5C4IA

Structure of an oxalate oxidoreductase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
394
structure length
394
Chain Sequence
GKVRNISGCVAVAHGVRLADVDVICSYPIRPYTGIMSELARMVADGELDAEFVHGEGEHAQLSVVYGASAAGARVFTGSSGVGVTYAMEVYSPISGERLPVQMAIADRTLDPPGDFGEEHTDAECCRDQGWIQGWASTPQEALDNTLIYYRVGEDQRVLLPQYACLDGYFVSHILGPVDIPDEAQVKEFLPPYKNHHVLDPRKPQIIGPQIEPAMGPPLQYQRYQAVKGVHKVLEEACDEFARIFGRKYDPYLDEYLTDDAEVIIFGQGAHMETAKAVARRLRNLGEKVGVARLRTFRPFPTEQIKERLSKFKAIGVLDVSANFGISCSGGVLLSELRAALYDYGDKVKTVGFVAGLGGEVVTHDEFYRMFQKLKEIAKTGKVEQTSYWIPFEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxalate oxidoreductase subunit alpha
publication title The Structure of an Oxalate Oxidoreductase Provides Insight into Microbial 2-Oxoacid Metabolism.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 154
structure length 394
sequence length 394
chains with identical sequence D
ec nomenclature ec 1.2.7.10: Oxalate oxidoreductase.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01855 POR_N Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg
A PF17147 PFOR_II Pyruvate:ferredoxin oxidoreductase core domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c4iA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c4iA01
4MPJA 2JI9A 4JD5A 5K6RA 1WCIA 1YD7A 3HWX1 3DUFB 4K9LA 1JSCA 2IEAA 2BFFA 4RJJA 5EXEA 3AHHA 1V11B 2AG0A 1UPCA 3HYLA 4KXVA 3EXG1 2AG1A 4KXXA 1X7WA 2O1SA 2C3YA 5HJEA 5K2OA 2BEWA 2X7JA 5DEIA 2IHUA 2NXWA 1YI1A 3DV0B 5EXDA 5K6TA 1L8AA 3AHFA 1OLSA 3LQ1A 1MCZA 4K9OA 4KXWA 3UK1A 2PANA 1TRKA 3EXFA 2FWNA 1RP7A 2C3OA 4JUFA 2C3MA 2BFCB 1T9DA 2BEVB 2WVGA 1TKAA 2BFBA 5K3SA 2JI8A 3FLMA 1PVDA 1V1RA 2Q29A 5DGDA 1T9BA 3AHIA 5ERYA 4JUDX 2VBFA 5EJAA 2JI6A 4COKA 4K9KA 1OLUA 4GPEA 1V16A 3AHJA 4KXUA 3AHEA 1POWA 5EJ7A 2BFDA 5EJ9A 2J9FA 2XTAA 5I51A 4JUAA 1NI4A 4KXYA 4K9NA 4QQ8A 2G28A 1UMCA 4FEEA 2BEUA 2OZLB 1OLSB 1GPUA 1V5GA 3EXFB 1DTWA 1X7XA 4KGDA 2C42A 3M49A 1Q6ZA 2JGDA 1R9JA 2PGOA 4GP9A 4C7XA 4JUBA 1KEKA 2Q5OA 2VK1A 3IAEA 3AHDA 4GM0A 1POXA 2IHTA 1OZHA 2Q28A 3ZHVA 4WBXC 1OLUB 1OZFA 2JI7A 1V1MB 3EXHA 3L84A 2VK4A 1UMDA 4RJKA 1TKBA 1W85B 3OOYA 2EZTA 3EY9A 2J9FB 2VJYA 5AHKA 3ZHQA 1NI4B 1Y9DA 5I5EA 2UZ1A 2R5NA 3AHCA 5I4IA 1X7ZA 1PO7A 3EXEB 5EJ8A 1U5BA 1W88A 3M7IA 3EXIA 1DTWB 1WCIB 4QELA 2Q5QA 2Y0PA 1OVMA 3D7KA 2C31A 2BFFB 2G67A 2UZAA 3E9YA 1PYDA 3DUFA 4D5EA 2C3PA 2JLCA 4D5GA 1V11A 4MQ5A 2JLAA 4Q9DA 1X7WB 1T9CA 1T9AA 1BFDA 4JU8A 2YIDA 2R8OA 2BEWB 4XEUA 5IMSA 3M6LA 2VK8A 1UM9A 2E6KA 3EXHB 2QTAA 1YBHA 2YICA 3ZHRA 1UMBA 3MOSA 2PGNA 1YNOA 2V3WA 1YI0A 5FEMA 1X80A 1QGDA 2UZ1B 2WVAA 2BFEA 1X7YA 4JU9A 1B0PA 1U5BB 1W88B 3UPTA 4K9PA 2BFBB 3ZHUA 3F6EX 1ITZA 1V1RB 5HHTA 1AY0A 1OLXA 3DVAA 3ZHTA 2C3UA 1TKCA 3LQ4A 5EJ5A 4ZP1A 1YHZA 1N0HA 3EA4A 3KOMA 1V16B 3AI7A 3JU3A 2XT6A 4JUCA 2BFDB 3EXG2 2Q27A 3OE1A 3FSJX 1UM9B 1QS0A 1UPBA 2VBGA 2EZ9A 3IAFA 4K9QA 1UPAA 1UMBB 5EJMA 1UMCB 2VBIA 2XT9A 2BEUB 5I5GA 2JIBA 2BP7A 4GM1A 1OZGA 1X80B 2OZLA 3EYAA 1X7XB 2BFEB 2IHVA 2O1XA 1X7YB 2R8PA 2JGDB 4GG1A 5EJ6A 1PI3A 3F6BX 1YHYA 5HGXA 5HYVA 2W93A 4K9MA 2PDAA 1OLXB 3RIMA 3DVAB 1V5FA 2Q5JA 3EXHC 5DGTA 4QPZA 4GM4A 4MPPA 3LPLA 2Q5LA 4MZXA 1ZPDA 2EZ8A 5ESDA 1UMDB 5EJ4A 4MPRA 1V1MA 5ERXA 3DV0A 3HWWA 1IK6A 1W85A 2EZ4A 1QS0B 2DJIA 2EZUA 2FN3A 2WVHA 1QPBA 4RJIA 3ZHSA 2QTCA 1X7ZB 3FZNA 3M34A 5C4IA 1V5EA 1Z8NA 4FEGA 2BP7B 2BFCA 4C7VA 3LQ2A 3EXEA 3AHGA 2G25A 2BEVA 1NGSA 3EXIB
chains in the Genus database with same CATH superfamily
1JNYA 4NBTA 3SYKA 2JIMA 4U2KA 1ILWA 3HYNA 3LBIA 1FNCA 3RK0A 1AO0A 3COYA 4TROA 5BSHA 2LNDA 1H4SA 3DBHA 1GA6A 3O7WA 3PQFA 2F7SA 2YCLA 3LH5A 5CD9A 1I4EB 2X86A 3K8YA 4AKEA 4U02A 5AVOA 1I94B 4R5HA 4RTKA 1T1GA 4MGYR 3GXBA 3K9WA 4YR7A 4PNPA 3IHWA 1CEEA 2IK8A 2ZG6A 3ZQJA 3CH7A 1HBJA 2QY9A 3I6BA 3M6FA 1OWOA 3LLVA 1CDZA 1NBMD 3PEYA 1RYHA 4HP8A 4WDQA 3CVYA 2ACKA 2C5BA 2ES4A 2GSWA 2XITA 3O31A 4RIEA 3V9AA 3WLLA 1O0BA 4ZO6A 1CP2A 5CLFA 3Q9UA 4KITB 1RWQA 1Y6QA 1B26A 3A4TA 4GR5A 4ON9A 4RY0A 5BPFA 2DUNA 2FPWA 2V96A 3AJRA 3N5CA 4K3VA 5SYMA 3TR5A 3ULKA 4AO6A 4TV8B 2C88A 4CF7A 2QN8A 4AS1A 5DJ5A 1GLVA 2IRWA 5A71A 3VDXA 3RI3A 2IP1A 2ZTHA 2X7JA 5JWRA 4HGYA 4YGYA 5CB4F 1AM4D 5LQRA 3MMSA 4HGZA 3HFGA 5HIIA 4WX2B 5DEIA 3DMDA 2OT3B 3PHIA 5GQSA 3WA7A 1ZK3A 3H04A 3H42B 5KWJA 4DJJA 2CT8A 1QIGA 2KW5A 1HLFA 4D9JA 4G4GA 1UAYA 1IVYA 1NN5A 4ND2A 1IBLB 5AOVA 1OBVA 1RYYA 2O06A 5JAUA 2BM0A 3ZTWA 5K6TA 1GHTA 1TT5A 1I3LA 1P2BA 2YW9A 5D7NA 5AK3A 1G8KA 4UUOA 1C9EA 3WDMA 1BN6A 1VYVA 1L5NA 1XPRA 2VNAA 1JHQA 1EP3B 4R1PA 5EKSA 2FWJA 3BFPA 3CCCA 4J91A 1KR2A 4H1HA 4NZ9A 1P6XA 1MU0A 4YT2A 3KU4A 3DWFA 3MILA 4GUAA 1GA4A 3LC0A 4HAYA 3WMEA 5IBRA 1FNSA 3TSOA 3TB4A 4RACA 5H16A 5B57C 2V7VA 4B9EA 1HGXA 1SBHA 2OLJA 1IFXA 4TM7A 4Q4AB 4XB2A 2XI4A 5LVAA 5DYNA 4FYMA 4D3YA 4G5RA 1IQUA 3OT5A 3CH5A 4ZWNA 5IDYA 2O0MA 1CEXA 1DO0A 2BFBA 4J0FA 1V9CA 1C30A 4HDRA 2REQA 1IN1A 1E2LA 1NLUA 1GL6A 2QE7A 2ZBGA 4ISBA 2Y0EA 1ES9A 3W9BA 5IG2A 4HWRA 2H4JA 1RI4A 2ODPA 4XGIA 1CS4C 3LDAA 3KAKA 4LXIA 1JMKC 2OZPA 4HH3C 3HB7A 3UG7A 5KX5F 2XOXA 2QBYB 4ZXPA 1X87A 1YZGA 2NVUA 3TW0A 1NY5A 5D3QA 4YT8A 2Z8ZA 3FYHA 4HXYA 1D6MA 2ETXA 1TO6A 4ABTA 3HB0A 1Z4JA 