5C44H

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
146
structure length
135
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 17
structure length 135
sequence length 146
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c44H00
4DR2Q 1YHAA 1I3QH 2JJQA 4JI2Q 3I2ZA 3GTLH 2UXDQ 2EQSA 4YCUA 4JI0Q 3AYHB 1T9HA 4QL5A 5IYCH 1L0WA 3STBD 4JI0L 1SRUA 1EIFA 4UPAA 4BBRH 3UDGA 1BKBA 3UDFA 4YY3L 4JV5Q 1TWCH 1X56A 2F3IA 1EUJA 1IBMQ 2UUAL 1OXXK 4C3JH 3OTOQ 1Q86C 1VQ6A 2AWNA 3A5UA 1NJIC 3M7NA 1I6HH 3UE1A 2ZJRA 4HIOA 1VS0A 3K81C 2E8GA 2JA6G 4LUVA 1E3PA 2D0PA 1X9NA 3OYYA 2R93G 4AYBG 4A93G 5IYBG 2AWOA 3BJUA 5DLQE 3W5OA 4POFA 4LF8Q 3ICEA 3HOVG 2Q2HA 3CCVA 2HT1A 2BA0A 3ERSX 4AIMA 2A8VA 4EQ5A 1M1KC 4PZ6A 5GAGC 1GKHA 2F52A 4BXXH 3AEVA 5FLMH 3ER0A 1FL0A 4OWXB 3CCUA 4KHPQ 2JEAI 3J81c 1R9TH 3MEFA 4QY7A 3ULJA 2RCNA 3PUVA 1WCMG 1UE1A 4JCVE 1VQ5A 5IP9G 1Y1WG 1P8LA 1IXRA 1WYDA 2L15A 3CCLA 3CD6A 1EYGA 4DAMA 1PV4A 4UP9A 4KLKA 1X55A 4A76A 2UUBQ 3H0GG 2PMZE 4GLAC 3CMEA 1PH1A 4QQBX 4JI5L 3WWVA 2UUBL 4POGA 2JA6H 1G6PA 1Y1WH 4JI5Q 3HKZG 4X65Q 1EWIA 4HJAA 2Q2UA 2D0OA 3S17H 1N33Q 3J80i 1VQOA 1KHIA 3KF8B 3L2PA 4DUYL 3HOWG 1V1QA 5IY0A 1VQKA 3HOXH 2VL6A 2WAQG 4P75A 4LFCL 1PH5A 3RZDH 3AQQA 1UWVA 1YNXA 2EIFA 4DV2Q 1XJVA 3HFZB 3VDYA 1YJ9A 2VQEQ 3I4MG 2IHEA 1YZ6A 1XMOQ 2HIVA 3HOUH 4A3LG 4BBSG 2UXCL 3TQYA 1N34L 2CKZB 4C2MH 1SE8A 2Z6KA 2N8NA 4DPGA 3CMAA 1I5FA 4IPHA 4O2DA 4A3KG 1K83H 4DR3L 4GKKQ 3KF6B 1YBYA 4HIMA 4DR4L 1ASYA 2NVYH 2RHQB 1PH7A 3TREA 3CCMA 5C4XG 2UU9Q 4LF9L 1HZ9A 3H0GH 2VZAA 4KI0A 3UE0A 5IP9H 4GS3A 4LF9Q 2OQ0A 3AFPA 2GVBA 2PI2E 3CW2C 3RLFA 3RN5A 2Y0SG 3H15A 1TWFH 3K7UC 1OXVA 3CCQA 4IJHA 4JI6L 1E22A 4HJ8A 4JI6Q 1NBWA 2R7ZG 4B3TQ 5E7NA 3I4MH 4YHHL 5LMNQ 4JI4Q 1VQMA 2E2IH 4B3MQ 2NN6G 1A62A 3HKSA 2VW9A 5K36G 1YITA 1WI5A 3G48A 3PGZA 3E9HA 4DUZQ 3HOVH 1A0IA 1HZAA 4L5RC 3F2BA 1I94Q 4DUZL 1VQ7A 4LF6L 1VQJA 5M5WH 2E5LL 4DAYB 1PYSB 1IYJB 1UE7A 4JI8Q 4A3JH 2E5LQ 4B3SQ 3TEHB 2UXDL 1CSQA 4JI8L 3HOZG 2HHHQ 5LMUL 1MJEA 1OXSC 4LFAL 5C44G 4R4IA 3PUYA 4RG1A 4KHZA 1JE5A 3SGIA 1XNQQ 4JV5L 1GO3E 3G71A 5IYCG 4GNXA 1HR0W 2UUAQ 4A3CG 1I50H 1A63A 1YEZA 2K75A 3GO5A 1KAWA 3KDFA 1S40A 4LF7Q 1HZBA 4DNIA 3KDFB 4A3KH 2JK8A 1E1TA 2VUMG 3CCSA 2IHFA 4DV1Q 4UP8A 3T1YQ 1CKNA 1RL2A 3T1YL 5BR8L 5GAHC 2N3SA 1MKHA 4TVAB 1C0AA 5M3MG 4DV3L 2D62A 1V43A 1X65A 4AYBE 3DLLA 1NMGA 3CCEA 4DV3Q 3M3YH 1RIPA 4JI3Q 4IFDJ 5FLMG 5M5YH 2CFMA 2LSSA 3TS0A 2F4VL 5GROA 5EAYA 2BH2A 4IOCA 4A3IG 3GTJH 3PO3G 4LF5Q 1NE3A 2IY5B 1SN8A 3M4PA 3CXCA 4LF5L 3S15H 2CWPA 4GLXA 4DV7L 4IPDA 3U50C 2AKWB 5IYBH 5H1SE 1J5EQ 4BA2I 4JOIA 5C44H 3RLOA 1IBKQ 3S14H 1DGSA 3U4ZA 1VQ4A 3PV0A 3FHWA 3OW2A 2H5XA 3RZOH 5GQOA 5GAEC 4JI1L 3KOJA 4MNOA 1IZ6A 4LUZA 3PF4A 4GOPC 3DM3A 4ME3A 1PFSA 1SLJA 5IWAL 1TWGH 4DR1L 1GVPA 4DR1Q 1XTDA 4DV0Q 3L0OA 2UUCL 1VQHA 3I4NG 1Z47A 2Y0SE 1IBLL 4OX9Q 3H3VI 1JJCB 3PO2G 3I55A 1YIJA 5M3MH 1VQEA 1KRSA 4GN5A 2E2JH 4YCVA 1KXLA 3CPFA 5LMNW 3CQZH 4IPCA 2ZM6L 4LF4L 1CKNB 1QVFA 1NY4A 4YWKA 2R6GA 5C3EH 4A3FH 2N78A 2K50A 2K5NA 3E0EA 1Q8KA 1KQSA 4QGUA 2YTYA 4A3CH 2VUMH 3M85A 1LM0A 1UEBA 4A93H 3I7FA 3RLNA 1VQBA 4TQUS 3H3VH 2CCZA 2UXCQ 3B6YA 1QUQB 2R93H 1G51A 4WJ4A 3U4VA 4DV4Q 2OTLA 4LFBQ 1UE6A 4X65L 2ES2A 1CKOA 5AJ3L 1VQNA 1BVSA 3D31A 5AJ3Q 4DR4Q 1EIYB 1HNWL 2WAQE 3ULLA 4DV6L 2PQAA 1HR0Q 2NVTH 1YHQA 2EXDA 1XPRA 2A1AA 1QVCA 3JC66 4A3DH 4UP7A 5C4JH 1D7QA 2Q2IA 4Y7NH 3F8TA 3PUZA 5JEAJ 3J80c 1EQQA 2XGTA 1X6OA 3F2DA 4FDBA 4P71A 2OQKA 2B63H 4R4QA 3UDIA 2ZTDA 1BBUA 4EX5A 2ASBA 1CSPA 4DR7Q 4K0KL 1M90C 1OTCA 1UE5A 2OCEA 4R4CA 5GADC 5M5XH 1E1OA 2ZTEA 3L7ZC 4PZ7A 1Q7YC 2JA5G 1K73C 2VS1A 3GTKH 5JJKA 4J15A 5IYDG 1K8AC 5C0XG 2JA7H 3S2HH 1Z9FA 4L5QA 4L5TA 2K52A 4Y52H 2A19A 5ELNA 3J81i 4HJ5A 2UXBQ 3F2CA 5FJ8G 2ZJPA 2UXBL 2RF4A 1B7YB 5JJLA 2LXKA 4MTNA 2K4KA 5FJ8H 5IYDH 1S3OA 4LFAQ 2HHHL 1WJJA 4BA1I 4BY7H 4OO1G 1U0LA 2IX0A 2I0QA 1GM5A 1X3EA 2DUDA 5M3FG 1XNQL 2MFIA 3KJOA 2R7FA 2ZTCA 4H02A 2YTXA 1FJGL 4A3MH 3STBC 1AE3A 2WFWA 4DR5Q 1Q46A 1FJGQ 4X66Q 4IO9A 3PCOB 2WB1E 4OO1I 1K3RA 4X64L 3CC7A 3AFQA 2VQFL 2C35B 1PH8A 1PH9A 1KL9A 1JMCA 1VQ9A 4QJFA 4JBMA 2B63G 4GKJQ 1KD1C 1C9OA 3CCRA 5IE8A 4OWTB 3HOWH 2KBNA 1E24A 2K5VA 2B3GA 4MZ9A 1W2BA 2R7ZH 4B3RL 1X54A 1TWAH 1XPOA 3TS2A 4PZ8A 4R4OA 4A3EG 3HOYG 3GDEA 3T1HQ 2AMCB 5FLXc 3S2DH 3GTOH 3T1HL 4DV7Q 2JA8G 1P16A 4YY3Q 1VQ8A 1JB7A 5IP7G 2JE6I 3M4QA 3JAMc 1WOCA 4DUYQ 1JJ2A 1HNZL 4LF7L 1AE2A 2VY3A 1PH3A 4JBJA 4DV1L 2OWOA 1OXUA 2KHIA 4LW1A 2JA5H 1VQFA 2HQLA 1VQLA 2JEBI 3NBHB 4DR6L 1J6QA 1LUZA 3KYHC 1Y14B 3CC4A 3S1MH 1CUKA 5C3EG 1VQAA 4X6AH 4P72A 4JI3L 4DV2L 4IFDG 1B8AA 2RHSB 2PNHA 3FP9A 4JBWA 3J7A5 5C0XI 4DV0L 4A3GG 1QVGA 2HIXA 1XPUA 1Y1VH 1IBLQ 4NPSA 4R1JA 3FKIG 4GOPB 5HGQA 4DK3C 4NXNQ 2I5LX 1C7YA 2GVAA 1NMFA 4IFDI 2ZM6Q 4RMFA 5IT9c 3CF5A 1W3SA 3M4OH 4JI2L 1SMXA 3K80C 1MIUA 4LWCA 4DK6C 4X62L 1VQIA 4A3JG 2KCTA 3PIPA 1V9PA 2K5HA 1YJWA 3M9BA 4JBKA 4O0AA 4YWLA 3K0XA 2NVXH 4OWWB 2IX1A 1SR3A 3PSIA 2QGQA 1Y1VG 1LTLA 1NTGA 4HIKA 3E9IA 2JA7G 2B29A 4GN4B 2R7DA 1HNXL 4DV6Q 1BBWA 5HY6A 4QIWE 1CKMA 2Q2TA 4LF4Q 3I4NH 1ASZA 3PO2H 4NXMQ 5ELOA 4C3HH 1L1OA 3S1NH 4NXML 2K14A 3J81j 4BY1H 2NN6I 4A3BH 3S1RH 1N32Q 1PA6A 1QZHA 2NZHA 1N32L 2JQOA 5LMUQ 3RR5A 4K0KQ 5JEAG 1TWHH 5C4XH 1K0RA 3PF5A 4A3DG 2JA8H 4APVA 4JI7L 3IRBA 2AHOB 3K8AA 4A3EH 3KJPA 1O7IA 1D8LA 3OTOL 1IBML 1XMQQ 3CP0A 4XIGS 1FGUA 2NZOA 4HJ7A 3KFUA 4GKKL 1HR0L 4YWMA 4OXPA 1K8GA 3FKIH 1H95A 2YYZA 3PIOA 1L1OB 1B70B 1YHBA 1AH9A 1WFQA 2WB1G 4LF8L 2WP8J 1EFWA 2VNUD 4DR3Q 4GLVB 2JA9A 3HOXG 4DR2L 4XTCS 4A75A 2N49A 4A3FG 2MQHA 1MJCA 3NEMA 4X66L 1A8VA 3BZCA 4X64Q 4KHPL 1IBKL 3TRZA 4IPGA 3S24A 1Q12A 2BH8A 3BU2A 1Q82C 1E7ZA 1N36Q 4JI1Q 1L1OC 3ULPA 4BY7G 1Q81C 3ZJYC 1N36L 1KRTA 3S16H 1IL2A 1VCIA 3PUXA 3GTQH 3J7ZC 2KCMA 3RN2A 2MNAA 1QUQA 2QEXA 4DV5L 4HIDA 1QZGA 4A3LH 3RNUA 2UUCQ 4DV5Q 3HOYH 4OX9L 5J3BA 1S72A 1TXYA 1G291 3W1BA 1HNZQ 1HH2P 4DR5L 3CC2A 3KF6A 2PI2A 2I5MX 2CQOA 2VQFQ 3JAMi 3GD7A 3GTMH 4DR6Q 2KHJA 4AH6A 3K7AH 5BR8Q 2R92G 2KENA 3Q8DA 4A4IA 4LUOA 1N9WA 1EOVA 1YI2A 3I56A 4B3RQ 4UY8C 2V1CC 1HZCA 1L2FA 4JC0A 1VQGA 1KC8C 3U58A 4IJLA 1XMOL 2BA1A 5M3FH 4LFBL 1N34Q 4NXNL 3PUWA 4GNXC 3KLWA 4L5SA 1N33L 4JYAL 1SROA 1HJPA 2QA4A 1J5EL 4JG2A 4JYAQ 5IP7H 4PMWA 2UU9L 4C3IH 1VQPA 4X62Q 4HJ9A 4BBSH 3D0FA 2YTVA 3PO3H 2MO0A 4YCWA 1PH2A 1XNRQ 3S1QH 1X3GA 3EBEA 4LFCQ 1XNRL 4AQYL 1GD7A 4AQYQ 5IWAQ 3HOUG 1JJGA 4DR7L 2E2HH 3A5ZB 1PHJA 3EN2A 3LGJA 1LYLA 1KIXA 2VQEL 4B3TL 4GNXB 4GKJL 4WJ3M 4P74A 4YHHQ 5LMNL 4JI4L 1Q1EA 2ATWA 1HNXQ 1JT8A 4B3ML 2R92H 2MO1A 1SFOH 3A0JA 3G4SA 2YU9H 4P73A 3CPWA 3F1ZA 1YJNA 1K9MC 1PH6A 3GTPH 2I5HA 2IT1A 1X3FA 4A3MG 1EQRA 2PQAB 1U5KA 3NENA 1I94L 4LF6Q 2Z0SA 1PYBA 2CWAA 2LXJA 4B3SL 1FVIA 1VQCA 4DKAC 3HOZH 3NELA 2OTJA 4OONA 3GTGH 4IOAA 4BBRG 2FXQA 2ID0A 1VQDA 3UDXA 3CCJA 3BZKA 4LNQA 3CAMA 4DV4L 4JI7Q 2Z6KC 1Q1BA 1WCMH 3I4OA 5C0XJ 4BY1G 1PH4A 4A3BG 2XTIA 1YVCA 4R4TA 1XMQL 4GOPA 4GN3B 3HKZE 2YV5A 4A3GH 1HNWQ 2ZJQA 5JJIA 2GN5A 4PG3A 4BXXG 3W1GA 1PVOA 2DGYA 4A3IH 3G6EA 1OXTA 2ALYB 3EIVA 3MXNB 2NVQH 1N8RC 4JOIC 3A74A 4NB3A 4ALPA 2F4VQ
chains in the Genus database with same CATH superfamily
1YHAA 1I3QH 4C3IG 4YCUA 1SDFA 3DHQA 2GA4B 2F0HA 5IYCH 4JI0L 1BKBA 1G6ZA 5M5XB 3BDCA 4IALA 1SYDA 1ET6A 4JV5Q 2UUAL 1B4OA 3OTOQ 1VQ6A 3A5UA 1SNOA 2C5CA 3BVMA 2JA6G 3P1HA 4BBSB 2QKIC 1JWUD 5FKAC 3BJUA 3J81E 4POFA 5E4WC 4RGOS 1QNKA 3HOVG 2HT1A 3GTMB 2NB0A 4CJ1B 4EQ5A 1BO0A 3I70A 3HOXB 3WOFA 5C3EB 1GKHA 2F0KA 3FDTA 1FL0A 4OWXB 2F3VA 5LHY1 3MEFA 2XVSA 1Y1WG 1NR4A 1C4QA 2WV6D 1WYDA 1ET9A 3J7YW 3H09A 1EYGA 4UP9A 1EYAA 5LL6S 3QO2A 5ELBA 4A76A 3H0GG 4GLAC 4HAEA 4JI5L 2Z9HA 1G6PA 3MTSA 2DNCA 2D5DA 5C4JB 1WCMB 4KJOA 3L2PA 4DUYL 1V1QA 2SEBD 3URYA 1VQKA 1V1PB 2KA7A 1PH5A 3G7LA 2EIFA 2KEDA 2RBMA 3HEJA 3D4WA 2IHEA 1YZ6A 1XMOQ 2UXCL 1N34L 5A2QE 4C2MH 5M5WB 2HCIA 2Z6KA 2N8NA 5D3IB 4CDEC 2EYHA 4IPHA 4O2DA 4GKKQ 2RCFA 4KV6A 1PH7A 3M4OB 5C4XG 3BYTB 3NWTA 4KI0A 4GS3A 2OQ0A 3CW2C 3RLFA 3U9OA 3CCQA 3SEBA 2A6EC 1E22A 3HP3A 1VDZA 3T51B 4JI6Q 2I46A 3F2UA 4YHHL 5LMNQ 1BCPB 1S5DD 4F87A 1D1IA 4B3MQ 1A62A 1EOTA 1YITA 3R8BA 2MP1A 3G48A 2NBFA 3E9HA 1DOMA 4RHSA 3F2BA 1VQ7A 4LF6L 1VQJA 5M5WH 4FVMA 1PYSB 1IYJB 1UE7A 4WJWA 2UXDL 2E5LQ 5LMUL 4RG1A 4OHJA 3D6CA 2MJ8A 5E3FA 5IYCG 3G71A 1A63A 1K83B 2PW7A 2JK8A 2VUMG 2SDFA 1BF4A 2N3SA 4DAVA 4QIWB 5M3MG 4PMCA 4DV3L 4AYBE 1VF7A 1WTQA 2CFMA 1D5MC 2LSSA 3TS0A 2L9HA 2F4VL 3PO3G 3HG9A 2IY5B 2OXPA 3I4MB 1I4QA 3S15H 1ZXTA 2PYKA 1MI2A 2AKWB 4BA2I 4DAPA 3RLOA 3NXWA 2K05A 3PV0A 1SBBB 3OW2A 2H5XA 4BBRB 5GQOA 5GAEC 2WIIB 1DOKA 4MNOA 3E3XA 4LUZA 1A3UA 2J7ZA 4GOPC 1RHPA 1PFSA 1GVPA 2NTSA 4DR1Q 5J39A 4DV0Q 3I4NG 1HPCA 2PPBC 1VQEA 1HUMA 4GN5A 3Q22A 1BDOA 2X69A 3CPFA 3S2HB 2DJFC 1STEA 4IPCA 1KDCA 4KMUC 1CKNB 1NY4A 3KBXA 4A3FH 3S15B 2K5NA 3V05A 2YTYA 4QGUA 1UEBA 4PMBA 3SR1A 1A3TA 1VQBA 1RJTA 1QUQB 3BZDB 3H0GB 3U4VA 4DV4Q 2OTLA 4TSSA 3V2TA 1VQNA 5AJ3Q 1D2BA 1HNWL 4FF1A 2L0CA 2PQAA 1HR0Q 2EXDA 2A1AA 1EY5A 4A3DH 3J7AV 2HDMA 1G8ZD 2ZTDA 2ASBA 2RDHA 4A3IB 3BDOA 1MSGA 3EQLC 1PTOH 3L7ZC 1RODA 1CZWA 5JJKA 5I6WA 2CW0C 2K52A 1MSHA 4Y52H 2A19A 3J81i 4X3SA 3F2CA 3EFXD 5I4DA 2UXBQ 2RDFA 5FJ8G 3OIQA 2H1EA 1V1PA 5F2DA 2OF1A 2LXKA 4ILWA 5IYDH 1S3OA 4LFAQ 2HHHL 1WJJA 4OO1G 2IX0A 3EVQA 2I0QA 4OL7A 1X3EA 2DUDA 4K5XA 3KJOA 3M4YA 