5C4IA

Structure of an oxalate oxidoreductase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
394
structure length
394
Chain Sequence
b'GKVRNISGCVAVAHGVRLADVDVICSYPIRPYTGIMSELARMVADGELDAEFVHGEGEHAQLSVVYGASAAGARVFTGSSGVGVTYAMEVYSPISGERLPVQMAIADRTLDPPGDFGEEHTDAECCRDQGWIQGWASTPQEALDNTLIYYRVGEDQRVLLPQYACLDGYFVSHILGPVDIPDEAQVKEFLPPYKNHHVLDPRKPQIIGPQIEPAMGPPLQYQRYQAVKGVHKVLEEACDEFARIFGRKYDPYLDEYLTDDAEVIIFGQGAHMETAKAVARRLRNLGEKVGVARLRTFRPFPTEQIKERLSKFKAIGVLDVSANFGISCSGGVLLSELRAALYDYGDKVKTVGFVAGLGGEVVTHDEFYRMFQKLKEIAKTGKVEQTSYWIPFEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxalate oxidoreductase subunit alpha
publication title The Structure of an Oxalate Oxidoreductase Provides Insight into Microbial 2-Oxoacid Metabolism.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 154
structure length 394
sequence length 394
chains with identical sequence D
ec nomenclature ec 1.2.7.10: Oxalate oxidoreductase.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01855 POR_N Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg
A PF17147 PFOR_II Pyruvate:ferredoxin oxidoreductase core domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c4iA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c4iA01
1YHYA 3HWX1 2JI7A 1KEKA 3LQ4A 1B0PA 4JUAA 3UK1A 3M34A 2FWNA 3DV0A 4QELA 1POXA 1UMBB 2JI9A 5FEMA 3AHCA 2QTCA 5EXEA 3KOMA 1OVMA 2XT9A 3EXEA 1V16B 2Q29A 1GPUA 2IHUA 3AHJA 2BEVA 2UZAA 1OLUB 3EA4A 4C7VA 2J9FA 2OZLA 3DVAB 3F6BX 3M7IA 1R9JA 1MCZA 1AY0A 3AHFA 2G25A 5DGDA 1N0HA 5ERXA 5ERYA 1V5GA 3F6EX 4MPPA 2BFDA 2BFBB 1UPCA 3EYAA 1WCIA 3ZHRA 1T9DA 1OZFA 3EY9A 2BFCA 3IAFA 2BP7B 4K9LA 1YBHA 3D7KA 2Q5QA 1V1RA 4MQ5A 4GP9A 1JSCA 4RJKA 2BFFA 2QTAA 2AG1A 2Q5LA 1YI0A 2YICA 1OLSA 3DV0B 5EJ4A 4JU9A 2JI6A 4K9PA 4COKA 1QS0A 3FSJX 1X80A 2C42A 3AHHA 1X7YA 4WBXC 2BEVB 1W88A 4JUDX 3AHDA 2PDAA 1RP7A 4RJJA 2OZLB 3EXHA 4K9KA 3EXFA 4KXYA 1OLXA 1YNOA 1UPAA 4GM0A 3AHIA 2UZ1B 5EJ8A 5IMSA 2VK1A 4MZXA 3FLMA 1WCIB 2JLAA 4FEGA 2BFCB 2WVGA 1QGDA 4JUCA 2V3WA 2YIDA 4KXWA 4XEUA 2BFFB 4MPJA 1UMDA 1TKCA 1T9BA 1UM9A 2PANA 2VBIA 1OLSB 2VK4A 1POWA 5I51A 1X7WA 4K9OA 1QS0B 1X7XA 3ZHSA 1Q6ZA 2PGNA 1V1MA 2JLCA 2NXWA 1X7YB 5EJ6A 4KXUA 1U5BA 4GM4A 4RJIA 4K9QA 2EZUA 5EJ7A 1T9CA 3IAEA 3EXHB 2Y0PA 5DGTA 1Y9DA 3HYLA 4KGDA 1W85A 2O1XA 3EXG1 2BEWB 5I5EA 2IEAA 1BFDA 5DEIA 1TKAA 5HGXA 4GG1A 5ESDA 1YHZA 2VK8A 4D5GA 2XT6A 2EZTA 3LQ2A 3DUFA 5EJ9A 1V11A 3EXEB 2G28A 3LQ1A 1DTWA 1UMDB 1UM9B 1TKBA 2IHVA 2J9FB 2VBGA 2BFEA 1PI3A 1X7XB 2WVAA 2BEUA 1T9AA 2VBFA 1UMCA 1V1MB 3M49A 3ZHUA 2JIBA 2C3PA 1PO7A 1U5BB 4JUFA 4D5EA 3M6LA 4GPEA 2WVHA 2BFDB 2Q5OA 2W93A 2R8OA 2G67A 3OE1A 5C4IA 1QPBA 2JGDA 1W85B 2R8PA 1YD7A 4K9MA 3RIMA 1V1RB 5K3SA 3UPTA 3ZHQA 2PGOA 2C31A 4JD5A 3AHEA 3EXG2 3EXIA 1YI1A 2C3YA 4JUBA 3DUFB 1ITZA 2C3UA 1X7ZA 1V11B 2Q27A 4Q9DA 1X80B 2O1SA 1V5EA 2X7JA 1DTWB 1PYDA 1W88B 4QPZA 1NI4A 5HJEA 1IK6A 2BFEB 3EXFB 2BEUB 5I5GA 2IHTA 1UMCB 2VJYA 1OLXB 3AI7A 2AG0A 2XTAA 2C3MA 2Q5JA 2E6KA 1Z8NA 2UZ1A 1ZPDA 5HHTA 2EZ9A 3E9YA 2EZ4A 4JU8A 2DJIA 3JU3A 2JI8A 1UMBA 2JGDB 1NGSA 3OOYA 4KXXA 3LPLA 4FEEA 5EJAA 1V16A 1OZGA 1V5FA 3AHGA 5K2OA 5HYVA 2C3OA 3L84A 3EXIB 4K9NA 5K6TA 1OLUA 5EXDA 1PVDA 3HWWA 1OZHA 1X7WB 3DVAA 1X7ZB 1UPBA 3ZHVA 5EJ5A 2Q28A 2R5NA 4C7XA 3EXHC 4KXVA 5AHKA 1TRKA 4GM1A 4QQ8A 4MPRA 1NI4B 2BFBA 2EZ8A 1L8AA 3ZHTA 2FN3A 3FZNA 3MOSA 5EJMA 5K6RA 4ZP1A 2BP7A 5I4IA 2BEWA
chains in the Genus database with same CATH superfamily
5B30A 1Q5PA 1RM5A 1KJNA 1QAQA 1KJZA 4JYBA 1OIVA 4HDMA 4ZHQA 1M2JA 4OQZA 2XQKA 3LVQE 1GEGA 3ZVRA 5C3MA 1BDIA 1E20A 1LNQA 3WLMA 1EPUA 3G2OA 3B89A 3HKEB 2V7VA 4R1MA 1IOVA 1KOGA 3PLAE 4IHJA 4JJIA 3DV0A 2XD9A 3R5XA 4CM6A 4ER5A 1LDNA 1GCGA 2X42A 1IY0A 1W30A 2A33A 1DT3A 4JMPA 3DOHA 4N0MA 3KEMA 5ICGA 1VLJA 2PZEA 4CVNA 3BJEA 3BD6A 4DLTA 4IIEA 1TO6A 5IVPA 2CCJA 2PD3A 4I7EA 3NATA 2ID8A 4FOSA 5FFNA 3D4BA 3AVOA 5C1IA 1DMRA 4WLEA 2YJ3A 1E3MA 2QVLA 1VIVA 2PZFA 1PT7A 1GPUA 2W48A 2CXPA 3CN9A 1C50A 1ULHA 3NTLA 5C4GB 2BL4A 5CT9A 3ZZ1A 2QT1A 5CEEA 3UXMA 2GETA 3WZ2A 3QFFA 5IF9A 3GLIA 4TWAA 4AWBA 3MZ0A 4ZCIA 3D0RA 3QU5A 2FFBA 3D8BA 1DKOA 4DA7A 2VDLB 3RS8A 4BASA 1L5ZA 3CF0A 3LO5A 1O1YA 3QUBA 2RGXA 1UT5A 2XNJA 3K32A 3TSAA 2IXFA 4ENUA 3RR2A 1MCZA 5DXJA 5J58A 5JCJD 4Z9BA 3M0EA 4ROSA 3SZUA 3KTAB 3HJUA 3SI7A 1OI3A 2G25A 1FYEA 1IPFA 4GMKA 4TOIA 3RC7A 1TLFA 2HN9A 4II3A 3E4CA 2FLKA 2YN0A 4HLUC 4RDXA 5H1YA 5IPFA 5LOVB 2N1BA 2Q2QA 1TM5E 1F4VA 4HVTA 3KOYA 1VMDA 4L85A 4FPXA 4N0PA 3N07A 4PTZA 2VWGA 2J1LA 3OM1A 1KI1A 3R20A 4BPRA 1ZI9A 2I4MA 3AOGA 4Q3KA 4UM7A 4F12A 1EIWA 2W6JA 4OYYA 3DL7A 1JAYA 2WMDA 2X76A 3MT8A 3P9NA 4GPZA 4PZLA 5IDVA 1OI2A 5C7YA 1QIIA 3LDGA 1PQWA 1DTEA 1IC6A 4YHHB 3UBTA 4EJFA 1G2IA 2FG7C 3V1KA 3T35A 2J67A 1PS9A 1BDMA 1SBIA 4FINA 1ZWKA 4FXPA 4XDYA 4BNLA 4F1JA 1A8IA 1RJ9A 2Z8YM 1ML3A 3ZXUB 3PLNA 1NLYA 2ZBUA 5EIBD 2XVMA 2EYQA 4PIVA 1H2XA 1S7GA 3K9FC 3K35A 4RJKA 4D97A 1V8ZA 1RAGA 2BHTA 2A4MA 2HWWA 1RHQA 4S3MA 1Z0ZA 2L18A 3EHDA 4EHNA 8ADHA 4MUBA 2OD9A 5JNWA 3FSGD 2Q0XA 1UK9A 3H7AA 3OLCX 1KAHA 4GI3A 4EEZA 1GTZA 1EI9A 4MPTA 1DO0A 3P97A 3QKTA 3IEUA 4NMHA 4EZBA 4MV9A 4ZV7A 2QA5A 2ZIZA 1WUJS 