1K3UB 2BUCA 3B3FA 4PLVA 3FHLA 5E2BA 4ZARA 3SR4A 2YYSA 1BG6A 3DC7A 5K0JA 4EMUA 4UHBA 4ZCIA 4BVHA 2VWQA 3HA7A 1ETUA 5CX1A 2R1TB 2G77B 1SUCA 3AHJA 3B1ZA 2GSDA 1SIBE 1POWA 2J3EA 2F3TA 2PXCA 1QHHB 3CSUA 3ENKA 3FB1A 1SBCA 4N54A 4NHEA 2D4AA 1WZIA 2NU6A 3IP9A 2BELA 4Q9JA 2QTMA 1G6HA 5B1IA 1N0UA 2DJ5A 2VDRB 4NAVA 4BWFB 4HY3A 1XMOB 3WQSB 1ZXXA 4DJAA 1HK7A 3INYA 4QGBA 4WRRA 3IUPA 4I9GA 4FC7A 2XGMA 2PX5A 2Q8PA 1DG3A 4L85A 1ZITA 4GNKA 1OVGA 3RIGA 4QGHA 4EITA 1U99A 1Z5VA 4AN0A 5IUJC 2QLNA 3GO4A 2ZZKA 2GEBA 4LVCA 1JB1A 4UAVA 2ZUSA 3RO7A 2QAIA 4N40A 3FHCB 3MC1A 3QVTA 1NQTA 3NBFA 5HNKA 3V00A 4FI3C 1C7ZA 1Z4LA 1AQLA 3A9VA 5I7RA 2R96A 1YCHA 3W79A 3MINB 4FDTA 3CKMA 2RKBA 4PFSA 4R9UC 2OK8A 4LQ4A 5JNVA 3KLOA 4ZCLA 4V02A 3G7SA 4HI0E 1T5IA 1NBOA 3RWBA 4F3NA 2HHHB 3L07A 3GFFA 2EFDB 4LIPD 3UTCA 1KDTA 2HX1A 4K1XA 1VQ1A 2F1KA 1VSQA 4N5HX 4P3NA 3WNVA 1ZJ4A 5KJEA 3ZBQA 3ZJTA 2FEKA 3KQMA 4Y2JA 2II6A 1K7XB 3C4VA 4IIHA 3ZLTA 5BXQC 4LC1A 1E20A 2DH6A 2PGOA 3OQPA 4I6GA 3ZY5A 3UHOA 1GAXA 5C8ZA 2Z1NA 1QO0A 2ZBEA 1H2YA 4FX5A 3VR4H 3WGNA 5SV2A 4LK3A 4PG5A 4OUKX 2W2MA 3IT3A 3N6XA 1V45E 3H11B 2CLEB 3OFJA 5CLGA 7MDHA 4PANA 2DBVO 4BGVA 3WDLA 5PNTA 5KMGB 3UJPA 1NURA 4UHKA 1DNPA 5DZSA 4GM0A 2IQ5A 3IT2A 3PGA1 1A4RA 2E21A 3VDMA 4JYCA 2AIRA 4WINA 4BE4A 4FUQA 4LN1A 2CMGA 2R25B 5CFOA 2WOOA 4DR2B 3MJFA 4JB0A 2IIBA 4FZ3A 1T5BA 2UVQA 5BN3A 3GLIE 5AVXA 4EFDA 2AK3A 3ZHVA 2QQGA 5BSRA 3FF4A 1KPHA 2ZATA 3WZLA 4EZIA 4ARIA 5KCMA 4B0OA 3AFOA 3EC2A 3DDOA 4QJ5A 4AZTA 1ST2A 4FSXA 2HF9A 4BX8A 4YMGA 4ZZIA 3GBVA 1BYUA 3UXHA 4AU1A 1UDRA 2GCOA 4K86A 2I29A 3R3YA 4UCFA 3TEMA 1G5TA 1I10A 1X3LA 2VK4A 2XUAA 1CJUC 4RJKA 2DKFA 3KXKA 1JWBB 1XZNA 2Y4NA 2HRQA 2HLNA 4X3PA 2CXQA 3WBFA 4MR8A 2ORWA 4FOOA 4N6NA 1VBMA 4MS4B 4S2UA 2J9FB 4C88A 2E4VA 1JIIA 3GQBA 3HBFA 3H3JA 1DIOB 1GPDG 1EK5A 5HQJA 2B4TO 2WK1A 2A0UA 4PXAA 1F12A 4MJLA 2NP6A 4R3WA 2N1BA 2C5GA 4Q1BA 1RM0A 1SBNE 2PRIA 3IHTA 4DIBA 1YTUA 2RGUA 4YCBA 5DK4A 3F74A 1Z29A 5DFAA 5GMOA 3VXKA 1E5XA 2ZIGA 4K7JA 3LCRA 2VCYA 5JAPA 4PO1A 4E6PA 1Z26A 3F7NA 1PK7A 2YYZA 4AUMA 4JELA 3H0EA 1I7SB 1YS6A 4IDAA 3R6TA 5E8RA 4O4LF 4V0OA 3LX5A 2VJAA 1MP0A 3SK0A 1EEHA 2ZSHA 1ZRHA 2C7VA 3DBHB 4YUYA 5KX5A 4EP1A 3U62A 2BBTA 4UM9B 3CEPB 3PHCA 1L7QA 5CDGA 1OV4A 6ADHA 5B2EA 3AG5A 1I51A 1Z0DA 1YB5A 2WJ6A 5KVVA 3DPSA 3D7KA 2A5DA 2GPYA 3ZY2A 1N1GA 3VH1A 2B98A 3BQNB 3ELBA 2G67A 3FZYA 4HOYA 2VNSA 3R7NA 3RHTA 4P98A 2YOGA 4P54A 4E2YA 1XCGB 3CMMA 4MKHA 2A4MA 1I6MA 1RAEA 4S0ZA 4B4WA 1JZSA 1RWBA 4HDQB 4R69A 4RZIA 3QMWA 1XTPA 4MUBA 2PA0A 2ISQA 4E5NA 3BGOS 1S6YA 3ZNOA 5C35A 4OBWA 4ZOCA 3N0XA 3UB4A 1JXQA 3SNKA 3GEPA 2E6UX 2ZI4A 3NU1A 2EIXA 5CM9C 3SX0A 2WSYB 1T9AA 3ZBPA 1K5DA 3K8OE 4C2TA 1ZK4A 3O2JA 3VH4A 5CTAA 2O5VA 2C4UA 4FNOA 2XGJA 1ZO8A 2G9UA 4C3VA 3C85A 1Y3FE 5K2MA 3WYCA 1WQ3A 4DMRA 2VPXA 2X13A 3JQBC 1TQ8A 1CR0A 1DPGA 1OILA 1YB6A 1CJCA 2GTPA 3OIVA 3HVIA 1Y4DE 1JE0A 1FDUA 5DYGA 2HLDD 4EPVA 1UBFA 3LG2A 4E13A 1MTOA 1W19A 2JK0A 3D31A 3JZMA 3CX8A 4QBTA 1LXCA 5FUWA 4AQDA 2XTMA 1F20A 2GKOA 1TT5B 1U2DA 3NBAA 5AKYA 3SKVA 4OHZA 3ODPA 3GLIB 1ABFA 1ZOPA 3TZKA 2A35A 3TRHA 3KZMA 2DQKA 5FYDA 1UBCA 4PGHA 1V43A 1PGPA 3VR4D 4Q7QA 4LCJA 4RVOA 4HH4A 1R0YA 4X84A 3Q7IA 3FG9A 1OXMA 3PZRA 1IK4A 5ITVA 3GMSA 1X80A 1UFOA 3AERA 1FRZA 1XUOA 4LF8B 2QENA 4OVKA 4A16A 4D9MA 1T15A 3R6LA 1QDLB 1CRLA 2OM6A 2ZS7A 4FYPA 4MWBA 4PCLA 4RK7A 4G0MA 3M3DA 4Q7LA 3VHXA 1NOJA 1RE0A 2B61A 4LISA 4S1PA 1SVOA 2VPTA 4D9FA 2OOKA 1EUDA 1ZA1A 2AQHA 3FA2A 5AKLA 5FBRB 3BBPA 3HMQA 2R8RA 4P84A 3UPTA 2M6LA 1ULUA 3RVRA 2BFBB 4W1RA 3FETA 3UNXA 3IBFA 1IDN1 1C30B 1UWVA 2C95A 5EFOA 4MI3A 1FXWF 2REQB 4DG8A 2NT4A 1NU6A 3ANNA 2A59A 1THMA 3R09A 3PC7A 2QAJA 3P9ZA 3ITEA 1TD1A 2CZQA 2D1FA 1C0IA 3USCS 5ALVA 1RXIA 4GXRA 3OTHA 1EIWA 4LZPA 3HZOA 4FMDB 2VDMB 1E2NA 5DDIP 4JS0A 2GILA 2NVUB 5FWAA 1UPXA 3E1GA 3RAGA 1FYDA 3IOBA 3WGTA 3QPUA 1QDUA 2DQYA 2W6MA 1L4NA 3VHRA 1EHYA 3KOOA 4JC8A 3K9GA 2VA9A 2AR7A 4LAFA 4ARSA 4BKQA 2ZR8A 1AKRA 5IXSA 2VHXA 4IZIA 2O2SA 4J0CA 1PLJA 4TQ9A 4TZTA 1JH9A 5CX1B 3S6JA 3QV2A 5IDXA 1BCSB 1DO8A 1RWMA 4DMKA 3P26A 3H2ZA 4HNRA 3EEQA 2WKSA 2ZE5A 2RBGA 1M1ZA 5UKDA 1S2OA 2BWJA 4ZCQA 3TE6A 3ZE1B 3QFRA 5B12A 3TCXB 4C07A 1Q57A 1YDFA 1AZWA 1UK6A 1M8FA 3NHSA 4HNAA 1YJXA 4XIYA 5HCNA 4C4PA 1N3LA 2VBGA 3DLPX 2IYXA 1JFTA 2EZ9A 5IVKA 3KR2A 3M1AA 1TJ3A 1HSZA 4M6WA 4EA8A 3QWFA 4E14A 2ZQ5A 4F9TA 2F2TA 3EFBA 2QJFA 5CG2A 2COUA 4F6RB 2D0DA 3IAFA 5DN6D 5EVCA 1J25A 1DJNA 1JYEA 1KO7A 1LNZA 1MIOB 1VLQA 2J9RA 1GITA 1XJWA 4FUTA 2OXCA 4FOSA 4O2LA 4O4LA 1FNBA 1FU4A 3P2JA 4CU2A 2PUEA 2W2XA 4D45A 2HWKA 1PR9A 2D2XA 1FDOA 1F2TB 2NQ2C 5CGQB 4BN0A 1VXOA 3NYWA 4R2JA 1IUKA 1WXXA 3E7XA 3T1TA 1XPUA 6REQA 3K70C 3D2BA 1RR6A 4ZV9A 4F7WA 2BN4A 4JXXA 4Y7DA 1YS2X 4C4YA 4CIDA 1X7YB 5DTIA 4N48A 3EQ2A 3W6UA 3JTMA 4B7AA 1QH8A 3BOSA 1SCBA 2WP8J 2V4UA 3NDRA 3CVWA 2G5TA 2WJHA 3LVRE 4MA0A 2EW2A 2RH9B 1TQDA 3BIWA 1KK2A 3R0XA 1ZD8A 4Z99A 4YFYA 1WKBA 4X1IA 1Y9EA 3BZUA 3SZ3A 1HNXB 2GBGA 2LPMA 1M1NA 1N7JA 4NENA 5KPDA 2DKOA 4JEUA 2PDAA 3PPIA 4Y2HA 4QPDA 5EZSA 2F9FA 4Y0VA 2AN9A 3JARA 4EKYA 1OXTA 1B15A 1QH9A 2DBZA 3M6WA 4BC1A 3NWJA 1DX4A 1Y8QA 2GM9A 3HEMA 3PP8A 5FNVA 1VLJA 4D9BA 1ZEJA 