2PO4A 4ZYSA 4A3MH 4HR7B 2F0GA 1FJGQ 1K3RA 4X64L 3CC7A 4CKEA 4GKJL 1HTLD 1JMCA 1KD1C 3CCRA 3HOWH 1RF2D 1E24A 1GUTA 1W2BA 3MXNA 1SYCA 4R8IA 2JA7B 1BCPF 2TMPA 1XPOA 4UHVA 5ELFA 2G9HD 4RFBA 4DV7Q 1V1OA 5E1FA 3MA2B 1VQ8A 1YNNC 5IP7G 4DUYQ 1SMYD 2VY3A 4XT3B 4JBJA 1CA5A 2OWOA 2KHIA 2EZVA 1VQFA 2HQLA 3A55A 1VQLA 4KJNA 1J6QA 1GOZA 1LUZA 3MC0B 4M8AA 4UAIA 3E6ZX 4XYQA 3J7A5 4RGNA 1QVGA 1I4RA 1Y1VH 1IBLQ 4IZ8A 5EBCA 4NPSA 4WFN3 4NXNQ 3MZ5A 1TS3A 4FP5D 1YNND 2ZM6Q 1TS2A 1E2VA 1JR0D 1SMXA 1SYGA 1LTRD 1MIUA 4LWCA 5EGTA 3QWNA 2KCTA 3PIPA 3I72A 1V9PA 1TS5A 3M9BA 2QDLA 4YWLA 2NVXH 2QGQA 4YIJA 4HIKA 2R7DA 2DN8A 4HTHA 5HY6A 4J1MA 4QIWE 2B2TC 1HQRD 3PO2H 1ASZA 4NXMQ 1HTPA 4ULLA 1G2TA 1LACA 3VYRA 1PA6A 1QZHA 1N32L 1I3QB 5LMUQ 3RR5A 5JEAG 5C4XH 3HOVB 3BVZA 1F2YA 2IL8A 4A3EH 3T56B 1IBML 3KJPA 4J6HA 2SNMA 1XMQQ 4XIGS 3KFUA 3J7AF 1AN8A 1HR0L 4QMGA 4YWMA 4OXPA 5EPLA 1K8GA 3PIOA 4H13C 1YHBA 1AH9A 1AFPA 1PZID 3FPUB 4DR3Q 4KKSA 2RVLA 1BXTA 1EY6A 4A75A 4DR2L 2MQHA 1F2ZA 2E2IB 3BZCA 4G4KA 3TRZA 2RA4A 4KN4C 1RDPD 1E7ZA 1PXUA 4H7BA 4BY7G 2TSSA 5KEEA 3S16H 1ML0D 2QDBA 2L4NA 1VCIA 3PUXA 1NUCA 4KTAA 4DV5Q 5J3BA 2R3ZA 1IW7D 1G291 5IGCA 3CC2A 3KF6A 2CQOA 1LT6D 3VR4A 4AH6A 3K7AH 4ZCKA 2BDNA 4A4IA 1N9WA 5C4HA 2BCOA 2Z4IA 5I6YA 5D3DA 1JCKB 1L2FA 1VQGA 3NP8A 1KC8C 3OWEB 1H9JA 2F0NA 4ZQ3A 4GNXC 3KLWA 3CU7A 4JYAL 1J5EL 5C44B 4HMJA 4PMWA 2JA6B 5HURA 4C3IH 4I7AA 4BBSH 4YCWA 1PH2A 1ENAA 2A68C 1GD7A 4AQYL 2OT2A 5IWAQ 2QILA 1G2SA 1PHJA 4DA2A 3EJIA 2MO1A 1Q90A 1F9SA 3G4SA 2YU9H 1SYEA 2IT1A 2JSOA 2JN4A 1A3VA 5CV6A 1U5KA 1I94L 3HOUB 2Z0SA 2XIWA 2CWAA 4DKAC 3HOZH 3Q23A 3GTGH 2K32A 1ESRA 4C1NI 1I6HB 3CCJA 4LNQA 3BZKA 2KCCA 4JI7Q 1AP0A 5C0XJ 4A3BG 1I50B 4JVZA 4BWGB 1YVCA 4R4TA 3H6MA 3HKZE 3IFTA 4FYDA 2NZ1D 1B50A 5BN4A 4BXXG 1WTHA 2ENBA 1M8AA 1BOSA 3W1GA 4A3IH 1E0BA 1N8RC 4JI2L 4DK1A 2F0EA 3QOLA 1EWHA 4R9WA 3S14B 4ZAIA 3A8KE 1GUOA 1L0WA 1EIFA 4UPAA 3UDGA 2F4IA 3A54A 2F3IA 1GUNA 1EUJA 5EKKA 3PIP3 1IBMQ 3PIO3 4C3JH 1Q86C 3FVQA 1VS0A 2KQ3A 1QCBD 2E8GA 2PQEA 4RCOA 4CDFC 3J80L 4EQNA 1X9NA 2HCCA 2K5DA 1DOLA 3ICEA 3CCVA 3AMUA 2BA0A 4AIMA 1R4PB 1M1KC 5GAGC 4O42A 1IYUA 5FLMH 3ER0A 5C3WA 4G7HC 4K2LA 4A3GB 3A8JE 1AZQA 3FMCA 3J81c 4AYBB 3ULJA 3PUVA 1WCMG 1SE2A 2L55A 4JCVE 1CTMA 5IP9G 1EY9A 4N9PA 2F0WA 2L15A 3CCLA 4HN7A 4EGVA 4QQBX 3WWVA 2UUBL 1QE6A 1EWIA 1TWCB 1N33Q 2PZWA 2B2YA 3NBIA 3KF8B 2O5JC 1I4HA 1TWGB 5IY0A 1X3PA 4NMZA 2LMCB 3HOXH 2WAQG 3SXHA 3QJYA 1GXDC 4J8QA 3AQQA 3HKZB 5EPKA 1XJVA 1STAA 2DJGC 3VDYA 3MVVA 3I4MG 3JAML 5A35A 1O7ZA 3TQYA 4CBVA 4L6TB 1A2TA 3CMAA 1I5FA 4IQZA 4A3KG 3D4DA 3W3AA 5ELDA 3KF6B 3TDQA 4DR4L 3TREA 2JA8B 3TBIB 3I73A 3UE0A 3H3VC 4LF9Q 1GJXA 3RN5A 4C56C 2Y0SG 1T5XD 3H91A 3VYTA 3H15A 4IJHA 3GV6A 3P7JA 4NW2A 4HJ8A 3I90A 4L8JA 3I4NB 4WORA 4DNRB 1LV9A 1VQMA 1ESFA 3HGBA 2NN6G 3DEOA 3FRPB 1WI5A 2E2JB 1DCZA 3K57A 2F0FA 4L5RC 1I94Q 4DUZL 2VUMB 4JI8Q 4A3JH 1TWAB 5C44G 4R4IA 3PUYA 1SSOA 1JE5A 1XNQQ 4JV5L 5FOBB 1HR0W 2UUAQ 1XX8A 2K01A 1YEZA 3GO5A 3KDFB 1KABA 3CCSA 2IHFA 2ZT9C 5C0XH 2JXMB 4RKBA 1RL2A 3T1YL 5I2XA 1RTOA 1V43A 3DLLA 1NMGA 3CCEA 4JI3Q 5NUCA 2PCFB 3OOCA 3D3RA 5M5YH 5GROA 3ND8A 2CVRA 4A3IG 5I9PA 2K03A 4LF5L 2CWPA 3HOWB 1F9QA 4IPDA 5IYBH 1J5EQ 5EKLA 5C44H 1IBKQ 2AQ1B 3S14H 5KRUA 1J9OA 1ONLA 4R8NA 5IWAL 1F2MA 2FJ2A 1XTDA 3QR8A 3L0OA 4OX9Q 5FO9B 2R92B 1GUSA 2EVBA 2E2DC 2G5DA 5CYUA 4F7XA 1ZKOA 1KXLA 4LF4L 4YWKA 1K8MA 1HFGA 2R6GA 1WTPA 1IKMA 2N78A 1PTOB 2K50A 1K3BC 1H9MA 2MHVA 1Q8KA 4L63B 2RDGA 4A3CH 2VUMH 5ELEA 3I7FA 2Q8TA 4TQUS 4XQJA 2UXCQ 2R93H 1G51A 1UE6A 2RQXA 2ES2A 1ILPA 1EIYB 2WAQE 3ULLA 1YHQA 1XPRA 1QVCA 1U4RA 2Q2IA 1EQQA 2EY1A 1QJOA 4HEDA 1TS4A 2WKCA 1DZ1A 4R4QA 3UDIA 1BBUA 3FPPA 3R2TA 1RTNA 4DR7Q 4K0KL 2OCEA 3IL8A 1R4QB 5GADC 2JA5G 4PZ7A 1RCVD 3L9AX 5IYDG 5C0XG 3S2HH 4L5QA 2K6AA 1Z7TA 5ELNA 2ZXPA 4I7ZC 3MAQA 2ZJPA 1Y8PB 1B7YB 2B39A 4C3JB 2A69C 4BY7H 5CV9A 4EVOA 5M3FG 2L11A 2R7FA 2YTXA 1VMPA 4ABNA 3STBC 4DR5Q 4IO9A 1L0XB 1PH9A 4JBMA 1VQ9A 2B63G 4LJZC 1EU3A 4OWTB 5A2QL 2B3GA 3C2PA 3C1EA 4QCLA 3TS2A 1F2LA 2Z8LA 3HOYG 3T1HQ 5FLXc 3S2DH 4XYOA 2JA8G 1P16A 2JE6I 1JJ2A 3T53B 1WOCA 1QOHA 1HNZL 1AE2A 4KD4A 1STHA 4TKOB 2JA5H 3HRZC 1JB3A 3NQTA 1PTOC 5C3EG 4JI3L 3S1RB 5KGUA 2PNHA 2RKSA 4DV0L 4B9XA 1CQVA 4FF3A 5HGQA 4KKUA 1C7YA 2EJMA 1NMFA 3X3NA 4IFDI 4RMFA 5IT9c 3CF5A 2P5ZX 1TWHB 3TSSA 1TKWB 3K80C 4DK6C 4X62L 1VQIA 1F77A 3P75A 3MFYA 4OWWB 4CJ0B 4HMIA 3PSIA 2F0IA 1LTLA 1NTGA 2F3WA 3E9IA 1Y69U 4N8X1 3OHXC 2K7VA 4LF4Q 3KLRA 5ELOA 2LS01 2K14A 1Z6HA 2NN6I 4H44C 4A3DG 4I65A 1IL8A 3NSWA 5KNDA 2AHOB 3K8AA 4ME5A 1O7IA 1CQFA 3CP0A 4HJ7A 5TSSA 4DAYA 3FKIH 3LNNA 5CBAE 3NQIA 4CJ2C 3DEPA 4LF8L 1O80A 1R9TB 4GLVB 4XTCS 4A3FG 1MJCA 2AUKA 3NEMA 2XRSD 4EQOA 2M00A 1A8VA 4X64Q 1IBKL 4IPGA 1NCVA 3BU2A 3WDNA 5JVG3 2KJXA 1Q3LA 1Q82C 1N36Q 1L1OC 3ULPA 4OO1H 1E2WA 1KAAA 4KHVA 3GTQH 3J7ZC 3RN2A 2MNAA 2QEXA 4HIDA 1QZGA 1SNQA 4C3IB 3FKIB 1MGSA 3RNUA 4HSPA 1TT2A 3HOYH 4OX9L 2B2UC 3S1MB 4K6LA 3W1BA 4DR5L 5M3MB 1PMRA 5DM63 2NN6H 2PI2A 1BR9A 3GD7A 2KENA 1FR3A 1YI2A 3I56A 2EJFC 3NE5B 4BY1B 2IPKD 2D9UA 2FMMA 3GTJB 2CQAA 4B08A 5M3FH 4G7OC 4NXNL 1FNUA 3HOZB 1LTBD 2B63B 2QA4A 4JG2A 4ZUJA 4DGZA 2B2VA 4RA8A 2FINB 4NDXA 2YTVA 3K0YA 5FLXL 1X3GA 4LFCQ 4KY5A 1XNRL 3NK9A 3HOUG 4RCNA 1JJGA 3AU7A 4DR7L 2E2HH 3EN2A 4B3TL 1LTSD 2VQEL 4GNXB 4JI4L 1Q1EA 2ATWA 3D8GA 1H9SA 1STNA 3QOJA 5DAUA 1SFOH 4QF4A 3A7AB 3F1ZA 1JORA 1PH6A 3GTPH 5KIXA 3RD4A 2PQAB 1IW7C 1TU2B 3NENA 4RAUC 5G3LF 4B3SL 3VYSA 1FVIA 3IAYA 1SE3A 5CGKA 4FNFA 1WD1A 2ID0A 3UDXA 3CAMA 1WCMH 3I4OA 3ITPA 4CHTB 1XMQL 4GN3B 1LT3D 2N55A 2HQEA 2DGYA 2B2UA 3SK8A 1OXTA 1UEAB 3EIVA 5IGGA 3LWUA 4FXDA 4DR3L 4ALPA 4DR2Q 2JJQA 4JI0Q 5KYLA 2FMCA 4QL5A 3HS0C 4BBRH 4MIUA 1BNZA 4MHEA 3UDFA 1TWCH 4A3EB 1PTOD 1W6JA 2EYMA 2AWNA 5AFWA 5CORA 2EOTA 3E0JA 1I6HH 2ZJRA 4HIOA 3K81C 4IUQA 5FLXE 1E3PA 1K0SA 4AYBG 3MFGA 5HGTA 4A93G 5IYBG 2AWOA 5DLQE 3W5OA 4LF8Q 1I6VC 2XN9C 3ERSX 2A8VA 4PZ6A 2F52A 4BXXH 1SMYC 2VXWA 2JEAI 1QG7A 4IFDH 1WTVA 1SAPA 1UE1A 1NAPA 4RH6A 4DAMA 1PV4A 1X55A 1PH1A 3CMEA 4POGA 1QB5D 2JA6H 5E4XA 2PNRC 2PW5A 3I3CA 4OEMB 5IT9E 4JI5Q 2IW3A 3HKZG 3PO3B 4X65Q 4HJAA 2D0OA 4OELB 3KF8A 3J80i 1VQOA 5CR3A 1KHIA 3TP8A 1I4XA 2FHTA 2Q8IB 5IOCA 2KVMA 4K14A 3WOEA 4P75A 4CKCA 4O1NA 1H9KA 1YNXA 4DV2Q 4RHRA 3HFZB 1QWYA 4BBSG 5M3FB 3I8ZA 4HCEA 1SE8A 4OIJA 2JYOA 4DPGA 1CFMA 1EQTA 5FK9C 1K83H 5L37A 4HIMA 1BBXC 1ASYA 2NVYH 3BDLA 3H0GH 2VZAA 1EQVA 3AFPA 2GVBA 2PI2E 1RD9D 2X6LA 1TWFH 3K7UC 1GUWA 1OXVA 4JI6L 1Y1WB 2XWJB 3R93A 4B3TQ 3I4MH 4WRDA 1DONA 4JI4Q 2F0MA 3N52A 4IUVA 1NR2A 4JW0A 2E2IH 3HKSA 2CH4W 2NUCA 3PGZA 1B9NA 1HHVA 3D4RA 3HOVH 1A0IA 1HZAA 2E5LL 1HXYD 1M4VA 3H94A 4KKTA 4B3SQ 2R7ZB 1IYVA 1CSQA 3MXUA 3HOZG 3TP5A 3DM1A 1EEID 3SGIA 3SK6A 4TRDA 1GO3E 4GNXA 4A3CG 1BCPC 4CDDC 1I50H 2K75A 3KDFA 1D1KA 2HD3A 5KNCA 4DV1Q 4UP8A 2F0VA 1CKNA 3UI2A 1MKHA 4FO2A 2D62A 5CV8A 2ZXOA 4DV3Q 4IFDJ 1RIPA 5FLMG 1SYBA 1I4GA 5EAYA 2JP1A 3AB9A 2HUGA 3GTJH 3VA5A 2F0OA 4Q0FA 4IN3A 4DXGA 1RKNA 5H1SE 4ODGA 4JOIA 2B2WC 3NHHA 2DY8A 1DGSA 3OSOA 1VQ4A 4HCSA 3Q24A 2A6ED 3W2DA 4KY6A 3KOJA 2F0PA 2M2LA 4OGQC 4C3JG 4ME3A 1SLJA 4DR1L 1TWGH 3FEWX 1KNAA 2O4XA 5D65A 3RMHA 3PO2G 2Y0SE 3M3YB 1JJCB 3I55A 1EFID 4PNYA 1TY2A 1S5CD 1KRSA 1PTOF 4YCVA 3CQZH 4RGMA 1LLRD 5C3EH 1W6KA 1KQSA 2BOSA 2L12A 3VR5A 1LM0A 5J1ZA 4A93H 4KY7A 3R2IA 3RLNA 3H3VH 2K5WA 3GTPB 2CCZA 1HFNA 5EKIA 4FF2A 3J80E 4LFBQ 5DM73 4MTKA 4X65L 1XWEA 1CKOA 5AJ3L 1BVSA 3D31A 4DR4Q 2M9VA 3SK4A 3BS1A 4DV6L 2B2TA 2LKVA 2KOLA 4UP7A 4Y7NH 1B9MA 3PUZA 2F03A 5JEAJ 5EJWA 3J80c 2WB1B 1X6OA 3F2DA 1STGA 4NP5A 2B63H 3M7GA 2EY5A 4EX5A 1CSPA 1M90C 1A2UA 2V4DA 1UE5A 2Q8RE 4UDUC 1I4PA 3CKIB 1UUPA 4R4CA 1E1OA 1Q7YC 1FNVA 1K73C 2VS1A 1Z9FA 1LTTD 4JPBW 1B53A 4L5TA 4B9WA 4HJ5A 2UXBL 2RF4A 2A73B 4MTNA 4BA1I 1EEFD 4X3TA 5IGDA 1XNQL 1KDBA 2MFIA 2ZTCA 1HRJA 1FJGL 2K1BA 1AE3A 2WFWA 1H9SB 3MXPA 1Q46A 4X66Q 2A74C 1C48A 1AEXA 3PCOB 2WB1E 4M1UB 2AQ2B 1EY7A 3CD6A 3AFQA 3GTKH 2C35B 4QJFA 4GKJQ 2OEOA 5IE8A 3KLSX 2KBNA 4MZ9A 1TWAH 1B3AA 4PZ8A 4R4OA 4LAAA 3TMEA 3IKJA 4MN3A 4YY3Q 5C6AA 5IT9L 3SK5A 1S5BD 1PH3A 4DV1L 1ICFB 1TR5A 2MPMA 2XSCA 2JEBI 3NBHB 3SE0A 4DR6L 2WACA 3CC4A 1SJHD 3S1MH 3S1QB 1CUKA 2D2CC 1VQAA 4BY7B 4DV2L 1CZGA 1B8AA 2RHSB 3EROA 4C3HG 4V0BA 1HQMC 3A8IE 4A3GG 1EZ6A 2KCNA 1XPUA 1LABA 3KUPA 3R3OA 4R1JA 4GOPB 4Z9CB 2I5LX 4XDXA 2GVAA 1O7LA 1K8OA 1W3SA 3DUZA 4DXFA 3M4OH 1L0YB 1JICA 4ZK9B 1ILQA 2DY7A 2E76C 4ZKBB 4O0AA 2ICEC 1BUVT 1T5EA 3TP6A 4F88A 1PZKD 4IUUA 2B29A 2JA7G 3DWQA 2IJ0A 2SOBA 1HNXL 2EY6A 2F0DA 1B2TA 2Q2TA 3I4NH 4NXML 4PQXA 3J81j 4A3BH 1N32Q 1BCPD 1PRTC 3TN2A 2NZHA 4K0KQ 1OO9B 1TWHH 4DN4M 3GTQB 4F8MA 1DXMA 2JA8H 4APVA 5FO8B 2PZTA 3TZUA 2CW0D 3IRBA 2XNAC 1D8LA 2FFKB 2B2WA 5JPNC 2KUMA 2NZOA 3OWFA 2R93B 3NWSA 4Y7NB 1L1OB 1B70B 5EPJA 2AQ3B 5K36H 2WB1G 4X3UA 1TWFB 2WP8J 1EFWA 1FD7D 1G91A 1KLGD 3S1NB 4IURA 2G9DA 1O7YA 4KHPL 2ICIA 2O2LD 3S24A 1Q12A 1STBA 2BH8A 2ZXRA 3QIAA 3DMUA 1FYCA 1CHPD 2A5HA 4KN7C 1XYIA 3ZJYC 1B44D 4LMQD 3G6JB 4A3JB 1IL2A 2KCMA 4A3LH 4DV5L 2DNEA 1S72A 1TXYA 4ZKCB 1HNZQ 1HA5A 3DWPA 1B3QA 2K04A 2KHSA 3JAMi 3GTMH 5BR8Q 1PFMA 4LUOA 3RZDB 1EOVA 4V190 1PFBA 4LK1C 4A3BB 3DXJC 4UY8C 3N6RA 1EYDA 1HZCA 3K5NA 4JC0A 4ID6A 1D5XC 2EDGA 4FXKC 4H0LC 3OIPA 1ZEQX 4LFBL 1GHKA 3Q0AA 3RZOB 3PUWA 5CC4A 3L3OC 4S3SA 