4N82A 4DCTA 2AL7A 3ZU5A 5HMMA 1YAHA 2A1UB 3DAYA 4NCIA 2VRWA 1TO1E 4WKPA 2FX3A 2Z8ZA 4C6SA 2P9QA 2XUIA 3R0IA 1ISPA 3QU9A 1XGKA 2ATVA 2CXSA 3GJRA 1XROA 4CKZA 3OQ6A 2UUAB 2ID9A 4FWIB 1SM4A 3R1IA 2X0KA 1T8TA 4ZQGA 4V1CI 1RQNA 2FH5B 4WFJA 4M1QA 1L5SA 1VLQA 1GFIA 3DFIA 1Q83A 6YASA 2L2QA 2CY0A 2JIZA 5JANA 1AS2A 2VHQA 1QVAA 4PX2A 3ZCUA 4CF5A 4D3ZA 2CB0A 4BGVA 1OV6A 4AO6A 1MZPA 3I5XA 2GTPA 1R0BA 3GIDA 4C1BA 3VNUA 4PINA 3OLXA 2PGIA 3O92A 1Z2NX 4L6AA 2FEOA 5AW0A 5KKNB 2VDRB 4HBGA 3T9FA 3DHNA 4QUKA 1UAAA 2VAVA 3KB1A 1TUGA 5T4FA 2H16A 5MGBA 3DBHA 4R98A 1WUKS 4GOMD 4AFNA 1UBRS 4F7DA 4FGWA 2VI5A 2EGGA 3CVWA 3I32A 1H0HA 1RWQA 2IP4A 4JC4A 1J90A 2EFHB 4GR9A 4LTNA 3RUHA 2JS7A 3TAXA 2QE7D 3NO4A 1C14A 3L5KA 4ZOAA 1O6FA 1UFVA 3MK31 3EC2A 3CPJB 1V0JA 2JLAA 2FUCA 2VPWA 1Z2EA 4IQ0A 4OPMA 1YU6A 4ZT7A 4X91A 5BVGB 3AI2A 5H5JA 2VDVE 3O1HB 2JJ1D 3COJA 3G1WA 1DWQA 2ZJ6A 3MBIA 5JMPA 1L5FA 3KJHA 1RI5A 2PPLA 3ORQA 4BLUA 4U2GA 3W5SA 4DR5B 4MPJA 3OM9A 2P7HA 4N03A 4E3WA 2IEIA 1D1TA 2PR2A 4IMIB 1LC3A 3L1VA 1NDUA 3L8MA 3DE1X 4N12A 1I6WA 3EK2A 1ID1A 4U9IS 5TQ0B 1KERA 2WIFA 3ENQA 3SIXA 3UIEA 2WFLA 4YV1A 2R6ZA 3CGWA 4IS2A 4GW3A 2F4VB 3FYSA 3N8NA 1VG0B 4XR4A 5AI4A 1YB2A 1ZX1A 2AFIA 3ZVKA 4BAGA 4EITA 4OX9B 5LM3A 4R51A 4Q3NA 4H1WA 5BQFA 2DPYA 3ICVA 1EFAA 4KB5A 1XMVA 4GSYA 4YHBA 3FTQA 3SU8A 5AKGA 2FWBA 1QS0B 4D3FA 1NN1A 5JZMA 521PA 2XB4A 4C4AA 1TADA 5B4UA 1SUSA 3JATA 2CDRA 2H4FA 1WE2A 4HSEA 3OTOB 1L4MA 3FRIA 1Q11A 5G4LA 4GKKB 1M1NA 4IJVA 2YWXA 1IQUA 4FFBA 2X77A 1TGYA 1VIYA 4YO8A 2LCFA 3ST7A 1P4RA 4IPTA 1WCXA 4RS4A 1O0SA 5A3JA 3PX2A 1U7XA 2RJNA 5DI3B 1XEWX 1XMIA 1EGQA 3BCSA 4H27A 3KHKA 1O95A 4NYJQ 1KZYC 1U2PA 3HTXA 4B83A 1KH1A 1IBRA 1REQB 1VZ2A 3HYLA 5COQA 4L0QA 3HR4A 3CURA 1DJPA 4P35A 3TKYA 4TKZA 1VL6A 5C81A 3AM5A 2IYQA 2O1XA 4LZAA 1NQVA 3TW0A 2X2PA 4AZSA 3EXG1 1F9AA 2BEWB 1XDZA 1EVIA 2ECKA 2H1LA 2ON6A 2XNDD 3MCWA 1CYEA 1L7NA 4NENB 4GP7A 5KYUA 1T2NA 3DEFA 3O84A 4FU0A 5FUMA 2AQKA 2LNDA 1P1FA 3UXYA 1QORA 2IPAB 4G0ZA 1BVRA 4HZUB 2J4DA 4EF6A 2A9KA 2JLRA 3PWTA 4R5HA 5HGXA 2H9YA 2HMYB 1KPHA 2P9ZA 2QEQA 5L3SB 3UB3A 3CR3C 5HTOA 1JHPA 1AQLA 3R5TA 4EJ2A 3JQBA 3BKWA 5JNTA 5KOYA 5AVVA 821PA 5LMNB 3DDOA 2Z09A 1S4MA 1KKMA 1U9ZA 2J85A 4Q39A 3ZWWA 3EPHA 2ZJAA 1RQGA 3DTNA 4O4HB 1E9CA 4LV5B 4PZ0A 1NUPA 3RU3A 2A7XA 2ZBPA 1MQSA 2V7TA 3HK2A 4MVJD 4RHEA 4IDDA 2B1QA 1O96A 2HY7A 1KAOA 2O3JA 3EZGA 3PCXA 2XRYA 4Q19A 3UVEA 1JDBC 1A7AA 1E3WB 2HWXA 1ZVKA 3BXEA 3KR2A 3NT4A 3QEBZ 1H93A 2E4WA 1DHTA 3O8LA 1Z38A 4R2MA 2V7EA 2EL9A 2ZW9A 3TTWA 3VPGA 5AW1A 1P1KA 2IHVA 3NWOA 1ZG3A 3USCS 3QVTA 4CLRB 2QD3A 5HJ5A 3MJFA 1AKVA 3TMYA 4A2WA 1QIGA 2ZRCA 1KHHA 3D2CA 4RLFA 7GPBA 3AJDA 2AYZA 2V6FA 4HRXA 1GCUA 4R7ZA 4RYLA 1CS0A 1RXCA 2D62A 3PSHA 4R68A 3T7EA 3NONA 5K5EA 4FB4A 5FX2A 3NTUA 721PA 5SZIA 3PDIB 4E7OA 3GP3A 1F4LA 3GVXA 4PIMA 2GOYA 1VG1A 1GTMA 4IIFA 2XYHA 2X1MA 1C1XB 4EB6A 1ZBQA 3HSKA 4YCNA 1K6EA 1OA1A 1US8A 3K0BA 3IIIA 3IAS6 4XLLA 5CUQA 1B93A 4QRIA 3T38A 3FPJA 1U8CB 3T34A 2ZYIA 3BJIC 2WNIA 3HLYA 3OPNA 1SC1A 2WF7A 3S55A 4RZXA 4BX0A 3DMFA 1MDBA 1C30A 3AIMA 4ON9A 3T3HA 1JA1A 5F2NA 2WNSA 4B81A 1RR6A 2ID4A 1B7GO 2FVYA 3SM9A 2V45A 4A73A 1XZHA 3ZIDA 1KQ3A 3TX6A 3F1LA 1K63A 1M6NA 1N8SA 2AB0A 2BHNA 4PWYA 3IV6A 1PS0A 3EC1A 3GEIA 3NMUF 2QN6A 3X2EA 3OAAD 4RY8A 4TXJA 3RJTA 5E7JA 2G1PA 1EFVA 1E62A 4DUPA 2XDYA 1N6PA 3KEOA 1G21A 1FDTA 3GFGA 5IJXA 3GJSA 3R9XB 4JVLA 3AU9A 4EP1A 5JFTA 2YMLA 1CUSA 4R4JA 2WG0A 1T25A 4AP5A 2BFPA 1CUGA 5TQJA 1CW2B 3OEWA 4ITRC 3AUAA 4F71A 2W2LA 2D2EA 2RI6A 3AR4A 3GRUA 2WMOB 5J40A 3RLIA 4FBGA 4KPEC 3E5MA 2KQUA 4YDHB 1R5BA 1W5FA 3ONFA 3QIVA 4PZCA 1N2HA 3CTPA 3PQ2A 1QQ5A 4WN9B 4YPOA 2C4HA 4DMHA 1H22A 1IHOA 1F6BA 1DXHA 1JMKC 2XZTA 3AETB 3OQVA 4NKRA 4NVRA 4Q9DA 4X6XA 1ENOA 2W43A 4JLDA 2YW9A 4TSRA 5A7GA 2MYNA 3KPJA 3Q2KA 3GJ6A 5ICCA 4H1VA 1QLJA 3PC6A 2OAEA 1UP7A 5BMVA 5KVVA 3KAPA 1U1CA 3TOCA 4I55F 3MUEA 4W5OA 1K98A 4GOND 2YWGA 5CB4A 3E7WA 2O2DA 2VHCA 4WXYB 1HNZB 3P71T 2O8NA 2NUPB 4FZ3A 4HUQA 2WWVD 1CE8B 4Y9RA 3PU6A 1KMCA 1UP6A 4WCDA 3I6ZA 3WP0A 3ILHA 4O2RA 2P2SA 1YR8A 2Y6UA 1H9BA 3HE3A 3K4HA 3INNA 1PAUA 1NN3A 1QBGA 2HXYA 4ZXFA 5ESXA 3RSCA 4EHKA 2AH5A 4BMSA 2ZSDA 2OYSA 3PYLA 3CPHA 1UMKA 3AL0C 4XQCA 3N70A 2FPGA 1F6WA 1PNTA 3BMCB 3NOOA 2JAUA 1EDEA 1QCDA 1I51A 1P7ZA 4MROA 1GN8A 2J7PA 4DM7A 3DE4X 2NVBA 4YV2A 3OJWA 4QT0A 1T10A 3KE9A 5LLSA 1NNLA 2IELA 3AZPA 1ZD2P 3JQAD 3VPHA 1JLLA 4L73A 4CQLB 2XQIA 4WJLA 4RZIA 4ESHA 5KO2A 2BPOA 2X23A 4E33A 1OXXK 3EOZA 2CT8A 5JNLA 4ZC8A 3NBUA 3VR6A 3DD5A 4Q6WA 1ZP6A 5IUKC 1DL5A 2YVUA 4FOPA 2BGIA 2FWRA 5IT9A 1XKLA 2JH9A 4HAUA 1BG6A 3JQ8A 4YJKA 1GGFA 2QMEA 4XTCS 3ZE8A 2PUEA 4CCYA 1FZTA 3RASA 2XDQB 1Y8RA 4H6VA 1G8GA 2Q8QA 2Q3FA 3UOAB 1E1QA 4W7SA 2AEMA 1WV0A 3GA7A 2WU1A 3EGDB 3JALA 2ACKA 4KUEA 3IDZA 5C1PA 3CSUA 2C0CA 1XXHE 4QU5A 2O6LA 3MJ4A 2GBIA 3C6BA 2JATA 2PX5A 2A9OA 2P6UA 4YK7A 1V5FA 1VL0A 3KYDB 1VHJA 4MUFA 1QP4A 2C88A 2CSUA 3H5RA 2HHHB 5CG2A 4KGXA 4URVR 4BZWA 3LA6A 2C3OA 3P7MA 2OO7A 2H1RA 5HOEA 2DQSA 1W9MA 4OFWA 1Z6AA 3CX7A 5DYWA 3WHIA 3D4IA 2BKUA 2AG6A 3CUUA 5CLJA 5LR6A 1RRGA 3QWFA 2V7QA 5KSYA 3TUZC 4FQ5A 2EXXA 2DRIA 3L7YA 5T67A 2WKQA 3KLBA 1KC1A 4RACA 3FWZA 