5C4CA

Crystal structure of abbb + udp-glc + di
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
289
structure length
282
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYSMRRMEMISFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 282
sequence length 289
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c4cA00
2AM4A 5C4BA 1TZFA 1H5RB 3CGXA 4HO2A 4DE7A 4CJ8A 2QH5A 1NWGB 2O1GA 5FV9A 1LZIA 5L6VA 2E8BA 1QWJA 4Y64A 1ZI3A 2RJ5A 4Y7FA 1G2VA 4Y63A 1I52A 5AJOA 2VS4A 2ICXA 3T7OA 3ZLLA 1ZCYA 5BXCA 1TW1A 3I0JA 5C4CA 2E3DA 2NXVA 1G97A 1ZDGA 4B4GA 4HO9A 1VGTA 2FYCB 4NANA 2WVMA 2AESA 1R80A 2RJ8A 3K8EA 4B2WA 4AC3A 3CKOA 1H5SB 1H4CA 1W57A 3POLA 1S4NA 2VS5A 4D11A 3I0DA 4KC4A 2D7RA 3CKQA 2WVKA 4Y7TA 4EE3A 1G0RA 1G23A 4FRQA 2RIYA 2RJ1A 3V0NA 1VH1A 5C1LA 3T7MA 2W0VA 5IDSA 2AM3A 1YP4A 5AJNA 4FRPA 4ASJA 3U2XA 5AJPA 1PZYB 5FTSA 3USRA 3HL3A 1VGWA 1H5TB 1ZDFA 4G87A 4JISA 1G8OA 1ZJ1A 5IDTA 1H4EA 1R7VA 1ZCUA 4KNXA 2PX7A 1ZJPA 1FGXA 2YQHA 1O23B 3V8ZA 3FWWA 2QKXA 3K8DA 4XWIA 1NQIB 4FRLA 3Q80A 1R7YA 2ZU8A 5FUHA 1ZJ2A 4EEGA 1JVGA 1H5RA 1JVDA 1EZIA 3E26A 1WT3A 5CQNX 4J18A 2ICYA 4M28A 2A8UA 2X5ZA 1KWSA 4FRDA 3I0CA 2OEFA 1JYKA 4M2BA 5C8RA 5CQLX 4R7PA 3T7NA 3GUEA 2Q4JA 1ZI4A 5DDVA 1VGUA 1WT2A 3PKPA 4FCUA 4KC2A 1FOAA 5C36A 1WT1A 4Y7GA 2XWMA 3I0KA 2V0JA 2AM5A 2D0JA 1G95A 2RITA 3U2TA 4HO5A 2O1FA 4HO4A 5CQOA 1JV3A 2VXMA 3E25A 2OI6A 1VGZA 3OKRA 4GBPA 1H5SA 5FTVA 4KC1A 2V0HA 2PGYA 3V0PA 2V0LA 2RIZA 4Y7UA 5CMGX 4UEGA 5C47A 2WVLA 4KNRA 1ZI1A 1YROB 4HO8A 1K4VA 1TW5A 1H5SD 1ON8A 2Z87A 1H5TA 5CMFX 1FG5N 1H7LA 1LVWA 3ZGFA 3I0IX 1VPAA 5C4EA 3U0XA 5JQQA 1TVYA 3PKQA 2V0KA 1OMXA 1INIA 3V8YA 1EYRA 3N9WA 5C3AA 1FWYA 4DDZA 1H7TA 1HJLA 4BMAA 1S4PA 2PA4A 1LZJA 2APCA 4HOCA 1SS9A 1FZWA 2I5EA 2RJ6A 2BO7A 1V83A 1ZI5A 3IOJA 2Y7AA 1H7GA 2FFVA 2WE9A 1ZHJA 3SX8A 1ZJOA 2FYDB 4NAKA 3SXGA 2BO4A 2P72A 3D98A 2XMEA 4EEAA 3TQDA 2BO8A 2Y4JA 2RJ7A 3DUVA 1G9RA 1GQCA 3Q7UA 4HO0A 3BCVA 4M4KA 1IINA 2YC5A 3OGZA 4K6RA 1W77A 5L6SA 3V0MA 3RSBA 1GWWA 3F1YA 2YQCA 1MP5A 2GGOA 3V0LA 1LL0A 2O1HA 1VM8A 4IRPA 1MC3A 2MZBA 2PGVA 4NALA 5C49A 4ZDQA 2I5KA 1JYLA 5IFYA 1ZJ0A 4KXOA 2RJ4A 1R81A 2Y4LA 2FYBA 4G3PA 4FRHA 4B2XA 1XHBA 1VH3A 1VZXA 1HV9A 4CVHA 1GX4A 4EEMA 1YP2A 4MYBA 4ASYA 1R82A 2YCMA 4HO6A 2Y4KA 4FRAA 3D5NA 5EJZA 4AYLA 4EEOA 3R2WA 2V0IA 3R3IA 1H7HA 2AECA 3I0LA 3LW6A 3SXCA 1ON6A 3FOQA 2I7BA 1ZCTA 4FREA 4Y62A 2YC3A 3D8VA 5CMJA 2UX8A 1E5KA 3RMVA 1NF5B 1QGSA 4KT7A 1V82A 3I0EA 2RJ0A 3U0YA 2XMHA 4Y7VA 1W55A 4CJCA 2FY7A 1H4DA 4B42A 2JCKA 3OC9A 3V0OA 3V0QA 3I0HA 1O7OA 3CKVA 1GWVA 1H3MA 1FXOA 1WSZA 4DECA 1INJA 1QG8A 1R7UA 3Q4SA 4HCQA 3ZLKA 3U2WA 1V84A 2P6WA 3ST8A 2Z86A 3DJ4A 1HM0A 2VS3A 4FROA 2CU2A 1LZ0A 4L41C 4KRVA 1ZIZA 3I0FA 3ZF8A 1ZJ3A 3TZTA 4B4BA 4M2AA 1R7TA 1LL3A 3I0GA 4FCEA 3SXEA 3BRKX 2BO6A 3V91A 3USQA 2JCLA 2YESA 4C2SA 4BQHA 5CMHA 4KPZA 4JD0A 2FFUA 4D11C 4CJBA 5I1FA 4Y6UA 1IIMA 1NHEB 3OAMA 4LW6A 3DK5A 4P02A 1HJJA 4B4MA 1YP3A 2FYAA 3OH3A 4D48A 4P00A 2XWNA 3SXDA 1FRWA 4LW3A 3SXAA 2AH9A 1S4OA 1VICA 4G3QA 4HG6A 1FXJA 4EVWA 1FO8A 2Y4MA 1FR8A 2D7IA 2WGZA 3OH4A 4ECMA 2X5SA 3IOHA 2WAWA 2ZU9A 1G3LA 2Y6PA 1Z90A 3SXBA 1MP4A 3NGWA 4KQLA 3IOIA 4KPXA 5C4DA 1OQMB 4MNDA 4AAWA 1O7QA 4FRBA 2A8WA 5HS2A 1FGGA 2JCJA 4B3UA 3KIAA 2WEEA 1H7FA 1G93A 5C3BA 2P73A 1HM9A 1WT0A 5EJ1A 5J49A 2OI7A 4D0ZA 1FO9A 3RMWA 2GGQA 4EE4A 1JV1A 1ZCVA 1VZUA 3JTJA 1GQ9A 1MP3A 2VSIA 4Y6NA 4HO3A 1O0RA 3SX5A 2X60A 1LL2A 3CKJA 2W0WA 4G3SA 1VZTA 5C1HA 1H5SC 5C3DA 5C38A 1H7QA 1GA8A 4IRQA 5FYEA 4FQWA 3V90A 3SX7A 5FU8A 3PNNA 3EE5A 3SPTA 1H7EA 4ARWA 4B5BA 5C48A 1HM8A 1NKHB 2JCOA 4FRMA 1PZTA 1LZ7A 2AE7A 1GX0A 3JUJA 2VSHA 2YQJA 2VFZA 2QGIA 3U2VA 3O3PA 4NAIA 2OEGA 3OH2A 4AYJA 4EE5A 1OMZA 1FR9A 2ZU7A 5C4FA 4YS8A 5FU0A 2RIXA 5CQMX 3CU0A 3JUKA 5EIYA 3SX3A 5CMIA 4Y9XA 5DDTA 3CKNA 1R7XA 3OH1A 2VXLA 3OH0A 1NMMB 3F1CA 1QGQA 3U2UA 5C1GA 5CQPA 3ZGGA 3QVBA 1XZ6A 1G1LA 2AGDA 2X65A 4D0TA 2YQSA 2RJ9A 4E1KA 2DPWA 1WVCA 2XWLA 2VD4A 2OI5A