4K2KA 4JYAQ 3NPPA 1UNSA 2N88A 2UU9L 1YNJD 1VQPA 4X62Q 3GTOB 1SNMA 3D0FA 3PO3H 2MO0A 3S1QH 1Q8IA 3EBEA 3SDZA 4DNTB 2NVTB 4AQYQ 2C9OA 4XXEA 4C3HB 1LYLA 3A56A 1KIXA 4P74A 1TIID 2KEEA 3GV3A 4PV1C 2R92H 1JT8A 2QEJC 3A0JA 1AZPA 4P73A 1YJNA 3EA6A 2I5HA 1EQRA 2B2VC 1LO5D 1SXTA 2CH4A 2WAQB 3NELA 2RSOA 4OONA 1TY0A 2EYFA 5JVH3 1CK1A 1VQDA 3A7LA 3PQIA 2Z6KC 1Q1BA 4A3MB 3Q6SA 4GOPA 4JK1C 2YV5A 1ENFA 2ZJQA 5JJIA 2GN5A 1E2ZA 1ICWA 2LFNA 1PVOA 3G6EA 2ALYB 4QUFA 4JOIC 5G3LD 4Q5VA 4G57A 4JI2Q 2UXDQ 2L5TA 3I2ZA 3GTLH 2EQSA 2Y0SB 3AYHB 1T9HA 3STBD 3VR3A 1CA6A 1SRUA 5CMDA 1WVLA 1PDQA 1GUGA 1PRTD 2PMZB 4YY3L 1X56A 3OMGA 1OXXK 2B8GA 3TZDA 1EIGA 1NJIC 2A68D 3M7NA 3KBGA 3UE1A 2NWGA 1XTCD 2K33A 4LUVA 2D0PA 2R93G 4U68A 3OYYA 3E5SA 3TP7A 3VR2A 1PYWD 3U9SA 4A3KB 2F0TA 2Q2HA 4K5VA 4NKLA 1MBYA 3K7AB 4K5WA 3AEVA 1LTGD 3CCUA 1PRTF 5I2YA 3MHBA 4KHPQ 1R9TH 4QY7A 2RCNA 1BQQT 3BVGA 3S9WA 3MEHA 5BN3A 1VQ5A 1P8LA 1IXRA 1ENCA 4KLKA 1J8IA 1SEBD 2UUBQ 2PMZE 1DD2A 4XQQA 5C3XA 1Y1WH 4P2CB 4HSVA 3S17H 2Q2UA 3OW7A 3K58A 1JOKA 1KNEA 3HOWG 2Z4HA 2VL6A 5DEHA 4LFCL 3RZDH 2E74C 2NVQB 3NTKA 1A6XA 2F0LA 1UWVA 4IUNA 3V96A 1YJ9A 2E75C 5J22A 2VQEQ 3C46A 3HOUH 4CDCC 2HIVA 1Y8NB 1S4ZA 4A3LG 4GZYC 1LT4D 2CKZB 3T13A 1EY0A 1KTKA 3GP7A 1YBYA 5COYA 2RHQB 3CCMA 2UU9Q 4LF9L 1HZ9A 5IP9H 5M9OA 3SHLA 3P20A 1NBWA 2R7ZG 3PO2B 5E7NA 1JOOA 1D5ZC 4DU9A 5K36G 2VW9A 1UAPA 4BS9A 1H9RA 3LWEA 3K6OA 4DUZQ 1NNXA 3KLSA 1IKLA 4DAYB 3S16B 3TEHB 5JAVA 4RGTA 4JI8L 1S5ED 2HHHQ 4LFAL 1MJEA 1OXSC 3KK7A 2A69D 4KHZA 4C2MB 2Z6BA 1KAWA 1S40A 4LF7Q 1HZBA 5IGFA 4DNIA 4A3KH 1E1TA 3T1YQ 2RSNA 1EY8A 2X6GA 5BR8L 1Y1VB 5GAHC 4TVAB 1C0AA 2EJGC 2QCPX 4A3FB 1EIHA 1X65A 3M3YH 2XWBB 5T1GA 2BH2A 4IOCA 1TVXA 4LF5Q 1NE3A 1SN8A 3M4PA 3CXCA 2AUJD 4GLXA 4DV7L 3U50C 2VB2X 3GTLB 3VR6A 5IGEA 4IUPA 3U4ZA 3K5LA 3FHWA 3S17B 4CKBA 3RZOH 3CHBD 1CHQD 2L1BA 4JI1L 2NTTA 4DFAA 1IZ6A 2EPBA 2F0UA 2EY2A 5D14A 3PF4A 3DM3A 5IGBA 1LTAD 2NYZD 2EYOA 3C3LA 3HOYB 2UUCL 1VQHA 1QNUA 1Z47A 1IBLL 3H3VI 4K6DA 1YIJA 1JOQA 5M3MH 4KD3A 5LMNW 3I4LA 2ZM6L 1F9PA 2MUYA 3IFDA 1QVFA 5JOBA 3ONAB 1MD2D 1SFOB 3E0EA 3M85A 4KK7A 2EYJA 4E6IA 4DK0A 2H4OA 4FF4A 3B6YA 4WJ4A 2WKDA 2WINB 3SVMA 1XXGA 2NVTH 4XT1B 4DF7A 2QW7A 1QILA 3JC66 1D7QA 5C4JH 3F8TA 1PZJD 1SNPA 2XGTA 4FDBA 4P71A 2OQKA 3GTKB 3CQZB 1OTCA 2F1MA 2J0TD 5M5XH 2ZTEA 2EXZA 1X3QA 1ZYRC 3CRKC 4J15A 1K8AC 2JA7H 4QB4A 1CT1D 1SYFA 1JWMD 1AW7A 1IHZA 5JJLA 2K4KA 5FJ8H 1B1ZA 1TQOA 1U0LA 3T4AC 1GM5A 3X3MA 4ZRZA 2KECA 1PFNA 4H02A 1SE4A 1SNCA 2HDLA 1PRTB 1FNWA 4OO1I 1CM9A 1KDAA 1PH8A 2VQFL 2E2JH 1LTID 1KL9A 3NBHA 1CI3M 1NSNS 1C9OA 1U4PA 3K5OA 2K5VA 2R7ZH 1U9RA 1X54A 4B3RL 2A6HC 2BDOA 2CHBD 4A3EG 5EBDA 3GDEA 2AMCB 1X32A 3GTOH 3T1HL 2BE5D 5JPMC 4OIKA 1JB7A 3M4QA 3JAMc 4U673 4LF7L 1YNJC 4RKLA 1OXUA 2PZUA 4LW1A 4EQPA 1EY4A 4A3DB 3KYHC 1Y14B 3ND9A 2IX3A 4ZUIA 5C4ZA 4P72A 4X6AH 4IFDG 3FP9A 4JBWA 5C5MA 1LT5D 5C0XI 2A6HD 5I9OA 2HIXA 1EZ8A 1JWSD 3BYYB 3FKIG 5C5LA 4DK3C 1WTXA 5KYIA 3MXGA 3VA7A 4N8FA 4RWSC 1U4LA 1HUNA 1WTOA 4A3JG 2B2YC 3PMFA 4XQNA 2K5HA 1YJWA 5CV4A 4JBKA 2B8FA 3K0XA 2NVYB 3O13A 2EYPA 2IX1A 2JA5B 1SR3A 1Y1VG 4GN4B 1SNDA 4DV6Q 1BBWA 4CGYB 1CKMA 3OPOA 4C3HH 1L1OA 1HCZA 3S1NH 5CV7A 1DYQA 1Y8OB 4BY1H 5KNBA 3S1RH 3T16A 5CBEE 2JQOA 1MHWC 2MGSA 1K0RA 1SJED 3MWYW 3PF5A 1HA6A 1F9RA 1JQYD 4JI7L 2F0SA 3OTOL 1DM0B 5ISRA 3K5MA 1DJRD 1FGUA 4GKKL 2QF7A 3CRLC 2EYLA 1H95A 2YYZA 2R61A 4FXGC 5IIFA 5JEAH 1WFQA 5M5YB 2VNUD 2JA9A 3HOXG 2O5IC 2E2HB 2N49A 1VMCA 1JE4A 2F0QA 5T1IA 4X66L 5ELCA 3DWAA 1JC7A 2YU9B 1U4MA 2K5QA 2Z1CA 1K28A 5FO7B 3NTHA 3JAME 4JI1Q 3QB3A 1Q81C 1N36L 3VYUA 1KRTA 3RUZA 5C4XB 5K5PA 1S5FD 3QG1A 3ERQA 1QUQA 2XRQD 2K28A 5CV5A 5DNFA 2UUCQ 4IUTA 3NUCA 1FGBD 1WTWA 1HH2P 1VF5C 2I5MX 2VQFQ 1WD0A 2I07B 3LX0A 4DR6Q 2KHJA 2R92G 2LY7A 3Q8DA 3OMCA 1A15A 4C1NK 1STYA 4B3RQ 2V1CC 2IWHA 3GQBA 1EYCA 3NTIA 5LL6X 1WTRA 3U58A 4IJLA 1XMOL 2BA1A 1N34Q 4K8IA 1EL0A 4L5SA 1N33L 1SROA 1HJPA 5IP7H 3GTGB 3C1FA 2SNSA 3S2DB 1EU4A 2BE5C 3K59A 3I91A 4HJ9A 3D6WA 1XNRQ 2F0JA 3BG3A 1KLUD 4N9TA 1ZYRD 3J81L 1C8CA 3A5ZB 3LGJA 4WJ3M 4YHHQ 5LMNL 5IODA 1HNXQ 5JJZA 4G7ZC 4B3ML 5EQ0A 4X3KA 3CPWA 4A93B 1K9MC 4A3MG 1X3FA 4QUCA 4LF6Q 1PYBA 2LXJA 3ZYYX 1D6EC 1VQCA 2OTJA 3HZXA 1V8QA 4K8JA 4IOAA 1O78A 4BBRG 2FXQA 1EWCA 1PLFA 4DV4L 1PH4A 4BY1G 2XTIA 4A3GH 2VB3X 1HNWQ 1II3A 2NVXB 4ZLTF 5BN5A 4PG3A 2J4XA 3MXNB 2NVQH 2EE1A 1GHJA 3A74A 4NB3A 2F4VQ
chains in the Genus database with same CATH topology
4DR2Q 1YHAA 1I3QH 2JJQA 4JI2Q 3I2ZA 3GTLH 2UXDQ 2EQSA 4YCUA 4JI0Q 3AYHB 1T9HA 4QL5A 5IYCH 1L0WA 3STBD 4JI0L 1SRUA 1EIFA 4UPAA 4BBRH 3UDGA 1BKBA 3UDFA 4YY3L 4JV5Q 1TWCH 1X56A 2F3IA 1EUJA 1IBMQ 2UUAL 1OXXK 4C3JH 3OTOQ 1Q86C 1VQ6A 2AWNA 3A5UA 1NJIC 3M7NA 1I6HH 3UE1A 2ZJRA 4HIOA 1VS0A 3K81C 2E8GA 2JA6G 4LUVA 1E3PA 2D0PA 1X9NA 3OYYA 2R93G 4AYBG 4A93G 5IYBG 2AWOA 3BJUA 5DLQE 3W5OA 4POFA 4LF8Q 3ICEA 3HOVG 2Q2HA 3CCVA 2HT1A 2BA0A 3ERSX 4AIMA 2A8VA 4EQ5A 1M1KC 4PZ6A 5GAGC 1GKHA 2F52A 4BXXH 3AEVA 5FLMH 3ER0A 1FL0A 4OWXB 3CCUA 4KHPQ 2JEAI 3J81c 1R9TH 3MEFA 4QY7A 3ULJA 2RCNA 3PUVA 1WCMG 1UE1A 4JCVE 1VQ5A 5IP9G 1Y1WG 1P8LA 1IXRA 1WYDA 2L15A 3CCLA 3CD6A 1EYGA 4DAMA 1PV4A 4UP9A 4KLKA 1X55A 4A76A 2UUBQ 3H0GG 2PMZE 4GLAC 3CMEA 1PH1A 4QQBX 4JI5L 3WWVA 2UUBL 4POGA 2JA6H 1G6PA 1Y1WH 4JI5Q 3HKZG 4X65Q 1EWIA 4HJAA 2Q2UA 2D0OA 3S17H 1N33Q 3J80i 1VQOA 1KHIA 3KF8B 3L2PA 4DUYL 3HOWG 1V1QA 5IY0A 1VQKA 3HOXH 2VL6A 2WAQG 4P75A 4LFCL 1PH5A 3RZDH 3AQQA 1UWVA 1YNXA 2EIFA 4DV2Q 1XJVA 3HFZB 3VDYA 1YJ9A 2VQEQ 3I4MG 2IHEA 1YZ6A 1XMOQ 2HIVA 3HOUH 4A3LG 4BBSG 2UXCL 3TQYA 1N34L 2CKZB 4C2MH 1SE8A 2Z6KA 2N8NA 4DPGA 3CMAA 1I5FA 4IPHA 4O2DA 4A3KG 1K83H 4DR3L 4GKKQ 3KF6B 1YBYA 4HIMA 4DR4L 1ASYA 2NVYH 2RHQB 1PH7A 3TREA 3CCMA 5C4XG 2UU9Q 4LF9L 1HZ9A 3H0GH 2VZAA 4KI0A 3UE0A 5IP9H 4GS3A 4LF9Q 2OQ0A 3AFPA 2GVBA 2PI2E 3CW2C 3RLFA 3RN5A 2Y0SG 3H15A 1TWFH 3K7UC 1OXVA 3CCQA 4IJHA 4JI6L 1E22A 4HJ8A 4JI6Q 1NBWA 2R7ZG 4B3TQ 5E7NA 3I4MH 4YHHL 5LMNQ 4JI4Q 1VQMA 2E2IH 4B3MQ 2NN6G 1A62A 3HKSA 2VW9A 5K36G 1YITA 1WI5A 3G48A 3PGZA 3E9HA 4DUZQ 3HOVH 1A0IA 1HZAA 4L5RC 3F2BA 1I94Q 4DUZL 1VQ7A 4LF6L 1VQJA 5M5WH 2E5LL 4DAYB 1PYSB 1IYJB 1UE7A 4JI8Q 4A3JH 2E5LQ 4B3SQ 3TEHB 2UXDL 1CSQA 4JI8L 3HOZG 2HHHQ 5LMUL 1MJEA 1OXSC 4LFAL 5C44G 4R4IA 3PUYA 4RG1A 4KHZA 1JE5A 3SGIA 1XNQQ 4JV5L 1GO3E 3G71A 5IYCG 4GNXA 1HR0W 2UUAQ 4A3CG 1I50H 1A63A 1YEZA 2K75A 3GO5A 1KAWA 3KDFA 1S40A 4LF7Q 1HZBA 4DNIA 3KDFB 4A3KH 2JK8A 1E1TA 2VUMG 3CCSA 2IHFA 4DV1Q 4UP8A 3T1YQ 1CKNA 1RL2A 3T1YL 5BR8L 5GAHC 2N3SA 1MKHA 4TVAB 1C0AA 5M3MG 4DV3L 2D62A 1V43A 1X65A 4AYBE 3DLLA 1NMGA 3CCEA 4DV3Q 3M3YH 1RIPA 4JI3Q 4IFDJ 5FLMG 5M5YH 2CFMA 2LSSA 3TS0A 2F4VL 5GROA 5EAYA 2BH2A 4IOCA 4A3IG 3GTJH 3PO3G 4LF5Q 1NE3A 2IY5B 1SN8A 3M4PA 3CXCA 4LF5L 3S15H 2CWPA 4GLXA 4DV7L 4IPDA 3U50C 2AKWB 5IYBH 5H1SE 1J5EQ 4BA2I 4JOIA 5C44H 3RLOA 1IBKQ 3S14H 1DGSA 3U4ZA 1VQ4A 3PV0A 3FHWA 3OW2A 2H5XA 3RZOH 5GQOA 5GAEC 4JI1L 3KOJA 4MNOA 1IZ6A 4LUZA 3PF4A 4GOPC 3DM3A 4ME3A 1PFSA 1SLJA 5IWAL 1TWGH 4DR1L 1GVPA 4DR1Q 1XTDA 4DV0Q 3L0OA 2UUCL 1VQHA 3I4NG 1Z47A 2Y0SE 1IBLL 4OX9Q 3H3VI 1JJCB 3PO2G 3I55A 1YIJA 5M3MH 1VQEA 1KRSA 4GN5A 2E2JH 4YCVA 1KXLA 3CPFA 5LMNW 3CQZH 4IPCA 2ZM6L 4LF4L 1CKNB 1QVFA 1NY4A 4YWKA 2R6GA 5C3EH 4A3FH 2N78A 2K50A 2K5NA 3E0EA 1Q8KA 1KQSA 4QGUA 2YTYA 4A3CH 2VUMH 3M85A 1LM0A 1UEBA 4A93H 3I7FA 3RLNA 1VQBA 4TQUS 3H3VH 2CCZA 2UXCQ 3B6YA 1QUQB 2R93H 1G51A 4WJ4A 3U4VA 4DV4Q 2OTLA 4LFBQ 1UE6A 4X65L 2ES2A 1CKOA 5AJ3L 1VQNA 1BVSA 3D31A 5AJ3Q 4DR4Q 1EIYB 1HNWL 2WAQE 3ULLA 4DV6L 2PQAA 1HR0Q 2NVTH 1YHQA 2EXDA 1XPRA 2A1AA 1QVCA 3JC66 4A3DH 4UP7A 5C4JH 1D7QA 2Q2IA 4Y7NH 3F8TA 3PUZA 5JEAJ 3J80c 1EQQA 2XGTA 1X6OA 3F2DA 4FDBA 4P71A 2OQKA 2B63H 4R4QA 3UDIA 2ZTDA 1BBUA 4EX5A 2ASBA 1CSPA 4DR7Q 4K0KL 1M90C 1OTCA 1UE5A 2OCEA 4R4CA 5GADC 5M5XH 1E1OA 2ZTEA 3L7ZC 4PZ7A 1Q7YC 2JA5G 1K73C 2VS1A 3GTKH 5JJKA 4J15A 5IYDG 1K8AC 5C0XG 2JA7H 3S2HH 1Z9FA 4L5QA 4L5TA 2K52A 4Y52H 2A19A 5ELNA 3J81i 4HJ5A 2UXBQ 3F2CA 5FJ8G 2ZJPA 2UXBL 2RF4A 1B7YB 5JJLA 2LXKA 4MTNA 2K4KA 5FJ8H 5IYDH 1S3OA 4LFAQ 2HHHL 1WJJA 4BA1I 4BY7H 4OO1G 1U0LA 2IX0A 2I0QA 1GM5A 1X3EA 2DUDA 5M3FG 1XNQL 2MFIA 3KJOA 2R7FA 2ZTCA 4H02A 2YTXA 1FJGL 4A3MH 3STBC 1AE3A 2WFWA 4DR5Q 1Q46A 1FJGQ 4X66Q 4IO9A 3PCOB 2WB1E 4OO1I 1K3RA 4X64L 3CC7A 3AFQA 2VQFL 2C35B 1PH8A 1PH9A 1KL9A 1JMCA 1VQ9A 4QJFA 4JBMA 2B63G 4GKJQ 1KD1C 1C9OA 3CCRA 5IE8A 4OWTB 3HOWH 2KBNA 1E24A 2K5VA 2B3GA 4MZ9A 1W2BA 2R7ZH 4B3RL 1X54A 1TWAH 1XPOA 3TS2A 4PZ8A 4R4OA 4A3EG 3HOYG 3GDEA 3T1HQ 2AMCB 5FLXc 3S2DH 3GTOH 3T1HL 4DV7Q 2JA8G 1P16A 4YY3Q 1VQ8A 1JB7A 5IP7G 2JE6I 3M4QA 3JAMc 1WOCA 4DUYQ 1JJ2A 1HNZL 4LF7L 1AE2A 2VY3A 1PH3A 4JBJA 4DV1L 2OWOA 1OXUA 2KHIA 4LW1A 2JA5H 1VQFA 2HQLA 1VQLA 2JEBI 3NBHB 4DR6L 1J6QA 1LUZA 3KYHC 1Y14B 3CC4A 3S1MH 1CUKA 5C3EG 1VQAA 4X6AH 4P72A 4JI3L 4DV2L 4IFDG 1B8AA 2RHSB 2PNHA 3FP9A 4JBWA 3J7A5 5C0XI 4DV0L 4A3GG 1QVGA 2HIXA 1XPUA 1Y1VH 1IBLQ 4NPSA 4R1JA 3FKIG 4GOPB 5HGQA 4DK3C 4NXNQ 2I5LX 1C7YA 2GVAA 1NMFA 4IFDI 2ZM6Q 4RMFA 5IT9c 3CF5A 1W3SA 3M4OH 4JI2L 1SMXA 3K80C 1MIUA 4LWCA 4DK6C 4X62L 1VQIA 4A3JG 2KCTA 3PIPA 1V9PA 2K5HA 1YJWA 3M9BA 4JBKA 4O0AA 4YWLA 3K0XA 2NVXH 4OWWB 2IX1A 1SR3A 3PSIA 2QGQA 1Y1VG 1LTLA 1NTGA 4HIKA 3E9IA 2JA7G 2B29A 4GN4B 2R7DA 1HNXL 4DV6Q 1BBWA 5HY6A 4QIWE 1CKMA 2Q2TA 4LF4Q 3I4NH 1ASZA 