1XI2A 4BLRA 3H4TA 2WFZA 2HDHA 4JA0A 4JL8A 4LJYA 3FTDA 2DXIA 4KXVA 4BUZA 4O2LA 4R2WA 3GLFA 5U9CA 3I8XA 1GFZA 3C7CB 4KVZA 1JXOA 1IEWA 4AVYA 3FPKA 4IIUA 1TYCA 3ZHCA 4QJ5A 4QUJA 3QUQA 1JQEA 2CL7X 3DXZA 4MPRA 1YS9A 5KNBH 2JBAB 5K4HA 1P3DA 3DHEA 1HYHA 1L8AA 3ICPA 4E5PA 1E0AA 2IZ5A 1N9GA 1U2RA 2CMDA 3AY6A 3NBAA 4C3ZA 3RYHA 1EU1A 2VXYA 3DD1A 1YVRA 3G8DA 4JUIA 4L95C 1YQQA 1VCMA 3ILSA 2R5WA 1D2NA 4X95A 1AH2A 2Q5EA 4Q9NA 3VYSB 1CUZA 3UOGA 4EGFA 4FW8A 3CY6A 3AR2A 1DZIA 4EJSB 4OCZA 1IOLA 2A9JA 1TE2A 2B98A 1T1RA 4ZT2A 3PJRA 3ETNA 2NQ2C 1MXHA 1U7ZA 4I2NA 4DIBA 3HWX1 5HR5A 3C7TA 1TLLA 1JH8A 5J63A 5JAQA 4GSLA 3I42A 4L0CA 1CF4A 1XOIA 2B37A 1Z4MA 3UK1A 4AJ2A 2XWPA 5T4HA 1YZVA 1X13A 1NVEA 1W46A 2VUHB 4WN3A 4OLBA 3EFOB 3IUYA 5NLLA 3TW8B 4NY1A 2Q2OA 4JYCA 3RKUA 4IFEA 4FYMA 4DTIA 5B1IA 1OOEA 5LYYA 3FDXA 2J4CA 4FWTA 2QKYA 3P26A 1E1YA 2BY4A 2HRDA 2HPZA 1Z8HA 5FTNA 4MJXA 2C2BA 2XTMA 2P79A 3SHWA 4JP3A 2HOQA 3N2ZB 4IDEA 5BMVF 4NV3A 3VTZA 5ALMA 4WCFB 1F2UB 1SKAA 2GO1A 1KZHA 5CB4F 1KZGB 3GDOA 2NVUB 4DDUA 2WQ7A 2WWWA 4HDRA 1F60A 3NPAA 2BVNA 3UV6A 2BEVA 2CDBA 3IILA 4OO3A 3CNBA 4L4ZA 3ND6A 2V65A 2FU5C 4M8KA 2TMKA 2VUSA 1QV7A 4PYMA 3UT5B 3WSVA 4S1VA 1OLUB 3CUVA 1A4UA 2F8MA 2PGLA 2FPPA 1JMYA 1QPGA 2HO5A 4I9HA 3UTDA 4MI1A 3SS9X 5AW6A 3FAKA 4FLEA 3OZSA 1FFEA 1R88A 1LH0A 1W34A 4IKOA 1WTAA 2WUDA 3DE3X 3TUIC 4W82A 2RAUA 2OFOA 4RGQA 1JKMA 2DFDA 3G2PA 2ZVPX 4MKXA 1LK5A 4J4TA 1ECLA 2VZLA 3QI2A 1LD3A 5IEJA 4QOSA 4I14A 4EX6A 5JJ5A 1THZA 3RE1A 1IIBA 3B6EA 2X1LA 2XTJA 1KRXA 1LU9A 1CY7A 2H8GA 5J2TA 2VNKA 4B3XA 4TQ9A 3C3PA 1LWNA 4IR7A 4RGBA 2Y76A 4YCJA 3QKRB 2DUNA 3PHBE 5COBA 1HUQA 3G5AA 1E5QA 4BZPA 2UYCA 2DBVO 1OZFA 2NO6A 2PFKA 3AILA 2W9XA 2J7KA 2GERA 3RIHA 1W36B 3CH7A 4DAEA 1LPBB 3NRCA 5FO0A 4OREX 5AJZA 3U3JA 1CEXA 4F6LA 5CD1A 1PDWA 3Q3VA 2XUQA 3WI7A 4OHZA 1OX5A 1JSCA 2Z3ZA 2XCOA 1H2FA 2BFFA 2MDTA 4I8DA 1TQ8A 1KNQA 2PRIA 3IVMA 1BVYF 2Z2ZA 3D81A 1CDOA 3JQGA 3LLMA 3VU3A 1Q57A 3L07A 1D4ZA 2UUOA 5G1OA 4LDRA 3K9BA 4J0FA 3VR1A 5BUSA 2REOA 3R40A 5A4DA 1LWOA 3T61A 3WNCA 2I34A 5CH3A 3F7MA 3JQAB 1D2AA 2I6SA 4JU9A 1NLUA 1U8XX 1TEXA 5CMLA 3JQFC 5F77A 3RSGA 4GH5A 2YBDA 3SXUB 4C78A 5LWHA 5JS8A 3A4NA 4LWPA 4X3PA 2UYHA 2I8CA 3RSQA 1TB4A 2W6JD 2X0EA 1JYFA 1E5XA 1R15A 1GCIA 4YXWD 1O94A 2Q3LA 4ANFA 1TEHA 3ZQUA 3RVSA 4BBJA 4QVIA 2GK4A 5I7OA 3UK2A 1XCGB 1J4AA 2ETVA 3CEPB 1RWKA 4LI3X 4V1CB 2J87A 1S2LA 1ZHHA 4P22A 3RS0A 3DCIA 4PLPA 4BCCA 1KMQA 1Y7LA 4HAYA 1NWHA 4IMJB 5EMJA 3RDPA 1SBNE 2HCTA 4FOOA 1GAEO 4I1UA 4D9BA 3IQZA 2V59A 2H2FA 4DABA 3U4QB 3R9XA 1NM5A 3L1JA 2H5IA 2ORVA 4Y7CA 2BMFA 3AVWA 2NM0A 3EXHA 4HV4A 4MP8A 2B92A 3T0FA 3NHJA 2O8EB 2VDNB 4DR1B 3D0KA 3F97A 4O25A 1WU8A 1RKVA 2RC5A 4Y2HA 3G1UA 1K27A 3PT9A 3S4YA 3QLVC 2WM8A 5JMOA 1QOQB 3PIRA 3OQJA 1A8PA 5DKFA 4F92B 3IVGA 1D6NA 3L05A 4FYHA 4DW8A 2J32A 3GFOA 3JARA 1RYMA 2IX9A 3G89A 2H54A 4JX8A 4KQKA 2ZAGA 4RAOA 1GAQA 2F9MA 2WSSA 4R1UA 2NSHA 2PGJA 4OJTA 2QSJA 3X1WA 3R5JA 3TMAA 3MJDA 1SVUA 2B8WA 2JRLA 3CM0A 3GEDA 4QPDA 4UBMA 5AQ1A 3L46A 2QTZA 2R1UA 3EHEA 3RM3A 4UTZA 2X8JA 5K0CA 3CLSC 2KX7A 5AVZA 1OB2A 1XZDA 1I9GA 3AERA 3FGPA 4J3NA 1NN0A 4XX0B 4TKVA 2C5EA 2QTHA 2I03A 4LAFA 3DPIA 3PQ4A 4XYLA 2XF8A 3PEUA 2XDAA 2CNOA 1U7HA 4KQ1A 5BQ3A 1GPBA 3EJWA 3THXB 2J3EA 2O0MA 4X6YA 3A1CA 3F8TA 1W2WB 1KJJA 4HYQA 4K1LA 1FNBA 1HL7A 1DKMA 3GZNB 3L8FA 1EUQA 1B26A 1ESNA 4MJ3A 1CERA 1RRFA 2TSYB 1LBHA 1N7GA 2OCBA 1BQ3A 3F0TA 4FIZA 2GN4A 3AF4A 4HYTA 4LYJA 4QYTA 3R8XA 4BWVA 3CW8X 3E82A 2VBIA 4CT5A 1FXWF 1CK4A 3A32A 2YJTD 2I7TA 1GPKA 2OCYC 1BJRE 2D1FA 1SCKA 2W83A 3GDGA 3BL6A 4OK3A 3UV7A 1KJ8A 3A4YA 2VDUE 3KPWA 4WXPA 3SYNA 4DC0A 1VC2A 2H1CA 4LNUB 4BKOA 2AJTA 1ECCA 3NANA 4ALKA 3VRHA 5G1PA 5IVKA 3LQKA 2OV1A 4ZC1A 5KJCA 3A7DA 3O9VA 3CX8A 4DLAA 2CWWA 4LXQA 4ALJA 4QGSA 2IHNA 2DE0X 2B78A 5J2TF 4WK6A 3R3JA 1RZRA 4G5RA 2FSPA 3I0ZA 4JZYA 3V6LA 3OIWA 2OOSA 1P7YA 4ZRDA 2D0PB 2IZ7A 2VF2A 5L95A 3DAPA 2RAPA 3G8CA 1KQNA 2WVJA 3DO6A 1FDVA 1FJHA 5EMLA 3DZFA 4E5DA 5K6AA 3GJ4A 1JW9B 3DVLA 1G4HA 1U0TA 2B4KA 3PNVA 4KMOA 4R9NA 3M6AA 4UDOA 1K2WA 4UUPA 5LUAA 3G2MA 3QUSA 3A31A 5EQTA 2QI9C 3PKZA 4DDHA 3ZYZA 3CZRA 5BV1A 1Z5NA 4JODA 1UDRA 2GN8A 1QVRA 1FQWA 4YI3A 2CN1A 4WEQA 4DCNA 3WL5A 4XOUA 1BC5A 4PQEA 4FNAA 4ENWA 1QHEA 3E2MA 4A27A 2PD4A 2FR0A 3FWYA 2WA2A 1QK3A 3ISJA 1ECFA 4HPWA 4S1TA 5EKSA 1CY1A 3DBIA 5A1JA 5F21A 1M1XB 1H2RS 4LXGA 3UUEA 4A0SA 1XTRA 3U4IA 4GX1A 1SOMA 3WMEA 2NP7A 2ZRBA 3E0XA 4BV9A 1FDIA 1TK9A 2FSIA 4ZWNA 2VJCA 3UJ3X 3M9WA 3BH6A 2P9EA 2NQTA 3ITDA 3EPLA 5GADl 2ZTVA 2ZI6A 3WC4A 1AC5A 1K8QA 2ICAA 3PHHA 3TGPA 2V1XA 1QQBA 1W4BA 2VJKA 3FN4A 2RGUA 1OWPA 3K2IA 3LQ1A 4MP3A 4N7MA 4RL6A 3WS7A 3AR9A 4QX6A 2ZE5A 4OHCA 2XUKA 2XCLA 2BMDA 4MVJP 3CRVA 1L5LA 3BD9A 2WUGA 3NDPA 4QTTB 3E1GA 3KPVA 3OQHA 1UJ6A 1SHJA 2CCGA 4TN5A 4GBMA 3GGOA 1R10A 4RHTA 4K81B 1XMPA 1H8EA 2P75A 2B1IA 3D0QA 1UFQA 4MCHA 2WU8A 1JIVA 4OMUA 2PLAA 5DRYA 3HJCA 4XGQA 1QAOA 3RGGA 2OXFA 5E9AA 2DOKA 2EKQA 1KZ9A 2QMQA 3IKJA 4Q7LA 3SEQA 3UK6A 1RXSA 4HK4A 2JLXA 3I39X 1FMJA 2C9MA 3LWDA 4YRBA 1I2ZA 2O06A 4H7DA 2BEUA 5L7YA 1RHMA 5TJ9A 2H4ZA 2WHRA 4N7JA 5K9ZA 3D6FA 4ZT4A 1C1DB 2GN2A 2GILA 3QPBA 4H7JA 4ZOCA 4F6CA 5B3JC 3WGIA 4TMVA 