chains in the Genus database with same CATH superfamily
2AM4A 5C4BA 1TZFA 1H5RB 3CGXA 4HO2A 4DE7A 4CJ8A 2QH5A 1NWGB 2O1GA 5FV9A 1LZIA 5L6VA 2E8BA 1QWJA 4Y64A 1ZI3A 2RJ5A 4O6NA 4Y7FA 1G2VA 4Y63A 1I52A 5AJOA 2VS4A 2ICXA 3T7OA 3ZLLA 1ZCYA 5BXCA 1TW1A 3I0JA 5C4CA 2E3DA 2NXVA 1G97A 1ZDGA 4B4GA 4HO9A 1VGTA 2FYCB 4NANA 2WVMA 2AESA 1R80A 2RJ8A 3K8EA 4B2WA 4AC3A 3CKOA 1H5SB 1H4CA 1W57A 3POLA 1S4NA 2VS5A 4D11A 3I0DA 4KC4A 2D7RA 3CKQA 2WVKA 4Y7TA 4EE3A 1G0RA 1G23A 4FRQA 2RIYA 2RJ1A 3V0NA 1VH1A 5C1LA 3T7MA 2W0VA 5IDSA 2AM3A 1YP4A 5AJNA 4FRPA 4ASJA 3U2XA 5AJPA 1PZYB 5FTSA 3USRA 3HL3A 1VGWA 1H5TB 1ZDFA 4G87A 4JISA 1G8OA 1ZJ1A 5IDTA 1H4EA 1R7VA 1ZCUA 4KNXA 2PX7A 1ZJPA 1FGXA 2YQHA 1O23B 3V8ZA 3FWWA 2QKXA 3K8DA 4XWIA 1NQIB 4FRLA 3Q80A 1R7YA 2ZU8A 5FUHA 1ZJ2A 4EEGA 1JVGA 1H5RA 1JVDA 1EZIA 3E26A 1WT3A 5CQNX 4J18A 2ICYA 4M28A 2A8UA 2X5ZA 1KWSA 4FRDA 3I0CA 2OEFA 1JYKA 4M2BA 5C8RA 5CQLX 4R7PA 3T7NA 3GUEA 2Q4JA 1ZI4A 5DDVA 1VGUA 1WT2A 3PKPA 4FCUA 4KC2A 1FOAA 5C36A 1WT1A 4Y7GA 2XWMA 3I0KA 2V0JA 2AM5A 2D0JA 1G95A 2RITA 3U2TA 4HO5A 2O1FA 4HO4A 5CQOA 1JV3A 2VXMA 3E25A 2OI6A 1VGZA 3OKRA 4GBPA 1H5SA 5FTVA 4KC1A 2V0HA 2PGYA 3V0PA 2V0LA 2RIZA 4Y7UA 2C0NA 5CMGX 4UEGA 5C47A 2WVLA 4KNRA 1ZI1A 1YROB 4HO8A 5D91A 2VK9A 1K4VA 1TW5A 1H5SD 1ON8A 2Z87A 1H5TA 5CMFX 1FG5N 1H7LA 1LVWA 3ZGFA 3I0IX 1VPAA 5C4EA 3U0XA 5JQQA 2J0AA 1TVYA 3PKQA 2V0KA 1OMXA 1INIA 3V8YA 1EYRA 3N9WA 5C3AA 1FWYA 4DDZA 1H7TA 1HJLA 4BMAA 1S4PA 2PA4A 1LZJA 2APCA 4HOCA 1SS9A 1FZWA 2I5EA 2RJ6A 2BO7A 1V83A 1ZI5A 3IOJA 2Y7AA 1H7GA 4MIXA 2FFVA 2WE9A 1ZHJA 3SX8A 1ZJOA 2FYDB 5D92A 4NAKA 3SXGA 2BO4A 2P72A 2XMEA 3D98A 4EEAA 3TQDA 4FIYA 2BO8A 2Y4JA 2RJ7A 3DUVA 1G9RA 1GQCA 3Q7UA 4HO0A 3BCVA 4M4KA 1IINA 2YC5A 3OGZA 4K6RA 1W77A 5L6SA 3V0MA 3RSBA 1GWWA 3F1YA 2YQCA 1MP5A 2GGOA 3V0LA 1LL0A 2O1HA 1VM8A 4IRPA 1MC3A 2MZBA 2PGVA 4NALA 5C49A 4ZDQA 2I5KA 1JYLA 5IFYA 1ZJ0A 4KXOA 2RJ4A 1R81A 2Y4LA 2FYBA 4G3PA 4FRHA 4B2XA 1XHBA 1VH3A 1VZXA 1HV9A 4CVHA 1GX4A 4EEMA 1YP2A 4MYBA 4ASYA 1R82A 2YCMA 4HO6A 2Y4KA 4FRAA 3D5NA 5EJZA 4AYLA 4EEOA 3R2WA 2V0IA 3R3IA 1H7HA 2AECA 3I0LA 3LW6A 3SXCA 1ON6A 3FOQA 2I7BA 1ZCTA 4FREA 4FIXA 4Y62A 2YC3A 3D8VA 5CMJA 2UX8A 1E5KA 3RMVA 1NF5B 1QGSA 4KT7A 1V82A 3I0EA 2RJ0A 3U0YA 2XMHA 4Y7VA 1W55A 4CJCA 2FY7A 1H4DA 4B42A 2JCKA 3OC9A 3V0OA 3V0QA 3I0HA 1O7OA 3CKVA 1GWVA 1H3MA 1FXOA 1WSZA 4DECA 1INJA 1QG8A 1R7UA 3Q4SA 4HCQA 3ZLKA 3U2WA 1V84A 2P6WA 3ST8A 2Z86A 3DJ4A 1HM0A 2VS3A 4FROA 2CU2A 1LZ0A 4L41C 4KRVA 1ZIZA 3I0FA 3ZF8A 1ZJ3A 3TZTA 4B4BA 4M2AA 1R7TA 1LL3A 3I0GA 4FCEA 3SXEA 3BRKX 2BO6A 3V91A 3USQA 2JCLA 2YESA 4C2SA 4BQHA 5CMHA 4KPZA 4JD0A 2FFUA 4D11C 4CJBA 5I1FA 4Y6UA 1IIMA 1NHEB 3OAMA 4LW6A 3DK5A 4P02A 1HJJA 4B4MA 1YP3A 2FYAA 3OH3A 4D48A 4P00A 2XWNA 3SXDA 1FRWA 4LW3A 3SXAA 2AH9A 1S4OA 1VICA 4G3QA 4HG6A 1FXJA 4EVWA 1FO8A 2Y4MA 1FR8A 2D7IA 2WGZA 3OH4A 4ECMA 2X5SA 3IOHA 2WAWA 2ZU9A 1G3LA 2Y6PA 2J0BA 1Z90A 3SXBA 1MP4A 3NGWA 4KQLA 3IOIA 4KPXA 5C4DA 1OQMB 4MNDA 4AAWA 1O7QA 4FRBA 2A8WA 5HS2A 1FGGA 2JCJA 4B3UA 3KIAA 2WEEA 1H7FA 1G93A 5C3BA 2P73A 1HM9A 1WT0A 5EJ1A 