3PO2H 4NXMQ 5ELOA 4C3HH 1L1OA 3S1NH 4NXML 2K14A 3J81j 4BY1H 2NN6I 4A3BH 3S1RH 1N32Q 1PA6A 1QZHA 2NZHA 1N32L 2JQOA 5LMUQ 3RR5A 4K0KQ 5JEAG 1TWHH 5C4XH 1K0RA 3PF5A 4A3DG 2JA8H 4APVA 4JI7L 3IRBA 2AHOB 3K8AA 4A3EH 3KJPA 1O7IA 1D8LA 3OTOL 1IBML 1XMQQ 3CP0A 4XIGS 1FGUA 2NZOA 4HJ7A 3KFUA 4GKKL 1HR0L 4YWMA 4OXPA 1K8GA 3FKIH 1H95A 2YYZA 3PIOA 1L1OB 1B70B 1YHBA 1AH9A 1WFQA 2WB1G 4LF8L 2WP8J 1EFWA 2VNUD 4DR3Q 4GLVB 2JA9A 3HOXG 4DR2L 4XTCS 4A75A 2N49A 4A3FG 2MQHA 1MJCA 3NEMA 4X66L 1A8VA 3BZCA 4X64Q 4KHPL 1IBKL 3TRZA 4IPGA 3S24A 1Q12A 2BH8A 3BU2A 1Q82C 1E7ZA 1N36Q 4JI1Q 1L1OC 3ULPA 4BY7G 1Q81C 3ZJYC 1N36L 1KRTA 3S16H 1IL2A 1VCIA 3PUXA 3GTQH 3J7ZC 2KCMA 3RN2A 2MNAA 1QUQA 2QEXA 4DV5L 4HIDA 1QZGA 4A3LH 3RNUA 2UUCQ 4DV5Q 3HOYH 4OX9L 5J3BA 1S72A 1TXYA 1G291 3W1BA 1HNZQ 1HH2P 4DR5L 3CC2A 3KF6A 2PI2A 2I5MX 2CQOA 2VQFQ 3JAMi 3GD7A 3GTMH 4DR6Q 2KHJA 4AH6A 3K7AH 5BR8Q 2R92G 2KENA 3Q8DA 4A4IA 4LUOA 1N9WA 1EOVA 1YI2A 3I56A 4B3RQ 4UY8C 2V1CC 1HZCA 1L2FA 4JC0A 1VQGA 1KC8C 3U58A 4IJLA 1XMOL 2BA1A 5M3FH 4LFBL 1N34Q 4NXNL 3PUWA 4GNXC 3KLWA 4L5SA 1N33L 4JYAL 1SROA 1HJPA 2QA4A 1J5EL 4JG2A 4JYAQ 5IP7H 4PMWA 2UU9L 4C3IH 1VQPA 4X62Q 4HJ9A 4BBSH 3D0FA 2YTVA 3PO3H 2MO0A 4YCWA 1PH2A 1XNRQ 3S1QH 1X3GA 3EBEA 4LFCQ 1XNRL 4AQYL 1GD7A 4AQYQ 5IWAQ 3HOUG 1JJGA 4DR7L 2E2HH 3A5ZB 1PHJA 3EN2A 3LGJA 1LYLA 1KIXA 2VQEL 4B3TL 4GNXB 4GKJL 4WJ3M 4P74A 4YHHQ 5LMNL 4JI4L 1Q1EA 2ATWA 1HNXQ 1JT8A 4B3ML 2R92H 2MO1A 1SFOH 3A0JA 3G4SA 2YU9H 4P73A 3CPWA 3F1ZA 1YJNA 1K9MC 1PH6A 3GTPH 2I5HA 2IT1A 1X3FA 4A3MG 1EQRA 2PQAB 1U5KA 3NENA 1I94L 4LF6Q 2Z0SA 1PYBA 2CWAA 2LXJA 4B3SL 1FVIA 1VQCA 4DKAC 3HOZH 3NELA 2OTJA 4OONA 3GTGH 4IOAA 4BBRG 2FXQA 2ID0A 1VQDA 3UDXA 3CCJA 3BZKA 4LNQA 3CAMA 4DV4L 4JI7Q 2Z6KC 1Q1BA 1WCMH 3I4OA 5C0XJ 4BY1G 1PH4A 4A3BG 2XTIA 1YVCA 4R4TA 1XMQL 4GOPA 4GN3B 3HKZE 2YV5A 4A3GH 1HNWQ 2ZJQA 5JJIA 2GN5A 4PG3A 4BXXG 3W1GA 1PVOA 2DGYA 4A3IH 3G6EA 1OXTA 2ALYB 3EIVA 3MXNB 2NVQH 1N8RC 4JOIC 3A74A 4NB3A 4ALPA 2F4VQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 Q;  1YHA A;  1I3Q H;  2JJQ A;  4JI2 Q;  3I2Z A;  3GTL H;  2UXD Q;  2EQS A;  4YCU A;  4JI0 Q;  3AYH B;  1T9H A;  4QL5 A;  5IYC H;  1L0W A;  3STB D;  4JI0 L;  1SRU A;  1EIF A;  4UPA A;  4BBR H;  3UDG A;  1BKB A;  3UDF A;  4YY3 L;  4JV5 Q;  1TWC H;  1X56 A;  2F3I A;  1EUJ A;  1IBM Q;  2UUA L;  1OXX K;  4C3J H;  3OTO Q;  1Q86 C;  1VQ6 A;  2AWN A;  3A5U A;  1NJI C;  3M7N A;  1I6H H;  3UE1 A;  2ZJR A;  4HIO A;  1VS0 A;  3K81 C;  2E8G A;  2JA6 G;  4LUV A;  1E3P A;  2D0P A;  1X9N A;  3OYY A;  2R93 G;  4AYB G;  4A93 G;  5IYB G;  2AWO A;  3BJU A;  5DLQ E;  3W5O A;  4POF A;  4LF8 Q;  3ICE A;  3HOV G;  2Q2H A;  3CCV A;  2HT1 A;  2BA0 A;  3ERS X;  4AIM A;  2A8V A;  4EQ5 A;  1M1K C;  4PZ6 A;  5GAG C;  1GKH A;  2F52 A;  4BXX H;  3AEV A;  5FLM H;  3ER0 A;  1FL0 A;  4OWX B;  3CCU A;  4KHP Q;  2JEA I;  3J81 c;  1R9T H;  3MEF A;  4QY7 A;  3ULJ A;  2RCN A;  3PUV A;  1WCM G;  1UE1 A;  4JCV E;  1VQ5 A;  5IP9 G;  1Y1W G;  1P8L A;  1IXR A;  1WYD A;  2L15 A;  3CCL A;  3CD6 A;  1EYG A;  4DAM A;  1PV4 A;  4UP9 A;  4KLK A;  1X55 A;  4A76 A;  2UUB Q;  3H0G G;  2PMZ E;  4GLA C;  3CME A;  1PH1 A;  4QQB X;  4JI5 L;  3WWV A;  2UUB L;  4POG A;  2JA6 H;  1G6P A;  1Y1W H;  4JI5 Q;  3HKZ G;  4X65 Q;  1EWI A;  4HJA A;  2Q2U A;  2D0O A;  3S17 H;  1N33 Q;  3J80 i;  1VQO A;  1KHI A;  3KF8 B;  3L2P A;  4DUY L;  3HOW G;  1V1Q A;  5IY0 A;  1VQK A;  3HOX H;  2VL6 A;  2WAQ G;  4P75 A;  4LFC L;  1PH5 A;  3RZD H;  3AQQ A;  1UWV A;  1YNX A;  2EIF A;  4DV2 Q;  1XJV A;  3HFZ B;  3VDY A;  1YJ9 A;  2VQE Q;  3I4M G;  2IHE A;  1YZ6 A;  1XMO Q;  2HIV A;  3HOU H;  4A3L G;  4BBS G;  2UXC L;  3TQY A;  1N34 L;  2CKZ B;  4C2M H;  1SE8 A;  2Z6K A;  2N8N A;  4DPG A;  3CMA A;  1I5F A;  4IPH A;  4O2D A;  4A3K G;  1K83 H;  4DR3 L;  4GKK Q;  3KF6 B;  1YBY A;  4HIM A;  4DR4 L;  1ASY A;  2NVY H;  2RHQ B;  1PH7 A;  3TRE A;  3CCM A;  5C4X G;  2UU9 Q;  4LF9 L;  1HZ9 A;  3H0G H;  2VZA A;  4KI0 A;  3UE0 A;  5IP9 H;  4GS3 A;  4LF9 Q;  2OQ0 A;  3AFP A;  2GVB A;  2PI2 E;  3CW2 C;  3RLF A;  3RN5 A;  2Y0S G;  3H15 A;  1TWF H;  3K7U C;  1OXV A;  3CCQ A;  4IJH A;  4JI6 L;  1E22 A;  4HJ8 A;  4JI6 Q;  1NBW A;  2R7Z G;  4B3T Q;  5E7N A;  3I4M H;  4YHH L;  5LMN Q;  4JI4 Q;  1VQM A;  2E2I H;  4B3M Q;  2NN6 G;  1A62 A;  3HKS A;  2VW9 A;  5K36 G;  1YIT A;  1WI5 A;  3G48 A;  3PGZ A;  3E9H A;  4DUZ Q;  3HOV H;  1A0I A;  1HZA A;  4L5R C;  3F2B A;  1I94 Q;  4DUZ L;  1VQ7 A;  4LF6 L;  1VQJ A;  5M5W H;  2E5L L;  4DAY B;  1PYS B;  1IYJ B;  1UE7 A;  4JI8 Q;  4A3J H;  2E5L Q;  4B3S Q;  3TEH B;  2UXD L;  1CSQ A;  4JI8 L;  3HOZ G;  2HHH Q;  5LMU L;  1MJE A;  1OXS C;  4LFA L;  5C44 G;  4R4I A;  3PUY A;  4RG1 A;  4KHZ A;  1JE5 A;  3SGI A;  1XNQ Q;  4JV5 L;  1GO3 E;  3G71 A;  5IYC G;  4GNX A;  1HR0 W;  2UUA Q;  4A3C G;  1I50 H;  1A63 A;  1YEZ A;  2K75 A;  3GO5 A;  1KAW A;  3KDF A;  1S40 A;  4LF7 Q;  1HZB A;  4DNI A;  3KDF B;  4A3K H;  2JK8 A;  1E1T A;  2VUM G;  3CCS A;  2IHF A;  4DV1 Q;  4UP8 A;  3T1Y Q;  1CKN A;  1RL2 A;  3T1Y L;  5BR8 L;  5GAH C;  2N3S A;  1MKH A;  4TVA B;  1C0A A;  5M3M G;  4DV3 L;  2D62 A;  1V43 A;  1X65 A;  4AYB E;  3DLL A;  1NMG A;  3CCE A;  4DV3 Q;  3M3Y H;  1RIP A;  4JI3 Q;  4IFD J;  5FLM G;  5M5Y H;  2CFM A;  2LSS A;  3TS0 A;  2F4V L;  5GRO A;  5EAY A;  2BH2 A;  4IOC A;  4A3I G;  3GTJ H;  3PO3 G;  4LF5 Q;  1NE3 A;  2IY5 B;  1SN8 A;  3M4P A;  3CXC A;  4LF5 L;  3S15 H;  2CWP A;  4GLX A;  4DV7 L;  4IPD A;  3U50 C;  2AKW B;  5IYB H;  5H1S E;  1J5E Q;  4BA2 I;  4JOI A;  5C44 H;  3RLO A;  1IBK Q;  3S14 H;  1DGS A;  3U4Z A;  1VQ4 A;  3PV0 A;  3FHW A;  3OW2 A;  2H5X A;  3RZO H;  5GQO A;  5GAE C;  4JI1 L;  3KOJ A;  4MNO A;  1IZ6 A;  4LUZ A;  3PF4 A;  4GOP C;  3DM3 A;  4ME3 A;  1PFS A;  1SLJ A;  5IWA L;  1TWG H;  4DR1 L;  1GVP A;  4DR1 Q;  1XTD A;  4DV0 Q;  3L0O A;  2UUC L;  1VQH A;  3I4N G;  1Z47 A;  2Y0S E;  1IBL L;  4OX9 Q;  3H3V I;  1JJC B;  3PO2 G;  3I55 A;  1YIJ A;  5M3M H;  1VQE A;  1KRS A;  4GN5 A;  2E2J H;  4YCV A;  1KXL A;  3CPF A;  5LMN W;  3CQZ H;  4IPC A;  2ZM6 L;  4LF4 L;  1CKN B;  1QVF A;  1NY4 A;  4YWK A;  2R6G A;  5C3E H;  4A3F H;  2N78 A;  2K50 A;  2K5N A;  3E0E A;  1Q8K A;  1KQS A;  4QGU A;  2YTY A;  4A3C H;  2VUM H;  3M85 A;  1LM0 A;  1UEB A;  4A93 H;  3I7F A;  3RLN A;  1VQB A;  4TQU S;  3H3V H;  2CCZ A;  2UXC Q;  3B6Y A;  1QUQ B;  2R93 H;  1G51 A;  4WJ4 A;  3U4V A;  4DV4 Q;  2OTL A;  4LFB Q;  1UE6 A;  4X65 L;  2ES2 A;  1CKO A;  5AJ3 L;  1VQN A;  1BVS A;  3D31 A;  5AJ3 Q;  4DR4 Q;  1EIY B;  1HNW L;  2WAQ E;  3ULL A;  4DV6 L;  2PQA A;  1HR0 Q;  2NVT H;  1YHQ A;  2EXD A;  1XPR A;  2A1A A;  1QVC A;  3JC6 6;  4A3D H;  4UP7 A;  5C4J H;  1D7Q A;  2Q2I A;  4Y7N H;  3F8T A;  3PUZ A;  5JEA J;  3J80 c;  1EQQ A;  2XGT A;  1X6O A;  3F2D A;  4FDB A;  4P71 A;  2OQK A;  2B63 H;  4R4Q A;  3UDI A;  2ZTD A;  1BBU A;  4EX5 A;  2ASB A;  1CSP A;  4DR7 Q;  4K0K L;  1M90 C;  1OTC A;  1UE5 A;  2OCE A;  4R4C A;  5GAD C;  5M5X H;  1E1O A;  2ZTE A;  3L7Z C;  4PZ7 A;  1Q7Y C;  2JA5 G;  1K73 C;  2VS1 A;  3GTK H;  5JJK A;  4J15 A;  5IYD G;  1K8A C;  5C0X G;  2JA7 H;  3S2H H;  1Z9F A;  4L5Q A;  4L5T A;  2K52 A;  4Y52 H;  2A19 A;  5ELN A;  3J81 i;  4HJ5 A;  2UXB Q;  3F2C A;  5FJ8 G;  2ZJP A;  2UXB L;  2RF4 A;  1B7Y B;  5JJL A;  2LXK A;  4MTN A;  2K4K A;  5FJ8 H;  5IYD H;  1S3O A;  4LFA Q;  2HHH L;  1WJJ A;  4BA1 I;  4BY7 H;  4OO1 G;  1U0L A;  2IX0 A;  2I0Q A;  1GM5 A;  1X3E A;  2DUD A;  5M3F G;  1XNQ L;  2MFI A;  3KJO A;  2R7F A;  2ZTC A;  4H02 A;  2YTX A;  1FJG L;  4A3M H;  3STB C;  1AE3 A;  2WFW A;  4DR5 Q;  1Q46 A;  1FJG Q;  4X66 Q;  4IO9 A;  3PCO B;  2WB1 E;  4OO1 I;  1K3R A;  4X64 L;  3CC7 A;  3AFQ A;  2VQF L;  2C35 B;  1PH8 A;  1PH9 A;  1KL9 A;  1JMC A;  1VQ9 A;  4QJF A;  4JBM A;  2B63 G;  4GKJ Q;  1KD1 C;  1C9O A;  3CCR A;  5IE8 A;  4OWT B;  3HOW H;  2KBN A;  1E24 A;  2K5V A;  2B3G A;  4MZ9 A;  1W2B A;  2R7Z H;  4B3R L;  1X54 A;  1TWA H;  1XPO A;  3TS2 A;  4PZ8 A;  4R4O A;  4A3E G;  3HOY G;  3GDE A;  3T1H Q;  2AMC B;  5FLX c;  3S2D H;  3GTO H;  3T1H L;  4DV7 Q;  2JA8 G;  1P16 A;  4YY3 Q;  1VQ8 A;  1JB7 A;  5IP7 G;  2JE6 I;  3M4Q A;  3JAM c;  1WOC A;  4DUY Q;  1JJ2 A;  1HNZ L;  4LF7 L;  1AE2 A;  2VY3 A;  1PH3 A;  4JBJ A;  4DV1 L;  2OWO A;  1OXU A;  2KHI A;  4LW1 A;  2JA5 H;  1VQF A;  2HQL A;  1VQL A;  2JEB I;  3NBH B;  4DR6 L;  1J6Q A;  1LUZ A;  3KYH C;  1Y14 B;  3CC4 A;  3S1M H;  1CUK A;  5C3E G;  1VQA A;  4X6A H;  4P72 A;  4JI3 L;  4DV2 L;  4IFD G;  1B8A A;  2RHS B;  2PNH A;  3FP9 A;  4JBW A;  3J7A 5;  5C0X I;  4DV0 L;  4A3G G;  1QVG A;  2HIX A;  1XPU A;  1Y1V H;  1IBL Q;  4NPS A;  4R1J A;  3FKI G;  4GOP B;  5HGQ A;  4DK3 C;  4NXN Q;  2I5L X;  1C7Y A;  2GVA A;  1NMF A;  4IFD I;  2ZM6 Q;  4RMF A;  5IT9 c;  3CF5 A;  1W3S A;  3M4O H;  4JI2 L;  1SMX A;  3K80 C;  1MIU A;  4LWC A;  4DK6 C;  4X62 L;  1VQI A;  4A3J G;  2KCT A;  3PIP A;  1V9P A;  2K5H A;  1YJW A;  3M9B A;  4JBK A;  4O0A A;  4YWL A;  3K0X A;  2NVX H;  4OWW B;  2IX1 A;  1SR3 A;  3PSI A;  2QGQ A;  1Y1V G;  1LTL A;  1NTG A;  4HIK A;  3E9I A;  2JA7 G;  2B29 A;  4GN4 B;  2R7D A;  1HNX L;  4DV6 Q;  1BBW A;  5HY6 A;  4QIW E;  1CKM A;  2Q2T A;  4LF4 Q;  3I4N H;  1ASZ A;  