2JHAA 1XVUA 1DIBA 3MWDA 1Q2XA 1QIJA 1M8PA 1P5FA 3BJMA 1SRRA 5T6MA 1A9ZA 5IN5A 4EHJA 5JNSA 1JEAA 4WLVA 2G77B 1M8KA 3HXOA 1SUDA 4RD3A 3RSFA 1TZ2A 3NC1C 3EODA 3MLBA 4K8RB 4JVSB 1NX9A 3WB0A 4EIWA 4B8WA 3X2FA 1YB4A 5KSOA 4CLHA 2V6IA 1GGMA 1TC2A 1F0PA 2VWPA 1SKYE 3GEBA 3ON5A 4M87A 4WLNA 2P3OA 4MRVA 4NE9A 3FRJA 1YZQA 5G4KA 5IVIA 2PZLA 5F78A 3WLNA 3TNLA 4F97A 1JDTA 1XE3A 1ZUWA 4DCSA 4N3NA 2JGDA 3O4HA 4PC7A 3HU2A 3E9DA 4HWTA 3WBBA 2YV1A 3QBVA 4BWYA 3IOMA 2X4GA 3QH4A 5HFAA 2XQVA 2YUTA 3A04A 3AT1A 3OX2A 2HWYA 3IDSA 3B5IA 4II7A 4FDAA 2Q1TA 1AMNA 2WQ6A 4JI7B 2NUAB 2O07A 5DV9A 3ZE1B 4Q9JA 2FZ4A 1DVRA 3UWPA 2ZANA 2ASVA 2QTRA 2A0WA 3LV8A 4IO1A 3N2LA 3T3EA 2WJPA 5EZSA 3UKJA 4PFJA 2CLLB 3KXIA 3OE5A 5LQMA 1OX4A 3OZUA 3TM5A 5CFQA 2Y67A 1HYGA 3ZWCA 3C1AA 1CRWG 3W8DA 3W5CA 5HPYB 2JAHA 1M67A 2VKQA 5JSHA 4G5HA 3PXUA 4MRMA 3A2KA 2JGEA 2YKGA 3NVMB 4KR3A 1O77A 4G97A 3KKEA 1W6RA 3MEQA 5GZ6A 2R1ZA 4UCXA 4LDJA 2YYYA 1Y3FE 2H07A 3U7GA 5J5AA 2WW8A 2GEJA 3HI4A 3TOSA 4TSKA 3TFOA 2EP5A 4DLXA 5BYKA 3TZHA 4DSAA 1DTWB 1NBMD 3I53A 4UXHA 3ADDA 4BE4A 1TDJA 2P77A 2JCBA 3WGLA 4LRYA 1ZGJA 1PZHA 5H59A 4G0UA 4OB6A 3KV1A 1WXQA 4MZDA 1G8YA 1MH1A 4RTLA 4OYLA 2QL7A 4EI7A 1BCSB 3HJNA 1JVSA 1CETA 3JZFA 3RV4A 4Z9AA 5BSWA 3QYAA 3VR4D 2HNBA 2TYSB 4BV2A 5HJEA 2HREA 2P1ZA 1UJMA 3H7IA 1NKSA 2KLBA 3AYZB 3QA3E 4P4NA 5A6SA 1M75A 5KIAA 1PL8A 3C3AA 5EGNA 2XW6A 5K99A 3KDSE 1XTJA 1ACLA 2ACVA 5KINB 5DE3A 4RQTA 1M8FA 3NIDB 4DPLA 2ZTHA 1B16A 1PJCA 5AH0A 2G4CA 2OP1A 1C1HA 3B3AA 4UNIA 1BIFA 1E4EB 4PPGA 1DI0A 3IJRA 3TLXA 5JWOA 4GAEA 5HCUA 3R6GA 1WBDA 2Y1GA 5IKOA 2BMWA 1LK0A 4FSHA 3KQQA 3AF0A 3SKXA 1T24A 4WZBB 4Y2UA 3CB4A 3L8YA 3R4CA 1P4AA 4OI2A 1GQRA 1L8LA 1MRSA 1JF8A 1W0CA 3H18A 5TMDA 3NKVA 3OU7A 4JP1A 1JU4A 2O4CA 2VAMA 4TWZA 1PEAA 1V71A 2CEKA 2RGRA 2RHGB 1PK9A 2XMPA 3OJEA 3VDRA 2HLDD 3TQQA 4IV0A 1XDUA 3QE2A 3ZD6A 1BH2A 3EUEA 3WHLA 4DILA 1GN9A 4X20A 3W1WA 4F4JA 1FYDA 3PEVA 1G6KA 4ZV9A 5E8RA 1NC3A 3VDMA 5ETJA 1TM2A 1G3QA 2HU8A 1UPXA 1OZGA 2X5NA 3G9TA 1IAQA 1ZSNA 3R3UA 1G98A 4BB5A 3G0CA 1MJ5A 5CB6A 1JIKA 2F3SA 3V33A 4LYEA 1BW9A 4FJ1A 3NXSA 2BWJA 2OL4A 1I3NA 3GRVA 4L8GA 5IARA 1CQIB 2W2OA 3EIXA 4PFQA 1P0QA 4AS1A 1OX6A 3N8KA 5K6TA 4I0WB 2E0IA 3FCAA 4XJTA 2WPNA 1QQ6A 1HXHA 3H9UA 3QVLA 1J00A 3KKZA 4ICIA 4WV3A 1C2YA 3L7CA 5JLJA 4NSNA 5J5CA 3I76A 1GA1A 5JU6A 4GDFA 3K94A 4DV6B 1O89A 5FL7A 2ZSAA 4U7HA 4DA8A 3PA6A 4F2HA 1QRRA 2R5NA 5ALSA 3VI3B 1UJCA 1KQGA 2VQEB 3I0MA 2R6JA 3JATB 3NEYA 2QVZX 1UOOA 1B1AA 2A9RA 3BIXA 3CF4G 3PQ8A 2E1RA 2MSDB 1JX6A 4S1WA 2JCSA 5BNFA 3I12A 3PQFA 5BO5A 3DL2A 5JJBA 2IYLD 4YAGA 1MG0A 1OQAA 2J5RA 3LVRE 3T8YA 3FYCA 4J7AA 2I8LA 1DWUA 1F51E 2JAQA 1XKXA 2DPXA 2IPLA 1TW3A 3AJEA 3SNHA 2PUJA 2VDWA 4I55B 4Y6QA 1J6UA 3PKIA 3SMQA 2D2IA 2P91A 3QOXA 1J8DA 3UG7A 1QP7A 2Q4OA 3BZWA 1M5UA 3C39A 3DFKA 1BHQ1 4LKOA 4NZ9A 5TMBA 5H3CA 3ZJ4A 4KO2S 4I99A 1VGRA 4N5LA 5JYBA 1E7WA 2HV9A 4YP5A 1FJXA 3V8NA 1FRQA 2WAYA 4IH1A 3IJ5A 3ZDEA 4TYMA 4ATNA 3GOHA 4ZEWA 3P2IA 1JG1A 4K6KA 4E09A 4D0LB 4QGHA 4ZAFA 3BG5A 1HE2A 4YJ3F 5DEOA 3MJEA 1H3EA 5HSGA 4RQBA 1C3JA 2Q6VA 4GIBA 1N77A 2FUNB 2I7VA 1FDRA 5FBHA 1VJ5A 2QS9A 1Z63A 1U7UA 2EFYA 3AEZA 4QELA 2VAWA 1VLMA 2BUBA 1E3EA 3SNKA 4MKIA 3WJ7A 3HSYA 1JB9A 4OIMA 1E1NA 2IXAA 2Z1MA 5B58T 3RLFA 4B9EA 1IWBB 1ZYUA 1HLGA 1DBQA 2P4UA 5D51S 1FFDA 4P3XA 3LTNC 1FP7A 2NXNA 2X5OA 3ZWMA 3H11A 3EZ9A 3FFWA 3M4YA 3EXEA 4QUIA 4R9UC 3AESB 5D3MA 2A9FA 3IFSA 1CY6A 3IEPA 5I3ZA 5LQUA 1JU3A 2G5TA 3H5VA 2Q7XA 3K30A 4NAUA 1YUNA 4RKEA 2G40A 3RQSA 1ND6A 2JZNA 3V32A 3I9LA 1WTCA 1ZQ9A 3B6JA 4I81A 5CYOA 4B4VA 1U3UA 3FNGA 4OU4A 5J43A 3SIRA 4W9NC 2EBWA 5I9TA 1Q7RA 1Z0AA 3EQ7A 3RC2A 2VJOA 2ZRQA 1UWCA 2QU8A 4WD3A 4ZQFA 1CS0B 3D5EA 1AY0A 4DEYA 1Z16A 3VDXA 3FM9A 5J5VA 3QWAA 3NH9A 2H17A 2ZQ5A 3A06A 1WSBA 3TN7A 2SKEA 3U37A 5JASA 3D2BA 4QXOA 3HJBA 3LBHA 1ZW1A 4EATA 4QBKA 3WV4A 3IERA 4YY3B 3IQDB 4LRWA 3MA0A 5ES3A 4BN0A 2FA9A 3RVBA 2HSJA 3EZ6A 4DIMA 1P4SA 4N5IX 5KJEA 4YBRA 3B2NA 2YHBA 3PPYA 1RDFA 4YRSA 5TF4A 1Y5MA 3I2JA 3DCNA 2PUVA 2IX3A 2JFOA 1C30B 1Y1TA 2WLTA 3GFQA 3PQ3A 4OAPA 2FQQA 1XALA 5ALOA 4ZD6A 2HQ1A 3S29A 2IT1A 1XF1A 2ZT7A 4EYQA 2QVGA 3KYBA 5KYNA 1GL9B 3GH1A 4MKHA 4C89A 3ZVMA 1DXQA 1CUEA 1SHTX 2QX6A 1T4DA 4PYRA 5BN1A 1Y5LA 3DOCA 1GPAA 3CZAA 2RHDA 4M4SA 3EY9A 4MARA 4LMRA 2FQWA 3NJRA 3NBFA 3DAHA 4UAGA 2A7QA 4C14A 4A15A 1HY3A 2FB9A 4QDZA 3IT1A 4JBXA 3USZA 3FFTA 2IUTA 3C16C 1V1RA 1IZZA 1FRVA 1CQWA 2G1UA 4YEDA 5EP1A 1AQNA 1CUFA 1Y6JA 3E81A 2H4YA 3MRTA 3VV2A 1H6BA 3G0GA 3WQSB 2B5OA 2W00A 2O5EA 3F3MA 1E3TA 2R4TA 1QHNA 3G3EA 4LE2A 1CZOA 2QMYA 4L8FA 4U2KA 3P27A 1HLDA 2JLQA 3RVOA 3IT0A 1WP9A 2MINA 4NDZA 4EECA 2O9JA 4CE6A 4I3FA 2BBTA 2COUA 4BFCA 5ARCA 4K9PA 4TL8A 1YDWA 1U2ZA 2DAPA 3H8WA 4EG5A 4TTJA 3H87A 3FDJA 2I62A 4NDNE 4OI1A 3CRMA 3KR0A 3TWOA 1ADYA 1SUBA 4N47A 3UMRA 1KMIY 1NMYA 1QDUA 4MYRA 1OC4A 1U81A 3FSJX 4BX3A 4B4WA 5IKPA 5KU1A 1X7YA 2ZITA 4G86A 2VJBA 4D3YA 1OFUX 4FE4A 4MKGA 4H08A 5IEBA 5JAMA 2EQ5A 3QV1A 5BMVB 1AF7A 1NDQA 4L0MA 3DSRA 1OKKA 2EFCB 4LDZA 2WT8A 4MI6A 3ZWDA 2A9QA 4KR2A 4EW1A 5CB4B 4IW3B 1E1MA 2FTKE 4Q4LA 4U2DA 3GLVA 5EKUA 4FLFA 5DHSA 2H1HA 3I9JA 4KP7A 5IH3A 4WOJA 4QTYA 2XKKA 2XVZA 