5J49A 2OI7A 4D0ZA 1FO9A 3RMWA 2GGQA 4EE4A 1JV1A 1ZCVA 1VZUA 3JTJA 1GQ9A 1MP3A 2VSIA 4Y6NA 4HO3A 1O0RA 3SX5A 2X60A 1LL2A 3CKJA 2W0WA 4G3SA 1VZTA 5C1HA 1H5SC 5C3DA 5C38A 1H7QA 1GA8A 4IRQA 5FYEA 4FQWA 3V90A 3SX7A 5FU8A 3PNNA 3EE5A 3SPTA 1H7EA 4ARWA 4B5BA 5C48A 1HM8A 1NKHB 2JCOA 4FRMA 1PZTA 1LZ7A 2AE7A 1GX0A 3JUJA 2VSHA 2YQJA 2VFZA 2QGIA 3U2VA 3O3PA 4NAIA 4O6MA 2OEGA 3OH2A 4AYJA 4EE5A 1OMZA 1FR9A 2ZU7A 5C4FA 4Q7CA 4YS8A 5FU0A 2RIXA 5CQMX 3CU0A 3JUKA 5EIYA 3SX3A 5CMIA 4Y9XA 5DDTA 3CKNA 1R7XA 3OH1A 2VXLA 3OH0A 1NMMB 3F1CA 1QGQA 3U2UA 5C1GA 5CQPA 3ZGGA 3QVBA 1XZ6A 1G1LA 2AGDA 2X65A 4D0TA 2YQSA 2RJ9A 4E1KA 2DPWA 1WVCA 2XWLA 2VD4A 2OI5A
chains in the Genus database with same CATH topology
2AM4A 5C4BA 1TZFA 1H5RB 3CGXA 4HO2A 4DE7A 4CJ8A 2QH5A 1NWGB 2O1GA 5FV9A 1LZIA 5L6VA 2E8BA 1QWJA 4Y64A 1ZI3A 2RJ5A 4O6NA 4Y7FA 1G2VA 4Y63A 1I52A 5AJOA 2VS4A 2ICXA 3T7OA 3ZLLA 1ZCYA 5BXCA 1TW1A 3I0JA 5C4CA 2E3DA 2NXVA 1G97A 1ZDGA 4B4GA 4HO9A 1VGTA 2FYCB 4NANA 2WVMA 2AESA 1R80A 2RJ8A 3K8EA 4B2WA 4AC3A 3CKOA 1H5SB 1H4CA 1W57A 3POLA 1S4NA 2VS5A 4D11A 3I0DA 4KC4A 2D7RA 3CKQA 2WVKA 4Y7TA 4EE3A 1G0RA 1G23A 4FRQA 2RIYA 2RJ1A 3V0NA 1VH1A 5C1LA 3T7MA 2W0VA 5IDSA 2AM3A 1YP4A 5AJNA 4FRPA 4ASJA 3U2XA 5AJPA 1PZYB 5FTSA 3USRA 3HL3A 1VGWA 1H5TB 1ZDFA 4G87A 4JISA 1G8OA 1ZJ1A 5IDTA 1H4EA 1R7VA 1ZCUA 4KNXA 2PX7A 1ZJPA 1FGXA 2YQHA 1O23B 3V8ZA 3FWWA 2QKXA 3K8DA 4XWIA 1NQIB 4FRLA 3Q80A 1R7YA 2ZU8A 5FUHA 1ZJ2A 4EEGA 1JVGA 1H5RA 1JVDA 1EZIA 3E26A 1WT3A 5CQNX 4J18A 2ICYA 4M28A 2A8UA 2X5ZA 1KWSA 4FRDA 3I0CA 2OEFA 1JYKA 4M2BA 5C8RA 5CQLX 4R7PA 3T7NA 3GUEA 2Q4JA 1ZI4A 5DDVA 1VGUA 1WT2A 3PKPA 4FCUA 4KC2A 1FOAA 5C36A 1WT1A 4Y7GA 2XWMA 3I0KA 2V0JA 2AM5A 2D0JA 1G95A 2RITA 3U2TA 4HO5A 2O1FA 4HO4A 5CQOA 1JV3A 2VXMA 3E25A 2OI6A 1VGZA 3OKRA 4GBPA 1H5SA 5FTVA 4KC1A 2V0HA 2PGYA 3V0PA 2V0LA 2RIZA 4Y7UA 2C0NA 5CMGX 4UEGA 5C47A 2WVLA 4KNRA 1ZI1A 1YROB 4HO8A 5D91A 2VK9A 1K4VA 1TW5A 1H5SD 1ON8A 2Z87A 1H5TA 5CMFX 1FG5N 1H7LA 1LVWA 3ZGFA 3I0IX 1VPAA 5C4EA 3U0XA 5JQQA 2J0AA 1TVYA 3PKQA 2V0KA 1OMXA 1INIA 3V8YA 1EYRA 3N9WA 5C3AA 1FWYA 4DDZA 1H7TA 1HJLA 4BMAA 1S4PA 2PA4A 1LZJA 2APCA 4HOCA 1SS9A 1FZWA 2I5EA 2RJ6A 2BO7A 1V83A 1ZI5A 3IOJA 2Y7AA 1H7GA 4MIXA 2FFVA 2WE9A 1ZHJA 3SX8A 1ZJOA 2FYDB 5D92A 4NAKA 3SXGA 2BO4A 2P72A 2XMEA 3D98A 4EEAA 3TQDA 4FIYA 2BO8A 2Y4JA 2RJ7A 3DUVA 1G9RA 1GQCA 3Q7UA 4HO0A 3BCVA 4M4KA 1IINA 2YC5A 3OGZA 4K6RA 1W77A 5L6SA 3V0MA 3RSBA 1GWWA 3F1YA 2YQCA 1MP5A 2GGOA 3V0LA 1LL0A 2O1HA 1VM8A 4IRPA 1MC3A 2MZBA 2PGVA 4NALA 5C49A 4ZDQA 2I5KA 1JYLA 5IFYA 1ZJ0A 4KXOA 2RJ4A 1R81A 2Y4LA 2FYBA 4G3PA 4FRHA 4B2XA 1XHBA 1VH3A 1VZXA 1HV9A 4CVHA 1GX4A 4EEMA 1YP2A 4MYBA 4ASYA 1R82A 2YCMA 4HO6A 2Y4KA 4FRAA 3D5NA 5EJZA 4AYLA 4EEOA 3R2WA 2V0IA 3R3IA 1H7HA 2AECA 3I0LA 3LW6A 3SXCA 1ON6A 3FOQA 2I7BA 1ZCTA 4FREA 4FIXA 4Y62A 2YC3A 3D8VA 5CMJA 2UX8A 1E5KA 3RMVA 1NF5B 1QGSA 4KT7A 1V82A 3I0EA 2RJ0A 3U0YA 2XMHA 4Y7VA 1W55A 4CJCA 2FY7A 1H4DA 4B42A 2JCKA 3OC9A 3V0OA 3V0QA 3I0HA 1O7OA 3CKVA 1GWVA 1H3MA 1FXOA 1WSZA 4DECA 1INJA 1QG8A 1R7UA 3Q4SA 4HCQA 3ZLKA 3U2WA 1V84A 2P6WA 3ST8A 2Z86A 3DJ4A 1HM0A 2VS3A 4FROA 2CU2A 1LZ0A 4L41C 4KRVA 1ZIZA 3I0FA 3ZF8A 1ZJ3A 3TZTA 4B4BA 4M2AA 1R7TA 1LL3A 3I0GA 4FCEA 3SXEA 3BRKX 2BO6A 3V91A 3USQA 2JCLA 2YESA 4C2SA 4BQHA 5CMHA 4KPZA 4JD0A 2FFUA 4D11C 4CJBA 5I1FA 4Y6UA 1IIMA 1NHEB 3OAMA 4LW6A 3DK5A 4P02A 1HJJA 4B4MA 1YP3A 2FYAA 3OH3A 4D48A 4P00A 2XWNA 3SXDA 1FRWA 4LW3A 3SXAA 2AH9A 1S4OA 1VICA 4G3QA 4HG6A 1FXJA 4EVWA 1FO8A 2Y4MA 1FR8A 2D7IA 2WGZA 