5CFZA 3I8OA 1IEXA 1PZXA 1RLOA 3GAZA 1UBKS 4G86A 1N2HA 1YSCA 3OAAD 1N9ZA 4Q4LA 3BQMB 2PWYA 4L16A 3WWOA 3WLQA 1IPHA 4GBGA 1SD5A 3JY6A 3DYBA 4AICA 3BL8A 1U31A 2BEKA 2BBOA 2YINC 1DJPA 5TVGA 1ZJWA 4AXXA 5ALFA 4KXMA 3HB1A 4BJHB 2OYCA 4IQFA 2GCOB 2VIIA 2WUVA 2DWOA 3N39C 4EAQA 1CY0A 5L40A 2WWIA 1BAPA 3CN7A 5CXXA 3QUCA 1Q0PA 1U8EA 4UAGA 4YGXB 3TH5A 3THYA 1ZP6A 3EA5A 4MWGA 2E18A 4MR8B 4UTOA 4US0R 4LY6A 3FOBA 4XQCA 1L4MA 3MN1A 2ZYVX 3HHEA 3PNSA 1DINA 4C22A 3LFHA 2NACA 1JQJC 1A8PA 1J09A 1TMKA 5HMMA 4DZRA 5ILOA 3PC3A 1P2VA 2ERXA 4PIMA 3VM6A 1K7YA 3IRVA 2VQDA 1QPBA 2ONZA 2QPAA 1ECLA 1D4OA 3OPNA 3EXAA 4HEA6 4KN5A 3ZXIA 2PBRA 1N6RA 3IH5A 1AKQA 2C1ZA 2NPIA 5T3UA 1DOHA 2ZTUA 4IHJA 1Q3KA 4JI6B 3UW1A 3TUJC 4JCOA 3BSYA 4MJXA 5FKJA 2H11A 3DFKA 2VPIA 5I8ZA 4A0RA 4KOEC 1AJEA 1K7CA 1QGAA 3H2IA 1NMSA 4POOA 3HVRA 1FXWA 4XVCA 3VA7A 2ZAMA 2RGGA 4UU7A 1XZFA 2W6ID 3JQAD 4F5YA 1O9GA 3D4BA 5DHSA 3UMCA 2YV4A 4Z6KA 1Z2OX 5DM4A 3VHQA 1Y7PA 2Q46A 2D62A 2BR4A 5ALGA 1KP2A 2GAAA 4N3NA 3HXPA 2PL5A 4NH0A 3I6QA 3VV2A 3ZBTA 4AYXA 1S3SA 2VR1A 4O33A 1F3LA 5IVPA 4JWKA 1Z7YA 2A3NA 4XDGA 3KAJA 3W8EA 4XWGA 4LBWA 4UJ3A 4E09A 1OXUA 1OF1A 3IP5A 1IH8A 4HGOA 1NDUA 5FAKA 2QRVB 3BGSA 5CEFA 1AMOA 5GIPE 1NVGA 2XRMA 1NMYA 2GCEA 2IS6A 1CSEE 4WHMA 3OE4A 1B3BA 2B9VA 5T4FA 3IE1A 4L6CA 5CA1A 4PFKA 3TTTA 1N25A 4XDZA 4Z9FA 1N6PA 5FB3A 1I6LA 4RVNA 3QHQA 1RLTA 1VFPA 2AN1A 3P94A 4KKXB 3RUCA 3SQDA 2O8FA 5TPWA 3FVVA 3LM8A 3T4PA 3UGQA 1RPZA 1H6BA 2ODAA 4JT2A 4RTRA 2CB0A 3IFSA 3V8PA 3IUYA 4REOA 3C3KA 3G2HA 4PQYA 4C0SA 2Q5CA 4O1IA 3OMLA 4Y98A 5CT9A 3T38A 4RO0A 5JAHA 4UVHA 1O7JA 4IEFB 4D98A 5GINE 1SC3A 4K6KA 5CGZA 1T2CA 2PEYA 1BIFA 2QUZA 4EHDA 1OASA 4YACA 3V3TA 2DTEA 2JI4A 2JJ1D 3AYZB 4NRDA 5BQPA 4AMUA 2VQFB 3FFWA 3ZWVA 5KINB 2GMWA 1AKTA 3DHEA 4AURA 4BNTA 5A4JA 4IWNA 2PIAA 1EX7A 4ZREA 3R7FA 4EJSC 2MMCA 5CEEA 2NADA 1WUTA 4UBLA 1V41E 3WIUA 1ZHHA 4O29A 4HV4A 2HAEA 2GFIA 4C4ZA 4RD1A 1JJAA 1Z13A 3K20A 3CNEA 4F71A 4AG5A 5IUKC 4FEYA 3AUFA 4HMQA 3T5BA 3FYSA 3A4IA 5IT0A 4LXTA 2WG0A 1L6IA 4MYRA 3UAYA 3DE6X 3RQSA 1COZA 3DBOB 4ALIA 1BHQ1 3MD9A 4WT7A 1USVA 1W2WB 4XJXA 4KMSA 2NUTA 2OCBA 2J6IA 3GPIA 3W5UA 3PQ5A 4ZT3A 1IM8A 5CCDA 2VJMB 3SBDA 1IEVA 3T0GA 1SIUA 3V55A 3EWSA 4L75A 4DCOA 2QVGA 1IUNA 1SZDA 2NSHA 2QV7A 1J8DA 2J9ZB 4BLTA 4D82A 1JFFB 1H66A 1V8PA 3O4HA 3WLFA 3RRYA 1YUNA 4F86A 2WFAA 1O6GA 2WB4A 2Z6VA 5EXPA 4J76A 2VEOA 2ZIVB 2R7LA 1OWMA 1L4EA 2FPMA 4OKSA 3RARA 5A3VA 1K0FA 3DMYA 4ZT2A 1U94A 2NLOA 3AG6A 2IF2A 3E4DA 3O1IC 9MHTA 3B1XA 4OJYA 1N7HA 2CNNA 3ZWDA 1Y1LA 2CWWA 4G8BA 4JL5A 4YMHA 4ZRDA 1ZR2A 1LTHR 1QPGA 1IN5A 2YUTA 4IFIA 5FFMA 2AG6A 2ZT7A 4C08A 1A95A 5T5QA 1IWPB 3T3DA 1FXSA 1KVTA 2XDAA 3Q3IA 4OI1A 3A1DA 3G1TA 4KL8S 4PV7A 1IXYA 1XVTA 2A58A 1R4MB 3NYQA 4JJ7A 4KP7A 5T67A 5FOQA 2Y76A 2VRCA 2A78A 4CXMA 5CXQA 1IJBA 3D8UA 1JDPA 1P77A 4LHYA 5LMZA 5JV5A 2LTAA 2EJCA 4L4SA 4TMTA 4FLEA 5IZCC 4QM6A 4BNKA 2XJ9A 3HP4A 3GH1A 1BZYA 2PR2A 3B53X 4OHXA 4CKWA 4RH3A 5E2IA 1LCIA 2N75A 3ENWA 2F00A 4QXRA 4L3OA 4JC4A 5ALXA 5GY7A 4LGMA 2QLFA 2EBWA 4F2GA 2CKMA 2FX5A 4QEDA 5BNFA 5F7OA 2G83A 1FVFA 2H5EA 5K05A 4I5DA 4QM7A 2EEPA 1NONA 4UZFA 4EIWA 1V4BA 2WIBA 4M6WB 4CM3A 2ZI6A 4LNAA 3EPPA 3UMSA 4CMHA 2PPVA 3OE7A 1X74A 3DVRX 2QP3A 5HRCA 2C7RA 2H4ZA 3VMFA 1XZGA 3KJFA 3T3PB 2NUAB 3GJ6A 3SU8A 3H0CA 4OFBA 2JNWA 3F6PA 4M9RA 2VC2B 3RD5A 1BJRE 3KB1A 4O4LB 4WEQA 1GFWA 2ODQA 2FSVA 2Q1TA 1JN0A 2COEA 2YQ5A 1QKJA 4V0RA 3TBFA 4BIIA 3D7SA 3EIWA 1AQUA 1XX6A 2HSWA 2BAGA 5A02A 1Z47A 3S2EA 3QV1A 4AKHA 1XWIA 1K88A 1E3SA 2H1CA 3UYLA 2CB9A 6REQB 5TQVA 1HFEL 4P4UA 1Z45A 2OBNA 3EXFB 1RC1A 1KMNA 3LOPA 3IA2A 4KV7A 1Z08A 4LYFA 2OV1A 3K94A 4Y9UA 5K0CA 1P4GA 2DU8A 1AQ6A 4MI1A 4N3BA 1QH8B 4D6XA 4EJSA 4RVGA 1MA3A 4WKGA 2O7VA 1JHUA 2CL0X 1JZQA 3L7DA 4RF4A 4EM6A 5FPKA 4X1IB 2YJ5A 1THGA 2BGIA 2CVOA 3AEXA 2YVQA 2UAGA 4LXGA 5KTRA 3U60B 1M1NB 3WL8A 4J7UA 2H5IA 1EX6A 2VUSA 4HPJB 5DHTA 2MSNA 4PG6A 3JARB 2QL5A 2X5JO 1GNLA 2XHEA 1QYRA 5HMLA 1WF6A 5ETJA 1Y8QB 5FNVB 1XZJA 2H2HA 1O97C 4IKPA 1U7OA 1PDVA 2Z5FA 2I2BA 2I66A 3LF1A 5AIBA 3FMIA 2OXIA 3T3HA 1KAMA 4UBIA 4PO3X 1QH0A 3EVAA 3W6PA 2PA3A 1RYDA 3FMFA 5KYWB 1VKHA 1T4DA 2ZFUA 5A9SA 1NHWA 1NRJB 3FSGA 3ESCA 4TYNA 4B46A 2UV8A 1PGNA 3NEYA 3LC1O 3ILHA 2E89A 2HIAA 3GH3A 5G02A 1ZJYA 1C8BA 3ORQA 4DM7A 2X9VA 5JAZA 4NULA 2IU6A 5I8WA 2XGGA 1L8OA 3BGDA 1CUEA 1DCFA 1LDMA 3D3JA 4GPD1 1A7UA 1E2MA 2NW6A 1A2QA 1XCMA 2C2YA 3I62A 3OQ6A 1M74A 5FTKA 3UAGA 1E3MA 5IEJA 4YYEA 2WUDA 1VE3A 2C9MA 3CRNA 3PXXA 4YJ3B 3R2JA 3C6YA 5J23A 3PIRA 4IY1A 1XTJA 1Z38A 4PX3A 5HRAA 1KAGA 3KHUA 5E6RA 2YN4A 5FD8A 5TF4A 4BFZA 3SC2B 1PZMA 5AJTA 5IZCA 1PG0A 1Y9DA 3MGAA 2FSGA 4IHJB 1TF7A 1XRNA 2VUTA 1I2ZA 1ZNYA 1GTJ1 3ETDA 2IGBA 3EASA 3F4KA 5LR6A 4AJ2A 2GPAA 3EIEA 2KBFA 2Z58A 4ZALA 5K0NA 3DCYA 2R8XA 4EBBA 3MPOA 2NAFA 2XW6A 4IJWA 1EFPB 4LJ4A 2ZUUA 5LLSA 1YJBA 1U5BA 1FMJA 4TPKA 2C54A 1CFJA 4QGSA 1KDVA 2V1XA 3F73A 3UMRA 4L5YA 3COJA 2GF0A 4KFSA 1VG1A 2IXBA 4JI3B 3TKYA 1RI5A 4RF5A 3MJTA 5IK2D 3UH1A 2Y6UA 2VAWA 3R5KA 4FHEA 4G4SP 4HX2A 2FY8A 4ZVTA 4MGHA 3ZWYA 2A67A 5AW2A 2Z6UA 3O8NA 4GT1A 4KREA 3O1HB 2FSIA 1DP4A 1F2UB 4JB8A 3ZKAA 1QG6A 2C31A 1UQRA 4Y2SA 1CUSA 4Y6RA 5CA1B 