2P6RA 4HS4A 2ODAA 1QZUA 2Y77A 2AZ4A 4HP8A 3D9QX 3I9OA 4JJEA 3S2SA 2CWDA 3T3PB 1D6SA 1TECE 2Q0QA 1AE1A 1XNGA 3SZLA 3HA2A 4B7AA 2WAAA 1TMYA 2EAUA 4KW7A 4M1WA 1P8JA 3AR3A 2IV7A 1RBZA 3M70A 1E5DA 4EYKA 4G4IA 1N7HA 1PJ8A 1R0LA 3HKCA 2RH8A 5BORA 1S4QA 3NGMA 2DF8A 3WWOA 1KI7A 3TLMA 4AO8A 3HABA 4EEXA 1S2OA 1JLLB 4PQFA 4YGYA 3LFUA 5FV7A 4RE5A 2PL5A 1WPGA 2I22A 4KUHA 4MRSA 5AKKA 3VNRA 2C82A 2YJ4A 5CVTA 1EJ0A 1I2MA 3QMPA 2RH5A 4PBSA 1GRQA 3EPPA 4UNQA 1O94D 3Q7RA 4OLJA 4PNPA 1N5DA 4CCYB 4RLHA 3LP5A 1R2QA 4LY3A 3FFAA 5ESRA 1N8NA 4MKRA 3R7AA 4A5OA 4HJRA 4D0SA 1YCHA 4CV0A 2BFCB 4MVWA 4YRJA 1CDZA 3ICEA 3NPMA 2NO9A 2ZWIA 4P80A 3JALB 4LYAA 4BMXA 3E5NA 2PX3A 3WR5A 2P2GA 5DK6A 1P73A 1Q92A 1RE0A 1J2YA 5ALUA 3O0TA 4KQ6A 4PSAA 1RWVA 1A9PA 4GGPA 2QN9A 3EWSA 4O4JF 4JOCA 1C7IA 1TMKA 1U2QA 5A5EA 1KKUA 1UBUS 3BK2A 3L6OO 1RMTA 1J5PA 2YMQA 4FHCA 4O4LB 1S3SA 2O2XA 1EX1A 3EDQA 4YLEA 5F12A 4BB6A 5AICA 4QC2A 2WI8A 4RF3A 1R6TA 4DQLA 2H51A 3O3MB 2P4SA 2GXUA 3K8QA 3NU1A 3DTYA 4N0DA 1CTQA 3HDQA 4BS9A 5JOQA 3BWCA 4OQYA 5CLQA 4ZICA 1JR3E 4GQIA 4N5NA 5KWEA 3DDHA 3A3OA 2ZRPA 2B9VA 2WSSD 3T95A 4CEJB 2QPLA 4V0OA 4O59O 3JVEA 1MTZA 3K0AA 3L0ZA 3VU9A 2PA3A 3CU5A 1QVVA 3WRXC 3V34A 3PDUA 4LZPA 3QG1A 4ZO8A 3W05A 4B43A 1COWA 3GNTA 1SQSA 4EY6A 1AU9A 4LOIA 1YAJA 1NXWA 3LDUA 4DQKA 4K9QA 1Z47A 3U3KA 3RT9A 1CB0A 4OXNA 5FJIA 3CNLA 3LL4A 1BXKA 3QRWA 4XIGS 5YASA 3NEPX 5EVJA 2OO5A 3HMQA 4PC1A 1N9GB 1HE8B 2WF8A 4RIHA 2VF5X 3RARA 1N2BA 2BUAA 3ZGNA 3R8FA 2D7JA 1N2CA 3P2JA 3EB9A 2EHJA 5L8VA 4KDEA 2DQ4A 3M2TA 4YASA 5AXAA 2IYFA 1JI3A 1V48A 1SURA 2GD6A 4F1KA 5E3HA 4HD8A 1IBKB 2WD8A 3VSEA 4AY6A 2WU4A 4G23A 4P81A 3OIGA 2XUFA 1W2HA 2Y99A 2J48A 1T3ZA 5EXPA 8AT1A 10MHA 1V9SA 1L5OA 3KIPA 2ZETA 1CJTC 2HXSA 4N7BA 4Y2YA 2JW5A 1CNFA 1JYSA 1KAEA 4RVNA 1RLJA 3CS3A 3GJ7A 3MBKA 1RKQA 1X87A 5J4YA 2QTLA 5F35A 1WPQA 2ZK7A 1FK8A 1WF3A 4DNOA 4KMSA 4Z1MA 3B1KA 3DMHA 1U0NA 3GDHA 2EZTA 3KOXA 3H19A 4BO6A 3PGXA 1R6BX 1AURA 1G5TA 1KSHA 1QV9A 1VMAA 2OD2A 2YASA 1DARA 3L6UA 4IZIA 1I3MA 5GMOA 5LXTA 1FIUA 5BQPA 2P2ZA 3V00A 2GD0A 5MN4A 1AKQA 4RZSA 3ZZNA 1N8TA 1P33A 1FQKA 1QC5B 1Z6XA 2G28A 3HNOA 3IUJA 5E9WA 3WB1A 1CZKA 5BXQC 1N2ZA 4AMVA 3ZJVA 3C6ZA 1PTJA 4HDRB 2RE8A 2AD5A 1XF9A 3ICOA 3LAWA 2BUCA 3MRVA 4BEWA 2OZPA 1XEWY 1X70A 2HUNA 3A3PA 4OBEA 3FE2A 4E5MA 1PZXA 1YHNA 1YT5A 2L19A 2JCXA 4HZGA 3KVRA 3GPIA 3O2NA 5B1SA 4DR6B 2WR8A 3N5CA 2QRKA 1KTVA 2FPPB 4HDSA 2IWRA 4EAAA 3HDJA 3PC8C 3ZE6A 2BZSA 2HFKA 3DA8A 2A14A 3HACA 3I2HA 4LJLA 4EHFA 1RQLA 2XCQA 5FPPA 1PI3A 4K7JA 3PC7A 2OSBA 2IU3A 1CC1S 3TBFA 3H1EA 2O2YA 3EZ7A 3HVKA 2NPOA 4WOKA 4OL9A 3ZWXA 4OYRA 3OE7A 2X6TA 1BWRA 2B7CA 2YVKA 4PQGA 5E2IA 4OA8A 2C3PA 3K0CC 4G5FA 4J9VA 4NI5A 5CDYA 4DA0A 1HMPA 3ER6A 1ZVMA 3P9RA 4BXOA 1PWXA 1UKVY 2RGGA 2WSYB 3M1LA 3KVVA 4CM7A 1X94A 4RV9A 5DCUA 5J2TB 2J3QA 2JDIA 4JJZA 1RZVA 1NF3A 2KBEA 4JLMA 4N6GA 5ALNA 5EMMA 4DNXA 5L6MB 1B76A 3TM4A 1EUDA 2XB6A 2YUIA 2ZS7A 4QYXA 3CJTA 3QUCA 1C7QA 1Z17A 1PQYA 2XZDA 1MGPA 4HXEB 2H31A 3BWBA 3E1KA 3PNMA 2PNFA 1AB6A 3I6MA 2BRUC 3LE8A 2C00A 1OAKA 1W85B 1P0CA 1XCJA 5JRDS 3AFNA 1ZH2A 1ZJJA 2K2QB 3C4QA 3O4FA 2WOOA 3ZUGA 3F2VA 4ARUA 2FZWA 3AMVA 3GK3A 3JWPA 2DFVA 5JD3A 3QKSA 3REOA 1GL3A 1XYGA 4LMBA 2O14A 4M9QA 1XZQA 4X0EA 3BRCA 2VQ3A 5BOVA 1IVYA 4X7MA 4ZK6A 1MNQA 1G8FA 1WL8A 5A2QA 2LPMA 4TMTA 3IIMA 3VYTB 3COSA 4JB0A 3ZPXA 2ZKIA 4JK3A 2JEOA 3WIUA 2WDZA 4XD2A 5A3VA 2O23A 3H99A 4RPIA 4P98A 5IBQA 3NTVA 3C5HA 1E60A 3CG4A 2Z8YA 3HY6A 2P90A 4RA6B 4OBBA 1JSZA 2OENG 1J9GA 2AC2A 2Y2UA 3U09A 1IB6A 1DIAA 3EAGA 4FI3C 2PSJA 4G3XA 2Q9AA 2EL7A 3ONDA 2W2VA 4I50F 3THSA 3CYFA 1V26A 1BKDR 5BN4B 2ONKA 1IPEA 2TECE 4B4UA 3WYFA 2P3LA 2PGXA 3DBRA 3FF1A 4JLSA 5F2OA 4J2OA 6NULA 3PWZA 2IEYA 2Q4RA 1QAMA 3OOWA 3SYRA 4E4YA 2BE9A 1XD2A 2VSFA 4G09A 5CU7A 4ZMBA 2CNWA 2UYQA 2I3GA 2B21A 1Z5UA 2JIPA 1K86A 4GGOA 1OFIA 1NT4A 3H16A 3DHYA 3ET4A 5IM5A 4AQDA 1JHRA 3CPEA 4AK9A 2UVPA 4LV8B 5AWFC 4Z4GA 1H1TA 1LJLA 1QWSA 3WGTA 1OB5A 3QNUA 3GHYA 1PKXA 1EX9A 5HMLA 2QU7A 4NZMA 5A04A 4KQXA 1JIXA 1MLDA 1G5QA 2ZIWB 3F2IA 5CVCA 1NRJB 2JHCA 4FYPA 4AU1A 1EA7A 2WTXA 1D2GA 3I6BA 4ER7A 2OCGA 4NXNB 2P4EA 1QTRA 1PCXA 4R9VA 2D4AA 5ARDA 4Q7QA 4E4TA 1KYZA 2EGHA 4W9MC 4NJEB 4Z1OA 1DBRA 5CPBA 4Y2XA 3QUTA 3B8EA 4JGBA 1L3IA 1ZIDA 3AINA 1JJFA 2UZ4A 4M8IA 2P5UA 3LYHA 2PY6A 5EXSA 2ZAMA 3CRW1 2COKA 2B4AA 1HFKA 2EIXA 3AUXA 2DJIA 4WZZA 4XUEA 2JGFA 3JCZA 4PG6A 4RETA 3AERB 4WESB 1JNYA 4BNIA 1SBTA 1NGSA 2DFKB 3PNBA 3IVRA 1Z45A 4JP8A 4C05A 2DERA 3KSDO 4M0UA 3N2GA 3BFVA 2FG5A 3KSAC 5E4JA 4OHRA 3GF4A 4BO0A 5L40A 3ZLJA 1V16A 3OCXA 4EBBA 1JA0A 4CU2A 3IEMA 3HB4X 1WWKA 5T4EA 4NXMB 1AZLA 4XWTA 1D1QA 3O3NB 3AHGA 3U13A 4M0CA 3V8EA 4A16A 1T2FA 4DANA 2J6IA 1FFBA 3DH0A 1EVZA 3R0VA 1MEJA 3ZW9A 3TQRA 3U4AA 3MWYW 1U1DA 4RANA 4I1VA 4JNCA 4MR8B 3UCXA 5C2JB 1XP8A 1HDXA 1QIHA 4RKQA 5BR1A 5B4TA 2VQFB 4G4GA 2WSBA 4XQ0A 1Y80A 2CZGA 5HA5A 4D4LA 4ENPA 4JI2B 1D2EA 1ZCZA 1N2JA 3WDKA 3O8QA 2AOTB 4PW0A 1JR2A 1UPFA 3ZHVA 2ZIFA 4NPHA 1NBAA 3SOZA 4IY1A 1ZEJA 2BFOA 2ZIXA 3O4IA 4OB8A 1PW5A 1NKVA 2HCRA 3PRYA 4R8SA 4CL8A 2GEUA 1VBMA 2E5LB 4YFYA 1FU8A 2AW3A 1Z39A 3TO5A 1XB2A 1V8FA 4KLRA 3UENA 1YR7A 1H65A 2JFWA 2P2DA 