5C4JH

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
144
structure length
143
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 16
structure length 143
sequence length 144
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c4jH00
2ZJQA 1WI5A 4A3BG 2JEBI 4PZ7A 1UE6A 4A3KG 4A3JH 4YWLA 1VQIA 4B3MQ 3CCVA 1CKMA 4C3HH 2N78A 3H3VH 3F2BA 1MKHA 4IPDA 4JI4L 3RLNA 3UDFA 3RZOH 1IL2A 3ULPA 1KRSA 3OTOQ 4A93G 4IOAA 1LUZA 3CCEA 4A3IH 2IX1A 4DR5Q 1MJCA 2NZHA 1V1QA 3MEFA 2ALYB 5GROA 2UU9Q 2BA1A 3CCSA 2B63H 1I5FA 2MFIA 1VQKA 1EOVA 4A3CG 1PH4A 3OW2A 4MTNA 3HOUG 2ZJPA 2JQOA 3PO2H 4DV7L 3PUVA 4B3SQ 1QVFA 1PH8A 2HHHL 5C0XJ 4JBMA 4RMFA 4NXMQ 1KQSA 1OXTA 5ELOA 4X64Q 2CKZB 2VS1A 4P73A 1QZHA 1EYGA 1BBWA 3K80C 4YCVA 1C7YA 4IO9A 4GLVB 2K5NA 4DR7Q 1SE8A 2L15A 1A62A 4PZ6A 3A5UA 4OONA 4DV5Q 1Z9FA 2A1AA 4HJ7A 4QY7A 1Y1VG 1OXXK 4DV4L 1N33Q 3HOZG 1TWCH 1PH1A 2PNHA 2UUAQ 5FLMH 1EIYB 5HGQA 4HJ8A 3S1MH 4NXNL 3TS2A 2GVAA 1HJPA 3AFQA 1PVOA 1VQBA 1M90C 4BA1I 1NTGA 4JI8L 2NVTH 4DR4Q 4KHZA 4JI6Q 1I94L 1KIXA 1HNZQ 4DR1L 1XNQQ 3G4SA 5GAEC 1DGSA 3PUZA 2LXKA 4LFCL 4P71A 4TQUS 4OXPA 5IT9c 3PIPA 3TS0A 5C44G 1BBUA 1SR3A 3RNUA 1IZ6A 1H95A 1TWFH 2N8NA 1KAWA 4P74A 4HIDA 4WJ4A 3M4PA 4LF5Q 4EQ5A 3STBC 4LF8L 4L5SA 3AYHB 4DKAC 4O0AA 2RF4A 4GLXA 4DV3L 4TVAB 4LUZA 2UXBL 1PH3A 1WCMH 1SFOH 5JJKA 4JV5L 1HNWQ 2ES2A 4QIWE 2NN6G 4YWMA 2JA7H 1X54A 2DGYA 3OYYA 3T1HQ 4L5QA 5GAHC 4A3EG 5JJLA 1JB7A 1X3GA 3JC66 4DV2Q 4R4CA 4BBSG 4GKJQ 3K7UC 2WB1E 4X65Q 2A8VA 3GTKH 1BKBA 4JI1L 4DPGA 3PF5A 4B3RQ 1HZBA 3TRZA 1HH2P 3PO3G 5C3EG 1C9OA 2H5XA 1GO3E 3J7A5 4BXXH 2MO1A 1G51A 2CWAA 1YJNA 4YY3L 2BH8A 4LF6Q 3J80c 1JJ2A 1CKOA 2AMCB 1KHIA 3RN2A 1HR0L 1TWAH 5IWAL 3HOWH 1PHJA 5M5WH 4IFDJ 4BBRG 4Y7NH 3CCRA 1IXRA 1JE5A 4NB3A 3T1YQ 2E5LL 4HIKA 5IP7H 3AFPA 3H0GG 1YIJA 4L5TA 4LF7L 5ELNA 4GNXC 1RIPA 4A3GG 3Q8DA 1IYJB 1OXVA 2YTVA 3CQZH 4HIMA 4X66L 1K83H 1SROA 4POFA 1Q7YC 4XTCS 1VQGA 2B3GA 2JJQA 3K8AA 2K4KA 4DV6L 1JJGA 2IY5B 1G6PA 4BY1G 4DAYB 2AKWB 5M3FG 3PF4A 5C0XI 3A0JA 2D62A 3ICEA 3EIVA 4PG3A 5GAGC 1LTLA 1B70B 2N3SA 3CP0A 2VQEQ 1NJIC 4JOIA 1N34Q 4JI7Q 1VQFA 2F3IA 2K75A 2NZOA 4DR6L 2KCMA 4R4QA 1VQJA 4A3FG 1YJ9A 2JEAI 4GKKL 4DUYQ 2JA5H 4OX9Q 5K36G 1ASYA 3J81j 2R7ZG 1X6OA 2AHOB 3HOYG 3JAMi 2R92G 1K0RA 1RL2A 5M3MG 3H15A 3CCJA 1C0AA 2YV5A 1VQMA 3HKZE 2Z0SA 4X6AH 3EBEA 4A3JG 3EN2A 1O7IA 3U58A 1JJCB 1FGUA 4LF9L 2I5HA 2K50A 3KOJA 1XMQL 1Y1WH 2NVXH 3I4MG 1HZCA 4GOPC 1A8VA 3WWVA 2VUMH 4GS3A 4JI5Q 4LFBQ 4A3IG 3PUWA 1XTDA 2EQSA 3FKIH 3LGJA 1PV4A 4B3TQ 2R92H 1Z47A 3STBD 1E7ZA 2IHFA 3S14H 4A3DG 2IX0A 4R4OA 5IE8A 5IP9H 1K73C 4YHHQ 2KHJA 1G291 3I2ZA 4MZ9A 1HNXL 3I4NH 4PMWA 1AE3A 1UE5A 1IBKL 1IBML 2VW9A 3S17H 4GN3B 4LNQA 1I3QH 4DK6C 5C4XH 1B7YB 1TXYA 2JA9A 2UUBQ 2YU9H 3F1ZA 2R93G 2R6GA 4JYAQ 4LUOA 4POGA 3HKSA 5JEAG 1EIFA 2JK8A 4LFAQ 1HZ9A 5LMNQ 4GOPB 4B3ML 4PZ8A 2K52A 4C3JH 1YEZA 1IBMQ 3ER0A 3UE1A 4LWCA 4YCUA 2BA0A 5LMUQ 3ULJA 1FVIA 2ZTCA 4GN5A 3OTOL 1KD1C 3CAMA 3AEVA 1U5KA 4DR5L 1Q82C 2OTJA 1N8RC 1HR0W 2UU9L 2ATWA 2XTIA 1LM0A 1MIUA 3HFZB 4AYBG 4X62Q 3KJPA 3HOXG 1PA6A 3BZKA 2I0QA 4IFDI 1V9PA 1Q1EA 2Z6KC 2N49A 2UXDQ 2VL6A 4A3BH 4B3SL 2PQAB 1K8AC 3M4QA 1NE3A 2YTXA 4A3KH 1KL9A 5AJ3Q 3W1BA 4NXML 1YBYA 2OQ0A 1PH2A 2ZM6Q 1X9NA 1L1OC 3DM3A 5IYCH 4C3IH 4X64L 3L2PA 4MNOA 1ASZA 2CWPA 2LSSA 4KLKA 2JA8H 3U4ZA 3F8TA 4IJHA 4H02A 4JI3Q 4DR7L 2JE6I 3KF6A 1WOCA 4DV1Q 2QA4A 4DV5L 2AWNA 1E3PA 4EX5A 1OXUA 2MQHA 4OO1I 4UP9A 4A3CH 3KF6B 1WCMG 1N33L 4OWXB 3CPFA 1E22A 2UUAL 1CUKA 3TREA 4DNIA 2ID0A 2PI2E 4P72A 