3K2BA 3ZDCA 3FNEA 3R20A 4E5VA 2P8SA 3DH0A 2R5FA 4WXYB 4GH5A 2F8LA 4HB2A 4EQZA 1I3NA 2O8FB 3EGDB 4GLLA 2JLCA 2ZBDA 1R5OA 5HK8A 2ZYRA 3KSBC 4E46A 3AETB 2JBAB 4D92A 3CVUA 3AP3A 1G20A 3GJYA 5LPNA 2F1OA 3KQHA 1WAMA 2DUWA 4PLPA 4IJ6A 1UC4B 1C7EA 3N9IA 3PUIA 4TT8A 1QGYA 5IBCA 1KHTA 5DSTA 1B16A 1ULHA 2QMOA 2O0KA 4ZO4A 2PTHA 4HWPA 4Q12A 3AUJB 4RXUA 2OTCA 3A6KA 3JV7A 4R1SA 1LRLA 2N1MA 2QMZA 3ANYB 4KDRA 2V0CA 5BV2P 3EGEA 3K1YA 3WO1A 5BN5A 5DHPA 3ETJA 2Y66A 3PK0A 5CXSA 4NI5A 5P21A 3HCEA 4I0WB 3WMWA 4M0FA 5C81A 1PJBA 1PD0A 1WF3A 3I3SR 5HF8A 3D6JA 4D0GA 2A9KA 5B3AA 1H05A 3GY0A 1IHXA 1NPTO 1WMDA 3K4PA 1U8CB 3ENZA 5CW1A 3ABZA 3T4EA 3UXYA 2P40A 1MNQA 4RLHA 3H9BA 4QLAA 4BFWA 4BX3A 4DGQA 4LXHA 5KQGA 3SE0A 3HNPA 5L4NA 3FUUA 3JATA 3HPRA 5ALSA 1P91A 1CJMA 1OYOA 1UXKA 1OYVA 3T3MB 3DTNA 4KRYA 1YR1A 5JTUA 4Q48A 1YI0A 1RZ3A 4E7PA 3C1OA 1SVLA 4H7KA 4I9UA 3JAMA 1K5GA 1MQ9A 3UENA 2Q3BA 3A1UA 4TWBA 1E6EA 1X42A 2B5VA 1E62A 2GZ3A 3BB3A 4JZYA 3RYFA 2FGKA 4F7DA 1XD2A 5ALLA 2WUFA 2WU0A 4Q47A 2XBMA 3OTGA 3KFVA 2HDWA 3ZV4A 3AB8A 4BJ1A 821PA 2ZTSA 2CLIB 1J1ZA 2J48A 2QRLA 3OA0A 4B71A 2VDOB 3EZLA 2PRKA 4UOQA 1EESA 2IYFA 4LGYA 1NWCA 1CUDA 4AWBA 2Q9AA 3I5MA 5C32A 1JEOA 3AV0B 3S1LA 3VO8A 2P5UA 3KUKA 2HGSA 2XZOA 3OX4A 3GRZA 3WNZA 1BSVA 1GQ2A 1TECE 4B45A 4DSAA 1TMGE 2VUUA 2BJVA 4GPZA 1E6MA 3ZHTA 1QYVA 1V9LA 2CJYA 4CDGA 2UU9B 5DI9A 4PTZA 2ATVA 1INLA 2FQQA 5AI4A 3DWEX 1O08A 2XDQB 2WD9A 1G8FA 1NAIA 1PWXA 1D5CA 2HQ1A 2W6JA 1BCRA 1H9CA 5MGBA 3B6MA 1R0ZA 1W0JD 2RG7A 5KYTA 4IDHA 4Y67A 4HBGA 3TRJA 3LBFA 2IZZA 1EUCB 1R0BA 1Y4UA 3FNHA 2YQZA 3W9UA 4AZVA 5KTYA 4GL2A 1VE9A 3FYUC 3JWIA 1WZ2A 3QQPA 1O9HA 1XLUA 3WDSA 2Q6VA 2XB9A 2Y8EA 3O84A 3UMGA 1EK2A 2AOVA 3INGA 4XB1A 5C0OE 3ER6A 4HGRA 1H85A 4BC0A 3CLSD 1XVAA 4LWOA 2VP0A 3WGVA 4P9NA 3ZDYB 1MABA 1LKZA 1VGRA 1XRSB 2ZBRA 4R8VA 2ENUA 3ZIAA 2ZUTA 1RI1A 4HEQA 4PGAA 2ADFA 1O6FA 1KNXA 3GC6A 4HWOA 3K15A 4QTZA 5C5CA 4YROA 1VTKA 2WNSA 1K92A 1U9YA 3THOA 1XPOA 3QBJA 4NC9A 1XQ6A 5IJ0B 4XOIA 4AJ1A 4TT3D 2ZYGA 1F8GA 4K9QA 2W48A 4X3CA 4XTCS 3R4CA 4P8RA 3S5JA 2CFTA 2HBZA 1ZSVA 1V47A 1HLPA 2Q6IA 5ULLA 5C7IO 4KVFA 4I9FA 2E7ZA 2DCMA 3WKDA 2LP4Y 1SUBA 5F2EA 1RAGA 3F71A 4QNMA 1LTQA 2VQ6A 3I9MA 4RKFA 5F77A 4B17A 4BO5A 5KVAA 3ZZMA 5FLEX 3ICQB 4AMGA 1FIUA 2FDRA 5A1TA 2ZDQA 3ZW7A 2WAYA 2C7PA 3C5VA 1E7MA 4OQXA 3CB2A 2Z5GA 1NR5A 2FZGA 2RAFA 4JYPA 1SN7A 4GHWA 4EJSB 4GWKA 3D0RA 1NE2A 2C5SA 1GDTA 3R40A 3RSCA 1FFWA 2OORC 3T1YB 2XECA 3HKEA 1BS1A 1PI3A 1XLTC 3OTWA 3SBXA 3FCOA 2DFTA 4ZZ1A 2FWRA 3FPCA 3NWOA 4E5SA 1HEUA 1HOTA 1V5IA 1ZD9A 2R8ZA 2X5XA 1U1EA 3RRJA 3OY2A 1UQUA 3QGMA 4GOXA 4BJ6A 3U61B 1P29A 2QLJA 4L95C 1HF3A 4FDUA 1EFUA 4DMGA 2EKZA 3QKWA 4RZQA 2WAOA 5JCJD 3CXRA 3T7SA 1RCTE 2ZRDA 3VOAA 4I08A 1GQFA 1FUEA 1T29A 4YAWA 2NX2A 1I1QB 1GU7A 1M76A 2HA4A 5B3KA 1Z5GA 2IYTA 3ACBA 4PC6A 4RY2A 1JV2B 3KQOA 3ZWWA 2X5NA 1QK5A 4K9SA 4KE8A 4N5DA 1T35A 2FW0A 3WRXC 4M60A 1KQGA 3CPEA 1O2DA 1W29A 2VWPA 2OA0A 5A6VA 1PWYE 5ALEA 3KQQA 1G291 3EG5A 3H75A 1WOMA 4EQ6A 1LZLA 3GNLA 3H2YA 5ALPA 3RREA 4R7TA 4WTOA 4YDRA 4M1SA 3SHOA 3NB0A 2N0SA 4TN5A 1IG3A 5J4VA 1PWEA 1AUQA 4IM7A 4MDEA 1TA4A 1N6OA 1IYZA 2QRGA 3PRHA 1SQFA 3Q7RA 5ENZA 1XU4A 1WMFA 2ZXFA 4KWEA 1R16A 4DABA 2NIPA 3M4NA 4EI8A 2A7QA 3C3XA 1U1IA 3HWWA 2H2IA 4LYYA 1SR8A 1QS0B 2W83A 3SJUA 4BDTA 5JD4A 1CD5A 1T6YA 4I1VA 4Q4DA 1IZ9A 1KEPA 4B34A 4CV0A 4W1PA 3OZSA 1IN4A 2AFHA 4NTZA 3FYUA 4Q9HA 5B2ZA 3SHVA 3LCJA 2A9OA 5CH3A 5DM70 4DJEC 1DJQA 1AA9A 3GT0A 1LSJA 4HK4A 4V38A 4Q6WA 1ZUHA 1T1SA 3PE4A 5TV2A 5FH9A 4QTUB 4FT4A 2YOHA 3KZVA 5BR4A 1K66A 1WV1A 1A69A 1D2HA 3KBBA 4JP5A 3RTGA 1CRPA 4C7VA 2YJGA 5JPIA 4EX6A 1P0CA 1J06A 2G25A 3V7YA 1JYSA 1NTOA 2XIJA 1H2AS 1BFKA 4KH1A 5GONB 5JNUA 1XOIA 2BFAA 1YK1A 2P62A 3WHLA 4BVFA 2PAAA 5AW3A 5K0TA 4AUNA 3BMCA 1C3OA 5K6RA 4LWQA 4RDIA 3H6GA 3LD9A 1I32A 1Q0RA 4C3UA 4IHKA 3C6MA 1ZBQA 2JCVA 1QV9A 1HYQA 1OW3B 1DDOA 1XYGA 3ZQ4A 1NASA 3A36A 4LXQA 2W70A 3UK0A 1US8A 4F38A 4YCMA 3JSXA 4OMFG 2QVXX 5DEOA 1GGHA 2BF4A 2QA5A 1VE5A 5HFAA 2I03A 4N0DA 2HRZA 2R1VB 2BM9A 3TAUA 2XCRB 3VJRA 4R4JA 4C2AA 2BI7A 1DPFA 5KI6A 2ZIWB 5FOSA 2QRHA 3MYYA 5HZHA 5IJAA 4Q82A 3D8TA 2JIRA 4RF3A 4UW9A 3I5XA 3UGJA 2OORA 3H13A 2ZAOA 4MW5A 2OFOA 2X1LA 1XLTA 3BD6A 3IPLA 3KEGA 3OQVA 4IIYA 1X7WA 4P80A 1ZXBA 5K1ZA 3UAOA 4PZUA 3GDWA 3NTXA 2C96A 3FR7A 3ZGZA 1QR6A 2WW8A 3U4AA 3OCZA 4RA6B 2JBWA 3DOEA 1PQYA 1IC6A 3G2KA 4I19A 3VKWA 2GGSA 4BE9A 3REQA 3KQLA 2OZEA 1QC5B 2DT5A 3OJLA 4WLVA 1QFSA 2H06A 4JWTA 2UYHA 5FBZA 4HRYA 1M1YE 3UMVA 4BVLA 1U02A 3A1CA 3GWZA 3FH0A 4RMHA 3RVBA 3HR7A 1PCXA 1Q1GA 1XEXA 1KI4A 3ON5A 1GYQA 3LYUA 3DV0B 3JATB 1O57A 4BZPA 1QOPB 2C4MA 2JZCA 4M9UA 4OHBA 3LGSA 3R77A 2WSIA 2FP4A 1CJTC 3I64A 1RJDA 3Q5GA 4EY6A 2MJLA 2RONA 3HU1A 3IT1A 4FBMA 3B5IA 3R75A 3TL2A 1WP4A 2DY0A 1NXWA 4C2UA 4FGUA 3RYFB 1U3GA 3EZGA 4CM6A 1FW8A 3GLGA 2V45A 2GO7A 1SHKA 3CJRA 2FWNA 3N05A 1ZVMA 2C3OA 1ISIA 2M1XA 3ONWA 2P1DA 3OQ1A 4NCIA 2NP7A 3VKVA 2IP2A 3PC6A 2VHCA 3G9XA 3QXSA 1VYHA 1DELA 5FULA 1EFHA 1DCMA 1YDEA 2QIOA 1FRVA 3QFFA 3L1IA 2R00A 4GOJA 3A3NA 4B2IA 3F5MA 4OK5A 1W5BA 1K3TA 5TGDA 2PUDA 1O8CA 4BUZA 3VKFA 3DV9A 4E0BA 4KO1S 3BJEA 2FSFA 2DETA 1LFAA 2Y0DA 