3OH4A 4ECMA 2X5SA 3IOHA 2WAWA 2ZU9A 1G3LA 2Y6PA 2J0BA 1Z90A 3SXBA 1MP4A 3NGWA 4KQLA 3IOIA 4KPXA 5C4DA 1OQMB 4MNDA 4AAWA 1O7QA 4FRBA 2A8WA 5HS2A 1FGGA 2JCJA 4B3UA 3KIAA 2WEEA 1H7FA 1G93A 5C3BA 2P73A 1HM9A 1WT0A 5EJ1A 5J49A 2OI7A 4D0ZA 1FO9A 3RMWA 2GGQA 4EE4A 1JV1A 1ZCVA 1VZUA 3JTJA 1GQ9A 1MP3A 2VSIA 4Y6NA 4HO3A 1O0RA 3SX5A 2X60A 1LL2A 3CKJA 2W0WA 4G3SA 1VZTA 5C1HA 1H5SC 5C3DA 5C38A 1H7QA 1GA8A 4IRQA 5FYEA 4FQWA 3V90A 3SX7A 5FU8A 3PNNA 3EE5A 3SPTA 1H7EA 4ARWA 4B5BA 5C48A 1HM8A 1NKHB 2JCOA 4FRMA 1PZTA 1LZ7A 2AE7A 1GX0A 3JUJA 2VSHA 2YQJA 2VFZA 2QGIA 3U2VA 3O3PA 4NAIA 4O6MA 2OEGA 3OH2A 4AYJA 4EE5A 1OMZA 1FR9A 2ZU7A 5C4FA 4Q7CA 4YS8A 5FU0A 2RIXA 5CQMX 3CU0A 3JUKA 5EIYA 3SX3A 5CMIA 4Y9XA 5DDTA 3CKNA 1R7XA 3OH1A 2VXLA 3OH0A 1NMMB 3F1CA 1QGQA 3U2UA 5C1GA 5CQPA 3ZGGA 3QVBA 1XZ6A 1G1LA 2AGDA 2X65A 4D0TA 2YQSA 2RJ9A 4E1KA 2DPWA 1WVCA 2XWLA 2VD4A 2OI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AM4 A;  5C4B A;  1TZF A;  1H5R B;  3CGX A;  4HO2 A;  4DE7 A;  4CJ8 A;  2QH5 A;  1NWG B;  2O1G A;  5FV9 A;  1LZI A;  5L6V A;  2E8B A;  1QWJ A;  4Y64 A;  1ZI3 A;  2RJ5 A;  4Y7F A;  1G2V A;  4Y63 A;  1I52 A;  5AJO A;  2VS4 A;  2ICX A;  3T7O A;  3ZLL A;  1ZCY A;  5BXC A;  1TW1 A;  3I0J A;  5C4C A;  2E3D A;  2NXV A;  1G97 A;  1ZDG A;  4B4G A;  4HO9 A;  1VGT A;  2FYC B;  4NAN A;  2WVM A;  2AES A;  1R80 A;  2RJ8 A;  3K8E A;  4B2W A;  4AC3 A;  3CKO A;  1H5S B;  1H4C A;  1W57 A;  3POL A;  1S4N A;  2VS5 A;  4D11 A;  3I0D A;  4KC4 A;  2D7R A;  3CKQ A;  2WVK A;  4Y7T A;  4EE3 A;  1G0R A;  1G23 A;  4FRQ A;  2RIY A;  2RJ1 A;  3V0N A;  1VH1 A;  5C1L A;  3T7M A;  2W0V A;  5IDS A;  2AM3 A;  1YP4 A;  5AJN A;  4FRP A;  4ASJ A;  3U2X A;  5AJP A;  1PZY B;  5FTS A;  3USR A;  3HL3 A;  1VGW A;  1H5T B;  1ZDF A;  4G87 A;  4JIS A;  1G8O A;  1ZJ1 A;  5IDT A;  1H4E A;  1R7V A;  1ZCU A;  4KNX A;  2PX7 A;  1ZJP A;  1FGX A;  2YQH A;  1O23 B;  3V8Z A;  3FWW A;  2QKX A;  3K8D A;  4XWI A;  1NQI B;  4FRL A;  3Q80 A;  1R7Y A;  2ZU8 A;  5FUH A;  1ZJ2 A;  4EEG A;  1JVG A;  1H5R A;  1JVD A;  1EZI A;  3E26 A;  1WT3 A;  5CQN X;  4J18 A;  2ICY A;  4M28 A;  2A8U A;  2X5Z A;  1KWS A;  4FRD A;  3I0C A;  2OEF A;  1JYK A;  4M2B A;  5C8R A;  5CQL X;  4R7P A;  3T7N A;  3GUE A;  2Q4J A;  1ZI4 A;  5DDV A;  1VGU A;  1WT2 A;  3PKP A;  4FCU A;  4KC2 A;  1FOA A;  5C36 A;  1WT1 A;  4Y7G A;  2XWM A;  3I0K A;  2V0J A;  2AM5 A;  2D0J A;  1G95 A;  2RIT A;  3U2T A;  4HO5 A;  2O1F A;  4HO4 A;  5CQO A;  1JV3 A;  2VXM A;  3E25 A;  2OI6 A;  1VGZ A;  3OKR A;  4GBP A;  1H5S A;  5FTV A;  4KC1 A;  2V0H A;  2PGY A;  3V0P A;  2V0L A;  2RIZ A;  4Y7U A;  5CMG X;  4UEG A;  5C47 A;  2WVL A;  4KNR A;  1ZI1 A;  1YRO B;  4HO8 A;  1K4V A;  1TW5 A;  1H5S D;  1ON8 A;  2Z87 A;  1H5T A;  5CMF X;  1FG5 N;  1H7L A;  1LVW A;  3ZGF A;  3I0I X;  1VPA A;  5C4E A;  3U0X A;  5JQQ A;  1TVY A;  3PKQ A;  2V0K A;  1OMX A;  1INI A;  3V8Y A;  1EYR A;  3N9W A;  5C3A A;  1FWY A;  4DDZ A;  1H7T A;  1HJL A;  4BMA A;  1S4P A;  2PA4 A;  1LZJ A;  2APC A;  4HOC A;  1SS9 A;  1FZW A;  2I5E A;  2RJ6 A;  2BO7 A;  1V83 A;  1ZI5 A;  3IOJ A;  2Y7A A;  1H7G A;  2FFV A;  2WE9 A;  1ZHJ A;  3SX8 A;  1ZJO A;  2FYD B;  4NAK A;  3SXG A;  2BO4 A;  2P72 A;  3D98 A;  2XME A;  4EEA A;  3TQD A;  2BO8 A;  2Y4J A;  2RJ7 A;  3DUV A;  1G9R A;  1GQC A;  3Q7U A;  4HO0 A;  3BCV A;  4M4K A;  1IIN A;  2YC5 A;  3OGZ A;  4K6R A;  1W77 A;  5L6S A;  3V0M A;  3RSB A;  1GWW A;  3F1Y A;  2YQC A;  1MP5 A;  2GGO A;  3V0L A;  1LL0 A;  2O1H A;  1VM8 