3RN5A 4BA2I 1E1OA 3MXNB 4BY7G 2YTYA 3CW2C 1SLJA 5M5YH 3J7ZC 2KHIA 3CCQA 1L1OB 2EIFA 4QGUA 1FJGQ 4DR4L 4JI6L 4A3MH 1BVSA 4ME3A 1HNZL 1VQ8A 1XNQL 3ULLA 1L2FA 1A0IA 2PI2A 4DK3C 3F2DA 3D0FA 2LXJA 1XPOA 1X65A 4BXXG 4YWKA 3KJOA 2QGQA 1S72A 1V43A 1PH7A 1E1TA 2E2JH 1Y1VH 1XPUA 4LF5L 2OQKA 4DR3Q 3HOWG 2KENA 1VQAA 2WAQE 4DR2Q 3S1RH 4DUZQ 2HT1A 1GM5A 3RLFA 1HNWL 1SRUA 3I56A 1K8GA 5IYDG 3I4OA 3T1HL 2OWOA 5JJIA 1S3OA 2E2IH 4DV2L 1PFSA 5EAYA 3JAMc 3S1QH 4GKJL 3A5ZB 4IOCA 4X65L 5C44H 4HJ5A 1SN8A 4A3LG 3UDIA 2CCZA 4JI0Q 4B3RL 3G71A 1K9MC 3J81i 2UUCQ 1XNRQ 2CFMA 1PH6A 1N32Q 1Q81C 4AH6A 1VQDA 4LF4L 3U50C 2JA6G 4IPCA 4UY8C 1EUJA 1OTCA 3M4OH 4LF6L 1I50H 5IY0A 3RR5A 2JA5G 5H1SE 2WFWA 1KC8C 2YYZA 1W3SA 4JBWA 1J5EQ 3T1YL 1Q12A 1SMXA 1FL0A 2VQFQ 4BBSH 4GNXA 2Q2TA 1YZ6A 1NY4A 4B3TL 1J6QA 1N36Q 1GVPA 1YITA 3GDEA 4AYBE 5FLXc 2F4VQ 4KHPQ 1WFQA 2NVQH 1Y1WG 4GNXB 4UPAA 3CCLA 4IPHA 3PIOA 1VQHA 2HIXA 4GLAC 4HJ9A 3NEMA 3S24A 1QUQA 2VQEL 2VUMG 1AH9A 3GTMH 5BR8Q 4AQYQ 4A4IA 1N34L 1MJEA 1XMOQ 1HNXQ 3A74A 4JI7L 3GTPH 2QEXA 4BBRH 3UE0A 1QUQB 2C35B 4DV0Q 2KBNA 2I5LX 3CMAA 5IP9G 4DUYL 3PUXA 3I55A 4OX9L 3GO5A 1EFWA 2Y0SG 3GTLH 4QJFA 1R9TH 2UXCQ 4O2DA 1K3RA 1IBLQ 1YHQA 5C4XG 2VZAA 1A63A 4JI2Q 1Y14B 3KDFB 3G6EA 2RHQB 4BY1H 5M3FH 4K0KQ 1VQ5A 2B63G 2K5HA 2A19A 3GTJH 1QVGA 1CKNB 3PV0A 1WYDA 3DLLA 3AQQA 3PO2G 3NELA 4A75A 1VQ9A 1OXSC 1UE1A 3HOVH 4A3FH 4JI5L 2HQLA 4GOPA 4LFBL 1EQQA 4WJ3M 4UP7A 1TWGH 2WB1G 4KI0A 5IYBH 4ALPA 1YJWA 3S2HH 2R7ZH 4JI4Q 1VQEA 2VY3A 5FJ8H 5M3MH 3NBHB 2BH2A 2DUDA 2OTLA 4YHHL 2F52A 4J15A 1P8LA 2K14A 3F2CA 2B29A 1WJJA 5C0XG 1D7QA 3KLWA 2R7DA 2PMZE 1YNXA 3G48A 3BJUA 2Q2UA 3ERSX 4GN4B 5IYCG 5FLMG 2UUBL 4QL5A 4JYAL 3I4MH 4DV7Q 2PQAA 4IJLA 1VQ7A 1D8LA 5LMNL 1CSPA 1LYLA 2GVBA 4LFAL 2HHHQ 2JA8G 3GTQH 2NN6I 1YVCA 2AWOA 1B8AA 4C2MH 1X56A 5LMUL 1XJVA 1VQOA 1X3EA 1UE7A 2WP8J 1Q86C 5JEAJ 1EWIA 4A3DH 3S16H 3W1GA 1VQ4A 1N9WA 4X62L 3FHWA 5GQOA 1U0LA 2E2HH 4OWWB 1VQLA 4A93H 4DV4Q 2ZJRA 2Z6KA 2UXDL 3CMEA 3KFUA 2R93H 4R4TA 4XIGS 4A3MG 3D31A 4NXNQ 2MO0A 1GD7A 1T9HA 5DLQE 5J3BA 4AIMA 2ZTEA 5AJ3L 1VQNA 3FP9A 3ZJYC 1VCIA 4JI8Q 2KCTA 2ZM6L 1X3FA 2D0PA 1L1OA 3CXCA 2JA7G 1UEBA 4APVA 2GN5A 4R1JA 1I94Q 3IRBA 3L7ZC 4DR1Q 2RCNA 4JI3L 2EXDA 1PYSB 1YHBA 4LFCQ 3HKZG 4JG2A 1NMFA 4DV1L 1EQRA 3E9IA 3M85A 3J81c 1CSQA 3HOXH 1VS0A 3L0OA 3B6YA 3CF5A 4LF8Q 2XGTA 5M5XH 3E0EA 1VQPA 3U4VA 3CC4A 2ASBA 2V1CC 4DV3Q 1M1KC 4LUVA 3CPWA 2UXBQ 3HOZH 3PCOB 4JV5Q 4FDBA 1FJGL 1X55A 1PH9A 2Y0SE 4A76A 1QVCA 1E24A 5IP7G 3PUYA 3M7NA 4JBJA 1GKHA 5HY6A 4JBKA 1PYBA 3K7AH 4JI1Q 3S2DH 1KXLA 3M9BA 1Q46A 4IFDG 4DR3L 3PGZA 4DR2L 3SGIA 4DUZL 4QQBX 4BY7H 3GTGH 3CD6A 2R7FA 4YY3Q 3S15H 4R4IA 3H3VI 1UWVA 4JC0A 3GTOH 3CCMA 2IT1A 3I7FA 1HR0Q 3E9HA 5IWAQ 2HIVA 1S40A 4YCWA 2Q2IA 3PSIA 3W5OA 2E5LQ 3CCUA 1HZAA 4OWTB 5E7NA 3VDYA 4LF7Q 4LF4Q 1YI2A 1JT8A 3GD7A 4A3EH 3KF8B 4X66Q 4JI0L 4UP8A 5LMNW 1XNRL 3K81C 2UUCL 4DV6Q 1I6HH 1N32L 4OO1G 4L5RC 2MNAA 2IHEA 1W2BA 3UDGA 3RZDH 1JMCA 3UDXA 2K5VA 1PH5A 4JOIC 1AE2A 1XPRA 4DAMA 2ZTDA 3PO3H 5C3EH 4Y52H 2OCEA 1J5EL 5IYDH 4DR6Q 3KYHC 1VQ6A 2E8GA 4GKKQ 4P75A 2VQFL 3FKIG 4HIOA 1P16A 1N36L 3BU2A 4A3LH 2F4VL 4KHPL 1NMGA 2I5MX 3H0GH 3S1NH 2RHSB 4A3GH 3RLOA 3KDFA 1Q1BA 1Q8KA 3NENA 2JA6H 3I4NG 1VQCA 3TEHB 3HOVG 4LW1A 1YHAA 1CKNA 2FXQA 4LF9Q 5BR8L 4AQYL 1QZGA 1KRTA 1XMOL 1XMQQ 1L0WA 4IPGA 3J80i 5IYBG 5GADC 2VNUD 4DV0L 3BZCA 4JCVE 5FJ8G 4NPSA 5C4JH 2Q2HA 2D0OA 4HJAA 3HOUH 3K0XA 1TWHH 2UXCL 3CC7A 1NBWA 1IBLL 3CC2A 2WAQG 4JI2L 4K0KL 3HOYH 3M3YH 2NVYH 4RG1A 3TQYA 2CQOA 1IBKQ