3PO2 H;  4NXM Q;  5ELO A;  4C3H H;  1L1O A;  3S1N H;  4NXM L;  2K14 A;  3J81 j;  4BY1 H;  2NN6 I;  4A3B H;  3S1R H;  1N32 Q;  1PA6 A;  1QZH A;  2NZH A;  1N32 L;  2JQO A;  5LMU Q;  3RR5 A;  4K0K Q;  5JEA G;  1TWH H;  5C4X H;  1K0R A;  3PF5 A;  4A3D G;  2JA8 H;  4APV A;  4JI7 L;  3IRB A;  2AHO B;  3K8A A;  4A3E H;  3KJP A;  1O7I A;  1D8L A;  3OTO L;  1IBM L;  1XMQ Q;  3CP0 A;  4XIG S;  1FGU A;  2NZO A;  4HJ7 A;  3KFU A;  4GKK L;  1HR0 L;  4YWM A;  4OXP A;  1K8G A;  3FKI H;  1H95 A;  2YYZ A;  3PIO A;  1L1O B;  1B70 B;  1YHB A;  1AH9 A;  1WFQ A;  2WB1 G;  4LF8 L;  2WP8 J;  1EFW A;  2VNU D;  4DR3 Q;  4GLV B;  2JA9 A;  3HOX G;  4DR2 L;  4XTC S;  4A75 A;  2N49 A;  4A3F G;  2MQH A;  1MJC A;  3NEM A;  4X66 L;  1A8V A;  3BZC A;  4X64 Q;  4KHP L;  1IBK L;  3TRZ A;  4IPG A;  3S24 A;  1Q12 A;  2BH8 A;  3BU2 A;  1Q82 C;  1E7Z A;  1N36 Q;  4JI1 Q;  1L1O C;  3ULP A;  4BY7 G;  1Q81 C;  3ZJY C;  1N36 L;  1KRT A;  3S16 H;  1IL2 A;  1VCI A;  3PUX A;  3GTQ H;  3J7Z C;  2KCM A;  3RN2 A;  2MNA A;  1QUQ A;  2QEX A;  4DV5 L;  4HID A;  1QZG A;  4A3L H;  3RNU A;  2UUC Q;  4DV5 Q;  3HOY H;  4OX9 L;  5J3B A;  1S72 A;  1TXY A;  1G29 1;  3W1B A;  1HNZ Q;  1HH2 P;  4DR5 L;  3CC2 A;  3KF6 A;  2PI2 A;  2I5M X;  2CQO A;  2VQF Q;  3JAM i;  3GD7 A;  3GTM H;  4DR6 Q;  2KHJ A;  4AH6 A;  3K7A H;  5BR8 Q;  2R92 G;  2KEN A;  3Q8D A;  4A4I A;  4LUO A;  1N9W A;  1EOV A;  1YI2 A;  3I56 A;  4B3R Q;  4UY8 C;  2V1C C;  1HZC A;  1L2F A;  4JC0 A;  1VQG A;  1KC8 C;  3U58 A;  4IJL A;  1XMO L;  2BA1 A;  5M3F H;  4LFB L;  1N34 Q;  4NXN L;  3PUW A;  4GNX C;  3KLW A;  4L5S A;  1N33 L;  4JYA L;  1SRO A;  1HJP A;  2QA4 A;  1J5E L;  4JG2 A;  4JYA Q;  5IP7 H;  4PMW A;  2UU9 L;  4C3I H;  1VQP A;  4X62 Q;  4HJ9 A;  4BBS H;  3D0F A;  2YTV A;  3PO3 H;  2MO0 A;  4YCW A;  1PH2 A;  1XNR Q;  3S1Q H;  1X3G A;  3EBE A;  4LFC Q;  1XNR L;  4AQY L;  1GD7 A;  4AQY Q;  5IWA Q;  3HOU G;  1JJG A;  4DR7 L;  2E2H H;  3A5Z B;  1PHJ A;  3EN2 A;  3LGJ A;  1LYL A;  1KIX A;  2VQE L;  4B3T L;  4GNX B;  4GKJ L;  4WJ3 M;  4P74 A;  4YHH Q;  5LMN L;  4JI4 L;  1Q1E A;  2ATW A;  1HNX Q;  1JT8 A;  4B3M L;  2R92 H;  2MO1 A;  1SFO H;  3A0J A;  3G4S A;  2YU9 H;  4P73 A;  3CPW A;  3F1Z A;  1YJN A;  1K9M C;  1PH6 A;  3GTP H;  2I5H A;  2IT1 A;  1X3F A;  4A3M G;  1EQR A;  2PQA B;  1U5K A;  3NEN A;  1I94 L;  4LF6 Q;  2Z0S A;  1PYB A;  2CWA A;  2LXJ A;  4B3S L;  1FVI A;  1VQC A;  4DKA C;  3HOZ H;  3NEL A;  2OTJ A;  4OON A;  3GTG H;  4IOA A;  4BBR G;  2FXQ A;  2ID0 A;  1VQD A;  3UDX A;  3CCJ A;  3BZK A;  4LNQ A;  3CAM A;  4DV4 L;  4JI7 Q;  2Z6K C;  1Q1B A;  1WCM H;  3I4O A;  5C0X J;  4BY1 G;  1PH4 A;  4A3B G;  2XTI A;  1YVC A;  4R4T A;  1XMQ L;  4GOP A;  4GN3 B;  3HKZ E;  2YV5 A;  4A3G H;  1HNW Q;  2ZJQ A;  5JJI A;  2GN5 A;  4PG3 A;  4BXX G;  3W1G A;  1PVO A;  2DGY A;  4A3I H;  3G6E A;  1OXT A;  2ALY B;  3EIV A;  3MXN B;  2NVQ H;  1N8R C;  4JOI C;  3A74 A;  4NB3 A;  4ALP A;  2F4V Q; 
#chains in the Genus database with same CATH topology
 1YHA A;  1I3Q H;  4C3I G;  4YCU A;  1SDF A;  3DHQ A;  2GA4 B;  2F0H A;  5IYC H;  4JI0 L;  1BKB A;  1G6Z A;  5M5X B;  3BDC A;  4IAL A;  1SYD A;  1ET6 A;  4JV5 Q;  2UUA L;  1B4O A;  3OTO Q;  1VQ6 A;  3A5U A;  1SNO A;  2C5C A;  3BVM A;  2JA6 G;  3P1H A;  4BBS B;  2QKI C;  1JWU D;  5FKA C;  3BJU A;  3J81 E;  4POF A;  5E4W C;  4RGO S;  1QNK A;  3HOV G;  2HT1 A;  3GTM B;  2NB0 A;  4CJ1 B;  4EQ5 A;  1BO0 A;  3I70 A;  3HOX B;  3WOF A;  5C3E B;  1GKH A;  2F0K A;  3FDT A;  1FL0 A;  4OWX B;  2F3V A;  5LHY 1;  3MEF A;  2XVS A;  1Y1W G;  1NR4 A;  1C4Q A;  2WV6 D;  1WYD A;  1ET9 A;  3J7Y W;  3H09 A;  1EYG A;  4UP9 A;  1EYA A;  5LL6 S;  3QO2 A;  5ELB A;  4A76 A;  3H0G G;  4GLA C;  4HAE A;  4JI5 L;  2Z9H A;  1G6P A;  3MTS A;  2DNC A;  2D5D A;  5C4J B;  1WCM B;  4KJO A;  3L2P A;  4DUY L;  1V1Q A;  2SEB D;  3URY A;  1VQK A;  1V1P B;  2KA7 A;  1PH5 A;  3G7L A;  2EIF A;  2KED A;  2RBM A;  3HEJ A;  3D4W A;  2IHE A;  1YZ6 A;  1XMO Q;  2UXC L;  1N34 L;  5A2Q E;  4C2M H;  5M5W B;  2HCI A;  2Z6K A;  2N8N A;  5D3I B;  4CDE C;  2EYH A;  4IPH A;  4O2D A;  4GKK Q;  2RCF A;  4KV6 A;  1PH7 A;  3M4O B;  5C4X G;  3BYT B;  3NWT A;  4KI0 A;  4GS3 A;  2OQ0 A;  3CW2 C;  3RLF A;  3U9O A;  3CCQ A;  3SEB A;  2A6E C;  1E22 A;  3HP3 A;  1VDZ A;  3T51 B;  4JI6 Q;  2I46 A;  3F2U A;  4YHH L;  5LMN Q;  1BCP B;  1S5D D;  4F87 A;  1D1I A;  4B3M Q;  1A62 A;  1EOT A;  1YIT A;  3R8B A;  2MP1 A;  3G48 A;  2NBF A;  3E9H A;  1DOM A;  4RHS A;  3F2B A;  1VQ7 A;  4LF6 L;  1VQJ A;  5M5W H;  4FVM A;  1PYS B;  1IYJ B;  1UE7 A;  4WJW A;  2UXD L;  2E5L Q;  5LMU L;  4RG1 A;  4OHJ A;  3D6C A;  2MJ8 A;  5E3F A;  5IYC G;  3G71 A;  1A63 A;  1K83 B;  2PW7 A;  2JK8 A;  2VUM G;  2SDF A;  1BF4 A;  2N3S A;  4DAV A;  4QIW B;  5M3M G;  4PMC A;  4DV3 L;  4AYB E;  1VF7 A;  1WTQ A;  2CFM A;  1D5M C;  2LSS A;  3TS0 A;  2L9H A;  2F4V L;  3PO3 G;  3HG9 A;  2IY5 B;  2OXP A;  3I4M B;  1I4Q A;  3S15 H;  1ZXT A;  2PYK A;  1MI2 A;  2AKW B;  4BA2 I;  4DAP A;  3RLO A;  3NXW A;  2K05 A;  3PV0 A;  1SBB B;  3OW2 A;  2H5X A;  4BBR B;  5GQO A;  5GAE C;  2WII B;  1DOK A;  4MNO A;  3E3X A;  4LUZ A;  1A3U A;  2J7Z A;  4GOP C;  1RHP A;  1PFS A;  1GVP A;  2NTS A;  4DR1 Q;  5J39 A;  4DV0 Q;  3I4N G;  1HPC A;  2PPB C;  1VQE A;  1HUM A;  4GN5 A;  3Q22 A;  1BDO A;  2X69 A;  3CPF A;  3S2H B;  2DJF C;  1STE A;  4IPC A;  1KDC A;  4KMU C;  1CKN B;  1NY4 A;  3KBX A;  4A3F H;  3S15 B;  2K5N A;  3V05 A;  2YTY A;  4QGU A;  1UEB A;  4PMB A;  3SR1 A;  1A3T A;  1VQB A;  1RJT A;  1QUQ B;  3BZD B;  3H0G B;  3U4V A;  4DV4 Q;  2OTL A;  4TSS A;  3V2T A;  1VQN A;  5AJ3 Q;  1D2B A;  1HNW L;  4FF1 A;  2L0C A;  2PQA A;  1HR0 Q;  2EXD A;  2A1A A;  1EY5 A;  4A3D H;  3J7A V;  2HDM A;  1G8Z D;  2ZTD A;  2ASB A;  2RDH A;  4A3I B;  3BDO A;  1MSG A;  3EQL C;  1PTO H;  3L7Z C;  1ROD A;  1CZW A;  5JJK A;  5I6W A;  2CW0 C;  2K52 A;  1MSH A;  4Y52 H;  2A19 A;  3J81 i;  4X3S A;  3F2C A;  3EFX D;  5I4D A;  2UXB Q;  2RDF A;  5FJ8 G;  3OIQ A;  2H1E A;  1V1P A;  5F2D A;  2OF1 A;  2LXK A;  4ILW A;  5IYD H;  1S3O A;  4LFA Q;  2HHH L;  1WJJ A;  4OO1 G;  2IX0 A;  3EVQ A;  2I0Q A;  4OL7 A;  1X3E A;  2DUD A;  4K5X A;  3KJO A;  3M4Y A;  2PO4 A;  4ZYS A;  4A3M H;  4HR7 B;  2F0G A;  1FJG Q;  1K3R A;  4X64 L;  3CC7 A;  4CKE A;  4GKJ L;  1HTL D;  1JMC A;  1KD1 C;  3CCR A;  3HOW H;  1RF2 D;  1E24 A;  1GUT A;  1W2B A;  3MXN A;  1SYC A;  4R8I A;  2JA7 B;  1BCP F;  2TMP A;  1XPO A;  4UHV A;  5ELF A;  2G9H D;  4RFB A;  4DV7 Q;  1V1O A;  5E1F A;  3MA2 B;  1VQ8 A;  1YNN C;  5IP7 G;  4DUY Q;  1SMY D;  2VY3 A;  4XT3 B;  4JBJ A;  1CA5 A;  2OWO A;  2KHI A;  2EZV A;  1VQF A;  2HQL A;  3A55 A;  1VQL A;  4KJN A;  1J6Q A;  1GOZ A;  1LUZ A;  3MC0 B;  4M8A A;  4UAI A;  3E6Z X;  4XYQ A;  3J7A 5;  4RGN A;  1QVG A;  1I4R A;  1Y1V H;  1IBL Q;  4IZ8 A;  5EBC A;  4NPS A;  4WFN 3;  4NXN Q;  3MZ5 A;  1TS3 A;  4FP5 D;  1YNN D;  2ZM6 Q;  1TS2 A;  1E2V A;  1JR0 D;  1SMX A;  1SYG A;  1LTR D;  1MIU A;  4LWC A;  5EGT A;  3QWN A;  2KCT A;  3PIP A;  3I72 A;  1V9P A;  1TS5 A;  3M9B A;  2QDL A;  4YWL A;  2NVX H;  2QGQ A;  4YIJ A;  4HIK A;  2R7D A;  2DN8 A;  4HTH A;  5HY6 A;  4J1M A;  4QIW E;  2B2T C;  1HQR D;  3PO2 H;  1ASZ A;  4NXM Q;  1HTP A;  4ULL A;  1G2T A;  1LAC A;  3VYR A;  1PA6 A;  1QZH A;  1N32 L;  1I3Q B;  5LMU Q;  3RR5 A;  5JEA G;  5C4X H;  3HOV B;  3BVZ A;  1F2Y A;  2IL8 A;  4A3E H;  3T56 B;  1IBM L;  3KJP A;  4J6H A;  2SNM A;  1XMQ Q;  4XIG S;  3KFU A;  3J7A F;  1AN8 A;  1HR0 L;  4QMG A;  4YWM A;  4OXP A;  5EPL A;  1K8G A;  3PIO A;  4H13 C;  1YHB A;  1AH9 A;  1AFP A;  1PZI D;  3FPU B;  4DR3 Q;  4KKS A;  2RVL A;  1BXT A;  1EY6 A;  4A75 A;  4DR2 L;  2MQH A;  1F2Z A;  2E2I B;  3BZC A;  4G4K A;  3TRZ A;  2RA4 A;  4KN4 C;  1RDP D;  1E7Z A;  1PXU A;  4H7B A;  4BY7 G;  2TSS A;  5KEE A;  3S16 H;  1ML0 D;  2QDB A;  2L4N A;  1VCI A;  3PUX A;  1NUC A;  4KTA A;  4DV5 Q;  5J3B A;  2R3Z A;  1IW7 D;  1G29 1;  5IGC A;  3CC2 A;  3KF6 A;  2CQO A;  1LT6 D;  3VR4 A;  4AH6 A;  3K7A H;  4ZCK A;  2BDN A;  4A4I A;  1N9W A;  5C4H A;  2BCO A;  2Z4I A;  5I6Y A;  5D3D A;  1JCK B;  1L2F A;  1VQG A;  3NP8 A;  1KC8 C;  3OWE B;  1H9J A;  2F0N A;  4ZQ3 A;  4GNX C;  3KLW A;  3CU7 A;  4JYA L;  1J5E L;  5C44 B;  4HMJ A;  4PMW A;  2JA6 B;  5HUR A;  4C3I H;  4I7A A;  4BBS H;  4YCW A;  1PH2 A;  1ENA A;  2A68 C;  1GD7 A;  4AQY L;  2OT2 A;  5IWA Q;  2QIL A;  1G2S A;  1PHJ A;  4DA2 A;  3EJI A;  2MO1 A;  1Q90 A;  1F9S A;  3G4S A;  2YU9 H;  1SYE A;  2IT1 A;  2JSO A;  2JN4 A;  1A3V A;  5CV6 A;  1U5K A;  1I94 L;  3HOU B;  2Z0S A;  2XIW A;  2CWA A;  4DKA C;  3HOZ H;  3Q23 A;  3GTG H;  2K32 A;  1ESR A;  4C1N I;  1I6H B;  3CCJ A;  4LNQ A;  3BZK A;  2KCC A;  4JI7 Q;  1AP0 A;  5C0X J;  4A3B G;  1I50 B;  4JVZ A;  4BWG B;  1YVC A;  4R4T A;  3H6M A;  3HKZ E;  3IFT A;  4FYD A;  2NZ1 D;  1B50 A;  5BN4 A;  4BXX G;  1WTH A;  2ENB A;  1M8A A;  1BOS A;  3W1G A;  4A3I H;  1E0B A;  1N8R C;  4JI2 L;  4DK1 A;  2F0E A;  3QOL A;  1EWH A;  4R9W A;  3S14 B;  4ZAI A;  3A8K E;  1GUO A;  1L0W A;  1EIF A;  4UPA A;  3UDG A;  2F4I A;  3A54 A;  2F3I A;  1GUN A;  1EUJ A;  5EKK A;  3PIP 3;  1IBM Q;  3PIO 3;  4C3J H;  1Q86 C;  3FVQ A;  1VS0 