3I1IA 4EX7A 3BGWA 2NTEA 2JD2A 2GAOA 5LQJA 1NN5A 1ZXLA 4N5HX 4C87A 4AULA 4X5OA 3M1IA 1KOLA 4CF7A 2A8YA 4QOJA 5LCXA 5TPWB 4WXMA 2A78A 4HF7A 3VPDA 3E6AA 1GL7A 2Z4TA 5FNZA 3ESBA 3I9FA 1HEYA 1C0EA 3F4KA 1C9DB 3SYTA 2CGEA 1II9A 1XLWA 4G1BA 2ZSJA 4OFXA 4HVLA 4XWYA 4DGQA 2O54A 4RK7A 2IDKA 1VSBA 1NA5A 3CVJA 1U0HC 3KU4A 3MOSA 3R0XA 4I2VA 4TTTS 3N2EA 1PLJA 4WNIA 4M7RA 2CLIB 3KOUA 4MWZA 4X9XA 4H7PA 2PUDA 5KS2A 3IDFA 3LHFA 5GM2A 1A2KC 4LUCA 1Y5RA 2VHTA 1PG2A 4MVCA 2BI4A 1NP6A 3WQRA 1EHYA 1LSJA 1WCWA 3Q7TA 3LNCA 4KPUB 4D4GA 4JUAA 2VIIA 3AKDA 4IWNA 1EINA 1OPRA 4D41A 3C3DA 3I83A 3UT0A 5FUVA 4IDGA 2MYUA 2LVBA 2DFTA 3KK0A 1QKKA 2OLKA 1OGIA 3ED5A 4EB8A 4F5WA 1FP4B 3ECAA 3PYXA 2AMYA 2C04A 2J0VA 3BSYA 3CLUD 3E7FA 3IVCA 5DN6D 5JALA 3KOMA 4IUBS 2YH2A 2P9BA 3BWDD 2HEGA 3GFFA 3KV3O 3SF0A 1AV7A 3T5BA 4YDQA 3UMMA 2ZBFA 4ZZ2A 1M9NA 4N5MA 4LV6A 1E2GA 1YDFA 3CR7A 4HNSA 1I94B 2UUBB 3EIHA 1RWBA 3BRWD 3EF1A 4KAFA 2GPYA 3OKFA 1NVAA 2P2NA 3KZOA 4MEAA 2DWPA 4CCWA 3WIEA 1H5NA 2GHIA 1D2MA 2WA1A 3ANYB 4Q1BA 4RV5A 5B7PA 2D7CA 2FDRA 4UPVA 2QRVA 3RTAA 3ZHZA 3Q3CA 2O2EA 1GWNA 1FU4A 1UH5A 1W93A 2PAFA 3MSCA 4BYMA 1ZOPA 3EVDA 3K20A 1U04A 4LXUA 1K89A 3UHPA 1IYZA 1NBHA 2NIPA 4QUHA 4YP6A 4D6YA 3G68A 4MB6A 1CQJA 2XCSB 3G2LA 1GV1A 4OQFA 1R8XA 1SIUA 4PZPA 5DDIP 4AZ0A 4TYPA 3MWDB 1XU9A 3FHJA 3R2JA 3GLKA 3RSZA 4KE6A 4QA9A 4CMIA 3FDFA 4NE2A 1SXJE 3E3OA 2G9ZA 4IINA 3KQLA 4JLOA 3FPBA 4FC7A 1XLTA 4RADA 1AQJA 3ZLTA 5JQWA 4BBAA 5FQNA 3I5AA 3MGCA 4QOIA 2BH2A 4GNRA 1WZNA 1VCNA 3T1VA 4GMFA 3E7XA 3MFYA 4QYMA 1UK6A 1KDYA 1XZIA 1SJ9A 2VF7A 3GWZA 2R6GA 3ITNA 1HDCA 1YRLA 3IHLA 3KKKA 4JT9A 4KVGA 4MO2A 1YS7A 2RHBA 3I92A 3QEMB 3HCAA 1HT0A 2VWHA 3F8SA 5A3SA 4C4XA 4DMCA 4EO7A 2BP7B 3OIFA 1H2ZA 2EJCA 2J3KA 3D7KA 4C9BA 2Y05A 3K0FA 5IJ9A 2IA5A 1OH8A 1PR2A 5IAOA 5DP1A 1EK5A 3F5QA 4IOJA 5A3RA 1WULS 1W75A 1OU0A 3SXJA 4BP8A 1TA0A 4HVCA 1L5MA 1ISGA 1RTKA 4LVUA 1RXVA 3WLKX 2RHCA 1OFHA 1RQ7A 2NO7A 1W2GA 3P20A 1ZCBA 3SZOA 2ZB3A 1OH5A 1YQUA 3U62A 1PR0A 4BRSA 4KXFB 1OX4B 4B4OA 3UH1A 1NQXA 5K3FB 2P6PA 1WKBA 1LVGA 4YJ3B 4LBZA 3WDSA 4BTEA 5H7XA 1T8YA 3EASA 5HDBB 5KNCD 5TIIA 5HBGA 4C88A 5ALGA 2WJWA 1TYDE 1T2AA 1BQEA 1Y6QA 3WGJA 5ALEA 5JCOC 3QNMA 4CLXA 4O33A 3WGHA 4CQNA 4YCCA 2A0FA 3I30X 3GCDA 2VKTA 3SX0A 2CLOB 1V8DA 2PN1A 2KE5A 3IVAA 3K70D 1ID8A 4R3WA 1C41A 4HTFA 2D5IA 4UUMA 3GRZA 2JIDA 4E31A 1E77A 5AXCA 1FS4A 2HHJA 3B36A 3OEED 5L3QA 3B3JA 3DOIA 3S2UA 2ETXA 2HA0A 3LCVB 1FX0A 5DWDA 3ORFA 621PA 1ZK4A 3SSAA 1Q3KA 3FTNA 3B48A 1ZLXA 3IMCA 1DQRA 5G0SA 3HKDA 2WINI 4FKMA 5A6SB 3A37A 2VDOB 4GQBA 1RC0A 1VYUA 3AKZA 3IAS1 1JEEA 2DTDA 4BQIA 2B3DA 3I5UA 4ZGGA 1GDHA 1LTKA 2CDCA 4PCAA 2VP2A 3H2HA 2Z2IA 4Y30A 1NBEA 3EGXB 5D1NA 1L5GB 2G9VA 1VSVA 3ZV7A 2I71A 2RGAA 3EQ2A 5FR1A 2AHOA 3H2GA 2E85A 4MW9A 4G84A 4LJAA 4J1TA 4YUAA 1V1JA 2DUWA 4JBGA 4Q4DA 4R2XA 2C7OA 3FYUA 4GLBA 2R96A 3CXRA 3TH5A 2PLWA 4Q9HA 4GX0A 5AVWA 1NFQA 3FXAA 2Y1OA 4G0VA 5IZCA 1B6GA 2QY9A 4WL0A 4ZOEA 1PNOA 1FU7A 3CRRA 3CX4A 2DWOA 2BM8A 4YCSA 2PSSA 1BAPA 2QVBA 1D4OA 5FPHA 4CWAA 1B0ZA 3DKPA 4X20B 1TMOA 2WJZB 4YRTA 3T41A 4FSDA 1BMFA 1ZESA 5LZ8A 3JVDA 1DP4A 2XJ4A 5F76A 2RHRA 2IYPA 4UMEA 4O1HA 3WGKA 1PG0A 1ORWA 4P3NA 3ROFA 3G2QA 4BQQA 3HXQA 2FJUA 3CO0S 4KSBA 2FPWA 2R1VB 3TE7A 4C6HA 5JV5A 5FORA 4G2TA 3S1SA 4G63A 3T94A 1UOEA 3H0KA 3O82A 1O6GA 1J56A 3R3SA 5I51A 5AM5A 3JWEA 4Q7KA 2G36A 3C3JA 4J1SA 1WLSA 3KJZA 2IU4A 3QU7A 4L7VA 1NVFA 3NDRA 4US1R 1JYEA 3TS1A 1L4BA 5DNYB 3AWIA 3X3HA 5B36A 1X7XA 5LP6A 1EZ4A 2Q99A 3PFBA 2EATA 3UZUA 2HA7A 4YJ2F 1J9EA 5DBOA 4X90A 4YAWA 1M5RA 1QH8A 2XQFA 3WQBA 5CHYA 5LMZA 3TIFA 2R2GA 3PF8A 2GF0A 2H8KA 3GRPA 2I7XA 2PTGA 3GLHA 3RYIB 2KM1A 1ZHFA 2FW0A 4IHKA 4PZUA 2GJ9A 5JQGF 3PUWA 3EE6A 3SJAA 4A10A 3TQFA 3RK0A 4BX8A 4ND3A 4YIHA 4FOLA 1G2QA 1MPXA 2V0CA 4LHZA 1KO8A 4NYIQ 4MIYA 5K4AA 3GNLA 1XSEA 1EQUA 4L8YA 5LU9A 2WZDA 4OHPA 3U7HB 1LC0A 4FGKA 4NYJR 4GI5A 3ENKA 1I30A 3UCFA 3L0SA 3TPZA 1JKXA 3B9QA 3PUHA 1GO2A 4OHOA 4ZYUA 1ONNA 3X1KA 3S6JA 5I5EA 1Y1LA 2D1YA 1VE7A 3HB9A 3A6JA 2N75A 4Q0MA 5ENVA 2PUCA 2IBTA 1PJZA 4M49A 4B9AA 4LCEA 3WGVA 3GMTA 2C4NA 4CTKA 1JZTA 2IH4A 3BEOA 4QHSA 4JXXA 1FRNA 2Z56A 3NBXX 3NC0C 4G9EA 4GG1A 2H2WA 3ZE7A 1GXSA 3I8SA 1NUHA 3JPYA 4L9SA 1XP5A 1H2EA 2I65A 4RKFA 2Q3EA 2XT6A 3O38A 4J7UA 5E7QA 3V2HA 3WYNA 4YT2A 1Q1AA 1X39A 1IE3A 3MYRA 5LQNA 3T1QA 5ENDA 1Z7GA 4C4SA 2X9VA 2EYUA 3K9HA 3R6LA 5K09A 1Y9AA 3TJZA 2RARA 4UVGA 1ST3A 4NONA 2G8NA 3KJFA 5T8KA 4PR0A 3H11B 3EXEB 2VG8A 3VTKA 4M37A 2ZIAA 2B2NA 1DQZA 4HWPA 4Q24A 2X2EA 5ALLA 4KSCA 2VJMA 4DG5A 4J0JA 5I9BA 5KTKA 1VYVA 5JHGB 5JYDA 3K9WA 1QZXA 5H70A 3GJ5A 4XWKA 3N5KA 3MNFA 1MOQA 3IQFA 4G36A 2W2PA 3CISA 4HQNA 4O4JB 1ZSYA 4D8TA 2ECFA 4UHCA 1JEYA 4S2UA 1KFEB 3L92A 3NAGA 1A72A 4B35A 1CUJA 2BFEA 3F6SA 3QYPA 2TMGA 2W7TA 1H6DA 1L7QA 4JIGA 4QBHA 4WBNF 1BXGB 3CBGA 3TL3A 1I2DA 1C8VB 3CZ4A 3QX7A 4M76B 3PFFA 5JEEA 1NF9A 2QL9A 3DXYA 1LI7A 1C1YA 1NL3A 5SYNA 1GP2A 2RGWA 5C46F 3M49A 3OX4A 3ZV4A 3O2SB 2AOUA 1U6JA 2XWSA 4AKGA 2B5VA 3LECA 3KVOA 1USKA 4BNUA 2GPBA 1U5BB 2DT5A 3EEQA 4JUFA 3PX7A 1W36C 3L8CA 3Q0TA 4C21A 3U39A 3RUAA 2I87A 2QTMA 1M34A 2BGNA 5K0ZA 1KDOA 1NW6A 2HTFA 3K70B 3KCNA 1WDMA 4HWRA 4H31A 