chains in the Genus database with same CATH superfamily
2L1BA 3NTHA 4PZ7A 2LKVA 1UAPA 1PRTD 1ZYRD 1W6KA 3CCVA 1CM9A 3OSOA 3F2BA 3RLNA 5BN5A 3ULPA 1KRSA 5FO9B 1RJTA 4A3IH 2IX1A 3MEFA 2ALYB 2BOSA 2BA1A 2B63H 4KY7A 5M5WB 1EOVA 4FF1A 4TKOB 1PH4A 3GQBA 1U4MA 4U68A 4KY5A 3PO2H 3PUVA 1L0YB 1PH8A 2HHHL 3D4DA 3BVMA 3CQZB 4RMFA 3PIP3 2KCNA 2PZUA 5ELOA 1B9NA 1I4XA 5KEEA 1QZHA 1EYGA 1BBWA 4G57A 1TU2B 4DR7Q 3I90A 2RDHA 4PZ6A 3KLRA 2D2CC 1Z9FA 1LTRD 4HJ7A 2B2YA 3NPPA 2PNHA 5IGGA 5I6WA 2JA5B 4NXNL 1F2MA 2F1MA 4BA1I 1NTGA 4JI8L 3OHXC 3TSSA 3CHBD 1HNZQ 4DR1L 1DGSA 4M8AA 3SK6A 4OXPA 5IT9c 4C1NI 1HHVA 1BBUA 1SR3A 1TT2A 1Y1WB 1B3QA 1IZ6A 2NVXB 1H95A 1TWFH 2F4IA 3FRPB 2AQ3B 3CRLC 1PH3A 2KJXA 1NNXA 1D6EC 1ET9A 2ES2A 4C1NK 3OYYA 3T1HQ 4L5QA 4KD4A 5GAHC 1DOLA 1X3GA 3S17B 4GKJQ 5C4XB 2IJ0A 1CHPD 1BBXC 4IUTA 4DPGA 1F9QA 1HZBA 1ESRA 2L11A 5KNBA 5C3EG 1CI3M 2ZT9C 1YJNA 2EYFA 1JJ2A 1CKOA 3RN2A 5KYLA 5M5WH 4IFDJ 1QG7A 5EQ0A 3CCRA 4NB3A 3WOFA 3OIQA 2QCPX 2ENBA 5ELNA 1IYJB 3CQZH 2ASBA 4A3BB 5TSSA 4XTCS 4DV6L 4A3KB 1EL0A 2AKWB 3A0JA 1B70B 3CP0A 3N52A 5C6AA 1N34Q 2F3IA 2F0KA 4ZCKA 4R4QA 4A3FG 2DY8A 2JEAI 2JA5H 1ASYA 3J81j 2R7ZG 3HOYG 4R9WA 2R92G 5CBEE 2SEBD 3CCJA 2XRQD 4RKLA 1VQMA 4A3JG 1O7IA 5LL6X 1XMQL 1Y1WH 2NVXH 2A6HC 5EPKA 4GOPC 3WWVA 4GS3A 4LFBQ 1EU4A 2C5CA 3PUWA 2E2JB 3G7LA 1SE4A 3LGJA 3HKZB 2LY7A 1RCVD 4A3DG 1FYCA 1K73C 2B8FA 2MUYA 3IKJA 1V1OA 1C8CA 1HNXL 3S17H 1AE3A 5ISRA 1IBKL 1IBML 4UDUC 4DK6C 5C4XH 1QCBD 2PZTA 2E2IB 2R6GA 2DN8A 1K8MA 5LMNQ 2B8GA 4KJOA 4PZ8A 1YEZA 3K5NA 1SMYC 5FOBB 4LWCA 3D6WA 4GN5A 2A5HA 1G6ZA 1U5KA 1Q82C 1I50B 1HR0W 1O78A 4AYBG 3KJPA 3A8KE 3BZKA 1AN8A 1KTKA 5E1FA 1SYEA 2D9UA 1I4HA 4Q0FA 2NUCA 4A3BH 3NBIA 4A3KH 1QNUA 4BBSB 1KL9A 5C4HA 3W1BA 3MXPA 1L1OC 3DM3A 4XQJA 1WTPA 1PXUA 4DR7L 5C4ZA 1WOCA 3CU7A 2MQHA 4KKTA 2B2TC 4UP9A 5D14A 1GUNA 3KF6B 4BBRB 4F8MA 3I73A 3TREA 2PI2E 2O4XA 3KLSX 3TP7A 1E1OA 2YTYA 3GTLB 3VYUA 1SLJA 1U4LA 2SNMA 4WJWA 2EIFA 4RGTA 2MJ8A 4ME3A 1HNZL 4BY1B 2AQ2B 1CFMA 2JYOA 3D0FA 1PH7A 1E1TA 2E2JH 2A69D 2OQKA 1WTVA 2KENA 5A35A 4RHSA 1GM5A 3S2HB 4JVZA 3S9WA 3RLFA 3D4RA 3NE5B 5M3MB 4OEMB 5IYDG 3T1HL 2E2IH 2R61A 1LT3D 3VA5A 4GKJL 2C9OA 1HQMC 2WKCA 2CCZA 1JWMD 1K3BC 3J81i 1PH6A 1N32Q 3GTQB 5KYIA 1Q81C 4DAYA 3U50C 4IPCA 1OTCA 1LT6D 1I50H 5IY0A 3RR5A 1SE3A 5JPNC 5EBDA 3J81L 1KC8C 2N55A 3AB9A 1JWSD 1W3SA 2SDFA 2O5JC 1Q3LA 2E2HB 2VQFQ 4BBSH 1K0SA 2Q2TA 4KTAA 1HPCA 4B9WA 1GVPA 3GDEA 2WV6D 2EY1A 4HCSA 4DXGA 5FLXc 1WFQA 4G7ZC 4IUQA 4UPAA 3CCLA 3HOUB 1HCZA 3PIOA 2VUMG 5BR8Q 1N34L 1BNZA 4HTHA 2LS01 2QEXA 2BE5D 3UE0A 4BBRH 1QUQB 2KEDA 4N9PA 2NTTA 1IW7C 1B2TA 3I70A 4CJ2C 2Y0SG 3GTLH 5M5XB 2E74C 1K3RA 5FLXE 4H7BA 5ELFA 1A63A 4JI2Q 5JPMC 3G6EA 4BY1H 3HOZB 2M9VA 1SDFA 3PV0A 2K03A 3C3LA 2M2LA 3AQQA 4A75A 1VQ9A 3EQLC 1FD7D 1UE1A 4GOPA 2HQLA 4LFBL 2AUKA 4WFN3 3K7AB 4UP7A 2WB1G 1YJWA 4KI0A 5IYBH 3S2HH 2H4OA 2VY3A 1MD2D 1TS3A 3OPOA 1EFID 1EY7A 3DWQA 5M3MH 3S15B 2DUDA 3GTOB 1DZ1A 4ZUIA 2K14A 5C0XG 4JK1C 2A68C 1YNXA 2R7DA 3BJUA 5FLMG 4QL5A 3U9OA 5LMNL 1LYLA 3GTQH 4A3EB 5BN4A 3I91A 2F0LA 1X56A 2TMPA 3RZDB 5EKLA 2PMZB 1ICWA 1N9WA 3FHWA 2E2HH 1VQLA 3FEWX 3CMEA 1TR5A 4ILWA 3D31A 5C3WA 1PTOF 2ZTEA 3HOUH 1L1OA 4R1JA 1I94Q 3NHHA 2JA6B 2EXDA 4JG2A 1MGSA 1U4PA 5CV7A 1GXDC 2B2TA 4ZYSA 1RTOA 5CMDA 3PQIA 5M5XH 5E4WC 2V1CC 1WTRA 3OIPA 4LUVA 1ILPA 2UXBQ 1R4PB 3HOZH 3PCOB 4JV5Q 1XTCD 2K6AA 5IP7G 4WORA 2LFNA 3P75A 4JBJA 1GKHA 2F0SA 1BCPB 3K7AH 4OELB 3W3AA 3NTKA 4FVMA 4QQBX 2A6ED 3BVZA 4C3HB 4YY3Q 3S15H 3H3VI 3GTOH 