A;  2KQ3 A;  1QCB D;  2E8G A;  2PQE A;  4RCO A;  4CDF C;  3J80 L;  4EQN A;  1X9N A;  2HCC A;  2K5D A;  1DOL A;  3ICE A;  3CCV A;  3AMU A;  2BA0 A;  4AIM A;  1R4P B;  1M1K C;  5GAG C;  4O42 A;  1IYU A;  5FLM H;  3ER0 A;  5C3W A;  4G7H C;  4K2L A;  4A3G B;  3A8J E;  1AZQ A;  3FMC A;  3J81 c;  4AYB B;  3ULJ A;  3PUV A;  1WCM G;  1SE2 A;  2L55 A;  4JCV E;  1CTM A;  5IP9 G;  1EY9 A;  4N9P A;  2F0W A;  2L15 A;  3CCL A;  4HN7 A;  4EGV A;  4QQB X;  3WWV A;  2UUB L;  1QE6 A;  1EWI A;  1TWC B;  1N33 Q;  2PZW A;  2B2Y A;  3NBI A;  3KF8 B;  2O5J C;  1I4H A;  1TWG B;  5IY0 A;  1X3P A;  4NMZ A;  2LMC B;  3HOX H;  2WAQ G;  3SXH A;  3QJY A;  1GXD C;  4J8Q A;  3AQQ A;  3HKZ B;  5EPK A;  1XJV A;  1STA A;  2DJG C;  3VDY A;  3MVV A;  3I4M G;  3JAM L;  5A35 A;  1O7Z A;  3TQY A;  4CBV A;  4L6T B;  1A2T A;  3CMA A;  1I5F A;  4IQZ A;  4A3K G;  3D4D A;  3W3A A;  5ELD A;  3KF6 B;  3TDQ A;  4DR4 L;  3TRE A;  2JA8 B;  3TBI B;  3I73 A;  3UE0 A;  3H3V C;  4LF9 Q;  1GJX A;  3RN5 A;  4C56 C;  2Y0S G;  1T5X D;  3H91 A;  3VYT A;  3H15 A;  4IJH A;  3GV6 A;  3P7J A;  4NW2 A;  4HJ8 A;  3I90 A;  4L8J A;  3I4N B;  4WOR A;  4DNR B;  1LV9 A;  1VQM A;  1ESF A;  3HGB A;  2NN6 G;  3DEO A;  3FRP B;  1WI5 A;  2E2J B;  1DCZ A;  3K57 A;  2F0F A;  4L5R C;  1I94 Q;  4DUZ L;  2VUM B;  4JI8 Q;  4A3J H;  1TWA B;  5C44 G;  4R4I A;  3PUY A;  1SSO A;  1JE5 A;  1XNQ Q;  4JV5 L;  5FOB B;  1HR0 W;  2UUA Q;  1XX8 A;  2K01 A;  1YEZ A;  3GO5 A;  3KDF B;  1KAB A;  3CCS A;  2IHF A;  2ZT9 C;  5C0X H;  2JXM B;  4RKB A;  1RL2 A;  3T1Y L;  5I2X A;  1RTO A;  1V43 A;  3DLL A;  1NMG A;  3CCE A;  4JI3 Q;  5NUC A;  2PCF B;  3OOC A;  3D3R A;  5M5Y H;  5GRO A;  3ND8 A;  2CVR A;  4A3I G;  5I9P A;  2K03 A;  4LF5 L;  2CWP A;  3HOW B;  1F9Q A;  4IPD A;  5IYB H;  1J5E Q;  5EKL A;  5C44 H;  1IBK Q;  2AQ1 B;  3S14 H;  5KRU A;  1J9O A;  1ONL A;  4R8N A;  5IWA L;  1F2M A;  2FJ2 A;  1XTD A;  3QR8 A;  3L0O A;  4OX9 Q;  5FO9 B;  2R92 B;  1GUS A;  2EVB A;  2E2D C;  2G5D A;  5CYU A;  4F7X A;  1ZKO A;  1KXL A;  4LF4 L;  4YWK A;  1K8M A;  1HFG A;  2R6G A;  1WTP A;  1IKM A;  2N78 A;  1PTO B;  2K50 A;  1K3B C;  1H9M A;  2MHV A;  1Q8K A;  4L63 B;  2RDG A;  4A3C H;  2VUM H;  5ELE A;  3I7F A;  2Q8T A;  4TQU S;  4XQJ A;  2UXC Q;  2R93 H;  1G51 A;  1UE6 A;  2RQX A;  2ES2 A;  1ILP A;  1EIY B;  2WAQ E;  3ULL A;  1YHQ A;  1XPR A;  1QVC A;  1U4R A;  2Q2I A;  1EQQ A;  2EY1 A;  1QJO A;  4HED A;  1TS4 A;  2WKC A;  1DZ1 A;  4R4Q A;  3UDI A;  1BBU A;  3FPP A;  3R2T A;  1RTN A;  4DR7 Q;  4K0K L;  2OCE A;  3IL8 A;  1R4Q B;  5GAD C;  2JA5 G;  4PZ7 A;  1RCV D;  3L9A X;  5IYD G;  5C0X G;  3S2H H;  4L5Q A;  2K6A A;  1Z7T A;  5ELN A;  2ZXP A;  4I7Z C;  3MAQ A;  2ZJP A;  1Y8P B;  1B7Y B;  2B39 A;  4C3J B;  2A69 C;  4BY7 H;  5CV9 A;  4EVO A;  5M3F G;  2L11 A;  2R7F A;  2YTX A;  1VMP A;  4ABN A;  3STB C;  4DR5 Q;  4IO9 A;  1L0X B;  1PH9 A;  4JBM A;  1VQ9 A;  2B63 G;  4LJZ C;  1EU3 A;  4OWT B;  5A2Q L;  2B3G A;  3C2P A;  3C1E A;  4QCL A;  3TS2 A;  1F2L A;  2Z8L A;  3HOY G;  3T1H Q;  5FLX c;  3S2D H;  4XYO A;  2JA8 G;  1P16 A;  2JE6 I;  1JJ2 A;  3T53 B;  1WOC A;  1QOH A;  1HNZ L;  1AE2 A;  4KD4 A;  1STH A;  4TKO B;  2JA5 H;  3HRZ C;  1JB3 A;  3NQT A;  1PTO C;  5C3E G;  4JI3 L;  3S1R B;  5KGU A;  2PNH A;  2RKS A;  4DV0 L;  4B9X A;  1CQV A;  4FF3 A;  5HGQ A;  4KKU A;  1C7Y A;  2EJM A;  1NMF A;  3X3N A;  4IFD I;  4RMF A;  5IT9 c;  3CF5 A;  2P5Z X;  1TWH B;  3TSS A;  1TKW B;  3K80 C;  4DK6 C;  4X62 L;  1VQI A;  1F77 A;  3P75 A;  3MFY A;  4OWW B;  4CJ0 B;  4HMI A;  3PSI A;  2F0I A;  1LTL A;  1NTG A;  2F3W A;  3E9I A;  1Y69 U;  4N8X 1;  3OHX C;  2K7V A;  4LF4 Q;  3KLR A;  5ELO A;  2LS0 1;  2K14 A;  1Z6H A;  2NN6 I;  4H44 C;  4A3D G;  4I65 A;  1IL8 A;  3NSW A;  5KND A;  2AHO B;  3K8A A;  4ME5 A;  1O7I A;  1CQF A;  3CP0 A;  4HJ7 A;  5TSS A;  4DAY A;  3FKI H;  3LNN A;  5CBA E;  3NQI A;  4CJ2 C;  3DEP A;  4LF8 L;  1O80 A;  1R9T B;  4GLV B;  4XTC S;  4A3F G;  1MJC A;  2AUK A;  3NEM A;  2XRS D;  4EQO A;  2M00 A;  1A8V A;  4X64 Q;  1IBK L;  4IPG A;  1NCV A;  3BU2 A;  3WDN A;  5JVG 3;  2KJX A;  1Q3L A;  1Q82 C;  1N36 Q;  1L1O C;  3ULP A;  4OO1 H;  1E2W A;  1KAA A;  4KHV A;  3GTQ H;  3J7Z C;  3RN2 A;  2MNA A;  2QEX A;  4HID A;  1QZG A;  1SNQ A;  4C3I B;  3FKI B;  1MGS A;  3RNU A;  4HSP A;  1TT2 A;  3HOY H;  4OX9 L;  2B2U C;  3S1M B;  4K6L A;  3W1B A;  4DR5 L;  5M3M B;  1PMR A;  5DM6 3;  2NN6 H;  2PI2 A;  1BR9 A;  3GD7 A;  2KEN A;  1FR3 A;  1YI2 A;  3I56 A;  2EJF C;  3NE5 B;  4BY1 B;  2IPK D;  2D9U A;  2FMM A;  3GTJ B;  2CQA A;  4B08 A;  5M3F H;  4G7O C;  4NXN L;  1FNU A;  3HOZ B;  1LTB D;  2B63 B;  2QA4 A;  4JG2 A;  4ZUJ A;  4DGZ A;  2B2V A;  4RA8 A;  2FIN B;  4NDX A;  2YTV A;  3K0Y A;  5FLX L;  1X3G A;  4LFC Q;  4KY5 A;  1XNR L;  3NK9 A;  3HOU G;  4RCN A;  1JJG A;  3AU7 A;  4DR7 L;  2E2H H;  3EN2 A;  4B3T L;  1LTS D;  2VQE L;  4GNX B;  4JI4 L;  1Q1E A;  2ATW A;  3D8G A;  1H9S A;  1STN A;  3QOJ A;  5DAU A;  1SFO H;  4QF4 A;  3A7A B;  3F1Z A;  1JOR A;  1PH6 A;  3GTP H;  5KIX A;  3RD4 A;  2PQA B;  1IW7 C;  1TU2 B;  3NEN A;  4RAU C;  5G3L F;  4B3S L;  3VYS A;  1FVI A;  3IAY A;  1SE3 A;  5CGK A;  4FNF A;  1WD1 A;  2ID0 A;  3UDX A;  3CAM A;  1WCM H;  3I4O A;  3ITP A;  4CHT B;  1XMQ L;  4GN3 B;  1LT3 D;  2N55 A;  2HQE A;  2DGY A;  2B2U A;  3SK8 A;  1OXT A;  1UEA B;  3EIV A;  5IGG A;  3LWU A;  4FXD A;  4DR3 L;  4ALP A;  4DR2 Q;  2JJQ A;  4JI0 Q;  5KYL A;  2FMC A;  4QL5 A;  3HS0 C;  4BBR H;  4MIU A;  1BNZ A;  4MHE A;  3UDF A;  1TWC H;  4A3E B;  1PTO D;  1W6J A;  2EYM A;  2AWN A;  5AFW A;  5COR A;  2EOT A;  3E0J A;  1I6H H;  2ZJR A;  4HIO A;  3K81 C;  4IUQ A;  5FLX E;  1E3P A;  1K0S A;  4AYB G;  3MFG A;  5HGT A;  4A93 G;  5IYB G;  2AWO A;  5DLQ E;  3W5O A;  4LF8 Q;  1I6V C;  2XN9 C;  3ERS X;  2A8V A;  4PZ6 A;  2F52 A;  4BXX H;  1SMY C;  2VXW A;  2JEA I;  1QG7 A;  4IFD H;  1WTV A;  1SAP A;  1UE1 A;  1NAP A;  4RH6 A;  4DAM A;  1PV4 A;  1X55 A;  1PH1 A;  3CME A;  4POG A;  1QB5 D;  2JA6 H;  5E4X A;  2PNR C;  2PW5 A;  3I3C A;  4OEM B;  5IT9 E;  4JI5 Q;  2IW3 A;  3HKZ G;  3PO3 B;  4X65 Q;  4HJA A;  2D0O A;  4OEL B;  3KF8 A;  3J80 i;  1VQO A;  5CR3 A;  1KHI A;  3TP8 A;  1I4X A;  2FHT A;  2Q8I B;  5IOC A;  2KVM A;  4K14 A;  3WOE A;  4P75 A;  4CKC A;  4O1N A;  1H9K A;  1YNX A;  4DV2 Q;  4RHR A;  3HFZ B;  1QWY A;  4BBS G;  5M3F B;  3I8Z A;  4HCE A;  1SE8 A;  4OIJ A;  2JYO A;  4DPG A;  1CFM A;  1EQT A;  5FK9 C;  1K83 H;  5L37 A;  4HIM A;  1BBX C;  1ASY A;  2NVY H;  3BDL A;  3H0G H;  2VZA A;  1EQV A;  3AFP A;  2GVB A;  2PI2 E;  1RD9 D;  2X6L A;  1TWF H;  3K7U C;  1GUW A;  1OXV A;  4JI6 L;  1Y1W B;  2XWJ B;  3R93 A;  4B3T Q;  3I4M H;  4WRD A;  1DON A;  4JI4 Q;  2F0M A;  3N52 A;  4IUV A;  1NR2 A;  4JW0 A;  2E2I H;  3HKS A;  2CH4 W;  2NUC A;  3PGZ A;  1B9N A;  1HHV A;  3D4R A;  3HOV H;  1A0I A;  1HZA A;  2E5L L;  1HXY D;  1M4V A;  3H94 A;  4KKT A;  4B3S Q;  2R7Z B;  1IYV A;  1CSQ A;  3MXU A;  3HOZ G;  3TP5 A;  3DM1 A;  1EEI D;  3SGI A;  3SK6 A;  4TRD A;  1GO3 E;  4GNX A;  4A3C G;  1BCP C;  4CDD C;  1I50 H;  2K75 A;  3KDF A;  1D1K A;  2HD3 A;  5KNC A;  4DV1 Q;  4UP8 A;  2F0V A;  1CKN A;  3UI2 A;  1MKH A;  4FO2 A;  2D62 A;  5CV8 A;  2ZXO A;  4DV3 Q;  4IFD J;  1RIP A;  5FLM G;  1SYB A;  1I4G A;  5EAY A;  2JP1 A;  3AB9 A;  2HUG A;  3GTJ H;  3VA5 A;  2F0O A;  4Q0F A;  4IN3 A;  4DXG A;  1RKN A;  5H1S E;  4ODG A;  4JOI A;  2B2W C;  3NHH A;  2DY8 A;  1DGS A;  3OSO A;  1VQ4 A;  4HCS A;  3Q24 A;  2A6E D;  3W2D A;  4KY6 A;  3KOJ A;  2F0P A;  2M2L A;  4OGQ C;  4C3J G;  4ME3 A;  1SLJ A;  4DR1 L;  1TWG H;  3FEW X;  1KNA A;  2O4X A;  5D65 A;  3RMH A;  3PO2 G;  2Y0S E;  3M3Y B;  1JJC B;  3I55 A;  1EFI D;  4PNY A;  1TY2 A;  1S5C D;  1KRS A;  1PTO F;  4YCV A;  3CQZ H;  4RGM A;  1LLR D;  5C3E H;  1W6K A;  1KQS A;  2BOS A;  2L12 A;  3VR5 A;  1LM0 A;  5J1Z A;  4A93 H;  4KY7 A;  3R2I A;  3RLN A;  3H3V H;  2K5W A;  3GTP B;  2CCZ A;  1HFN A;  5EKI A;  4FF2 A;  3J80 E;  4LFB Q;  5DM7 3;  4MTK A;  4X65 L;  1XWE A;  1CKO A;  5AJ3 L;  1BVS A;  3D31 A;  4DR4 Q;  2M9V A;  3SK4 A;  3BS1 A;  4DV6 L;  2B2T A;  2LKV A;  2KOL A;  4UP7 A;  4Y7N H;  1B9M A;  3PUZ A;  2F03 A;  5JEA J;  5EJW A;  3J80 c;  2WB1 B;  1X6O A;  3F2D A;  1STG A;  4NP5 A;  2B63 H;  3M7G A;  2EY5 A;  4EX5 A;  1CSP A;  1M90 C;  1A2U A;  2V4D A;  1UE5 A;  2Q8R E;  4UDU C;  1I4P A;  3CKI B;  1UUP A;  4R4C A;  1E1O A;  1Q7Y C;  1FNV A;  1K73 C;  2VS1 A;  1Z9F A;  1LTT D;  4JPB W;  1B53 A;  4L5T A;  4B9W A;  4HJ5 A;  2UXB L;  2RF4 A;  2A73 B;  4MTN A;  4BA1 I;  1EEF D;  4X3T A;  5IGD A;  1XNQ L;  1KDB A;  2MFI A;  2ZTC A;  1HRJ A;  1FJG L;  2K1B A;  1AE3 A;  2WFW A;  1H9S B;  3MXP A;  1Q46 A;  4X66 Q;  2A74 C;  1C48 A;  1AEX A;  3PCO B;  2WB1 E;  4M1U B;  2AQ2 B;  1EY7 A;  3CD6 A;  3AFQ A;  3GTK H;  2C35 B;  4QJF A;  4GKJ Q;  2OEO A;  5IE8 A;  3KLS X;  2KBN A;  4MZ9 A;  1TWA H;  1B3A A;  4PZ8 A;  4R4O A;  4LAA A;  3TME A;  3IKJ A;  4MN3 A;  4YY3 Q;  5C6A A;  5IT9 L;  3SK5 A;  1S5B D;  1PH3 A;  4DV1 L;  1ICF B;  1TR5 A;  2MPM A;  2XSC A;  2JEB I;  3NBH B;  3SE0 A;  4DR6 L;  2WAC A;  3CC4 A;  1SJH D;  3S1M H;  3S1Q B;  1CUK A;  2D2C C;  1VQA A;  4BY7 B;  4DV2 