1CUYA 1XXHE 4Y3UA 1LNQA 4KGXA 4KVAA 1SHZA 4YJHB 2XMRA 5L53A 4WERA 1CR2A 3QNUA 4XZ3A 1P9WA 3R5SA 1BCRB 4G09A 4GZLA 1AS0A 3AC0A 2Q99A 3QMMA 2ATIA 2PZJA 1O96A 5DMHA 3GN1A 4B8YA 2C8VA 2PJDA 1MF7A 3L7OA 1I3MA 2HF2A 1JPNA 2X6QA 3JYNA 1GZ7A 4G5QA 3HG7A 4IV5A 4J0KA 4RELA 3RTBA 4DRYA 4F4IA 1BGWA 3QVGB 3VOBA 4GSLA 4EHNA 4IV8A 1JECA 2JI6A 4GMDA 5EKTA 1E3LA 1DX6A 1N8KA 4QJ3A 4FYIA 4YYZA 3GNSA 2JANA 3L0BA 4GPEA 4GKKB 4TL8A 3OP4A 4MQUA 4WFKA 4KXUA 4C0KA 4QECA 4OTZA 4CM5A 2Y77A 4E5KA 5JHGB 1EWQA 4N9WA 3Q6IA 4DY4A 3DZIA 3QLEA 2Q2VA 4D3XA 2WJPA 1D2NA 1G98A 2A1TR 3LY7A 1HNZB 1Y7LA 4HAIA 2Q7XA 1W76A 2NO0A 1AT1A 1JHOA 4NK4A 3OZCA 4B9AA 1HA3A 4A10A 3D2CA 2BDUA 2CXSA 2ZCVA 1K6MA 4H7EA 4XI9A 4IVNA 5B3LA 1E1QD 3H9JA 2C5EA 3GLFA 4YMVA 2QSJA 2YOFA 4DCVA 4RDXA 1K8XB 3E9DA 3OLYA 4KXYA 3WP0A 2FMUA 4K9NA 1GNQA 2W2LD 3JR3A 1JQKA 2PSSA 2J3HA 4YDSA 1DAIA 421PA 3ET5A 3V5NA 4OMDA 4JVMA 2TRSB 3QA3E 4H31A 4J0DA 3NP7A 4GW3A 3RFUA 2IYSA 2VCHA 2YWJA 2A0FA 2XNDA 2QS9A 4UFPA 1E5TA 5JXJA 1G9XA 1GTSA 1E0AA 2GZRA 2PEZA 4IXNA 3WE7A 3KKMA 1JDSA 2RI1A 3GCWA 3IIMA 4QATA 4EG5A 1JX6A 3MAAC 1B42A 3URMA 5HIKA 1BX1A 2Q5HA 2PKEA 9LDBA 5KOIA 1FFCA 3A1EA 3BAZA 2OP0A 1OFTA 2PD6A 4S05A 2WM2A 2PS1A 3LXUX 4XIGS 3QEMA 4ALKA 2Q3DA 1R6VA 4UNPA 5AHRA 3P9CA 1W5SA 4CIXA 4C7XA 4MAFA 2P9FA 3E18A 4ZQBA 5IDQA 4E08A 3OEWA 3H2JA 3ESRA 2FMHA 1PQWA 4PZDA 3SOZA 3T1VA 1VLMA 4XFDA 3UWKA 3VR0A 5INTA 4PBSA 4PC3A 3VYSB 2GN9A 1KI8A 1N2CE 3FLEA 2Z8XA 5H4GA 5IXJA 2VK2A 4AS3A 2CHVA 5KOJB 3TL3A 1QZ3A 2J30A 1V6AA 1JQDA 2WWGA 1YZYA 2Z5LA 4XUEA 2HJRA 3EGCA 2JPDA 1DC4A 3GDGA 2IHTA 4DLAA 2NV6A 3QOXA 4YRMA 2I3DA 3INTA 3S55A 4DSOA 3U6BA 3VSBA 4DVGA 2D3TA 1AMUA 1G64A 4EQ6B 1KYVA 2ZJ3A 3U7IA 4EWLA 1IM2A 1T4CA 4W5QA 3DNFA 3ZC3A 4R5MA 4B80A 4M7RA 2HGZA 1E1YA 5CHEA 2KE5A 2M6KA 2RHTA 4E5MA 3D3KA 3VBEA 1DJLA 2V7BA 3TZBA 4C14A 4V2UA 2EWWA 2IYAA 5MFPA 1N4AA 1D4AA 1NF8A 1UJ5A 2ZQYA 2WAAA 1KIFA 3R41A 5EI5A 1E1RA 4AJ4A 4LVOA 4A36A 3IAM6 4JXZA 1KSJA 1V96A 4G0OA 3QY9A 2IA5A 3FYUB 3ZJYA 5AHKA 1N6NA 4QO8A 4Z0HO 2AHOA 3RC1A 1WY7A 1YZKA 3OF5A 2GZSA 3OO0A 5EJFA 4LJ8A 4MW6A 1R00A 3UB2A 5AW1A 3ZLBA 1P61B 4JP3A 3ZZTA 2Z2JA 4ENWA 4ZOQI 1RJ9B 3GUUA 2ECKA 2DWUA 3I9V6 3ROPA 3VYRB 2G9NA 1QV6A 3MAGA 3TQOA 2I2CA 3I61A 5JHHB 3CF6R 1QP8A 4DGSA 2Y27A 5EJ8A 1M5RA 1ESDA 3L4BC 2WG1A 4RLFA 1W88A 1VZ3A 1TZCA 3GDHA 3L04A 2HSDA 5CPFA 5KQMA 3AIIA 4RFSB 5K6AC 1HQCA 2WWXA 4YRAA 1C3OB 1UJ2A 3QBVA 4M9QA 4QOFA 1ZD5A 4UEJA 3FVTA 3DKPA 5BQXA 1IBKB 2R1UA 4TYQA 3A1VA 3EJ6A 4UMVA 4F3RA 3AEYA 3GUVA 1L5SA 3NXKA 5H80A 1YZ3A 4CEIB 3HBAA 3PDIB 4AT1A 1US8B 1P9OA 4JROA 3FLBA 5EZ6B 1ZGZA 4LA4A 1TYZA 1W48A 3II6X 1CJBA 3W3AA 3GFQA 4OJMX 1XEAA 3KYIB 1EGQA 2ODEA 2XODA 2B99A 3AW9A 2LR0A 2ZKLA 4TVKA 1GR0A 1UKZA 4AP6A 4LHEA 1HR0B 2PUWA 1V8OA 4YI5A 3T15A 3WKBA 2H54A 2VT2A 4FQ8A 2JH9A 2V8BA 5FRDA 4TSFD 1JQAA 1X7WB 2F62A 3I1IA 4MO9A 3HXMA 3PG5A 3AKYA 4UXIA 2ZB8A 1D1TA 2JAQA 4L07A 2P2DA 4NYIQ 3S1SA 4KHPB 1MXHA 2WU8A 3LQKA 4X93A 5A5VA 5L3QA 3TQTA 3R76A 3IEIA 4XM1A 2B82A 2XQJA 2ZTMA 3N8NA 2G17A 4I4LA 5DF1A 4DOMA 3M6LA 4DWVA 2MR6A 3EDYA 4PC7A 1UDXA 1UM9A 5LA6F 2ACVA 2K2WA 1N2CB 4U7FA 3WLJA 4A8JC 1DC6A 2P90A 1Q17A 1ODJA 1U3CA 3ZWQA 4BV9A 1I7NA 1IBCA 3A7EA 3HUUA 3NBQA 1XEXB 2ZDHA 4QUHA 1DVRA 3QP9A 4FMPA 4IIBA 1A88A 1L1RA 2EIHA 2YICA 5GJWC 1QFZA 4EG8A 5JWOA 1NVVR 2IUUA 3ZHRA 2XT0A 1A77A 1I6WA 2FK7A 2R5WA 3AUSA 4PIVA 4OQEA 2E4YA 2Q1UA 2CXOA 1DKRA 1YNOA 2VTKA 4JSTA 4WN9A 2RK6A 3TQSA 3WFIA 2V7TA 2V5AA 1GPLA 5H9WA 2CLMB 3O8OA 1WBBA 1XN4A 4NY1A 1VHDA 1I1HA 1QGDA 3WHKA 2UZ1B 2WD8A 3PQEA 5L51A 1TO2E 2Z6QA 1HMYA 3RRMA 1YMVA 4GLBA 1BWRA 2YTZA 4Q18A 1N8SA 3K72B 4RLSA 2JFVA 3TDKA 1B0PA 2P2SA 1NF9A 3HDHA 2OQIA 5DT2A 2IEYA 3IAS1 4J2TA 2D2IA 4AIRA 4FCVA 1WB4A 4HFRA 4PPFA 4YRCA 4U39A 4BYGA 1RMYA 1OI4A 3EZ6A 4KMOA 1XJQA 2FUCA 1D6NA 2JGJA 4KOAA 1YRQA 4WOJA 3HB9A 3NAGA 1GUFA 1O6CA 3OX2A 1JG2A 1KDOA 3E22A 3A6EA 2P2YA 5D51S 5LYYA 4R6WA 1DCTA 5KYYA 2ZJOA 1K9VF 1GTRA 1O96B 1TKCA 3DDZX 4AFNA 2PSEA 3HGMA 4EDHA 2RE8A 3G2NA 3OIYA 1IQRA 1JLHA 4UOEA 1HE3A 3KKQA 2BR5A 1GA1A 1PL8A 3E7PA 3L4BA 2OBXA 1R5BA 2H4YA 4L8VA 4LZJA 4OLFA 3PHLA 3U09A 4KZPA 3TOCA 2KBEA 3KOMA 2YWCA 2A5FA 4MUKA 4CUKA 1QG4A 1JIVA 3COSA 5BSVA 2J9YB 2JD0A 4N65A 2XT6A 3P2KA 1RJGA 2EGHA 1RTTA 3FFBA 3Q9LA 4G1VA 1II9A 1OBHA 4B3TB 4DCMA 2AFIA 3DZGA 4KXNA 4OSEA 3RBXA 2AJLI 4KXQA 3K9FC 2QRKA 3D54D 1XMJA 4ZYZA 3OA2A 1DEKA 1T0HB 4L4ZA 4PFQA 4RAOA 1RLMA 1E3WA 3NGXA 1RM5A 2B4YA 4EY5A 3O82A 4PQGA 2HOQA 4OLJA 3FOAA 3HM9A 4XGKA 5KNBA 3DYVA 3BMXA 3P2YA 1NX9A 1LW6E 1UXIA 2KYRA 2I8LA 2W0SA 3RR2A 4HGNA 1XALA 2PX8A 4J9VA 1TD9A 4RZXA 3CYFA 5SYAA 4TX1A 2A3RA 4H1WA 4KO2S 3ICPA 1UMBB 1Z0KA 4D4IA 3F9IA 2CLOB 1WVGA 3EOBI 3QX8A 1VI2A 2FLVA 2YNMC 3FUTA 5AI5A 5B7GA 1F2DA 1CUZA 2Y6VA 3UEOA 4Z54A 1JUDA 2CK3A 4H7JA 4AD8A 2EKPA 1OTHA 4IG4A 4ZCTA 2R68A 4CM7A 1L3CA 4HNTA 2LIPA 1QRUA 1PNTA 4Z53A 4A8JA 2QK4A 4ERXA 3NEJA 3PFHA 4XASA 5A03A 1SCNE 1RKQA 4JB3A 4MUGA 2BFEB 4UEKA 3UKJA 2P69A 2G9RA 2R8PA 5G4KA 4CNQA 3W5BA 2ODBA 1YB2A 4JSRA 5LOVF 4R7ZA 3VISA 3X3HA 1AN9A 1NFRA 1N0VC 1IZ8A 3FUVA 3RS3A 1QE5A 1K4KA 4N3GA 5CT4A 5JZ9A 1RZRA 5HGXA 3W1WA 1ZKMA 3OUTA 1DQSA 3Q41A 4K9MA 