5IWAQ 2HIVA 3MTSA 4ID6A 3V96A 2Q2IA 3NK9A 5E7NA 1LTAD 4LF4Q 5CBAE 3HS0C 4A3EH 4X66Q 4UP8A 1N32L 4OO1G 2MNAA 3RZDH 2Q8TA 3UDXA 1FR3A 2XVSA 2EYMA 4XT1B 4DAMA 3Q22A 1KLGD 1SYBA 1IKLA 1SBBB 3F2UA 2G5DA 4GKKQ 2VQFL 3FKIG 4HIOA 1P16A 1CA5A 4A3LH 1NAPA 1MBYA 3S1MB 1LV9A 3N6RA 2RHSB 3R3OA 3RLOA 3KDFA 1Q1BA 2JA6H 2CH4W 4JPBW 4LW1A 1YHAA 2IX3A 5BR8L 1QZGA 4N9TA 4JCVE 2K33A 5JJZA 1IHZA 2EOTA 2G9DA 2LMCB 3GV3A 2L12A 1S5FD 4FNFA 2WAQG 4JI2L 4IALA 4DF7A 1UEAB 2CQOA 4K6LA 3TQYA 3M4YA 2AQ1B 4K6DA 4YWLA 1HTPA 1GJXA 4K5WA 4C3HH 3H3VH 1XYIA 4A93G 1HFGA 3MC0B 2NZHA 5GROA 1V1QA 2M00A 2UU9Q 5ELBA 1TWAB 5ELEA 3HOWB 1VQKA 1HUNA 1F9RA 1JOKA 5KGUA 2L4NA 2EYOA 2MP1A 4KKSA 4HMIA 1DJRD 4I7AA 4J8QA 5C0XJ 3NSWA 1H9SA 1J8IA 3QWNA 4X64Q 2CKZB 4P73A 2CW0D 3K80C 5G3LF 4IO9A 1STEA 1A62A 3J7YW 4OONA 3QOJA 2A1AA 1Y1VG 2K04A 3NP8A 2UUAQ 5HGQA 3S1MH 2GVAA 1HJPA 1NCVA 1M90C 3M7GA 1D5XC 1U9RA 3DXJC 3HG9A 5CV5A 1I94L 1XNQQ 4DXFA 4P71A 3PIPA 1PFNA 5C44G 4RGNA 3TP8A 3QIAA 4MN3A 5KNCA 1KAWA 4ZKCB 2XWBB 1V1PB 3AYHB 4L5SA 1E0BA 4LUZA 2UXBL 4JV5L 1HNWQ 4DGZA 3FPUB 1X54A 3HZXA 5JJLA 3JC66 4R4CA 3K7UC 2WB1E 2A8VA 1BKBA 1TQOA 4B3RQ 2H1EA 1S4ZA 1WTHA 4QIWB 2CWAA 2F0EA 4I7ZC 3TDQA 4YY3L 2AMCB 1TWAH 5IWAL 3HOWH 4OL7A 3TN2A 1YNND 2DNEA 3QJYA 3H0GG 4X3KA 4L5TA 5CV9A 2HUGA 4CHTB 4TRDA 1OXVA 4B3TQ 2YTVA 4HIMA 4X66L 4POFA 1Q7YC 2JJQA 2IY5B 1A2TA 2OT2A 4IFDH 3I3CA 5M3FG 3PF4A 5GAGC 2FMCA 1LTLA 2HDLA 4C3IB 2VQEQ 1NJIC 2F03A 2RSOA 2JA8B 1G2TA 2NZOA 2KCMA 4CKCA 4FXGC 4LMQD 4GKKL 4HSVA 4DUYQ 3BDLA 1X6OA 5FKAC 1B9MA 3RMHA 3JAMi 1K0RA 3T51B 4KN4C 3ONAB 1BCPD 3H15A 1C0AA 1DONA 2Z0SA 2WINB 1KABA 4KHVA 3JAML 4ZUJA 2K50A 3FMCA 3I4MG 3VR6A 4XDXA 1HZCA 3E3XA 5DM63 1EY0A 1D1IA 4HCEA 4A3IG 4QUFA 1XTDA 2EQSA 2PCFB 4RGOS 1Z47A 3DWAA 5IE8A 1C4QA 5ELCA 4YHHQ 2KHJA 1G291 2F0VA 3I2ZA 1HRJA 4PMWA 1M8AA 4GN3B 4LNQA 1B7YB 2JA9A 1RDPD 3DEOA 4JYAQ 3S1QB 4LUOA 5D3DA 5JEAG 2JK8A 4LFAQ 4OHJA 5CYUA 1G91A 1FGBD 2G9HD 5C3XA 3ULJA 3NUCA 1STNA 3CAMA 2OTJA 2F0PA 1N8RC 4FXKC 4Q5VA 2UU9L 2XTIA 2I0QA 5FK9C 1RD9D 4L6TB 5I9OA 1MSGA 1Y8OB 3LWUA 2YTXA 3TP6A 1YBYA 1PH2A 2ZM6Q 5IYCH 4C3IH 4X64L 2JP1A 4C56C 4MNOA 1ASZA 1TS4A 4KLKA 2JA8H 3F8TA 2WIIB 4H02A 4JI3Q 3KF6A 4DV1Q 2AWNA 1E3PA 4EX5A 1OXUA 1TY0A 2F3VA 3IL8A 2UUAL 1STBA 4DNIA 4BA2I 4P72A 2NB0A 1E2VA 2CHBD 3CW2C 1R9TB 3CCQA 2OF1A 3H91A 1FJGQ 4ME5A 1VQ8A 1XNQL 3DMUA 2LXJA 4YWKA 2QGQA 1S72A 3H3VC 5AFWA 2A6HD 2WKDA 1XPUA 3I72A 3VR5A 4A3FB 1KDAA 5IT9E 2WAQE 1ENAA 4FXDA 4ODGA 3SK8A 2HT1A 4ZLTF 2DJFC 2R7ZB 1HNWL 4H44C 1PRTC 1SRUA 1SYDA 4FO2A 1ZYRC 1K8GA 3I4OA 2OWOA 1S3OA 1LABA 1EY4A 1PFSA 5EAYA 3S1QH 4A3JB 3HRZC 3A5ZB 1SE2A 4QCLA 2KUMA 4JI0Q 4B3RL 1EWCA 3G71A 1XNRQ 2Z6BA 2UUCQ 2CFMA 4AH6A 2HD3A 1EUJA 4XYQA 1Y8PB 2JA5G 1SNCA 2WFWA 4A3DB 3S16B 5HURA 5J22A 5ELDA 1FL0A 1F9SA 1YZ6A 4B3TL 1J6QA 2NWGA 1YITA 2JSOA 1Y1WG 5KNDA 4EQOA 4IPHA 4GLAC 3S24A 3T56B 1QUQA 2VQEL 5IGDA 1Z7TA 2DY7A 4AQYQ 1O7YA 3R8BA 1H9MA 2KBNA 2I5LX 4DUYL 4AYBB 1ML0D 3PUXA 1H9KA 3GO5A 1EFWA 2K5DA 5E3FA 1DXMA 1WVLA 1R9TH 2UXCQ 3QOLA 4O2DA 3Q24A 2MGSA 1IBLQ 4F88A 4RHRA 2VZAA 5C4XG 2EY2A 1HQRD 2K5HA 1QVGA 1I4GA 2L0CA 1B44D 1BDOA 3H09A 3NELA 1E2ZA 4CDCC 2Z8LA 1JICA 2XWJB 4A3FH 1HUMA 4J1MA 3J7AV 4WJ3M 2EY5A 2R7ZH 4JI4Q 1Y69U 2CQAA 2NYZD 3GTGB 4MTKA 4YHHL 3AMUA 2B29A 1WJJA 1JE4A 2CH4A 5A2QE 3ERSX 4GN4B 3IFTA 4JYAL 4EVOA 3NTIA 4DV7Q 1CQFA 2PQAA 2F0FA 1D8LA 1CSPA 2GVBA 4LFAL 2NN6I 4P2CB 1WD1A 2AWOA 4IUVA 4L63B 4ZAIA 2KHSA 3WDNA 5JEAJ 3E0JA 1HTLD 4A3DH 2IWHA 3S16H 3A8IE 1VQ4A 3QG1A 4FF4A 3PO3B 