L;  1CZG A;  1B8A A;  2RHS B;  3ERO A;  4C3H G;  4V0B A;  1HQM C;  3A8I E;  4A3G G;  1EZ6 A;  2KCN A;  1XPU A;  1LAB A;  3KUP A;  3R3O A;  4R1J A;  4GOP B;  4Z9C B;  2I5L X;  4XDX A;  2GVA A;  1O7L A;  1K8O A;  1W3S A;  3DUZ A;  4DXF A;  3M4O H;  1L0Y B;  1JIC A;  4ZK9 B;  1ILQ A;  2DY7 A;  2E76 C;  4ZKB B;  4O0A A;  2ICE C;  1BUV T;  1T5E A;  3TP6 A;  4F88 A;  1PZK D;  4IUU A;  2B29 A;  2JA7 G;  3DWQ A;  2IJ0 A;  2SOB A;  1HNX L;  2EY6 A;  2F0D A;  1B2T A;  2Q2T A;  3I4N H;  4NXM L;  4PQX A;  3J81 j;  4A3B H;  1N32 Q;  1BCP D;  1PRT C;  3TN2 A;  2NZH A;  4K0K Q;  1OO9 B;  1TWH H;  4DN4 M;  3GTQ B;  4F8M A;  1DXM A;  2JA8 H;  4APV A;  5FO8 B;  2PZT A;  3TZU A;  2CW0 D;  3IRB A;  2XNA C;  1D8L A;  2FFK B;  2B2W A;  5JPN C;  2KUM A;  2NZO A;  3OWF A;  2R93 B;  3NWS A;  4Y7N B;  1L1O B;  1B70 B;  5EPJ A;  2AQ3 B;  5K36 H;  2WB1 G;  4X3U A;  1TWF B;  2WP8 J;  1EFW A;  1FD7 D;  1G91 A;  1KLG D;  3S1N B;  4IUR A;  2G9D A;  1O7Y A;  4KHP L;  2ICI A;  2O2L D;  3S24 A;  1Q12 A;  1STB A;  2BH8 A;  2ZXR A;  3QIA A;  3DMU A;  1FYC A;  1CHP D;  2A5H A;  4KN7 C;  1XYI A;  3ZJY C;  1B44 D;  4LMQ D;  3G6J B;  4A3J B;  1IL2 A;  2KCM A;  4A3L H;  4DV5 L;  2DNE A;  1S72 A;  1TXY A;  4ZKC B;  1HNZ Q;  1HA5 A;  3DWP A;  1B3Q A;  2K04 A;  2KHS A;  3JAM i;  3GTM H;  5BR8 Q;  1PFM A;  4LUO A;  3RZD B;  1EOV A;  4V19 0;  1PFB A;  4LK1 C;  4A3B B;  3DXJ C;  4UY8 C;  3N6R A;  1EYD A;  1HZC A;  3K5N A;  4JC0 A;  4ID6 A;  1D5X C;  2EDG A;  4FXK C;  4H0L C;  3OIP A;  1ZEQ X;  4LFB L;  1GHK A;  3Q0A A;  3RZO B;  3PUW A;  5CC4 A;  3L3O C;  4S3S A;  4K2K A;  4JYA Q;  3NPP A;  1UNS A;  2N88 A;  2UU9 L;  1YNJ D;  1VQP A;  4X62 Q;  3GTO B;  1SNM A;  3D0F A;  3PO3 H;  2MO0 A;  3S1Q H;  1Q8I A;  3EBE A;  3SDZ A;  4DNT B;  2NVT B;  4AQY Q;  2C9O A;  4XXE A;  4C3H B;  1LYL A;  3A56 A;  1KIX A;  4P74 A;  1TII D;  2KEE A;  3GV3 A;  4PV1 C;  2R92 H;  1JT8 A;  2QEJ C;  3A0J A;  1AZP A;  4P73 A;  1YJN A;  3EA6 A;  2I5H A;  1EQR A;  2B2V C;  1LO5 D;  1SXT A;  2CH4 A;  2WAQ B;  3NEL A;  2RSO A;  4OON A;  1TY0 A;  2EYF A;  5JVH 3;  1CK1 A;  1VQD A;  3A7L A;  3PQI A;  2Z6K C;  1Q1B A;  4A3M B;  3Q6S A;  4GOP A;  4JK1 C;  2YV5 A;  1ENF A;  2ZJQ A;  5JJI A;  2GN5 A;  1E2Z A;  1ICW A;  2LFN A;  1PVO A;  3G6E A;  2ALY B;  4QUF A;  4JOI C;  5G3L D;  4Q5V A;  4G57 A;  4JI2 Q;  2UXD Q;  2L5T A;  3I2Z A;  3GTL H;  2EQS A;  2Y0S B;  3AYH B;  1T9H A;  3STB D;  3VR3 A;  1CA6 A;  1SRU A;  5CMD A;  1WVL A;  1PDQ A;  1GUG A;  1PRT D;  2PMZ B;  4YY3 L;  1X56 A;  3OMG A;  1OXX K;  2B8G A;  3TZD A;  1EIG A;  1NJI C;  2A68 D;  3M7N A;  3KBG A;  3UE1 A;  2NWG A;  1XTC D;  2K33 A;  4LUV A;  2D0P A;  2R93 G;  4U68 A;  3OYY A;  3E5S A;  3TP7 A;  3VR2 A;  1PYW D;  3U9S A;  4A3K B;  2F0T A;  2Q2H A;  4K5V A;  4NKL A;  1MBY A;  3K7A B;  4K5W A;  3AEV A;  1LTG D;  3CCU A;  1PRT F;  5I2Y A;  3MHB A;  4KHP Q;  1R9T H;  4QY7 A;  2RCN A;  1BQQ T;  3BVG A;  3S9W A;  3MEH A;  5BN3 A;  1VQ5 A;  1P8L A;  1IXR A;  1ENC A;  4KLK A;  1J8I A;  1SEB D;  2UUB Q;  2PMZ E;  1DD2 A;  4XQQ A;  5C3X A;  1Y1W H;  4P2C B;  4HSV A;  3S17 H;  2Q2U A;  3OW7 A;  3K58 A;  1JOK A;  1KNE A;  3HOW G;  2Z4H A;  2VL6 A;  5DEH A;  4LFC L;  3RZD H;  2E74 C;  2NVQ B;  3NTK A;  1A6X A;  2F0L A;  1UWV A;  4IUN A;  3V96 A;  1YJ9 A;  2E75 C;  5J22 A;  2VQE Q;  3C46 A;  3HOU H;  4CDC C;  2HIV A;  1Y8N B;  1S4Z A;  4A3L G;  4GZY C;  1LT4 D;  2CKZ B;  3T13 A;  1EY0 A;  1KTK A;  3GP7 A;  1YBY A;  5COY A;  2RHQ B;  3CCM A;  2UU9 Q;  4LF9 L;  1HZ9 A;  5IP9 H;  5M9O A;  3SHL A;  3P20 A;  1NBW A;  2R7Z G;  3PO2 B;  5E7N A;  1JOO A;  1D5Z C;  4DU9 A;  5K36 G;  2VW9 A;  1UAP A;  4BS9 A;  1H9R A;  3LWE A;  3K6O A;  4DUZ Q;  1NNX A;  3KLS A;  1IKL A;  4DAY B;  3S16 B;  3TEH B;  5JAV A;  4RGT A;  4JI8 L;  1S5E D;  2HHH Q;  4LFA L;  1MJE A;  1OXS C;  3KK7 A;  2A69 D;  4KHZ A;  4C2M B;  2Z6B A;  1KAW A;  1S40 A;  4LF7 Q;  1HZB A;  5IGF A;  4DNI A;  4A3K H;  1E1T A;  3T1Y Q;  2RSN A;  1EY8 A;  2X6G A;  5BR8 L;  1Y1V B;  5GAH C;  4TVA B;  1C0A A;  2EJG C;  2QCP X;  4A3F B;  1EIH A;  1X65 A;  3M3Y H;  2XWB B;  5T1G A;  2BH2 A;  4IOC A;  1TVX A;  4LF5 Q;  1NE3 A;  1SN8 A;  3M4P A;  3CXC A;  2AUJ D;  4GLX A;  4DV7 L;  3U50 C;  2VB2 X;  3GTL B;  3VR6 A;  5IGE A;  4IUP A;  3U4Z A;  3K5L A;  3FHW A;  3S17 B;  4CKB A;  3RZO H;  3CHB D;  1CHQ D;  2L1B A;  4JI1 L;  2NTT A;  4DFA A;  1IZ6 A;  2EPB A;  2F0U A;  2EY2 A;  5D14 A;  3PF4 A;  3DM3 A;  5IGB A;  1LTA D;  2NYZ D;  2EYO A;  3C3L A;  3HOY B;  2UUC L;  1VQH A;  1QNU A;  1Z47 A;  1IBL L;  3H3V I;  4K6D A;  1YIJ A;  1JOQ A;  5M3M H;  4KD3 A;  5LMN W;  3I4L A;  2ZM6 L;  1F9P A;  2MUY A;  3IFD A;  1QVF A;  5JOB A;  3ONA B;  1MD2 D;  1SFO B;  3E0E A;  3M85 A;  4KK7 A;  2EYJ A;  4E6I A;  4DK0 A;  2H4O A;  4FF4 A;  3B6Y A;  4WJ4 A;  2WKD A;  2WIN B;  3SVM A;  1XXG A;  2NVT H;  4XT1 B;  4DF7 A;  2QW7 A;  1QIL A;  3JC6 6;  1D7Q A;  5C4J H;  3F8T A;  1PZJ D;  1SNP A;  2XGT A;  4FDB A;  4P71 A;  2OQK A;  3GTK B;  3CQZ B;  1OTC A;  2F1M A;  2J0T D;  5M5X H;  2ZTE A;  2EXZ A;  1X3Q A;  1ZYR C;  3CRK C;  4J15 A;  1K8A C;  2JA7 H;  4QB4 A;  1CT1 D;  1SYF A;  1JWM D;  1AW7 A;  1IHZ A;  5JJL A;  2K4K A;  5FJ8 H;  1B1Z A;  1TQO A;  1U0L A;  3T4A C;  1GM5 A;  3X3M A;  4ZRZ A;  2KEC A;  1PFN A;  4H02 A;  1SE4 A;  1SNC A;  2HDL A;  1PRT B;  1FNW A;  4OO1 I;  1CM9 A;  1KDA A;  1PH8 A;  2VQF L;  2E2J H;  1LTI D;  1KL9 A;  3NBH A;  1CI3 M;  1NSN S;  1C9O A;  1U4P A;  3K5O A;  2K5V A;  2R7Z H;  1U9R A;  1X54 A;  4B3R L;  2A6H C;  2BDO A;  2CHB D;  4A3E G;  5EBD A;  3GDE A;  2AMC B;  1X32 A;  3GTO H;  3T1H L;  2BE5 D;  5JPM C;  4OIK A;  1JB7 A;  3M4Q A;  3JAM c;  4U67 3;  4LF7 L;  1YNJ C;  4RKL A;  1OXU A;  2PZU A;  4LW1 A;  4EQP A;  1EY4 A;  4A3D B;  3KYH C;  1Y14 B;  3ND9 A;  2IX3 A;  4ZUI A;  5C4Z A;  4P72 A;  4X6A H;  4IFD G;  3FP9 A;  4JBW A;  5C5M A;  1LT5 D;  5C0X I;  2A6H D;  5I9O A;  2HIX A;  1EZ8 A;  1JWS D;  3BYY B;  3FKI G;  5C5L A;  4DK3 C;  1WTX A;  5KYI A;  3MXG A;  3VA7 A;  4N8F A;  4RWS C;  1U4L A;  1HUN A;  1WTO A;  4A3J G;  2B2Y C;  3PMF A;  4XQN A;  2K5H A;  1YJW A;  5CV4 A;  4JBK A;  2B8F A;  3K0X A;  2NVY B;  3O13 A;  2EYP A;  2IX1 A;  2JA5 B;  1SR3 A;  1Y1V G;  4GN4 B;  1SND A;  4DV6 Q;  1BBW A;  4CGY B;  1CKM A;  3OPO A;  4C3H H;  1L1O A;  1HCZ A;  3S1N H;  5CV7 A;  1DYQ A;  1Y8O B;  4BY1 H;  5KNB A;  3S1R H;  3T16 A;  5CBE E;  2JQO A;  1MHW C;  2MGS A;  1K0R A;  1SJE D;  3MWY W;  3PF5 A;  1HA6 A;  1F9R A;  1JQY D;  4JI7 L;  2F0S A;  3OTO L;  1DM0 B;  5ISR A;  3K5M A;  1DJR D;  1FGU A;  4GKK L;  2QF7 A;  3CRL C;  2EYL A;  1H95 A;  2YYZ A;  2R61 A;  4FXG C;  5IIF A;  5JEA H;  1WFQ A;  5M5Y B;  2VNU D;  2JA9 A;  3HOX G;  2O5I C;  2E2H B;  2N49 A;  1VMC A;  1JE4 A;  2F0Q A;  5T1I A;  4X66 L;  5ELC A;  3DWA A;  1JC7 A;  2YU9 B;  1U4M A;  2K5Q A;  2Z1C A;  1K28 A;  5FO7 B;  3NTH A;  3JAM E;  4JI1 Q;  3QB3 A;  1Q81 C;  1N36 L;  3VYU A;  1KRT A;  3RUZ A;  5C4X B;  5K5P A;  1S5F D;  3QG1 A;  3ERQ A;  1QUQ A;  2XRQ D;  2K28 A;  5CV5 A;  5DNF A;  2UUC Q;  4IUT A;  3NUC A;  1FGB D;  1WTW A;  1HH2 P;  1VF5 C;  2I5M X;  2VQF Q;  1WD0 A;  2I07 B;  3LX0 A;  4DR6 Q;  2KHJ A;  2R92 G;  2LY7 A;  3Q8D A;  3OMC A;  1A15 A;  4C1N K;  1STY A;  4B3R Q;  2V1C C;  2IWH A;  3GQB A;  1EYC A;  3NTI A;  5LL6 X;  1WTR A;  3U58 A;  4IJL A;  1XMO L;  2BA1 A;  1N34 Q;  4K8I A;  1EL0 A;  4L5S A;  1N33 L;  1SRO A;  1HJP A;  5IP7 H;  3GTG B;  3C1F A;  2SNS A;  3S2D B;  1EU4 A;  2BE5 C;  3K59 A;  3I91 A;  4HJ9 A;  3D6W A;  1XNR Q;  2F0J A;  3BG3 A;  1KLU D;  4N9T A;  1ZYR D;  3J81 L;  1C8C A;  3A5Z B;  3LGJ A;  4WJ3 M;  4YHH Q;  5LMN L;  5IOD A;  1HNX Q;  5JJZ A;  4G7Z C;  4B3M L;  5EQ0 A;  4X3K A;  3CPW A;  4A93 B;  1K9M C;  4A3M G;  1X3F A;  4QUC A;  4LF6 Q;  1PYB A;  2LXJ A;  3ZYY X;  1D6E C;  1VQC A;  2OTJ A;  3HZX A;  1V8Q A;  4K8J A;  4IOA A;  1O78 A;  4BBR G;  2FXQ A;  1EWC A;  1PLF A;  4DV4 L;  1PH4 A;  4BY1 G;  2XTI A;  4A3G H;  2VB3 X;  1HNW Q;  1II3 A;  2NVX B;  4ZLT F;  5BN5 A;  4PG3 A;  2J4X A;  3MXN B;  2NVQ H;  2EE1 A;  1GHJ A;  3A74 A;  4NB3 A;  2F4V Q; 
#chains in the Genus database with same CATH homology