2B3DA 3ICVA 2KB0A 1OB2A 1IB6A 3D8HA 3O95A 3ZCXA 1Q1EA 1N2OA 1I3KA 4OATA 5C8VA 3OEYA 3Q3HA 2XB2A 3PQ6A 3TDNA 4MRNA 5CYPA 1BA2A 1V5FA 1ZONA 2Q5JA 3BA6A 4G41A 2P9JA 4UU8A 4DARA 2XR1A 3DO5A 3EQZA 4FLFA 4B2LA 3GLVA 4XYBA 4RMGA 5LA6A 3WVNA 2FK8A 4BNDA 4EKGA 1A8HA 5DLYA 3T5PA 1Y6GA 1JI0A 4PVCA 1VXRA 1B14A 2WYUA 4JL6A 5HPYB 2GK6A 1GDDA 2OCDA 1SRRA 1ADBA 1JEQA 2JF0A 2I9KA 1NU8A 2X2EA 3Q85A 2PWBA 2UUPA 4IGKA 2VUHB 2Q7OE 3RFFA 1JAXA 4AY5A 4LJ6A 3EFOA 4R2LA 1KERA 3WMGA 4BECA 2BMEA 1L4HA 5JSZA 3C3EA 5AVKA 4YWJA 2PZLA 2H7XA 3D1VA 3KK0A 3DM5A 1SK9A 3AOEC 1OJ7A 4IMIB 3M33A 4M7PA 3TZHA 1Z18A 3T7CA 5B5SA 4X91A 2PIDA 1BC5A 4JBLA 5FUBA 3PR1A 3WY9A 2MTBA 4I55F 4Q15A 1RFLA 3MCAA 3Q0TA 5BWNA 2WZDA 1YOVA 5CIYA 5DTJA 4D8UA 5LQMA 3ADBA 4F9EA 1BDMA 3BH7A 1E79D 4EL5A 5IKEA 3G59A 2IS1A 3CKYA 5ERGB 2XCTB 4BZZA 4DLXA 3C43A 1N6IA 3G5TA 4JBNA 2JHPA 3HH8A 3LQ2A 3PA6A 4PWZA 1ZBDA 2P0EA 3KTFA 3CA8A 2PKRA 3G8DA 1QYWA 3PNMA 2V3VA 3VPXA 1YS7A 4MPJA 2JI9A 4ALMA 4IDGA 3TWOA 3WWYA 4HAXA 2ZYDA 1GSHA 3CLTC 1Y1RA 4MROA 3OH8A 4WDRA 1CR1A 3C8MA 4F1KA 5HFNA 2IBTA 1C80A 1KZ9A 3GPBA 5I7AA 1H2FA 1N7IA 3COVA 1XK6A 2CL7X 2ZWIA 3N8IA 2XMGA 5JZMA 3TKLA 1TM7E 4QJIA 2ZBUA 1T2NA 1TM2A 3T34A 1ADJA 3ORHA 5D6NA 3AHHA 3ZCQA 1DIHA 4RY9A 5JCZA 2HPVA 10MHA 2H2AA 4BQOA 2AG0A 2GHIA 1UPCA 1ECCA 2ZPAA 4GE3A 5JI3E 1UQTA 1B0UA 5AMXA 4BQSA 1A98A 2YHIA 4UAUA 1KR5A 1VBNA 3QY0A 4FFBA 5E4FA 1ODCA 4WLFA 2POQX 3PC8C 1GEEA 4ND3A 4E6EA 2Z2XA 1AKVA 3M5DA 4QASA 5DW0A 5L3QB 1ZZEA 3BWXA 5KQLA 3QH4A 3MFYA 4P3OA 2D6FA 2WTUA 3E6AA 2VT6A 4Z1OA 2OQRA 3F9CA 4GVXA 1MC4A 1Q2XA 4ID3A 1HY3A 1E9DA 2X8BA 3NM5A 1EFCA 1VL0A 2B9EA 3C6ZA 4Q7KA 3B1VA 3QE9Y 3DHWC 3E84A 3PB3A 4D8YA 4OXIA 3FMVA 1SD1A 2NSJA 5EJ2A 5B58C 2DBRA 4IQ8A 1Q3HA 4ZOLF 2A9PA 5TPZD 3CVJA 1CNEA 1JRLA 1Y1PA 1OSNA 5LB4A 4N0QA 4D42A 2HMUA 1R8JA 2RJOA 2V55B 3F5QA 2B36A 3MZ0A 4MIYA 1RLUA 4YI3A 1RP1A 4ENPA 4M8KA 5E6SB 2G3YA 2BR3A 1UDBA 1A1SA 3VNSA 4H0CA 1IM5A 3LPCA 1GQSA 2B69A 3OD5A 5DB4A 3FR8A 4URHA 1ECBA 1A5TA 3PEUA 5LOVA 3H1AA 3QXXA 3IYLW 4ESVA 1KNQA 4JYMA 1TRKA 4UEOA 1CZLA 1IY8A 1RP7A 5JY1A 1MOPA 4E94A 4OYYA 4PYIA 4HFNA 2GHQA 3VR6A 4DA0A 2F3QA 3WGYA 4D8VA 2QN1A 1B8UA 4F93B 2BFCB 1H94A 3AOEA 3EDQA 3KE9A 4MV5A 3TW8A 4R98A 1XRQA 4AY3A 3CPHA 2I1WA 1XXLA 2RGWA 5IAOA 2E1PA 2JRCA 3B6JA 3PWKA 2FUNB 4FN4A 3NCHA 4YAEA 5AM2A 2AKAB 2BHLA 4J07A 1OFHA 5FADA 3KWMA 3AL0C 3OPQA 2H65A 4X7BA 4FGZA 3TR0A 1SHTX 3OM1A 5KYYB 1VB3A 3JVUA 3PYXA 1WR8A 4KQHA 4DUGD 1Z9BA 2UYYA 2VSOA 4FT2A 3W7AA 2YYAA 3W1EA 4AI6A 4OQ4A 3WFZA 1LPAB 4NKRA 3ZDDA 1TNDA 2C7QA 4KFRA 5CU7A 1LJLA 1PU2A 3AHIA 3L40A 5TMBA 4Y6LA 3D3WA 1XL0A 5FWYB 5FUMA 1PDOA 1ZA2A 3TFOA 3QFSA 3FBWA 3I28A 2ZJ7A 4HN2A 4MRVA 4WD3A 2KMLA 1KKUA 4KSCA 3VTKA 4HDSA 4I9NA 2AFIB 3RJ5A 4BMDA 4C01A 1O87A 2GAJA 1GPNA 1R8XA 3LK6A 3WLPA 4B3CA 3AHEA 5J1SB 3ANXA 4D41A 4AX4A 1W0CA 4I55A 4YUAA 2XPCA 3MUEA 4L0CA 1K06A 4NL4H 3RC9A 2FA9A 2PS9A 3CTPA 1LBEA 1OT3A 1YVUA 2H07A 2JGKA 3JYPA 1OXSC 1OA1A 1L5LA 4GOMD 1DCKA 4B32A 1CEYA 1KJ9A 1CQZA 1FFEA 3KZXA 1WCYA 4N9QA 4P5EA 5C2JB 4OB6A 2O8BA 3AKCA 4B3SB 1CXZA 4NBSA 1NI4A 1FYEA 2IOFK 2RHHA 1AKEA 2ZIXA 3GT3A 5TF0A 4ER3A 3HE3A 5ICFA 4R2HA 3THRA 2MINA 3H7AA 1FNMA 3PC8A 3AFHA 4P92A 4TWRA 1ZH0A 2D06A 1SURA 2HXYA 5AM3A 3LDFA 1X15A 4RA9A 1E2UA 1Y80A 1NQWA 5ILQA 3RBVA 4C6RA 4BLRA 1EDDA 5BUQA 2Q2WA 3TLMA 1K5HA 5EOVA 1IN6A 3OLXA 4OGLA 2QRJA 2J09A 1C0PA 2BEUA 2R751 4DRXA 3JWGA 4A8JB 1E3DA 3FZEA 3PUYA 4A3SA 4DA7A 2CEKA 1UC5B 2PWPA 2UZ4A 5ALQA 3IVCA 3MHTA 1II8A 4LNHA 5G4KB 4CQJA 1SVNA 3WKAA 2WYIA 3GCGA 1XTZA 3RV3A 2VHQA 1MRNA 1YQTA 1NVFA 3QIAA 4B3JA 1X13A 2ZRNA 4ND8B 3I1JA 1P2GA 2Y1KA 3PGJA 4GC9A 3FCXA 5EMLA 1T3GA 3RU3A 4FBGA 2O3SA 4MYDA 3S8MA 3V4VB 4NYJQ 3C87A 4ENUA 1R0KA 2GAIA 4M46A 4GXTA 2PGJA 3PEWA 4OIFA 4AC9A 4RH0A 1TK3A 4CR8A 4L8FA 2YWRA 4XWWA 4LE2A 4OYLA 1DIRA 2JAXA 4B4OA 1ZQ1A 4L1KA 4IS3A 4LV5B 3HWRA 4O4HB 4P34A 3RUHA 2DFNA 1ZNWA 4P7FA 3FRIA 4ETMA 4PN7A 4O4IF 5HF6A 3D7RA 3T35A 3L02A 5IW8A 3T5DA 4BOYA 3GNQA 1E98A 3S81A 4IUDS 2RDMA 4URUR 3DMTC 5LA6B 4MW2A 4MV3A 4BNDB 3ICEA 5TDHA 4QDTA 4QTYA 2JIDA 4OQLA 4MI6A 4QL3A 4ZOLA 1P1JA 4RTJA 2I34A 3IQHX 3P9SA 3IIKA 3B38A 2VP4A 1XAIA 1D2GA 1K6JA 3F5FA 2CWDA 4PHGA 1JEQB 4LJSA 1TEHA 3ZWMA 3UYKA 5JC1A 1OLUB 4C1NA 3L7YA 4YN3A 1FXUA 1DFIA 3EFOB 1MVOA 1DS6A 2ALJA 2D54A 2IZ0A 2PX6A 2YWHA 3KKEA 3WSVA 3ITDA 2HT1A 1I4TD 3HC7A 3NHAA 4MP6A 1U04A 3DMGA 3F49S 1A8QA 1NBMA 3FCAA 1IHUA 3HWSA 4HN9A 4TTVA 3O73A 5TJHA 3ZV3A 4DMCA 1NUQA 5MGNA 3ZNQA 3FOEC 1OYYA 3V7FA 4ZI7B 3A31A 1VPEA 3HPQA 3NORA 3T7JA 3K9HA 1NG9A 1K7EB 2WBLC 3ZI0A 1U0EA 1YOVB 3N8HA 2GA8A 5CDFA 4BL5A 2J5RA 5KKCA 2Q6TA 2G76A 1D8TA 1BKDR 1GUZA 2WKWA 2O20A 2ZYHA 4TTAA 1JW9B 1SB9A 5IRCD 3C45A 1PLKA 2BBWA 4IGEA 1JIJA 4JGGA 2ISSD 1ELOA 1GM5A 4X7PA 1EVJA 4CZ2A 1P7YA 2YUIA 3AUUA 2NAPA 2FRDC 1SULA 3OWOA 3H4IA 4KQEA 2OENG 4GZ5A 1DHRA 2QE7D 4BYMA 5K3DA 5EGSA 3S7TA 1H1TA 1G0OA 2PZFA 4JLBA 1N0IA 3HCRA 2VNIA 5DBIA 2AWOA 3S5UA 3B7GA 5AVZA 3FSEA 2HLPA 3ANMA 4GR4A 3CZAA 3TR6A 4D4HA 5A06A 3B2NA 1QYIA 3I5UA 3IVRA 2H16A 3A2LA 3T9AA 3FI0A 3PI6A 1JT9A 3QVWA 3KOZA 1JF8A 4NZZA 3WJ7A 5C1BA 3U44B 1GQYA 4MWOA 1DBVO 2YV1A 4C2BA 1E0DA 1SC6A 