4O1NA 4CJ1B 4OWWB 4OIKA 4DA2A 1GHKA 5EGTA 3KFUA 3SR1A 3A7LA 3MXNA 1GD7A 5DLQE 4NKLA 2ZM6L 1VCIA 2JA7G 2F0NA 4A3GB 1B50A 2RCNA 4LAAA 4JI3L 4CBVA 1RTNA 2ICIA 3HKZG 1NMFA 4HAEA 4DV1L 1EQRA 3E9IA 3J81c 2OXPA 1YNJD 3C1FA 4QUCA 2XGTA 3E0EA 3U4VA 1IW7D 2HDMA 4DV3Q 3VR3A 3ND9A 1GUOA 2EYJA 2VXWA 2RA4A 4FDBA 1FJGL 2RQXA 1KAAA 1PH9A 1QVCA 1B4OA 1UUPA 2BDOA 4JBKA 4PV1C 5FO7B 3J81E 3M9BA 1Q46A 3PGZA 4HSPA 1TVXA 3L3OC 3SGIA 3GTGH 4ZKBB 1ICFB 4R4IA 2Y0SB 1UWVA 2IT1A 1HR0Q 5I9PA 3WOEA 2PQEA 4TSSA 4YCWA 3PSIA 4CDDC 1WTQA 1G2SA 2NN6H 4MHEA 4ZK9B 1YI2A 4JI0L 1NUCA 3FDTA 1XNRL 2UUCL 1IKMA 1W2BA 2K5VA 2WB1B 4JOIC 1PH5A 1B3AA 3A7AB 3PO3H 4Y52H 4X3TA 3R2IA 4DR6Q 5IYDH 2E8GA 2F0OA 2I46A 3CKIB 1TWCB 5C5LA 4EQPA 4A3GH 3NENA 3I4NG 2NVTB 1STYA 1VQCA 4CGYB 1CKNA 2FXQA 4LF9Q 4AQYL 3X3MA 3HGBA 5EKKA 4IPGA 3J80i 5IYBG 2GA4B 4NP5A 1WTOA 3R93A 1I6VC 2Q2HA 2D0OA 4IURA 1PYWD 4HJAA 3J80L 3KBGA 2UXCL 1LTGD 1IBLL 3LNNA 3NBHA 5K36H 5NUCA 4NW2A 1WCMB 1SFOB 2A69C 4K2KA 4RG1A 5CV6A 2RDFA 2HCCA 1WI5A 1I4QA 2KVMA 1UE6A 3K6OA 1VQIA 2NZ1D 3GTKB 1CKMA 1ONLA 2N78A 1MKHA 1CZWA 4JI4L 1IL2A 1VF5C 1LUZA 4UAIA 4XYOA 2QDLA 1S5ED 3NWSA 1EY9A 3CCSA 5FLXL 2MFIA 1RODA 4A3CG 2TSSA 1QOHA 2RKSA 2Z9HA 4MTNA 3HOUG 1MI2A 4DV7L 4B3SQ 1QVFA 3P1HA 4NXMQ 4JBMA 1E2WA 1K83B 4CKBA 1OXTA 3A54A 4DK0A 4YCVA 4B9XA 1ZKOA 3K58A 1ESFA 2KEEA 1SE8A 2L15A 5K5PA 1I4RA 3TZDA 4QY7A 3P20A 1OXXK 3T4AC 3HOZG 1TWCH 3DM1A 1PH1A 3NQTA 5FLMH 1EIYB 3VYRA 4QB4A 3D4WA 4EGVA 2BE5C 2NVTH 2K1BA 4JI6Q 3PUZA 2LXKA 3BYYB 4TQUS 1SNOA 5EKIA 3RNUA 3VYSA 4IZ8A 5CGKA 4P74A 4HIDA 4WJ4A 3M4PA 3STBC 4DV3L 3FKIB 3QR8A 1WCMH 3FVQA 1SFOH 5JJKA 1TS5A 2DGYA 3ITPA 1PDQA 4A3EG 2F0DA 4KY6A 1X32A 2F0UA 4RAUC 5CC4A 3L9AX 5E4XA 3V05A 3SHLA 3GTKH 3KF8A 1PTOD 3PF5A 3TRZA 4BXXH 2H5XA 3J7A5 2EVBA 2MO1A 4C3JB 1GOZA 1F2ZA 4LF6Q 3KUPA 1JWUD 5JVG3 1HR0L 1JE5A 5JAVA 3NWTA 4FP5D 4HIKA 5IP7H 1YIJA 1RIPA 2PW5A 2B39A 3Q8DA 1PVOA 1K83H 1SROA 1VQGA 2B3GA 3KBXA 1G6PA 4DAYB 2FJ2A 1CA6A 3ICEA 1H9RA 2N3SA 4CDFC 4JOIA 3TBIB 2V4DA 1VQFA 3QO2A 4DR6L 3OW7A 1KLUD 2E2DC 1RL2A 1SSOA 2XIWA 2YV5A 1EEID 5FO8B 4OO1H 4X6AH 3HKZE 2BDNA 2A73B 3EBEA 1WD0A 3U58A 1JJCB 1FGUA 1RKNA 4A3MB 4LF9L 2I5HA 1K28A 1A15A 2B2VC 2XRSD 1CQVA 2K32A 1CT1D 1A8VA 1EIHA 1AZQA 2Q8IB 1Y1VB 3FKIH 1F2YA 5CORA 1SNMA 4X3SA 1E7ZA 2QILA 3S1RB 4QMGA 2IX0A 5IP9H 1PMRA 3T13A 2VW9A 2R93G 2X6LA 4GOPB 5C44B 2K52A 3OWFA 3VR2A 4C3JH 1IBMQ 2EJGC 2XN9C 2QEJC 3ER0A 2HQEA 5LMUQ 2BA0A 1FVIA 2ZTCA 1KD1C 3OMCA 4KKUA 1LM0A 1MIUA 3HFZB 4X62Q 3HOXG 1PA6A 4IFDI 1V9PA 4K5XA 1XWEA 2O5IC 2N49A 1IYUA 4B3SL 5DNFA 3M4QA 1NE3A 4OGQC 1OO9B 5AJ3Q 4NXML 3V2TA 1RHPA 1MHWC 2SNSA 2NVQB 1BR9A 3U4ZA 4IJHA 1JR0D 2QF7A 2JE6I 2EJFC 1A3UA 3MZ5A 5DM73 3GTMB 2JN4A 2QA4A 2MHVA 3GTPB 1IYVA 1Q8IA 1A6XA 4OWXB 3CPFA 1E22A 5T1IA 1CUKA 3KLSA 4BY7G 3EFXD 2DNCA 3TP5A 1SNPA 3UI2A 3FPPA 4CJ0B 2KHIA 3SDZA 1L1OB 4QGUA 4JI6L 2VB3X 4A3MH 5M3FB 3ULLA 1L2FA 1A0IA 3D6CA 3GTJB 1K8OA 1XPOA 1X65A 3KJOA 1TIID 5IODA 4N8X1 1Y1VH 5L37A 2EY6A 5IIFA 4DR3Q 3HOWG 3HOVB 4DR2Q 3S1RH 1SNDA 4DUZQ 5G3LD 1AW7A 3C1EA 3I56A 2RSNA 5I2YA 4HEDA 3JAMc 3OMGA 4PNYA 5I4DA 2EYPA 5C44H 4HJ5A 1SN8A 3I4MB 1K9MC 3VYTA 3EA6A 1EQVA 4LF4L 3TMEA 4UY8C 4A3IB 4C2MB 4LF6L 4R8NA 5IOCA 1IL8A 5KRUA 2F0TA 2F0JA 1TKWB 1J5EQ 3AU7A 3I4LA 1WTWA 1SMXA 4DU9A 1U4RA 1AFPA 1II3A 3JAME 4NDXA 2CW0C 4H13C 1TS2A 1NY4A 1Y8NB 1N36Q 2EDGA 4KN7C 1PRTF 4KHPQ 3T16A 2F0QA 2NVQH 1SYCA 4GNXB 2B2WC 1VQHA 3GTMH 4A4IA 1MJEA 3GTPH 3A74A 1ILQA 1EYDA 2C35B 1PZKD 4QJFA 4FF2A 3K5OA 1FNVA 1YHQA 1JOQA 