A;  4IRP A;  1MC3 A;  2MZB A;  2PGV A;  4NAL A;  5C49 A;  4ZDQ A;  2I5K A;  1JYL A;  5IFY A;  1ZJ0 A;  4KXO A;  2RJ4 A;  1R81 A;  2Y4L A;  2FYB A;  4G3P A;  4FRH A;  4B2X A;  1XHB A;  1VH3 A;  1VZX A;  1HV9 A;  4CVH A;  1GX4 A;  4EEM A;  1YP2 A;  4MYB A;  4ASY A;  1R82 A;  2YCM A;  4HO6 A;  2Y4K A;  4FRA A;  3D5N A;  5EJZ A;  4AYL A;  4EEO A;  3R2W A;  2V0I A;  3R3I A;  1H7H A;  2AEC A;  3I0L A;  3LW6 A;  3SXC A;  1ON6 A;  3FOQ A;  2I7B A;  1ZCT A;  4FRE A;  4Y62 A;  2YC3 A;  3D8V A;  5CMJ A;  2UX8 A;  1E5K A;  3RMV A;  1NF5 B;  1QGS A;  4KT7 A;  1V82 A;  3I0E A;  2RJ0 A;  3U0Y A;  2XMH A;  4Y7V A;  1W55 A;  4CJC A;  2FY7 A;  1H4D A;  4B42 A;  2JCK A;  3OC9 A;  3V0O A;  3V0Q A;  3I0H A;  1O7O A;  3CKV A;  1GWV A;  1H3M A;  1FXO A;  1WSZ A;  4DEC A;  1INJ A;  1QG8 A;  1R7U A;  3Q4S A;  4HCQ A;  3ZLK A;  3U2W A;  1V84 A;  2P6W A;  3ST8 A;  2Z86 A;  3DJ4 A;  1HM0 A;  2VS3 A;  4FRO A;  2CU2 A;  1LZ0 A;  4L41 C;  4KRV A;  1ZIZ A;  3I0F A;  3ZF8 A;  1ZJ3 A;  3TZT A;  4B4B A;  4M2A A;  1R7T A;  1LL3 A;  3I0G A;  4FCE A;  3SXE A;  3BRK X;  2BO6 A;  3V91 A;  3USQ A;  2JCL A;  2YES A;  4C2S A;  4BQH A;  5CMH A;  4KPZ A;  4JD0 A;  2FFU A;  4D11 C;  4CJB A;  5I1F A;  4Y6U A;  1IIM A;  1NHE B;  3OAM A;  4LW6 A;  3DK5 A;  4P02 A;  1HJJ A;  4B4M A;  1YP3 A;  2FYA A;  3OH3 A;  4D48 A;  4P00 A;  2XWN A;  3SXD A;  1FRW A;  4LW3 A;  3SXA A;  2AH9 A;  1S4O A;  1VIC A;  4G3Q A;  4HG6 A;  1FXJ A;  4EVW A;  1FO8 A;  2Y4M A;  1FR8 A;  2D7I A;  2WGZ A;  3OH4 A;  4ECM A;  2X5S A;  3IOH A;  2WAW A;  2ZU9 A;  1G3L A;  2Y6P A;  1Z90 A;  3SXB A;  1MP4 A;  3NGW A;  4KQL A;  3IOI A;  4KPX A;  5C4D A;  1OQM B;  4MND A;  4AAW A;  1O7Q A;  4FRB A;  2A8W A;  5HS2 A;  1FGG A;  2JCJ A;  4B3U A;  3KIA A;  2WEE A;  1H7F A;  1G93 A;  5C3B A;  2P73 A;  1HM9 A;  1WT0 A;  5EJ1 A;  5J49 A;  2OI7 A;  4D0Z A;  1FO9 A;  3RMW A;  2GGQ A;  4EE4 A;  1JV1 A;  1ZCV A;  1VZU A;  3JTJ A;  1GQ9 A;  1MP3 A;  2VSI A;  4Y6N A;  4HO3 A;  1O0R A;  3SX5 A;  2X60 A;  1LL2 A;  3CKJ A;  2W0W A;  4G3S A;  1VZT A;  5C1H A;  1H5S C;  5C3D A;  5C38 A;  1H7Q A;  1GA8 A;  4IRQ A;  5FYE A;  4FQW A;  3V90 A;  3SX7 A;  5FU8 A;  3PNN A;  3EE5 A;  3SPT A;  1H7E A;  4ARW A;  4B5B A;  5C48 A;  1HM8 A;  1NKH B;  2JCO A;  4FRM A;  1PZT A;  1LZ7 A;  2AE7 A;  1GX0 A;  3JUJ A;  2VSH A;  2YQJ A;  2VFZ A;  2QGI A;  3U2V A;  3O3P A;  4NAI A;  2OEG A;  3OH2 A;  4AYJ A;  4EE5 A;  1OMZ A;  1FR9 A;  2ZU7 A;  5C4F A;  4YS8 A;  5FU0 A;  2RIX A;  5CQM X;  3CU0 A;  3JUK A;  5EIY A;  3SX3 A;  5CMI A;  4Y9X A;  5DDT A;  3CKN A;  1R7X A;  3OH1 A;  2VXL A;  3OH0 A;  1NMM B;  3F1C A;  1QGQ A;  3U2U A;  5C1G A;  5CQP A;  3ZGG A;  3QVB A;  1XZ6 A;  1G1L A;  2AGD A;  2X65 A;  4D0T A;  2YQS A;  2RJ9 A;  4E1K A;  2DPW A;  1WVC A;  2XWL A;  2VD4 A;  2OI5 A; 
#chains in the Genus database with same CATH topology
 2AM4 A;  5C4B A;  1TZF A;  1H5R B;  3CGX A;  4HO2 A;  4DE7 A;  4CJ8 A;  2QH5 A;  1NWG B;  2O1G A;  5FV9 A;  1LZI A;  5L6V A;  2E8B A;  1QWJ A;  4Y64 A;  1ZI3 A;  2RJ5 A;  4O6N A;  4Y7F A;  1G2V A;  4Y63 A;  1I52 A;  5AJO A;  2VS4 A;  2ICX A;  3T7O A;  3ZLL A;  1ZCY A;  5BXC A;  1TW1 A;  3I0J A;  5C4C A;  2E3D A;  2NXV A;  1G97 A;  1ZDG A;  4B4G A;  4HO9 A;  1VGT A;  2FYC B;  4NAN A;  2WVM A;  2AES A;  1R80 A;  2RJ8 A;  3K8E A;  4B2W A;  4AC3 A;  3CKO A;  1H5S B;  1H4C A;  1W57 A;  3POL A;  1S4N A;  2VS5 A;  4D11 A;  3I0D A;  4KC4 A;  2D7R A;  3CKQ A;  2WVK A;  4Y7T A;  4EE3 A;  1G0R