2J46A 4HQ6A 4MW7A 4FBLA 2WKRA 1SFRA 2E55A 3EQ9A 2ACWA 3FNFA 1ISGA 2YHIB 1ZUD1 2OV6A 4Y1EA 4UQOA 4ZI5A 7MHTA 3JQDA 1R4NA 3L1VA 4L9RA 4DBVO 1T9ZA 1B2RA 1SXHA 3S99A 3WV4A 4ZICA 2I7VA 4Q9LA 1T9CA 3ESYA 1RACA 2OHXA 2POCA 4KW7A 4OGGA 4AJHA 1Z75A 2EL7A 4W5TA 1G5RA 1Y4AE 3HSSA 4JU8A 2AB0A 5ICSA 2CDCA 2OE2A 3K1AA 3L7LA 4L6IA 3RYHA 2V7QD 4EA6A 4LBYA 3LKDA 1QHGA 5HA5A 4U5XA 3WYGA 2H17A 4HR7A 1ZCAA 2QLTA 2QL9A 1CQIA 1T8TA 5ITWA 3QIVA 5ARBA 3LDUA 3LYLA 2CXUA 4MWSA 4YLGA 1FL9A 2PZ8A 5MFZA 1VSVA 3ZGYA 4YXWD 3EPHA 3O47A 3DMTA 5M2QA 1AGYA 2Z3ZA 3UPDA 4P4SB 2PGNA 4KAAA 4RK0A 1TVMA 4FB4A 1RMTA 2ZBQA 5LM3A 1UWKA 4F0JA 5FTMA 4RDCA 3BJMA 3DS8A 4RZHA 4A6PA 4DV3B 5BWBA 4ZDWA 4L9AA 1ESZA 4F12A 3ZDXB 2GTHA 1RPTA 4CKEA 1P39A 2C2OA 4ZZ2A 3JQFC 3KVVA 1M54A 1T0IA 1H2XA 1PUIA 2ZJ4A 3WL3A 5JYDA 4LY0A 1E8MA 4ARBA 1G5QA 2VQEB 5JCOA 1QVAA 2FSPA 1K97A 3O2NA 4Y9DA 4NDAA 1XDSA 3AO0B 3KQSA 4EG4A 3UKDA 4O4IA 2V9ZA 4UD6A 3HO6A 1Q0SA 3A6HA 3ZHUA 4LCEA 4RHCA 4IR7A 1X8KA 2WSSD 1RJFA 3TIXB 1FP4B 1ZW1A 2OBLA 4PR0A 2R86A 2V5VA 4PCVA 1AY0A 3H5OA 3H8JA 3K1JA 4PSVA 5HHTA 3OZBA 1XP8A 2FN9A 4RV9A 2GEDA 5HEKA 5L45A 4Q6BA 1DZIA 2YQ4A 3B6KA 1YBAA 2FRDA 4YV1A 4HQ0A 3KQYA 4U6NA 2V6JA 1A9YA 3MWDA 3OP1A 4PZCA 8ATCA 1PT8A 3LXRA 5DGIA 3SZGA 4HDSB 4EY7A 1H6AA 3QMVA 2V1UA 2YBEA 4TKLA 4W5WA 4UARA 4ZEWA 4GQBA 4F96A 4QUJA 1M3SA 1M83A 4YRLA 3ZDEA 5COAA 2FFAA 4K9RA 1MEOA 1U8UA 2YXNA 4FGJA 5JCOC 3QVMA 2CHFA 4OLAA 1KDRA 2BBSA 3IXLA 2ZM6B 1MR3F 4XAQA 4DMFA 1Q0HA 4JBIA 1RHMA 1CIPA 4Y2VA 1UPBA 1KXJA 3PUXA 4Z0NA 4WESA 4KDCA 4NMHA 4E12A 4R83A 3EF0A 4TTRA 4NPAA 4DV0B 4W99A 2OAEA 3AH8A 4HXGA 1Z4KA 2MINB 4REQA 4E5YA 2Z5VA 4II2A 3LCCA 1P5HA 3ZV5A 5ANRB 1U0TA 3SDBA 4C0LA 4IKEA 1JJBA 2JGLA 1S89A 4ZAXA 2BEUB 3AVQA 4IYJA 4DRXB 1XQYA 3GJSA 1LBQA 1JU3A 3FJYA 1IJEA 1II8B 2R6FA 5HFJA 3VZRA 1NQOA 3TRFA 4LF5B 1I3OA 2OZLA 2FN8A 5FP0A 4HVLA 4QFDA 4RD2A 3RQIA 1GGVA 3RUFA 4ERNA 5JMTA 3M5PA 3WDKA 2E4UA 2J07A 3AQIA 4TKMA 5BQ3A 2B37A 2P4HX 2Z57A 4YAGA 5LLTA 5TEVA 1RPAA 2WF7A 1A8SA 1E5VA 1ORRA 1C7QA 2J87A 3CNLA 4ETWA 4Z7QB 2JLWA 1SQGA 4FZVA 1M73E 3AFIA 4O8CA 3GPLA 5CNJA 3MUFA 3F6BX 3KBOA 3N58A 4LZZA 5B1YA 4AWXA 4HWTA 3M9WA 1DX9A 3BGVA 2OBFA 1LTKA 2YV5A 1G63A 3R9KA 2QNRA 4BLVA 2IQIA 3IEKA 4MVJE 3N0WA 2ZYIA 3CW8X 3E3AA 3HNRA 2IELA 1Y6ZA 2F9LA 4G25A 3PJEA 2AXNA 4JMLA 3HLKA 5JQGF 4HCJA 1RQXA 4JDPA 2PL9A 7AT1A 5C52B 3THXB 4JI2B 4S1NA 1Y3CE 4FMBB 3NTLA 3N0RA 1GYPA 3CZ4A 3L6RA 5E4JA 4LHXA 4MPPA 2F1RA 2JVIA 1LU9A 2X3UA 4HQLA 4MVJG 5L7WA 1DMSA 2JGFA 2EARA 2P77A 1N9GA 2QW0X 1RAFA 3OQNA 1E9VA 4PGGA 5TQ0A 2FZLA 3PGLA 2WKQA 4LXUA 4CF6A 2GXSA 3HFJA 4F4HA 4OGKA 3R7BA 1RKXA 3JQ7B 4AJOA 4DTIA 2FW8A 3CE6A 2OCKA 3PWZA 3CW2A 4FNAA 3ADKA 4PO8A 1QZZA 5CVDA 4AM8A 5CDUA 1Q7CA 1XGKA 2BEJA 2YV3A 3G23A 4WVFA 2DT8A 3EIOA 4CL2A 3U6KA 1MVNA 1YB4A 2QTTA 1XHLA 4XKJA 3VGJA 2R60A 1WMBA 2FN3A 2XZTA 5FXMA 1ONPA 3ZHSA 3LUAA 1J6UA 1NIPA 2PKXA 4G23A 2IWRA 1DBIA 2AOWA 2DQ4A 3KVRA 3ZZNA 5DSXA 4CCYA 1KAHA 5BWMA 1ZS9A 3KL4A 4ZDIA 1EAYA 4I8XA 3TD9A 1FVXA 2ZWVA 5FLXA 3PD7A 3N86A 5THXA 3RTAA 4R7GA 3HXOA 3OPMA 3LDHA 1GGJA 2I2AA 4H4CA 4A0QA 4QYTA 2HLDA 1FS6A 1L7BA 1MW9X 5TEWA 3W77A 2QGNA 5BSTA 4RULA 2X8LA 3DDNA 3SWWA 2F55A 2R2GA 3M3PA 4ZVLA 2A57A 3G85A 3ZWXA 2IUTA 1VL6A 1NSTA 1HDCA 2HFJA 4FKZA 1PNVA 3ZCPA 1LLUA 2DHDA 2FMFA 1W35A 1ID8A 2NXCA 4FP9A 2BGKA 4L5BA 5K4GA 3GW8A 3VR4A 1KEVA 2JKZA 1RWNA 5L6LB 5LSAA 2OGWA 2XKBA 1J33A 4ZHSA 1PQPA 1ZJ6A 4U2GA 3V7UA 3ME5A 3NANA 1RYFA 4MSUA 4BB9A 1BFUA 4B4UA 3L4JA 3AF0A 1TYAE 3T3EA 5EPEA 2IEAA 1WPRA 1EE2A 3OOJA 1GUBA 2QMYA 3O38A 2YR0A 1F6BA 1GPMA 5ALKA 5ADUS 4UZEA 3L8DA 3RVJA 1I5OA 1Z68A 2VXBA 4WOKA 1WIWA 3UHPA 1FU7A 3GDOA 3C2QA 4M9SA 5IAAA 4WMLA 4LZOA 4BNGA 2VF2A 3RAPR 1W2GA 3NJRA 1Z2AA 2AF3C 3ETGA 3EVZA 2AG1A 5C7YA 3BF7A 4GWGA 4ZOAA 2O23A 1CUBA 5HK9A 3RYHB 3KTOA 1ZD3A 3PYLA 3NQ41 3TLBA 1L4KA 1KFKB 1E4EB 2VYQA 2O1SA 4DCGA 3JYQA 3AU9A 4JLAA 1CQIB 2Y0CA 3B48A 3V1YA 3RT1A 3LT5A 1VYUA 4KX5A 2WY2D 2RH4A 2GEVA 2BDEA 1O58A 1Z4PX 3L0CA 3K5HA 1DT3A 3RYIB 1VDMA 4YX9A 1NY6A 4CRWB 2E9SA 4TTTS 1L7RA 4ZANA 1HNNA 5EHZA 2JFXA 4G0WA 4G6ZA 4O0LA 1G18A 1FSFA 2I2XB 3C3AA 3AVPA 1MX9A 2FJPA 2VOJA 3SZMA 4CKEB 3OLVA 3KOXA 4CTNA 2OHHA 1TKRA 1HH4A 5LZ8A 1MCZA 3SC6A 2OCAA 1D3AA 1ABEA 5K01A 4N82A 4ARCA 1EWKA 5IEBA 5K3FA 3WLEA 1Z8FA 5BOSB 3V2HA 1XRRA 1WU7A 1UBSB 4E31A 2INGX 3O21A 3WXMA 3PITA 4GC5A 1U2ZA 2CMHA 3QI2A 1Z5UA 3BUSA 1GAEO 4O4IB 3U5TA 1BH2A 2VF7A 3E8XA 3QHAA 1AUXA 1EWRA 1UF9A 5DN6A 1WB5A 2X4IA 3C97A 5JQGA 4LI3X 3ROTA 2G72A 2JFFA 2QAGC 4M0EA 3WI7A 2HRRA 5CFNA 2FPGA 2YJZA 1PRYA 4CV2A 1PVDA 2YN0A 2C57A 1ADFA 5CHYA 5JDIA 1EQUA 1FBNA 3ADPA 3PI7A 1KJNA 4FYKA 3DEHA 5DT9A 1XCBA 4CBVA 3D5QA 1HFWA 1UJMA 3N74A 4QQRA 2EU8A 4CKCA 3P0RA 3SQOA 3VR1A 2CXNA 2O2YA 3V2IA 1SG9A 1VJ5A 1RAAA 5ERYA 3DQQA 3GFOA 1IDOA 1QIJA 1XU9A 2JB9A 3IQGX 3NG1A 4HQRA 4A6EA 3E3LA 4EEZA 1RMQA 5FA6A 3LPAA 4EI7A 1N2GA 1DDGA 1KI1A 2HXSA 4ROTA 2VATA 4U63A 4EVSA 1N75A 2ZRKA 4JIGA 1SVIA 4BV8A 2XEDA 3ND6A 4U6SA 2VF5X 5CIQA 2WQ6A 4NFHA 3QNMA 4FMCF 1JG3A 2RHJA 3NRCA 3QYJA 3GLHE 5ILGA 1NVWQ 4LSGA 4ZC8A 4TZ6A 4UULA 4WESB 5FBLB 5A7GA 1XVLA 3I92A 3LBNA 2QTLA 4P4LA 3OAAA 1I7PA 4JJ4A 3WGJA 