 4DR2 Q;  1YHA A;  1I3Q H;  2JJQ A;  4JI2 Q;  3I2Z A;  3GTL H;  2UXD Q;  2EQS A;  4YCU A;  4JI0 Q;  3AYH B;  1T9H A;  4QL5 A;  5IYC H;  1L0W A;  3STB D;  4JI0 L;  1SRU A;  1EIF A;  4UPA A;  4BBR H;  3UDG A;  1BKB A;  3UDF A;  4YY3 L;  4JV5 Q;  1TWC H;  1X56 A;  2F3I A;  1EUJ A;  1IBM Q;  2UUA L;  1OXX K;  4C3J H;  3OTO Q;  1Q86 C;  1VQ6 A;  2AWN A;  3A5U A;  1NJI C;  3M7N A;  1I6H H;  3UE1 A;  2ZJR A;  4HIO A;  1VS0 A;  3K81 C;  2E8G A;  2JA6 G;  4LUV A;  1E3P A;  2D0P A;  1X9N A;  3OYY A;  2R93 G;  4AYB G;  4A93 G;  5IYB G;  2AWO A;  3BJU A;  5DLQ E;  3W5O A;  4POF A;  4LF8 Q;  3ICE A;  3HOV G;  2Q2H A;  3CCV A;  2HT1 A;  2BA0 A;  3ERS X;  4AIM A;  2A8V A;  4EQ5 A;  1M1K C;  4PZ6 A;  5GAG C;  1GKH A;  2F52 A;  4BXX H;  3AEV A;  5FLM H;  3ER0 A;  1FL0 A;  4OWX B;  3CCU A;  4KHP Q;  2JEA I;  3J81 c;  1R9T H;  3MEF A;  4QY7 A;  3ULJ A;  2RCN A;  3PUV A;  1WCM G;  1UE1 A;  4JCV E;  1VQ5 A;  5IP9 G;  1Y1W G;  1P8L A;  1IXR A;  1WYD A;  2L15 A;  3CCL A;  3CD6 A;  1EYG A;  4DAM A;  1PV4 A;  4UP9 A;  4KLK A;  1X55 A;  4A76 A;  2UUB Q;  3H0G G;  2PMZ E;  4GLA C;  3CME A;  1PH1 A;  4QQB X;  4JI5 L;  3WWV A;  2UUB L;  4POG A;  2JA6 H;  1G6P A;  1Y1W H;  4JI5 Q;  3HKZ G;  4X65 Q;  1EWI A;  4HJA A;  2Q2U A;  2D0O A;  3S17 H;  1N33 Q;  3J80 i;  1VQO A;  1KHI A;  3KF8 B;  3L2P A;  4DUY L;  3HOW G;  1V1Q A;  5IY0 A;  1VQK A;  3HOX H;  2VL6 A;  2WAQ G;  4P75 A;  4LFC L;  1PH5 A;  3RZD H;  3AQQ A;  1UWV A;  1YNX A;  2EIF A;  4DV2 Q;  1XJV A;  3HFZ B;  3VDY A;  1YJ9 A;  2VQE Q;  3I4M G;  2IHE A;  1YZ6 A;  1XMO Q;  2HIV A;  3HOU H;  4A3L G;  4BBS G;  2UXC L;  3TQY A;  1N34 L;  2CKZ B;  4C2M H;  1SE8 A;  2Z6K A;  2N8N A;  4DPG A;  3CMA A;  1I5F A;  4IPH A;  4O2D A;  4A3K G;  1K83 H;  4DR3 L;  4GKK Q;  3KF6 B;  1YBY A;  4HIM A;  4DR4 L;  1ASY A;  2NVY H;  2RHQ B;  1PH7 A;  3TRE A;  3CCM A;  5C4X G;  2UU9 Q;  4LF9 L;  1HZ9 A;  3H0G H;  2VZA A;  4KI0 A;  3UE0 A;  5IP9 H;  4GS3 A;  4LF9 Q;  2OQ0 A;  3AFP A;  2GVB A;  2PI2 E;  3CW2 C;  3RLF A;  3RN5 A;  2Y0S G;  3H15 A;  1TWF H;  3K7U C;  1OXV A;  3CCQ A;  4IJH A;  4JI6 L;  1E22 A;  4HJ8 A;  4JI6 Q;  1NBW A;  2R7Z G;  4B3T Q;  5E7N A;  3I4M H;  4YHH L;  5LMN Q;  4JI4 Q;  1VQM A;  2E2I H;  4B3M Q;  2NN6 G;  1A62 A;  3HKS A;  2VW9 A;  5K36 G;  1YIT A;  1WI5 A;  3G48 A;  3PGZ A;  3E9H A;  4DUZ Q;  3HOV H;  1A0I A;  1HZA A;  4L5R C;  3F2B A;  1I94 Q;  4DUZ L;  1VQ7 A;  4LF6 L;  1VQJ A;  5M5W H;  2E5L L;  4DAY B;  1PYS B;  1IYJ B;  1UE7 A;  4JI8 Q;  4A3J H;  2E5L Q;  4B3S Q;  3TEH B;  2UXD L;  1CSQ A;  4JI8 L;  3HOZ G;  2HHH Q;  5LMU L;  1MJE A;  1OXS C;  4LFA L;  5C44 G;  4R4I A;  3PUY A;  4RG1 A;  4KHZ A;  1JE5 A;  3SGI A;  1XNQ Q;  4JV5 L;  1GO3 E;  3G71 A;  5IYC G;  4GNX A;  1HR0 W;  2UUA Q;  4A3C G;  1I50 H;  1A63 A;  1YEZ A;  2K75 A;  3GO5 A;  1KAW A;  3KDF A;  1S40 A;  4LF7 Q;  1HZB A;  4DNI A;  3KDF B;  4A3K H;  2JK8 A;  1E1T A;  2VUM G;  3CCS A;  2IHF A;  4DV1 Q;  4UP8 A;  3T1Y Q;  1CKN A;  1RL2 A;  3T1Y L;  5BR8 L;  5GAH C;  2N3S A;  1MKH A;  4TVA B;  1C0A A;  5M3M G;  4DV3 L;  2D62 A;  1V43 A;  1X65 A;  4AYB E;  3DLL A;  1NMG A;  3CCE A;  4DV3 Q;  3M3Y H;  1RIP A;  4JI3 Q;  4IFD J;  5FLM G;  5M5Y H;  2CFM A;  2LSS A;  3TS0 A;  2F4V L;  5GRO A;  5EAY A;  2BH2 A;  4IOC A;  4A3I G;  3GTJ H;  3PO3 G;  4LF5 Q;  1NE3 A;  2IY5 B;  1SN8 A;  3M4P A;  3CXC A;  4LF5 L;  3S15 H;  2CWP A;  4GLX A;  4DV7 L;  4IPD A;  3U50 C;  2AKW B;  5IYB H;  5H1S E;  1J5E Q;  4BA2 I;  4JOI A;  5C44 H;  3RLO A;  1IBK Q;  3S14 H;  1DGS A;  3U4Z A;  1VQ4 A;  3PV0 A;  3FHW A;  3OW2 A;  2H5X A;  3RZO H;  5GQO A;  5GAE C;  4JI1 L;  3KOJ A;  4MNO A;  1IZ6 A;  4LUZ A;  3PF4 A;  4GOP C;  3DM3 A;  4ME3 A;  1PFS A;  1SLJ A;  5IWA L;  1TWG H;  4DR1 L;  1GVP A;  4DR1 Q;  1XTD A;  4DV0 Q;  3L0O A;  2UUC L;  1VQH A;  3I4N G;  1Z47 A;  2Y0S E;  1IBL L;  4OX9 Q;  3H3V I;  1JJC B;  3PO2 G;  3I55 A;  1YIJ A;  5M3M H;  1VQE A;  1KRS A;  4GN5 A;  2E2J H;  4YCV A;  1KXL A;  3CPF A;  5LMN W;  3CQZ H;  4IPC A;  2ZM6 L;  4LF4 L;  1CKN B;  1QVF A;  1NY4 A;  4YWK A;  2R6G A;  5C3E H;  4A3F H;  2N78 A;  2K50 A;  2K5N A;  3E0E A;  1Q8K A;  1KQS A;  4QGU A;  2YTY A;  4A3C H;  2VUM H;  3M85 A;  1LM0 A;  1UEB A;  4A93 H;  3I7F A;  3RLN A;  1VQB A;  4TQU S;  3H3V H;  2CCZ A;  2UXC Q;  3B6Y A;  1QUQ B;  2R93 H;  1G51 A;  4WJ4 A;  3U4V A;  4DV4 Q;  2OTL A;  4LFB Q;  1UE6 A;  4X65 L;  2ES2 A;  1CKO A;  5AJ3 L;  1VQN A;  1BVS A;  3D31 A;  5AJ3 Q;  4DR4 Q;  1EIY B;  1HNW L;  2WAQ E;  3ULL A;  4DV6 L;  2PQA A;  1HR0 Q;  2NVT H;  1YHQ A;  2EXD A;  1XPR A;  2A1A A;  1QVC A;  3JC6 6;  4A3D H;  4UP7 A;  5C4J H;  1D7Q A;  2Q2I A;  4Y7N H;  3F8T A;  3PUZ A;  5JEA J;  3J80 c;  1EQQ A;  2XGT A;  1X6O A;  3F2D A;  4FDB A;  4P71 A;  2OQK A;  2B63 H;  4R4Q A;  3UDI A;  2ZTD A;  1BBU A;  4EX5 A;  2ASB A;  1CSP A;  4DR7 Q;  4K0K L;  1M90 C;  1OTC A;  1UE5 A;  2OCE A;  4R4C A;  5GAD C;  5M5X H;  1E1O A;  2ZTE A;  3L7Z C;  4PZ7 A;  1Q7Y C;  2JA5 G;  1K73 C;  2VS1 A;  3GTK H;  5JJK A;  4J15 A;  5IYD G;  1K8A C;  5C0X G;  2JA7 H;  3S2H H;  1Z9F A;  4L5Q A;  4L5T A;  2K52 A;  4Y52 H;  2A19 A;  5ELN A;  3J81 i;  4HJ5 A;  2UXB Q;  3F2C A;  5FJ8 G;  2ZJP A;  2UXB L;  2RF4 A;  1B7Y B;  5JJL A;  2LXK A;  4MTN A;  2K4K A;  5FJ8 H;  5IYD H;  1S3O A;  4LFA Q;  2HHH L;  1WJJ A;  4BA1 I;  4BY7 H;  4OO1 G;  1U0L A;  2IX0 A;  2I0Q A;  1GM5 A;  1X3E A;  2DUD A;  5M3F G;  1XNQ L;  2MFI A;  3KJO A;  2R7F A;  2ZTC A;  4H02 A;  2YTX A;  1FJG L;  4A3M H;  3STB C;  1AE3 A;  2WFW A;  4DR5 Q;  1Q46 A;  1FJG Q;  4X66 Q;  4IO9 A;  3PCO B;  2WB1 E;  4OO1 I;  1K3R A;  4X64 L;  3CC7 A;  3AFQ A;  2VQF L;  2C35 B;  1PH8 A;  1PH9 A;  1KL9 A;  1JMC A;  1VQ9 A;  4QJF A;  4JBM A;  2B63 G;  4GKJ Q;  1KD1 C;  1C9O A;  3CCR A;  5IE8 A;  4OWT B;  3HOW H;  2KBN A;  1E24 A;  2K5V A;  2B3G A;  4MZ9 A;  1W2B A;  2R7Z H;  4B3R L;  1X54 A;  1TWA H;  1XPO A;  3TS2 A;  4PZ8 A;  4R4O A;  4A3E G;  3HOY G;  3GDE A;  3T1H Q;  2AMC B;  5FLX c;  3S2D H;  3GTO H;  3T1H L;  4DV7 Q;  2JA8 G;  1P16 A;  4YY3 Q;  1VQ8 A;  1JB7 A;  5IP7 G;  2JE6 I;  3M4Q A;  3JAM c;  1WOC A;  4DUY Q;  1JJ2 A;  1HNZ L;  4LF7 L;  1AE2 A;  2VY3 A;  1PH3 A;  4JBJ A;  4DV1 L;  2OWO A;  1OXU A;  2KHI A;  4LW1 A;  2JA5 H;  1VQF A;  2HQL A;  1VQL A;  2JEB I;  3NBH B;  4DR6 L;  1J6Q A;  1LUZ A;  3KYH C;  1Y14 B;  3CC4 A;  3S1M H;  1CUK A;  5C3E G;  1VQA A;  4X6A H;  4P72 A;  4JI3 L;  4DV2 L;  4IFD G;  1B8A A;  2RHS B;  2PNH A;  3FP9 A;  4JBW A;  3J7A 5;  5C0X I;  4DV0 L;  4A3G G;  1QVG A;  2HIX A;  1XPU A;  1Y1V H;  1IBL Q;  4NPS A;  4R1J A;  3FKI G;  4GOP B;  5HGQ A;  4DK3 C;  4NXN Q;  2I5L X;  1C7Y A;  2GVA A;  1NMF A;  4IFD I;  2ZM6 Q;  4RMF A;  5IT9 c;  3CF5 A;  1W3S A;  3M4O H;  4JI2 L;  1SMX A;  3K80 C;  1MIU A;  4LWC A;  4DK6 C;  4X62 L;  1VQI A;  4A3J G;  2KCT A;  3PIP A;  1V9P A;  2K5H A;  1YJW A;  3M9B A;  4JBK A;  4O0A A;  4YWL A;  3K0X A;  2NVX H;  4OWW B;  2IX1 A;  1SR3 A;  3PSI A;  2QGQ A;  1Y1V G;  1LTL A;  1NTG A;  4HIK A;  3E9I A;  2JA7 G;  2B29 A;  4GN4 B;  2R7D A;  1HNX L;  4DV6 Q;  1BBW A;  5HY6 A;  4QIW E;  1CKM A;  2Q2T A;  4LF4 Q;  3I4N H;  1ASZ A;  3PO2 H;  4NXM Q;  5ELO A;  4C3H H;  1L1O A;  3S1N H;  4NXM L;  2K14 A;  3J81 j;  4BY1 H;  2NN6 I;  4A3B H;  3S1R H;  1N32 Q;  1PA6 A;  1QZH A;  2NZH A;  1N32 L;  2JQO A;  5LMU Q;  3RR5 A;  4K0K Q;  5JEA G;  1TWH H;  5C4X H;  1K0R A;  3PF5 A;  4A3D G;  2JA8 H;  4APV A;  4JI7 L;  3IRB A;  2AHO B;  3K8A A;  4A3E H;  3KJP A;  1O7I A;  1D8L A;  3OTO L;  1IBM L;  1XMQ Q;  3CP0 A;  4XIG S;  1FGU A;  2NZO A;  4HJ7 A;  3KFU A;  4GKK L;  1HR0 L;  4YWM A;  4OXP A;  1K8G A;  3FKI H;  1H95 A;  2YYZ A;  3PIO A;  1L1O B;  1B70 B;  1YHB A;  1AH9 A;  1WFQ A;  2WB1 G;  4LF8 L;  2WP8 J;  1EFW A;  2VNU D;  4DR3 Q;  4GLV B;  2JA9 A;  3HOX G;  4DR2 L;  4XTC S;  4A75 A;  2N49 A;  4A3F G;  2MQH A;  1MJC A;  3NEM A;  4X66 L;  1A8V A;  3BZC A;  4X64 Q;  4KHP L;  1IBK L;  3TRZ A;  4IPG A;  3S24 A;  1Q12 A;  2BH8 A;  3BU2 A;  1Q82 C;  1E7Z A;  1N36 Q;  4JI1 Q;  1L1O C;  3ULP A;  4BY7 G;  1Q81 C;  3ZJY C;  1N36 L;  1KRT A;  3S16 H;  1IL2 A;  1VCI A;  3PUX A;  3GTQ H;  3J7Z C;  2KCM A;  3RN2 A;  2MNA A;  1QUQ A;  2QEX A;  4DV5 L;  4HID A;  1QZG A;  4A3L H;  3RNU A;  2UUC Q;  4DV5 Q;  3HOY H;  4OX9 L;  5J3B A;  1S72 A;  1TXY A;  1G29 1;  3W1B A;  1HNZ Q;  1HH2 P;  4DR5 L;  3CC2 A;  3KF6 A;  2PI2 A;  2I5M X;  2CQO A;  2VQF Q;  3JAM i;  3GD7 A;  3GTM H;  4DR6 Q;  2KHJ A;  4AH6 A;  3K7A H;  5BR8 Q;  2R92 G;  2KEN A;  3Q8D A;  4A4I A;  4LUO A;  1N9W A;  1EOV A;  1YI2 A;  3I56 A;  4B3R Q;  4UY8 C;  2V1C C;  1HZC A;  1L2F A;  4JC0 A;  1VQG A;  1KC8 C;  3U58 A;  4IJL A;  1XMO L;  2BA1 A;  5M3F H;  4LFB L;  1N34 Q;  4NXN L;  3PUW A;  4GNX C;  3KLW A;  4L5S A;  1N33 L;  4JYA L;  1SRO A;  1HJP A;  2QA4 A;  1J5E L;  4JG2 A;  4JYA Q;  5IP7 H;  4PMW A;  2UU9 L;  4C3I H;  1VQP A;  4X62 Q;  4HJ9 A;  4BBS H;  3D0F A;  2YTV A;  3PO3 H;  2MO0 A;  4YCW A;  1PH2 A;  1XNR Q;  3S1Q H;  1X3G A;  3EBE A;  4LFC Q;  1XNR L;  4AQY L;  1GD7 A;  4AQY Q;  5IWA Q;  3HOU G;  1JJG A;  4DR7 L;  2E2H H;  3A5Z B;  1PHJ A;  3EN2 A;  3LGJ A;  1LYL A;  1KIX A;  2VQE L;  4B3T L;  4GNX B;  4GKJ L;  4WJ3 M;  4P74 A;  4YHH Q;  5LMN L;  4JI4 L;  1Q1E A;  2ATW A;  1HNX Q;  1JT8 A;  4B3M L;  2R92 H;  2MO1 A;  1SFO H;  3A0J A;  3G4S A;  2YU9 H;  4P73 A;  3CPW A;  3F1Z A;  1YJN A;  1K9M C;  1PH6 A;  3GTP H;  2I5H A;  2IT1 A;  1X3F A;  4A3M G;  1EQR A;  2PQA B;  1U5K A;  3NEN A;  1I94 L;  4LF6 Q;  2Z0S A;  1PYB A;  2CWA A;  2LXJ A;  4B3S L;  1FVI A;  1VQC A;  4DKA C;  3HOZ H;  3NEL A;  2OTJ A;  4OON A;  3GTG H;  4IOA A;  4BBR G;  2FXQ A;  2ID0 A;  1VQD A;  3UDX A;  3CCJ A;  3BZK A;  4LNQ A;  3CAM A;  4DV4 L;  4JI7 Q;  2Z6K C;  1Q1B A;  1WCM H;  3I4O A;  5C0X J;  4BY1 G;  1PH4 A;  4A3B G;  2XTI A;  1YVC A;  4R4T A;  1XMQ L;  4GOP A;  4GN3 B;  3HKZ E;  2YV5 A;  4A3G H;  1HNW Q;  2ZJQ A;  5JJI A;  2GN5 A;  4PG3 A;  4BXX G;  3W1G A;  1PVO A;  2DGY A;  4A3I H;  3G6E A;  1OXT A;  2ALY B;  3EIV A;  3MXN B;  2NVQ H;  1N8R C;  4JOI C;  3A74 A;  4NB3 A;  4ALP A;  2F4V Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...