4D2IA 3MS4A 1PVOA 3ZVLA 5FPKA 3AUJB 2Y0EA 3G7NA 5A9TA 1RNLA 4KWIA 4UVEA 3IL2A 4YUZA 1SOAA 5IM4F 1N0WA 5CDHA 1A9YA 3UV3A 4G0OA 4KDFA 1KZ7B 1TUBA 1N3IA 1GQSA 4FNOA 3A0UA 2PUAA 4WACA 2CHGA 4AJ1A 1V1RB 1MKYA 1PUIA 1YQWA 1E2FA 4EZIA 5IHXA 4POAA 4OK5A 1F1BA 3N2KA 1B6SA 4H4DA 5B58C 1KYYA 4GYKA 3GJZA 1ZCJA 4L5BA 4KMRA 4ZVOA 4NJMA 4REQA 3LA8A 3G82C 3OE7D 3N9IA 1SVOA 1UXKA 4TV8A 1ECJA 2QT9A 4J7CA 4D25A 1NF2A 3N86A 1IWOA 5LP6F 2H7CA 3RSLA 4TT8A 1PV2A 1T1EA 2YYZA 1X7ZA 3DFFA 5GY7A 2ZJ2A 4DRZA 4YJDA 1JPJA 2AXPA 1YB1A 2CJFA 5C35A 5KX5F 3N8HA 1NP3A 5JLAA 1NE7A 5LMUB 2IEDA 4QTXA 1OY1A 3AOEC 4TKUA 4Z0PA 4C76A 1JH9A 4RXUA 3P2MA 3V1UA 2R00C 3CRNA 4PF1A 5KTSA 2C1XA 3HNPA 2ZULA 2QPOA 4XPIB 2V8OA 4BE9A 2BTOA 3WK7A 1UKBA 1WMFA 3FBTA 4MDYA 3TLCA 3QVWA 1JFRA 2C9DA 4LQ4A 2BF7A 5SZHB 5MFPA 2OPHA 5HM8A 3GT4A 1HH4A 3CTMA 3P45A 4EY8A 2Z58A 2G07A 4TL7A 1FFSA 1KSFX 1WXIA 1KGSA 3MJRA 1RHKA 1ZRSA 4B40A 3NWBA 4P3YA 3HKCB 5F7OA 4JSTA 3LOQA 1ENPA 3VSBA 4MLZA 3WG9A 4LFAB 1J33A 3KJEA 5A5GA 5E6UA 1M6VA 4BFVA 4WQMA 2HF9A 5T57A 1AM4D 3SQDA 1LB1B 4NG5A 4KEAA 4MW2A 1NQTA 4QYWA 3U5TA 5DPMA 1U0BB 1QHXA 1I0LA 3T0IA 2GBGA 1L7PA 2QW8A 2HIHA 3KQKA 1KH2A 2HRRA 1KEUA 5ESWA 1WO8A 1NUTA 2ZR0A 4N54A 2ZS8A 5KCZA 3MLAA 1W73A 3MD9A 1P1CA 1SVMA 4FDVA 2QIPA 4UAJA 3PL1A 5JRZA 4F86A 1KO7A 4V0SA 2H7XA 1W9HA 3ADOA 4MW1A 1OXKB 3GT3A 1Q20A 2CL5A 2VQDA 2W71A 2B35A 1ODKA 4HX2A 2GAFA 2M6LA 2IYZA 3GIWA 1QIMA 4IICA 1NI3A 4H59A 4O1MA 4F8YA 3L7NA 5IJAA 5EHIA 3IQEA 1ZICA 4DE5A 4P34A 1W4RA 1T9HA 1TJPB 5I7FA 1CZLA 3DGFC 2ZJFA 4AN1A 5AJWA 1IBSA 2X41A 5AVRA 1RE1A 5JDIC 1ZMXA 2H63A 2FQXA 4P7KA 3K9CA 1COZA 2QD5A 2OCKA 1R0YA 2WG2A 5D7BA 5HKKD 1W1IA 2O7QA 2YFKA 4EHIA 3HYRA 3RODA 4B3FX 5I48A 1YTUA 2AMVA 1U3WA 1G7RA 3CWZA 3A6ZA 3K1AA 3KDPA 5CIWA 2X4IA 3QOFA 4LYFA 1WV1A 3NKLA 3OZWA 5EIHA 2O1WA 4ZCSA 1T29A 1L5HA 1YRWA 1ABBA 2IHBA 2PMEA 3WYGA 3FOAA 1AIPA 5EERA 2NTJA 5JR3A 1UJBA 8GPBA 1JJVA 1P2TA 2F9LA 121PA 4NPCA 4FR0A 2YRXA 5FBQB 3EDCA 1MC5A 4I50B 4OGKA 2AT1A 4YCAA 1CKEA 4W5WA 1LLQA 3FI0A 3VXKA 2DX7A 3PICA 3NTRA 2RIRA 1RJFA 2XNKA 5EOVA 1ESDA 4HWGA 4HXFB 4IL5A 3ZWAA 1DDIA 1NI4B 3MCTA 3L9XA 4IJ6A 1G7CA 2BEKA 3HJAA 9ABPA 1G18A 1F0KA 3D3EA 3IR6A 4M1YA 4M88A 5BSTA 4XUGB 1N2CB 1S9HA 3RJ5A 1ZOLA 1G8AA 1VHQA 2WTEA 5SZJA 3PHLA 4L6IA 3PE4A 1MU0A 5DN9A 4MWCA 5C18A 2OAQ1 2C92A 1JPUA 4IRMA 4J90A 1EDBA 2D06A 3ZQJA 4ESVA 4KN8A 3AGQA 4MV4A 3TNJA 5A5DA 3IAHA 2AJLI 2QXUA 4EGQA 4B3HA 1AK9A 3FD8A 1OIXA 3WLPA 1R5JA 2O2IA 4X44A 1KEKA 4KR7A 1E1LA 1B0PA 3ECSA 2QQGA 4TV8F 5LYJA 5AKHA 3F96A 2D59A 1QCYA 1T4CB 2WYIA 3C3XA 3FZEA 1PT6A 3LCCA 3EEBA 4I6JA 5GTDA 4JKIA 3ZW8A 3C3EA 2O8DB 4NFLA 3BFXA 2BMAA 1Q91A 3WNBA 5ADUS 3QEJA 2PBLA 4M3NA 3TNFA 3GEGA 5HUJA 3DFMA 4URFA 1MOPA 5HUHA 2IU0A 3WJ2A 1JEDA 2WSMA 3GMSA 4C0AC 4ND2A 4YAIA 1O4WA 3LHDA 4KO3S 1GKKA 4NF2A 1OGJA 1W5TA 1E6MA 3AO0B 2G1JA 3C5WP 5KB3A 5KQRA 1Q0TA 3EFEA 5J23A 2MHCA 2FPXA 5A02A 3ZGXA 4HPXB 4RDIA 3R7BA 4L6CA 1SPBS 1M1ZA 4LNHA 3WXMA 2IHUA 2WM3A 2WRZA 5G0VA 3AHJA 4E14A 2G80A 3A2NA 3ORSA 5CX1B 3VTFA 4AN0A 4FYVA 3LY9A 4RQAA 4RFSA 2O2ZA 4WZAA 3W8RA 4XFKA 4CKEB 3TGLA 3R3YA 1F06A 2ALJA 3DE7X 2Y1CA 4YRRA 1X8XA 1WB6A 5LC1A 3U16A 4Q82A 5I7RA 4PVCA 2IS1A 2D74A 3W6UA 5K4GA 1J0CA 2BEJA 3ELWA 3VPBA 2IS2A 5ERGB 3F3YA 1Z56C 3DEYX 1JBEA 1L8QA 4WXEA 3SJ7A 5E4YA 3FUCA 2DQZA 4JT4A 5LLDA 2PT5A 4RAQA 3TNYA 2J0SA 1CUHA 2NZ2A 2X14A 2DTXA 3W9SA 3U7EB 4RTSA 1D0SA 3SIPA 2VSOA 1LQUA 5DNVA 3K72B 1N2IA 3QYJA 5BWOA 1FVHA 2PX8A 3N6XA 3DCJA 3R74A 4JLNA 5AUQA 5CFZA 1T4BA 1Y3DE 2QTTA 2UAGA 3A0RB 3A1UA 3EPKA 1TEZA 4BXOB 1P4HA 2AN4A 3SP1A 1Z6GA 5E0KB 4AUMA 3LX5A 2Q6TA 1XCPA 3DR3A 1FQOA 4PLTA 1IM5A 2YIVX 5E6RB 1EUDB 2BR4A 3AR5A 3CZMA 1XJ0A 3MLEA 5EQDA 5CLHA 4MWBA 2AG8A 5CRIA 3QPDA 3WYBA 1CEQA 1P2GA 2YJ6A 1WCIA 3ZHRA 5A0VA 1JEQA 1G63A 3FFXA 3O21A 3K8OE 4P0QB 1CRPA 1DUVG 3JQDA 3R7WA 2IYAA 2PMFA 1A7JA 2G08A 5HIMA 4A0RA 3TDNA 4GSKA 1ZI8A 2IXDA 2XMSA 3U7FB 2PK3A 3C4JA 3ZIAA 1DCKA 1O5OA 1E96A 2AR9A 3TFQA 3L79A 3VKHA 4DLWA 1KY5A 3ASVA 3BCRA 4PO1A 1I7PA 4FQ8A 4E3ZA 2EW2A 1Z2DA 2HAEA 2I54A 4HDOB 2C5HA 1Y1QA 1Z35A 2ZWAA 1MIHA 1Y3CE 3D6TB 4QGFA 5EHGA 2BBWA 2QM0A 2IWHA 1FE8A 1OLSA 4DF3A 5AVXA 1VP3A 1DIHA 1J24A 1BFUA 1PL0A 2FZKA 4Z0NA 5BOSB 2C54A 4MICA 1N32B 3HCBA 4JLVA 4TX1A 1IJFA 3N58A 4BKUA 4NCJA 1G0NA 4PPNA 3I2GA 1VCHA 4FCTA 3NHFA 4D98A 1U94A 2WD7A 3QFHA 4LJ9A 4PPFA 3MXOA 5KYKA 1IMOA 1R6VA 1YRYE 3G8YA 3NW9A 1UDBA 3P5BA 1UBHS 4L9WA 2WHPB 1ORRA 2GF9A 1U6IA 1JQJC 1KI8A 3DBRB 2PRZA 1X3SA 2XDWA 1IULA 2CCKA 4HH4A 4YAFA 5D87A 2A5JA 2BSXA 4E5KA 1XD2B 4GLOA 4JJ8A 3D7SA 4QAJA 4QXMA 1SVWA 4I1YA 4YQYA 3WMRA 2CLFB 1U3DA 1FCJA 3RUPA 4CIVA 4XVUA 4C20A 3OZRA 4KQWA 4DMUB 1BN6A 2BW0A 4CIXA 4D8XA 1XNQB 1I24A 3DE5X 3U4CA 4HY3A 1GLNA 3F5DA 4PZ9A 3O74A 1E4OA 3HUUA 3VO9A 2W58A 5AP9A 1R37A 2X0RA 3W6NA 5A06A 2V3CC 5I9NA 3OE4A 1Z4KA 3KR1A 4JR1A 4PYNA 1LRLA 1RAFA 4MB0A 4X94A 3JYHA 5ELLA 5DFAA 4OG2A 5IXJA 1XRMA 2EHDA 3Q9LA 3AVXA 3DB2A 1LVHA 3BGSA 1P45A 3OT1B 4GM0A 1QQTA 1QUFA 4EJ0A 1QX4A 1O87A 2ZT5A 2X2FA 1T5LA 3IV7A 4GKJB 4R2LA 5JWHA 4DCPA 4LQDA 1DC4A 1MC1A 3PC3A 5LJIA 1CVLA 3QPUA 2ORIA 3WKEA 3WICA 4PFKA 1G0OA 3ZWNA 4I08A 3GJQA 1VCIA 