2ZJBA 1EMDA 3VNQA 3AUTA 3Q6MA 3BIXA 4UUQA 3IEXA 2FEPA 1YZLA 4LTMA 3TUZC 3NTRA 4FW8A 5H02A 5KWVA 4GLJA 4RHXA 1E7QA 5LD2C 2FPIB 1JIXA 2VRNA 3IVAA 1DWOA 2DPHA 1M0SA 2QTWB 4UUMA 4U3JA 5E8JA 2Q3JA 3DOCA 3QPWA 3IJ5A 1C14A 3L0PA 1YCFA 1BXKA 3NHPA 3ROFA 1TM1E 1P80A 4OSOA 1GNRA 2OZLB 1ZAYA 3R3JA 4O6VA 3QTTA 1D2MA 4Z4GA 1ZVJA 4DDMA 1TUGA 4ZK6A 2QP9X 4ZYUA 4GZ3A 2EERA 3RPEA 5MF6A 5G2OA 2O2HA 2VSYA 4Z4FA 3NUQA 2EATA 1E6CA 4V3BA 1SOAA 1XTTA 4G81A 5JMWA 2IEDA 4OP2A 4C0AC 2HLHA 4WLNA 1KDZA 1FTQA 1PGJA 3IIEA 1U9ZA 1YJQA 3K70D 3A6GA 3AVWA 4L5IA 2NV2B 3JWEA 4IIVA 2IS2A 5EUCA 4QPPA 5TY0A 1M6EX 4KGVA 4CM1A 2ZULA 1VKOA 3C8UA 2DQZA 2FUKA 1RXYA 2ZWOA 2PKQP 5FTNA 3WV5A 4B3MB 4G0UA 3JQAA 1SHJA 3GG2A 4L9WA 3SD7A 2PYDA 3Q15C 3FROA 3UXEA 2NZUG 3KYCB 4GGMX 2IIPA 2C8LA 3FPAA 5AVTA 4WJKB 1TK2A 1KEUA 4B8ZA 1U2TA 3QKTA 3FUXA 5JNSA 1EM8A 2OO5C 4AXBA 2FDCA 4MA5A 3DP9A 1U2GC 4IQ4A 2IY7A 5BW5A 2IH4A 5KBYA 2O14A 4JEHA 1SC4A 3OFKA 2Q4DA 1DTSA 4JSYA 2AUNA 1LBTA 4DCCA 4HLNA 5EKXA 3MPUA 3CR7A 4EJFA 3IC5A 3LHKA 4C0JA 3T0IA 2RKOA 4MTCA 1ZQ9A 3F0TA 5GZ3A 2PH3A 3RSHA 1VJTA 4QPCA 5K3OA 1JKJB 3AKDA 3EZ2A 1DAGA 2B8JA 5FR1A 2IT1A 5FUXA 3T4UA 1KU0A 2WAMA 3PTAA 1VA5A 1EUYA 2IYRA 1G55A 2LXNA 4Z0TA 4IFBA 3ESXA 5CB6A 4UE6A 4E07A 1W5AA 3QYFA 2V0NA 4E70A 2JIPA 4R1UA 5FBQB 2BVNA 2IV3A 4O1HA 5LDGA 2DPXA 1QPZA 4UXJA 3NDJA 3B9RA 2SKEA 1Z6YA 5AQEA 2HMSA 3SVLA 3QOFA 1SXJE 2QWXA 2PSJA 3SPXA 3AU8A 3B51X 4BDSA 4WBNF 1XKTA 1TOAA 3GK3A 4WI1A 3PQ4A 1LS1A 1HWYA 1NSFA 1U5CA 4K88A 2FR1A 4ZMBA 3TSZA 2P9HA 1SU6A 1WUIS 2FG5A 4BO6A 1WOYA 4G2TA 4LYJA 3V34A 3QUTA 1VKRA 1DTWB 4G84A 1H8HA 1BMTA 4GI1A 5D1HA 4K6OA 4OJKA 1U6JA 1B2LA 3HABA 2AKYA 2NUPA 5AKJA 2VRCD 2CUKA 1VJCA 3A6ZA 1QGUA 2BCGY 3HMKA 3R5FA 2WWYA 2W8BA 3GUCA 4ZYWA 2XWQA 5HBRA 1JTFA 1XLWA 3OZEA 5TC4A 2L2QA 1RM3A 1G7RA 3IKJA 5E7IA 2F90A 2C3PA 2PO7A 4BUJA 3UPUA 4MDYA 1F38A 3F4BA 4MAMA 2XLBA 1STOA 621PA 4MUMA 1PHRA 3QU7A 1AZLA 4Q05A 2H59A 4WPGA 2V0GA 4INOA 1IHPA 1A9XB 1O03A 1UKEA 1N1MA 2HPAA 3W2FA 1VKNA 1IRIA 3OE7D 5CA0F 1YGYA 1ZK2A 3HGQA 3DE3X 4XVRA 1Z4QA 4OLHA 5JLAA 4IJUA 1KY2A 3DOJA 1FLDA 2ZT6A 4PXSA 5GGXA 3AQ4A 2AGVA 3GUZA 3OZIA 3K35A 1H2RS 1VIAA 4L7QA 4URFA 1F5NA 1O0SA 2EHJA 1B00A 1JA9A 3GAAA 5JROA 1KJQA 1OGIA 3JAWA 1GNPA 2C92A 1Q0UA 3C15C 5LXTF 3TI9A 4CLRA 5ISMA 2DQSA 4K0KB 1JAIA 5FLYA 2VZEA 1R0WA 2AL7A 4YAUA 1NW9B 3HVJA 2VZ9A 1O5IA 5H3CA 5ELLA 3GMTA 3QNWA 3RS4A 4CVNA 3G02A 5JFTA 3KT8A 5IJXA 4JCCA 3T3IA 5H3LA 3OE5A 5AVRA 3PV0A 4ZJPA 3KKNA 4RORA 5KYGA 3PHGA 5AD1A 1CVIA 1R27A 4MUFA 1L1EA 3K05A 3L8GA 4BBAA 4LVUA 4QYXA 4D3FA 4LCBA 4Q3BA 1PTKA 4DQDA 2O1WA 4P2BA 1EPUA 4DA9A 1U2GA 5KVCA 4XARA 5ITZB 1JHMA 1PKXA 2RFLA 2ZI9A 4FS8A 4GPBA 4YQFA 4IOJA 1PR1A 3PX7A 2G1PA 1A7KA 3NHYA 2Z95A 1SA0A 1NQXA 4RE6A 1P3JA 4FGSA 3GP5A 3W9YA 4JMPA 2R47A 3EEBA 3DUWA 3OZFA 4E1AA 2XWJI 2H4XA 1E1LA 1RC0A 2GD2A 4OAPA 3DMFA 3BD9A 3VR5H 5KNCH 1RAHA 2I1QA 3FSRA 3PRJA 2ZJ8A 1DBSA 2P4EA 2ICAA 1WE2A 3V8EA 4HNUA 2NGRA 3IV9A 5ICMA 3NVMB 4I1RA 4NBVA 5AICA 1RNLA 1ITZA 4FD2A 4XCXA 1RXCA 2WINI 1V95A 3QEKA 4GRIA 1GU0A 2QL7A 1DKMA 3FSGD 4G5YA 3OT4A 4HN4B 4IPTA 4L3WA 4YRNA 4MKFA 4W1QA 3RC8A 1ZICA 1ZMOA 1N78A 3HY4A 3DVQX 4OXKA 4BQQA 3N75A 2FHSA 2ZYAA 4H59A 1NIJA 4W5JA 5DLPA 4TTJA 5B37A 3DDHA 3E58A 5D3ZA 4C3ZA 4X8OA 3NBUA 3HTXA 2VZ0A 3E81A 3SC3A 2VKQA 4MUJA 1JAZA 3EA4A 3IE0A 3T9CA 4QIHA 1BXRA 1E3QA 3PPWA 1SRQA 3RSQA 4OBXA 1COWA 1XRMA 2G7ZA 2H31A 1PSDA 3DE1X 4M1KA 2WTAA 4U8GA 1TZBA 5K3BA 4JH0A 1TYBE 3CKLA 3FPFA 3NPMA 3EXG2 3T52A 5F1OA 4D4MA 3OU7A 4KMMA 2I6GA 1H9BA 3ST7A 2KI5A 4LC9A 3OBIA 3THWA 1RIIA 3M1IA 4R68A 1CK4A 2G4CA 4EUFA 2HQBA 2WJWA 1A4UA 5LQNA 1HDXA 2O8EA 3BWCA 1NP6A 3I2YX 3S0JA 1G2QA 1QBGA 1A5ZA 4J29A 1XCPA 3IOEA 3TMKA 4WBNA 2O2GA 4U3JB 1ESMA 4UCQA 2IV7A 1N1EA 3T5AA 1I0LA 2F17A 4V0QA 2XT9A 4LG1A 1I7LA 3K09C 4GMFA 1YTLA 1JBKA 4KC0A 3OURA 1PKEA 1U0HC 5HS4A 2ZB7A 4GM1A 4OB7A 4BZWA 1NXVA 1PFVA 2XUGA 5L95A 1UEXC 4LGCA 3OKCA 4OHCA 4EPRA 4YS6A 1PZNA 2FWBA 3AUXA 4D9EA 5JAOA 4BY9E 3NM6B 1Y9AA 2IZ7A 4R8KA 1WPXA 3PKJA 3FPJA 3ISVA 3KKZA 4NCHA 2HUPA 4L4RA 5K3AA 5EJ6A 4LZAA 1KDPA 4JQOA 3L8HA 3PTLA 1TZKA 2I62A 2VJQA 1J00A 1MGOA 4MKIA 4CM4B 3IX7A 3KXDA 4PC1A 1K2WA 3EUAA 6Q21A 5KNLA 1U0BB 3H17A 4EYSA 5KKAA 2QTZA 2FPXA 4J1SA 3ZU5A 4D9IA 3H16A 2BZSA 4I5IA 5D87A 4EL0A 1J97A 3UT5A 3JQAB 2EP7A 1EP2B 1J8FA 2G06A 4JDUA 4QGGA 3RKUA 1XD9A 4GBED 4NZMA 3MTGA 4XIFA 5CA0A 1G59A 5IP5A 3HCBA 3EQ7A 3K32A 1E2EA 2VVTA 4NZNA 4RH1A 2P1RA 3B1JA 3PL1A 2EV9A 4GOOD 3KQTA 4IJKA 3UV6A 1QF6A 3S44A 1EGMB 4NDZA 3KPUA 4RJTA 1J0DA 3A6FA 4QPZA 5AKGA 5IK2A 1XROA 2AJ8A 1CCWA 1YZHA 1CJKC 2A0XA 2X9NA 2X41A 2BISA 4BO3A 4R41A 3TW6A 5JNLA 3KNZA 1XFDA 3WK4A 2CCKA 2QAGB 1J7KA 4CDRA 4DF3A 5LXTA 1MB2A 3K9LA 4UCWA 3VC7A 4JLNA 4MZXA 1ZPDA 5C1PA 2LZ0A 5TSDA 2XZPA 3CLSC 2JK1A 3AY6A 1IZ7A 1G2OA 1VBFA 2EZ8A 1USGA 3H5AA 4OF4A 4KQ1A 4H60A 4WXRA 1NF2A 4UQLA 1GTMA 1JYFA 5EP2A 4LYAA 1VRVA 3L82B 3OQOA 3B12A 3ELYA 1W47A 4TV9B 4B7ZA 1EP1B 3KUCA 3VR5D 2OZVA 2XB4A 1PL0A 1FB5A 1X2BA 1XZAA 3H2GA 4CQLB 2GZ1A 2EZ4A 3LZ6A 4J43A 1G16A 1UM8A 3MJRA 4J0IA 3WAGA 3TLXA 1M6HA 1SUFA 5IFKA 1JQBA 1L5RA 2Q0HA 2AR0A 4D0RA 5M29A 1A8UA 2ZR7A 1YL6A 3N2LA