A;  1G23 A;  4FRQ A;  2RIY A;  2RJ1 A;  3V0N A;  1VH1 A;  5C1L A;  3T7M A;  2W0V A;  5IDS A;  2AM3 A;  1YP4 A;  5AJN A;  4FRP A;  4ASJ A;  3U2X A;  5AJP A;  1PZY B;  5FTS A;  3USR A;  3HL3 A;  1VGW A;  1H5T B;  1ZDF A;  4G87 A;  4JIS A;  1G8O A;  1ZJ1 A;  5IDT A;  1H4E A;  1R7V A;  1ZCU A;  4KNX A;  2PX7 A;  1ZJP A;  1FGX A;  2YQH A;  1O23 B;  3V8Z A;  3FWW A;  2QKX A;  3K8D A;  4XWI A;  1NQI B;  4FRL A;  3Q80 A;  1R7Y A;  2ZU8 A;  5FUH A;  1ZJ2 A;  4EEG A;  1JVG A;  1H5R A;  1JVD A;  1EZI A;  3E26 A;  1WT3 A;  5CQN X;  4J18 A;  2ICY A;  4M28 A;  2A8U A;  2X5Z A;  1KWS A;  4FRD A;  3I0C A;  2OEF A;  1JYK A;  4M2B A;  5C8R A;  5CQL X;  4R7P A;  3T7N A;  3GUE A;  2Q4J A;  1ZI4 A;  5DDV A;  1VGU A;  1WT2 A;  3PKP A;  4FCU A;  4KC2 A;  1FOA A;  5C36 A;  1WT1 A;  4Y7G A;  2XWM A;  3I0K A;  2V0J A;  2AM5 A;  2D0J A;  1G95 A;  2RIT A;  3U2T A;  4HO5 A;  2O1F A;  4HO4 A;  5CQO A;  1JV3 A;  2VXM A;  3E25 A;  2OI6 A;  1VGZ A;  3OKR A;  4GBP A;  1H5S A;  5FTV A;  4KC1 A;  2V0H A;  2PGY A;  3V0P A;  2V0L A;  2RIZ A;  4Y7U A;  2C0N A;  5CMG X;  4UEG A;  5C47 A;  2WVL A;  4KNR A;  1ZI1 A;  1YRO B;  4HO8 A;  5D91 A;  2VK9 A;  1K4V A;  1TW5 A;  1H5S D;  1ON8 A;  2Z87 A;  1H5T A;  5CMF X;  1FG5 N;  1H7L A;  1LVW A;  3ZGF A;  3I0I X;  1VPA A;  5C4E A;  3U0X A;  5JQQ A;  2J0A A;  1TVY A;  3PKQ A;  2V0K A;  1OMX A;  1INI A;  3V8Y A;  1EYR A;  3N9W A;  5C3A A;  1FWY A;  4DDZ A;  1H7T A;  1HJL A;  4BMA A;  1S4P A;  2PA4 A;  1LZJ A;  2APC A;  4HOC A;  1SS9 A;  1FZW A;  2I5E A;  2RJ6 A;  2BO7 A;  1V83 A;  1ZI5 A;  3IOJ A;  2Y7A A;  1H7G A;  4MIX A;  2FFV A;  2WE9 A;  1ZHJ A;  3SX8 A;  1ZJO A;  2FYD B;  5D92 A;  4NAK A;  3SXG A;  2BO4 A;  2P72 A;  2XME A;  3D98 A;  4EEA A;  3TQD A;  4FIY A;  2BO8 A;  2Y4J A;  2RJ7 A;  3DUV A;  1G9R A;  1GQC A;  3Q7U A;  4HO0 A;  3BCV A;  4M4K A;  1IIN A;  2YC5 A;  3OGZ A;  4K6R A;  1W77 A;  5L6S A;  3V0M A;  3RSB A;  1GWW A;  3F1Y A;  2YQC A;  1MP5 A;  2GGO A;  3V0L A;  1LL0 A;  2O1H A;  1VM8 A;  4IRP A;  1MC3 A;  2MZB A;  2PGV A;  4NAL A;  5C49 A;  4ZDQ A;  2I5K A;  1JYL A;  5IFY A;  1ZJ0 A;  4KXO A;  2RJ4 A;  1R81 A;  2Y4L A;  2FYB A;  4G3P A;  4FRH A;  4B2X A;  1XHB A;  1VH3 A;  1VZX A;  1HV9 A;  4CVH A;  1GX4 A;  4EEM A;  1YP2 A;  4MYB A;  4ASY A;  1R82 A;  2YCM A;  4HO6 A;  2Y4K A;  4FRA A;  3D5N A;  5EJZ A;  4AYL A;  4EEO A;  3R2W A;  2V0I A;  3R3I A;  1H7H A;  2AEC A;  3I0L A;  3LW6 A;  3SXC A;  1ON6 A;  3FOQ A;  2I7B A;  1ZCT A;  4FRE A;  4FIX A;  4Y62 A;  2YC3 A;  3D8V A;  5CMJ A;  2UX8 A;  1E5K A;  3RMV A;  1NF5 B;  1QGS A;  4KT7 A;  1V82 A;  3I0E A;  2RJ0 A;  3U0Y A;  2XMH A;  4Y7V A;  1W55 A;  4CJC A;  2FY7 A;  1H4D A;  4B42 A;  2JCK A;  3OC9 A;  3V0O A;  3V0Q A;  3I0H A;  1O7O A;  3CKV A;  1GWV A;  1H3M A;  1FXO A;  1WSZ A;  4DEC A;  1INJ A;  1QG8 A;  1R7U A;  3Q4S A;  4HCQ A;  3ZLK A;  3U2W A;  1V84 A;  2P6W A;  3ST8 A;  2Z86 A;  3DJ4 A;  1HM0 A;  2VS3 A;  4FRO A;  2CU2 A;  1LZ0 A;  4L41 C;  4KRV A;  1ZIZ A;  3I0F A;  3ZF8 A;  1ZJ3 A;  3TZT A;  4B4B A;  4M2A A;  1R7T A;  1LL3 A;  3I0G A;  4FCE A;  3SXE A;  3BRK X;  2BO6 A;  3V91 A;  3USQ A;  2JCL A;  2YES A;  4C2S A;  4BQH A;  5CMH A;  4KPZ A;  4JD0 A;  2FFU A;  4D11 C;  4CJB A;  5I1F A;  4Y6U A;  1IIM A;  1NHE B;  3OAM A;  4LW6 A;  3DK5 A;  4P02 A;  1HJJ A;  4B4M A;  1YP3 A;  2FYA A;  3OH3 A;  4D48 A;  4P00 A;  2XWN A;  3SXD A;  1FRW A;  4LW3 A;  3SXA A;  2AH9 A;  1S4O A;  1VIC A;  4G3Q A;  4HG6 A;  1FXJ A;  4EVW