1NVBA 1ZEMA 4EW2A 2NO0A 2WEKA 1KYXA 5LPNA 2Z9DA 4A2CA 3OPMA 3PDWA 4M7OA 4CKCB 4KG7A 3PKJA 5A4FS 2JJMA 5IT4A 1BHSA 2YOGA 1CSEE 1I4TD 3PFIA 4XYBA 3T7CA 1TKRA 2N9UA 2I3DA 3GRCA 2ZS9A 3NALA 4EVQA 1IG3A 1JRLA 3UAXA 2QL5A 4YN3A 3QJ5A 1IUPA 5HM6A 2QZ9A 4XEUA 1P4GA 4IQGA 4EDHA 2VHXA 5IKXA 3CO5A 4OUDA 3RK4A 5EHXA 3ZDRA 4O4IF 5AKYA 4PZZA 2F43B 4FYXA 2NXCA 4G81A 1E2QA 4PXSA 2V5VA 4EO4A 4F3YA 5CLLA 1GSOA 3AYXB 3MMPA 4JDUA 1G55A 2C1EA 3FFBA 3ETCA 2NAFA 1J5XA 3W5UA 2GXQA 3FMFA 1KJYA 4HADA 2W2MA 3O8QB 1M6YA 1SHLA 1HZZA 2HLPA 3F47A 1I5OA 3NYIA 1M83A 1V4VA 1WQ4A 2OB2A 1QYVA 2FMXA 2I2WA 2PH1A 3CE9A 5EE3A 5G40A 3U31A 1HURA 2FWPA 3V9PA 2PGNA 4C07A 3UAOA 3ZJTA 1Y3BE 2GBCA 1Z7YA 3LQRA 2FR8C 2VAXA 3NOQA 4RVHA 4UU7A 2AKAB 1VHTA 4BQEA 4L76A 4LEIA 2YY5A 4WPGA 1Y9JA 3KELA 4NBLA 1VG8A 3MUOA 4M9CA 1U0OC 2CNLA 1NPDA 2JFVA 2PT6A 3EOBI 2B20A 3GJTA 4YNBA 5FUBA 3U3ZA 5C5CA 4DDTA 5EJ7A 4KFCA 3E9RA 1UQRA 1BMFD 2IBMA 3DDSA 4IKEA 3UGKA 4BCDA 3IAEA 3DBLB 4RXMA 2XBLA 1Z5PA 1A71A 3FGOA 5G02A 3L1HA 4M53A 3F9IA 3STXA 1OWNA 3OKAA 2CVHA 4M1EA 1K5PA 4ZEXA 4DBVO 3EJ6A 4Q6BA 3LQYA 4TKMA 2ZBRA 3VAYA 4M2LA 1ZISA 3J7TA 4OMFG 1DAGA 3G5LA 5IZ4A 5FPSA 3VDQA 1DEXA 1JG4A 1RYNA 3IUNA 3PXEA 1M0TA 1V3TA 2PT7A 5JAOA 1AA6A 1MG5A 1AX9A 4Z7JA 5CT4A 4M9XA 2OLJA 1N1DA 3K5HA 5KYYB 2P78A 1XHFA 3LY7A 2NU9B 4ZDIA 1HSZA 1YE8A 1H0SA 3DVRX 5ALVA 4ERNA 1XRLA 4LI0A 4CCAA 3AG6A 4JLPA 3QA9A 5CXXA 1TPZA 4DJJA 1ML4A 1YA4A 3FVVA 1BTOA 1RP1A 2W37A 3H1AA 1LPPA 3URMA 2HDOA 3AONB 1W25A 5DNAA 1OA0A 1WMSA 3AFMA 2OPBA 4G0MA 4GICA 4UNRA 3D59A 3KO8A 4G0QA 3QOWA 4Y6OA 3FVRA 1A0OA 2VT3A 5HWSA 2J3HA 3Q40A 1D04A 1FPMA 4FGZA 3ZNPA 1GL6A 4CMCA 2IPOA 3IEIA 5JY6A 2VP3A 2PIAA 3BHNA 5JPIA 3IKTA 1ORDA 3FTCA 3ID6C 4GBJA 1Z25A 4Y7DA 3S0JA 1I7NA 1VA5A 3N1UA 5NULA 5IAAA 2RKBA 5LZ4A 1AGXA 1C9KA 4MVJE 4UXIA 3CKLA 4DLSA 3PEFA 4ZDKA 5I4CA 4D92A 3OLVA 4EH1A 2HSGA 3MBOA 5CPFA 3HB1A 5L3RA 3TCXB 4GLFA 3W8EA 1W6UA 3CH6A 3WRVA 2PKEA 1BZYA 4KXQA 2CB9A 4CFSA 5GVRA 3HH8A 4Q7JB 3VKUA 1NW7A 2WOJA 4OLAA 1XYYA 5TB5A 2DC1A 2C8JA 3AZOA 4HEA1 1X19A 1V1MB 2FPKA 3UATA 2A1TS 3VHRA 1E0JA 1NI5A 1Z3IX 2B2XA 1KJ9A 2OV3A 1OFTA 1QGED 3NI2A 1ZOIA 3LS2A 5CA1A 4CETA 4YJ2B 2IE0A 1IN7A 1H2WA 3BE4A 1QONA 1N0UA 3AR7A 3PWKA 5DJ5A 3SHVA 4D5EA 1CEEA 2IOFA 4JN6B 4KIGA 5JE8A 2IYWA 3ADKA 3OTGA 4NFSA 3OHPA 4OHKA 4QDUA 3H9QA 1B14A 5LLTA 2D3WA 3L1UA 4MUEA 3F3KA 1IN1A 2W93A 4IQ4A 2B34A 1Y1SA 5JQGB 4KBGA 2HZ7A 4TZKA 1II8B 1SGWA 2ZRMA 4HQOA 1OWLA 1PJLA 3OE1A 4PV7A 2P69A 5A4IS 4AY5A 1TYAE 3FR7A 5DCLA 5H02A 4AT1A 3G2IA 4KBYA 3A6GA 3K0FB 5FA5A 3NHRA 5CCEA 1KETA 4ZI3A 4G07A 3ROKA 1RJEA 1SFRA 2GAJA 1F3LA 2P2LA 2YNMA 1KXJA 4GS5A 4JX9A 4R2KA 4TKLA 1K7FB 4C5CA 4D0RA 1U1FA 3FH0A 1RU3A 1ZN2A 4HNAA 3GVCA 3ZJ5A 1VKRA 2FPRA 4AKSA 1CR6A 5CH5A 3I9V6 4CMBA 1A7KA 3OEHD 2C95A 1YUMA 3LVFO 2M6KA 4A1FA 3PPXA 4EPRA 5AESA 4N6NA 1UJ2A 3LK7A 3CEMA 1WHSA 2QBYA 2P3SA 1UANA 1YOVA 2QTFA 2R4UA 1KORA 3ZX4A 2V96A 2BONA 2BZGA 3GI1A 2ANCA 4KGZA 4NEHB 3SC2A 1Y34E 3CUWA 4GVLA 5HEKA 2AKYA 3SSMA 4BO1A 3IXLA 1RWOA 3OF3A 3PFWO 2AXEA 2DUUA 4D44A 3HXLA 4MYDA 4X00A 4QL3A 4S24A 5F4ZA 2NU7A 2X7JA 4DSOA 3Q10A 5DU2A 3X1MA 2VYQA 3MTQA 4BO7A 1G17A 1DQSA 2R1TA 3G0OA 1LFAA 2JJ2D 3GD5A 4R9SA 4R8KA 1FNMA 5B6PA 3A6PC 1YMQA 2C2GA 2CW5A 4UFOA 5AJUA 2FKAA 5C3UA 4BZQA 4OAQA 1FX0B 4MV5A 1B8PA 3BGDA 3VO8A 5F1PA 5BPHA 1GM5A 2CVFA 1M76A 2CFOA 1EWYA 4AL4A 1SUFA 1RXUA 4MUKA 5F23A 5BNWA 1JDZA 1R64A 3A28A 3PNKA 1T36B 4Z4QA 1AG9A 1VE5A 4QGGA 1ISRA 1K7YA 4YYEA 4WBNB 3JAKA 2PLNA 4D9JA 2I0FA 1MF7A 2YQ5A 3B20A 3DOFA 4MWEA 1JKJB 5FNVA 2WHXA 1ETUA 5H3HA 2GCGA 3SG0A 4MA5A 1FTQA 4NH0A 1CJKC 4PRKA 1DWOA 2IXEA 3Q88A 4N8SA 1RAIA 2I4LA 3FPFA 1ZR2A 4AYTA 4BFTA 5LQSA 5HHTA 3FYUB 3OZTA 3C15C 3VAAA 4NBNA 1VE6A 2D2XA 3NORA 4G1VA 4JU8A 4P8RA 2IE8A 3GR6A 1ZOSA 5A62A 4Y18A 2ZB2A 1ZOOA 1DHRA 4HNHA 4IDNA 4LFCB 2HDWA 4ZCQA 4BP1A 1XFDA 4LC0A 5DYGA 3ER8A 4NCXA 4Y0VA 3OSZA 3VAZA 3IO3A 5LZ9A 3BXFA 1J1ZA 3B7WA 3G13A 3AFIA 4B71A 3OCYA 4HNQA 4W1SA 2QUIA 3RUFA 3ZIUA 4UTNA 3ZY4A 1R5OA 2Q46A 1LVUA 1N5IA 5AI8A 2E1PA 2IQ5A 4H1TA 1ISMA 5CBPA 3RWOA 3PR1A 1WSWA 2XEXA 4RZHA 1BEEA 3VX3A 4MGYR 3SN6A 5KNCH 5KDOA 5C8YA 1D7OA 2AZTA 2YFHA 4HX5A 3M4NA 2MMCA 5EXDA 1GAWA 5ED0A 3Q85A 3O83A 4KQHA 1QNFA 2XUGA 1KC3A 4CDGA 4R8RA 2Y66A 4ZO6A 4ZQBA 1VRVA 1E59A 3P5SA 4OP3A 3WBFA 3PTAA 4C4PA 5LP6B 5JHHB 3OFVA 2ZRAA 1E2DA 2RGBA 4O2BF 1R8SA 1N7IA 2B6HA 2V9ZA 4CU5A 5B1EA 1QH8B 2D5AA 2R66A 5KX5B 4YPFA 2NUBA 2OAP1 4BV8A 2F2TA 3VJMA 1ND5A 1J8FA 1Q12A 3CEHA 2X6QA 4MKZA 1U63A 2OVBA 3F74A 2FRDC 3L4EA 3OH8A 4NOMA 4RSRA 4S1PA 4ESEA 4ZI7B 5ADVA 1L7OA 3IHWA 3W3AD 4B45A 4CODB 5DMXA 3JZIA 4UVDA 2BFBA 3FZGA 4G37A 2FSVA 5EESA 3S5JA 5A5FA 4YS6A 3GLSA 3DNFA 3FPCA 4DV2B 1TZJA 1ZJYA 4TLDA 1KS9A 1MFPA 1U4SA 2NXEA 1DBIA 3Q7SA 4Q3LA 5EJMA 2PBZA 3K5IA 4B8ZA 4RCVA 4Y1FA 3LYUA 1OUMA 2EX4A 3TRKA 1BWPA 1EJ2A 1H4TA 3TSOA 5EPUA 1XTKA 4FX5A 4PRYA 1NVWQ 2IYUA 1N2OA 1S2MA 1NTOA 2I6UA 2V4UA 2XVXA 3DP9A 3P9CA 3Q0IA 4D45A 3BIJA 4DV7B 4IVQA 3VNBA 2JI7A 1P5RA 4CEHB 3B12A 1GYRA 3KLMX 1TD9A 2BGLA 5LVAA 1JN0A 2GA9A 1B00A 1I3CA 4L8LA 2I9PA 1GXSB 3SDSA 4BIMA 1NJ8A 2GK3A 3G17A 2TMDA 2WP0A 3IXMA 4KWHA 1IB0A 1MJNA 4K2HA </