1QNKA 1Y14B 3KDFB 5M3FH 1VQ5A 2B63G 1BUVT 3GTJH 3C46A 1WYDA 3DHQA 3PO2G 4X3UA 1OXSC 2B2VA 3HOVH 2RCFA 3BG3A 1EQQA 1C48A 3S2DB 4ALPA 3EVQA 1VQEA 1DCZA 3MWYW 5FJ8H 4JW0A 2F52A 3F2CA 1D7QA 3KLWA 2PMZE 3G48A 4B08A 2Q2UA 4M1UB 1ZEQX 2Z4IA 4L8JA 4C3IG 5IYCG 4K2LA 3I4MH 2EXZA 4J6HA 4G4KA 2JA8G 1SEBD 4K5VA 3IFDA 5T1GA 1LO5D 1YNNC 1B8AA 1GUTA 4C2MH 4DNTB 1F77A 5LMUL 1SJED 1AEXA 1XJVA 2K01A 1VQOA 2WP8J 3HEJA 1EWIA 3W1GA 4X62L 5C3EB 4DV4Q 1PFBA 3EROA 4R4TA 4HMJA 1T9HA 4AIMA 5JEAH 5AJ3L 4BWGB 1H9SB 3ZJYC 3CXCA 1KNEA 2KCTA 4OIJA 2D0PA 5EBCA 1GUWA 1UEBA 2GN5A 3S1NB 3L7ZC 5JVH3 4LFCQ 4RFBA 1ENFA 2J7ZA 3I8ZA 1BCPC 1SAPA 4O42A 4RCNA 3CF5A 3BDOA 3CC4A 1VQPA 4LF8Q 4PQXA 5C4JB 1EU3A 1QILA 5J39A 1X55A 1H9JA 1PFMA 3HOYB 2R92B 4DFAA 5HY6A 3SK5A 4JI1Q 3S2DH 4IUNA 1XX8A 2KECA 4DR3L 1I4PA 4DR2L 4DUZL 1SYGA 3CD6A 2Z4HA 3RZOB 3I7FA 4HN7A 1SMYD 3W5OA 1AZPA 2E5LQ 2L5TA 4MIUA 4LF7Q 2IL8A 1CTMA 5LMNW 3MEHA 4L5RC 3CRKC 2IHEA 4F7XA 3E6ZX 1JMCA 5IT9L 1D5ZC 5F2DA 2ZTDA 1XPRA 4KJNA 5C3EH 4CKEA 1O7LA 1J5EL 1NR4A 3KYHC 1VQ6A 1HA6A 2R3ZA 2F0HA 1N36L 3BU2A 4KHPL 2I5MX 1BOSA 3K0YA 3S1NH 1F2LA 2Z1CA 2ICEC 5EPJA 2B2WA 2PW7A 1EEFD 2F3WA 2FFKB 1KRTA 1L0WA 2F0IA 4ZRZA 1VF7A 4XQQA 5GADC 1LACA 2VNUD 3H94A 2P5ZX 1BQQT 1JB3A 5C4JH 4XXEA 1JOOA 1SNQA 3K0XA 5J1ZA 2OEOA 3R2TA 3GV6A 1ENCA 3CC7A 1BF4A 4IUPA 3HOYH 3TZUA 2R92H 2BCOA 2JA7B 3Q0AA 2ZJQA 4A3BG 4DAVA 2JEBI 4CDEC 4K14A 4A3KG 4A3JH 3O13A 2X69A 4B3MQ 4DAPA 1STAA 1VMPA 1DYQA 4IPDA 3UDFA 3RZOH 3K5LA 3OTOQ 4IOAA 3CCEA 1MSHA 1MJCA 4DR5Q 2KCCA 2IW3A 1I5FA 2NTSA 3DWPA 4Y7NB 3OW2A 3MHBA 2ZJPA 1EYCA 2JQOA 1PTOB 1V8QA 4S3SA 2ZXPA 1KQSA 5LL6S 2VS1A 4I65A 4IUUA 1C7YA 4GLVB 2K5NA 2F0WA 5I6YA 4FYDA 2K5WA 5JOBA 3A5UA 4DV5Q 3NQIA 4DV4L 1N33Q 4HJ8A 5DAUA 3TS2A 5A2QL 3Q23A 3AFQA 1VQBA 1KDCA 2I07B 1VMCA 3QB3A 4RWSC 4DR4Q 3SVMA 4KHZA 1KIXA 2KOLA 1D1KA 3G4SA 1SJHD 5GAEC 4LFCL 1A3VA 3TS0A 2EPBA 3LWEA 1NR2A 1KNAA 1DD2A 1W6JA 2B2UC 3DEPA 5IGCA 1JORA 2N8NA 1EZ6A 4LF5Q 1SYFA 4EQ5A 2VUMB 4LF8L 3MXUA 4DKAC 4O0AA 2RF4A 4GLXA 4TVAB 1CHQD 4IQZA 3S14B 4QIWE 2NN6G 4YWMA 2JA7H 1JB7A 1EIGA 4DV2Q 3I4NB 2VB2X 4BBSG 1I3QB 3PMFA 4X65Q 4EQNA 2YU9B 4JI1L 3X3NA 4ABNA 1HH2P 3PO3G 2A68D 1C9OA 1GO3E 3C2PA 4KV6A 1G51A 1EWHA 2BH8A 2PYKA 2K5QA 3J80c 1KHIA 1PHJA 4BBRG 4Y7NH 1IXRA 3T1YQ 3ERQA 1GUSA 2E5LL 4KK7A 1PTOH 3AFPA 1AP0A 4LF7L 3NXWA 4GNXC 4A3GG 2QDBA 1XXGA 1JJGA 3K8AA 4RCOA 2K4KA 4HR7B 4BY1G 2QW7A 3MFGA 5C0XI 2D62A 2JXMB 3EIVA 4PG3A 2E75C 2PO4A 4NMZA 3J80E 4JI7Q 2K75A 5D3IB 1VQJA 1YJ9A 2NBFA 2PPBC 3U9SA 1O80A 4OX9Q 4E6IA 5K36G 3SXHA 1B53A 3Q6SA 1D5MC 2AHOB 1LTSD 2WACA 5EJWA 5M3MG 2K28A 1FNWA 1YNJC 1S5CD 5HGTA 5M5YB 2EYLA 3EN2A 3KOJA 1JQYD 4FF3A 5BN3A 2FINB 5EPLA 2VUMH 4JI5Q 1PV4A 3LX0A 1EY8A 3STBD 1LT4D 2IHFA 3S14H 3K57A 4R4OA 3BVGA 3T53B 4ULLA 5IGBA 4MZ9A 3I4NH 1M4VA 1GUGA 1UE5A 3W2DA 1QJOA 1I3QH 1TXYA 2UUBQ 2X6GA 3F1ZA 2YU9H 4YIJA 4POGA 1B1ZA 3HKSA 1EIFA 1HZ9A 4B3ML 3J7AF 3K59A 3UE1A 4YCUA 3OTOL 3D3RA 3M4OB 1DOKA 3AEVA 4IN3A 4DR5L 1LTBD 2ATWA 1Q1EA 2Z6KC 1DOMA 2UXDQ 1T5XD 2VL6A 3G6JB 2PQAB 1K8AC 1CK1A 2L9HA 5C0XH 2OQ0A 1X9NA 3L2PA 1KDBA 2CWPA 2LSSA 3BYTB 5C5MA 4DV5L 3MXGA 1LTTD 4OO1I 4A3CH 1N33L 1WCMG 1S5BD 1A2UA 1SXTA 1V1PA 2ID0A 3RN5A 3MXNB 2PNRC 2ZXRA 5M5YH 3J7ZC 4DR4L 2E76C 2K05A 3MVVA 4PMBA 1BVSA 1QE6A 2PI2A 4DK3C 3F2DA 3MFYA 1EZ8A 4BXXG 4RGMA 1V43A 1UNSA 3K5MA 2B2UA 4LF5L 5CV8A 3SEBA 1VQAA 1TWGB 3MAQA 3BS1A 3SE0A 1DM0B 1O7ZA 4XT3B 5JJIA 4DV2L 1QWYA 2EJMA 1WTXA 3PIO3 2FMMA 4QF4A 4IOCA 2IPKD 4X65L 2WAQB 4A3LG 3UDIA 4KMUC 1ZXTA 1VQDA 2JA6G 2A74C 3OOCA 3M4OH 3ND8A 2N88A 4DNRB 1STGA 3HP3A 4Z9CB 3VA7A 1J9OA 4UHVA 5H1SE 2YYZA 4JBWA 1PRTB 3T1YL 1NSNS 1Q12A 1FNUA 3H6MA 1X3QA 4A93B 4GNXA 1T5EA 2R93B 2F4VQ 4AYBE 4LJZC 3A56A 1HFNA 2F0GA 2HIXA 4HJ9A 2EZVA 3NEMA 1AH9A 4KD3A 4JI7L 1XMOQ 1LLRD 4LK1C 4DV0Q 4K8JA 1EQTA 3SK4A 2J0TD 1RF2D 3IAYA 3CMAA 5IP9G 3GP7A 3HOXB 1LT5D 4C3HG 3I55A 4OX9L 4U673 5M9OA 3OWEB 3A8JE 3DUZA 2RHQB 5LHY1 3EJIA 4K0KQ 2A19A 1CKNB 1BO0A 3DLLA 4C3JG 1JC7A 3RUZA 5CV4A 4JI5L 4F87A 2KA7A 2A6EC 4DN4M 1TWGH 4BY7B 3NBHB 2BH2A 2OTLA 1S5DD 1PTOC 4J15A 1P8LA 5KIXA 2UUBL 4RA8A 3URYA 1VQ7A 4IJLA 3D8GA 1EY5A 1L0XB 2HHHQ 4PMCA 1YVCA 1X3PA 1I6HB 3E5SA 1X3EA 1UE7A 2EYHA 1Q86C 1LTID 3ZYYX 2RVLA 3A55A 1R4QB 5GQOA 1U0LA 2EE1A 2B2YC 1QB5D 2ZJRA 2Z6KA 4A93H 2SOBA 2UXDL 1PZID 2R93H 2K7VA 2O2LD 4XIGS 4A3MG 4NXNQ 2MO0A 5J3BA 1VQNA 1HA5A 1EY6A 3FP9A 1PLFA 2RDGA 1BXTA 1TY2A 4K8IA 1X3FA 4ZQ3A 4JI8Q 4APVA 3H0GB 3IRBA 1D2BA 4DR1Q 4H0LC 1PYSB 1YHBA 2KQ3A 3M85A 1CSQA 3HOXH 1CZGA 1VS0A 2PZWA 5DEHA 3L0OA 3B6YA 2XNAC 5IGFA 4XQNA 1M1KC 3CPWA 1TWHB 2HCIA 1Z6HA 3BZDB 1PZJD 4RH6A 1EOTA 2Y0SE 1F9PA 4A76A 1E24A 4V0BA 2NVYB 3PUYA 3M3YB 5I2XA 1ET6A 3M7NA 3MA2B 1PYBA 5D65A 2QKIC 1KXLA 4G7OC 3RD4A 4IFDG 4BY7H 2R7FA 4JC0A 1BCPF 3CCMA 3E9HA 1S40A 1GHJA 4DK1A 3CCUA 1HZAA 2B63B 4OWTB 3VDYA 4RKBA 1JT8A 3GD7A 3KF8B 3PO2B 2AUJD 2Q8RE 3K81C 4DV6Q 1I6HH 1HXYD 1EYAA 4WRDA 3UDGA 4GZYC 2J4XA 4N8FA 1AE2A 2FHTA 2OCEA 3BDCA 5COYA 5CR3A 1G8ZD 1JCKB 4P75A 2XSCA 2F4VL 1NMGA 3VR4A 2ZXOA 3H0GH 2RBMA 2D5DA 4G7HC 1Q8KA 3TEHB 3HOVG 3P7JA 2MPMA 1XMOL 1XMQQ 5IGEA 2DJGC 2CVRA 4R8IA 4DV0L 3BZCA 5FJ8G 4V190 4NPSA 1TWFB 1A3TA 4BS9A 2L55A 1TWHH 3KK7A 1NBWA 3CC2A 1VDZA 1Q90A 4K0KL 2F0MA 3M3YH 2NVYH 1HNXQ 1STHA 1IBKQ
chains in the Genus database with same CATH topology
2ZJQA 1WI5A 4A3BG 2JEBI 4PZ7A 1UE6A 4A3KG 4A3JH 4YWLA 1VQIA 4B3MQ 3CCVA 1CKMA 4C3HH 2N78A 3H3VH 3F2BA 1MKHA 4IPDA 4JI4L 3RLNA 3UDFA 3RZOH 1IL2A 3ULPA 1KRSA 3OTOQ 4A93G 4IOAA 1LUZA 3CCEA 4A3IH 2IX1A 4DR5Q 1MJCA 2NZHA 1V1QA 3MEFA 2ALYB 5GROA 2UU9Q 2BA1A 3CCSA 2B63H 1I5FA 2MFIA 1VQKA 1EOVA 4A3CG 1PH4A 3OW2A 4MTNA 3HOUG 2ZJPA 2JQOA 3PO2H 4DV7L 3PUVA 4B3SQ 1QVFA 1PH8A 2HHHL 5C0XJ 4JBMA 4RMFA 4NXMQ 1KQSA 1OXTA 5ELOA 4X64Q 2CKZB 2VS1A 4P73A 1QZHA 1EYGA 1BBWA 3K80C 4YCVA 1C7YA 4IO9A 4GLVB 2K5NA 4DR7Q 1SE8A 2L15A 1A62A 4PZ6A 3A5UA 4OONA 4DV5Q 1Z9FA 2A1AA 4HJ7A 4QY7A 1Y1VG 1OXXK 4DV4L 1N33Q 3HOZG 1TWCH 1PH1A 2PNHA 2UUAQ 5FLMH 1EIYB 5HGQA 4HJ8A 3S1MH 4NXNL 3TS2A 2GVAA 1HJPA 3AFQA 1PVOA 1VQBA 1M90C 4BA1I 1NTGA 4JI8L 2NVTH 4DR4Q 4KHZA 4JI6Q 1I94L 1KIXA 1HNZQ 4DR1L 1XNQQ 3G4SA 5GAEC 1DGSA 3PUZA 2LXKA 4LFCL 4P71A 4TQUS 4OXPA 5IT9c 3PIPA 3TS0A 5C44G 1BBUA 1SR3A 3RNUA 1IZ6A 1H95A 1TWFH 2N8NA 1KAWA 4P74A 4HIDA 4WJ4A 3M4PA 4LF5Q 4EQ5A 3STBC 4LF8L 4L5SA 3AYHB 4DKAC 4O0AA 2RF4A 4GLXA 4DV3L 4TVAB 4LUZA 2UXBL 1PH3A 1WCMH 1SFOH 5JJKA 4JV5L 1HNWQ 2ES2A 4QIWE 2NN6G 4YWMA 2JA7H 1X54A 2DGYA 3OYYA 3T1HQ 4L5QA 5GAHC 4A3EG 5JJLA 1JB7A 1X3GA 3JC66 4DV2Q 4R4CA 4BBSG 4GKJQ 3K7UC 2WB1E 4X65Q 2A8VA 3GTKH 1BKBA 4JI1L 4DPGA 3PF5A 4B3RQ 1HZBA 3TRZA 1HH2P 3PO3G 5C3EG 1C9OA 2H5XA 1GO3E 3J7A5 4BXXH 2MO1A 1G51A 2CWAA 1YJNA 4YY3L 2BH8A 4LF6Q 3J80c 1JJ2A 1CKOA 2AMCB 1KHIA 3RN2A 1HR0L 1TWAH 5IWAL 3HOWH 1PHJA 5M5WH 4IFDJ 4BBRG 4Y7NH 3CCRA 1IXRA 1JE5A 4NB3A 3T1YQ 2E5LL 4HIKA 5IP7H 3AFPA 3H0GG 1YIJA 4L5TA 4LF7L 5ELNA 4GNXC 1RIPA 4A3GG 3Q8DA 1IYJB 1OXVA 2YTVA 3CQZH 4HIMA 4X66L 1K83H 1SROA 4POFA 1Q7YC 4XTCS 1VQGA 2B3GA 2JJQA 3K8AA 2K4KA 4DV6L 1JJGA 2IY5B 1G6PA 