A;  1FO8 A;  2Y4M A;  1FR8 A;  2D7I A;  2WGZ A;  3OH4 A;  4ECM A;  2X5S A;  3IOH A;  2WAW A;  2ZU9 A;  1G3L A;  2Y6P A;  2J0B A;  1Z90 A;  3SXB A;  1MP4 A;  3NGW A;  4KQL A;  3IOI A;  4KPX A;  5C4D A;  1OQM B;  4MND A;  4AAW A;  1O7Q A;  4FRB A;  2A8W A;  5HS2 A;  1FGG A;  2JCJ A;  4B3U A;  3KIA A;  2WEE A;  1H7F A;  1G93 A;  5C3B A;  2P73 A;  1HM9 A;  1WT0 A;  5EJ1 A;  5J49 A;  2OI7 A;  4D0Z A;  1FO9 A;  3RMW A;  2GGQ A;  4EE4 A;  1JV1 A;  1ZCV A;  1VZU A;  3JTJ A;  1GQ9 A;  1MP3 A;  2VSI A;  4Y6N A;  4HO3 A;  1O0R A;  3SX5 A;  2X60 A;  1LL2 A;  3CKJ A;  2W0W A;  4G3S A;  1VZT A;  5C1H A;  1H5S C;  5C3D A;  5C38 A;  1H7Q A;  1GA8 A;  4IRQ A;  5FYE A;  4FQW A;  3V90 A;  3SX7 A;  5FU8 A;  3PNN A;  3EE5 A;  3SPT A;  1H7E A;  4ARW A;  4B5B A;  5C48 A;  1HM8 A;  1NKH B;  2JCO A;  4FRM A;  1PZT A;  1LZ7 A;  2AE7 A;  1GX0 A;  3JUJ A;  2VSH A;  2YQJ A;  2VFZ A;  2QGI A;  3U2V A;  3O3P A;  4NAI A;  4O6M A;  2OEG A;  3OH2 A;  4AYJ A;  4EE5 A;  1OMZ A;  1FR9 A;  2ZU7 A;  5C4F A;  4Q7C A;  4YS8 A;  5FU0 A;  2RIX A;  5CQM X;  3CU0 A;  3JUK A;  5EIY A;  3SX3 A;  5CMI A;  4Y9X A;  5DDT A;  3CKN A;  1R7X A;  3OH1 A;  2VXL A;  3OH0 A;  1NMM B;  3F1C A;  1QGQ A;  3U2U A;  5C1G A;  5CQP A;  3ZGG A;  3QVB A;  1XZ6 A;  1G1L A;  2AGD A;  2X65 A;  4D0T A;  2YQS A;  2RJ9 A;  4E1K A;  2DPW A;  1WVC A;  2XWL A;  2VD4 A;  2OI5 A; 
#chains in the Genus database with same CATH homology
 2AM4 A;  5C4B A;  1TZF A;  1H5R B;  3CGX A;  4HO2 A;  4DE7 A;  4CJ8 A;  2QH5 A;  1NWG B;  2O1G A;  5FV9 A;  1LZI A;  5L6V A;  2E8B A;  1QWJ A;  4Y64 A;  1ZI3 A;  2RJ5 A;  4O6N A;  4Y7F A;  1G2V A;  4Y63 A;  1I52 A;  5AJO A;  2VS4 A;  2ICX A;  3T7O A;  3ZLL A;  1ZCY A;  5BXC A;  1TW1 A;  3I0J A;  5C4C A;  2E3D A;  2NXV A;  1G97 A;  1ZDG A;  4B4G A;  4HO9 A;  1VGT A;  2FYC B;  4NAN A;  2WVM A;  2AES A;  1R80 A;  2RJ8 A;  3K8E A;  4B2W A;  4AC3 A;  3CKO A;  1H5S B;  1H4C A;  1W57 A;  3POL A;  1S4N A;  2VS5 A;  4D11 A;  3I0D A;  4KC4 A;  2D7R A;  3CKQ A;  2WVK A;  4Y7T A;  4EE3 A;  1G0R A;  1G23 A;  4FRQ A;  2RIY A;  2RJ1 A;  3V0N A;  1VH1 A;  5C1L A;  3T7M A;  2W0V A;  5IDS A;  2AM3 A;  1YP4 A;  5AJN A;  4FRP A;  4ASJ A;  3U2X A;  5AJP A;  1PZY B;  5FTS A;  3USR A;  3HL3 A;  1VGW A;  1H5T B;  1ZDF A;  4G87 A;  4JIS A;  1G8O A;  1ZJ1 A;  5IDT A;  1H4E A;  1R7V A;  1ZCU A;  4KNX A;  2PX7 A;  1ZJP A;  1FGX A;  2YQH A;  1O23 B;  3V8Z A;  3FWW A;  2QKX A;  3K8D A;  4XWI A;  1NQI B;  4FRL A;  3Q80 A;  1R7Y A;  2ZU8 A;  5FUH A;  1ZJ2 A;  4EEG A;  1JVG A;  1H5R A;  1JVD A;  1EZI A;  3E26 A;  1WT3 A;  5CQN X;  4J18 A;  2ICY A;  4M28 A;  2A8U A;  2X5Z A;  1KWS A;  4FRD A;  3I0C A;  2OEF A;  1JYK A;  4M2B A;  5C8R A;  5CQL X;  4R7P A;  3T7N A;  3GUE A;  2Q4J A;  1ZI4 A;  5DDV A;  1VGU A;  1WT2 A;  3PKP A;  4FCU A;  4KC2 A;  1FOA A;  5C36 A;  1WT1 A;  4Y7G A;  2XWM A;  3I0K A;  2V0J A;  2AM5 A;  2D0J A;  1G95 A;  2RIT A;  3U2T A;  4HO5 A;  2O1F A;  4HO4 A;  5CQO A;  1JV3 A;  2VXM A;  3E25 A;  2OI6 A;  1VGZ A;  3OKR A;  4GBP A;  1H5S A;  5FTV A;  4KC1 A;  2V0H A;  2PGY A;  3V0P A;  2V0L A;  2RIZ A;  4Y7U A;  2C0N A;  5CMG X;  4UEG A;  5C47 A;  2WVL A;  4KNR A;  1ZI1 A;  1YRO B;  4HO8 A;  5D91 A;  2VK9 A;  1K4V A;  1TW5 A;  1H5S D;  1ON8 A;  2Z87 A;  1H5T A;  5CMF X;  1FG5 N;  1H7L A;  1LVW A;  3ZGF A;  3I0I X;  1VPA A;  5C4E A;  3U0X A;  5JQQ A;  2J0A A;  1TVY A;  3PKQ A;  2V0K A;  1OMX A;  1INI A;  3V8Y A;  1EYR A;  3N9W A;  5C3A A;  1FWY A;  4DDZ A;  1H7T A;  1HJL A;  4BMA A;  1S4P A;  2PA4 A;  1LZJ A;  2APC A;  4HOC A;  1SS9 A;  1FZW A;  2I5E A;  2RJ6 A;  2BO7 A;  1V83 A;  1ZI5 A;  3IOJ A;  2Y7A A;  1H7G A;  4MIX A;  2FFV A;  2WE9 A;  1ZHJ A;  3SX8 A;  1ZJO A;  2FYD B;  5D92 A;  4NAK A;  3SXG A;  2BO4 A;  2P72 A;  2XME A;  3D98 A;  4EEA A;  3TQD A;  4FIY A;  2BO8 A;  2Y4J A;  2RJ7 A;  3DUV A;  1G9R A;  1GQC A;  3Q7U A;  4HO0 A;  3BCV A;  4M4K A;  1IIN A;  2YC5 A;  3OGZ A;  4K6R A;  1W77 A;  5L6S A;  3V0M A;  3RSB A;  1GWW A;  3F1Y A;  2YQC A;  1MP5 A;  2GGO A;  3V0L A;  1LL0 A;  2O1H A;  1VM8 A;  4IRP A;  1MC3 A;  2MZB A;  2PGV A;  4NAL A;  5C49 A;  4ZDQ A;  2I5K A;  1JYL A;  5IFY A;  1ZJ0 A;  4KXO A;  2RJ4 A;  1R81 A;  2Y4L A;  2FYB A;  4G3P A;  4FRH A;  4B2X A;  1XHB A;  1VH3 A;  1VZX A;  1HV9 A;  4CVH A;  1GX4 A;  4EEM A;  1YP2 A;  4MYB A;  4ASY A;  1R82 A;  2YCM A;  4HO6 A;  2Y4K A;  4FRA A;  3D5N A;  5EJZ A;  4AYL A;  4EEO A;  3R2W A;  2V0I A;  3R3I A;  1H7H A;  2AEC A;  3I0L A;  3LW6 A;  3SXC A;  1ON6 A;  3FOQ A;  2I7B A;  1ZCT A;  4FRE A;  4FIX A;  4Y62 A;  2YC3 A;  3D8V A;  5CMJ A;  2UX8 A;  1E5K A;  3RMV A;  1NF5 B;  1QGS A;  4KT7 A;  1V82 A;  3I0E A;  2RJ0 A;  3U0Y A;  2XMH A;  4Y7V A;  1W55 A;  4CJC A;  2FY7 A;  1H4D A;  4B42 A;  2JCK A;  3OC9 A;  3V0O A;  3V0Q A;  3I0H A;  1O7O A;  3CKV A;  1GWV A;  1H3M A;  1FXO A;  1WSZ A;  4DEC A;  1INJ A;  1QG8 A;  1R7U A;  3Q4S A;  4HCQ A;  3ZLK A;  3U2W A;  1V84 A;  2P6W A;  3ST8 A;  2Z86 A;  3DJ4 A;  1HM0 A;  2VS3 A;  4FRO A;  2CU2 A;  1LZ0 A;  4L41 C;  4KRV A;  1ZIZ A;  3I0F A;  3ZF8 A;  1ZJ3 A;  3TZT A;  4B4B A;  4M2A A;  1R7T A;  1LL3 A;  3I0G A;  4FCE A;  3SXE A;  3BRK X;  2BO6 A;  3V91 A;  3USQ A;  2JCL A;  2YES A;  4C2S A;  4BQH A;  5CMH A;  4KPZ A;  4JD0 A;  2FFU A;  4D11 C;  4CJB A;  5I1F A;  4Y6U A;  1IIM A;  1NHE B;  3OAM A;  4LW6 A;  3DK5 A;  4P02 A;  1HJJ A;  4B4M A;  1YP3 A;  2FYA A;  3OH3 A;  4D48 A;  4P00 A;  2XWN A;  3SXD A;  1FRW A;  4LW3 A;  3SXA A;  2AH9 A;  1S4O A;  1VIC A;  4G3Q A;  4HG6 A;  1FXJ A;  4EVW A;  1FO8 A;  2Y4M A;  1FR8 A;  2D7I A;  2WGZ A;  3OH4 A;  4ECM A;  2X5S A;  3IOH A;  2WAW A;  2ZU9 A;  1G3L A;  2Y6P A;  2J0B A;  1Z90 A;  3SXB A;  1MP4 A;  3NGW A;  4KQL A;  3IOI A;  4KPX A;  5C4D A;  1OQM B;  4MND A;  4AAW A;  1O7Q A;  4FRB A;  2A8W A;  5HS2 A;  1FGG A;  2JCJ A;  4B3U A;  3KIA A;  2WEE A;  1H7F A;  1G93 A;  5C3B A;  2P73 A;  1HM9 A;  1WT0 A;  5EJ1 A;  5J49 A;  2OI7 A;  4D0Z A;  1FO9 A;  3RMW A;  2GGQ A;  4EE4 A;  1JV1 A;  1ZCV A;  1VZU A;  3JTJ A;  1GQ9 A;  1MP3 A;  2VSI A;  4Y6N A;  4HO3 A;  1O0R A;  3SX5 A;  2X60 A;  1LL2 A;  3CKJ A;  2W0W A;  4G3S A;  1VZT A;  5C1H A;  1H5S C;  5C3D A;  5C38 A;  1H7Q A;  1GA8 A;  4IRQ A;  5FYE A;  4FQW A;  3V90 A;  3SX7 A;  5FU8 A;  3PNN A;  3EE5 A;  3SPT A;  1H7E A;  4ARW A;  4B5B A;  5C48 A;  1HM8 A;  1NKH B;  2JCO A;  4FRM A;  1PZT A;  1LZ7 A;  2AE7 A;  1GX0 A;  3JUJ A;  2VSH A;  2YQJ A;  2VFZ A;  2QGI A;  3U2V A;  3O3P A;  4NAI A;  4O6M A;  2OEG A;  3OH2 A;  4AYJ A;  4EE5 A;  1OMZ A;  1FR9 A;  2ZU7 A;  5C4F A;  4Q7C A;  4YS8 A;  5FU0 A;  2RIX A;  5CQM X;  3CU0 A;  3JUK A;  5EIY A;  3SX3 A;  5CMI A;  4Y9X A;  5DDT A;  3CKN A;  1R7X A;  3OH1 A;  2VXL A;  3OH0 A;  1NMM B;  3F1C A;  1QGQ A;  3U2U A;  5C1G A;  5CQP A;  3ZGG A;  3QVB A;  1XZ6 A;  1G1L A;  2AGD A;  2X65 A;  4D0T A;  2YQS A;  2RJ9 A;  4E1K A;  2DPW A;  1WVC A;  2XWL A;  2VD4 A;  2OI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...