4BY1G 4DAYB 2AKWB 5M3FG 3PF4A 5C0XI 3A0JA 2D62A 3ICEA 3EIVA 4PG3A 5GAGC 1LTLA 1B70B 2N3SA 3CP0A 2VQEQ 1NJIC 4JOIA 1N34Q 4JI7Q 1VQFA 2F3IA 2K75A 2NZOA 4DR6L 2KCMA 4R4QA 1VQJA 4A3FG 1YJ9A 2JEAI 4GKKL 4DUYQ 2JA5H 4OX9Q 5K36G 1ASYA 3J81j 2R7ZG 1X6OA 2AHOB 3HOYG 3JAMi 2R92G 1K0RA 1RL2A 5M3MG 3H15A 3CCJA 1C0AA 2YV5A 1VQMA 3HKZE 2Z0SA 4X6AH 3EBEA 4A3JG 3EN2A 1O7IA 3U58A 1JJCB 1FGUA 4LF9L 2I5HA 2K50A 3KOJA 1XMQL 1Y1WH 2NVXH 3I4MG 1HZCA 4GOPC 1A8VA 3WWVA 2VUMH 4GS3A 4JI5Q 4LFBQ 4A3IG 3PUWA 1XTDA 2EQSA 3FKIH 3LGJA 1PV4A 4B3TQ 2R92H 1Z47A 3STBD 1E7ZA 2IHFA 3S14H 4A3DG 2IX0A 4R4OA 5IE8A 5IP9H 1K73C 4YHHQ 2KHJA 1G291 3I2ZA 4MZ9A 1HNXL 3I4NH 4PMWA 1AE3A 1UE5A 1IBKL 1IBML 2VW9A 3S17H 4GN3B 4LNQA 1I3QH 4DK6C 5C4XH 1B7YB 1TXYA 2JA9A 2UUBQ 2YU9H 3F1ZA 2R93G 2R6GA 4JYAQ 4LUOA 4POGA 3HKSA 5JEAG 1EIFA 2JK8A 4LFAQ 1HZ9A 5LMNQ 4GOPB 4B3ML 4PZ8A 2K52A 4C3JH 1YEZA 1IBMQ 3ER0A 3UE1A 4LWCA 4YCUA 2BA0A 5LMUQ 3ULJA 1FVIA 2ZTCA 4GN5A 3OTOL 1KD1C 3CAMA 3AEVA 1U5KA 4DR5L 1Q82C 2OTJA 1N8RC 1HR0W 2UU9L 2ATWA 2XTIA 1LM0A 1MIUA 3HFZB 4AYBG 4X62Q 3KJPA 3HOXG 1PA6A 3BZKA 2I0QA 4IFDI 1V9PA 1Q1EA 2Z6KC 2N49A 2UXDQ 2VL6A 4A3BH 4B3SL 2PQAB 1K8AC 3M4QA 1NE3A 2YTXA 4A3KH 1KL9A 5AJ3Q 3W1BA 4NXML 1YBYA 2OQ0A 1PH2A 2ZM6Q 1X9NA 1L1OC 3DM3A 5IYCH 4C3IH 4X64L 3L2PA 4MNOA 1ASZA 2CWPA 2LSSA 4KLKA 2JA8H 3U4ZA 3F8TA 4IJHA 4H02A 4JI3Q 4DR7L 2JE6I 3KF6A 1WOCA 4DV1Q 2QA4A 4DV5L 2AWNA 1E3PA 4EX5A 1OXUA 2MQHA 4OO1I 4UP9A 4A3CH 3KF6B 1WCMG 1N33L 4OWXB 3CPFA 1E22A 2UUAL 1CUKA 3TREA 4DNIA 2ID0A 2PI2E 4P72A 3RN5A 4BA2I 1E1OA 3MXNB 4BY7G 2YTYA 3CW2C 1SLJA 5M5YH 3J7ZC 2KHIA 3CCQA 1L1OB 2EIFA 4QGUA 1FJGQ 4DR4L 4JI6L 4A3MH 1BVSA 4ME3A 1HNZL 1VQ8A 1XNQL 3ULLA 1L2FA 1A0IA 2PI2A 4DK3C 3F2DA 3D0FA 2LXJA 1XPOA 1X65A 4BXXG 4YWKA 3KJOA 2QGQA 1S72A 1V43A 1PH7A 1E1TA 2E2JH 1Y1VH 1XPUA 4LF5L 2OQKA 4DR3Q 3HOWG 2KENA 1VQAA 2WAQE 4DR2Q 3S1RH 4DUZQ 2HT1A 1GM5A 3RLFA 1HNWL 1SRUA 3I56A 1K8GA 5IYDG 3I4OA 3T1HL 2OWOA 5JJIA 1S3OA 2E2IH 4DV2L 1PFSA 5EAYA 3JAMc 3S1QH 4GKJL 3A5ZB 4IOCA 4X65L 5C44H 4HJ5A 1SN8A 4A3LG 3UDIA 2CCZA 4JI0Q 4B3RL 3G71A 1K9MC 3J81i 2UUCQ 1XNRQ 2CFMA 1PH6A 1N32Q 1Q81C 4AH6A 1VQDA 4LF4L 3U50C 2JA6G 4IPCA 4UY8C 1EUJA 1OTCA 3M4OH 4LF6L 1I50H 5IY0A 3RR5A 2JA5G 5H1SE 2WFWA 1KC8C 2YYZA 1W3SA 4JBWA 1J5EQ 3T1YL 1Q12A 1SMXA 1FL0A 2VQFQ 4BBSH 4GNXA 2Q2TA 1YZ6A 1NY4A 4B3TL 1J6QA 1N36Q 1GVPA 1YITA 3GDEA 4AYBE 5FLXc 2F4VQ 4KHPQ 1WFQA 2NVQH 1Y1WG 4GNXB 4UPAA 3CCLA 4IPHA 3PIOA 1VQHA 2HIXA 4GLAC 4HJ9A 3NEMA 3S24A 1QUQA 2VQEL 2VUMG 1AH9A 3GTMH 5BR8Q 4AQYQ 4A4IA 1N34L 1MJEA 1XMOQ 1HNXQ 3A74A 4JI7L 3GTPH 2QEXA 4BBRH 3UE0A 1QUQB 2C35B 4DV0Q 2KBNA 2I5LX 3CMAA 5IP9G 4DUYL 3PUXA 3I55A 4OX9L 3GO5A 1EFWA 2Y0SG 3GTLH 4QJFA 1R9TH 2UXCQ 4O2DA 1K3RA 1IBLQ 1YHQA 5C4XG 2VZAA 1A63A 4JI2Q 1Y14B 3KDFB 3G6EA 2RHQB 4BY1H 5M3FH 4K0KQ 1VQ5A 2B63G 2K5HA 2A19A 3GTJH 1QVGA 1CKNB 3PV0A 1WYDA 3DLLA 3AQQA 3PO2G 3NELA 4A75A 1VQ9A 1OXSC 1UE1A 3HOVH 4A3FH 4JI5L 2HQLA 4GOPA 4LFBL 1EQQA 4WJ3M 4UP7A 1TWGH 2WB1G 4KI0A 5IYBH 4ALPA 1YJWA 3S2HH 2R7ZH 4JI4Q 1VQEA 2VY3A 5FJ8H 5M3MH 3NBHB 2BH2A 2DUDA 2OTLA 4YHHL 2F52A 4J15A 1P8LA 2K14A 3F2CA 2B29A 1WJJA 5C0XG 1D7QA 3KLWA 2R7DA 2PMZE 1YNXA 3G48A 3BJUA 2Q2UA 3ERSX 4GN4B 5IYCG 5FLMG 2UUBL 4QL5A 4JYAL 3I4MH 4DV7Q 2PQAA 4IJLA 1VQ7A 1D8LA 5LMNL 1CSPA 1LYLA 2GVBA 4LFAL 2HHHQ 2JA8G 3GTQH 2NN6I 1YVCA 2AWOA 1B8AA 4C2MH 1X56A 5LMUL 1XJVA 1VQOA 1X3EA 1UE7A 2WP8J 1Q86C 5JEAJ 1EWIA 4A3DH 3S16H 3W1GA 1VQ4A 1N9WA 4X62L 3FHWA 5GQOA 1U0LA 2E2HH 4OWWB 1VQLA 4A93H 4DV4Q 2ZJRA 2Z6KA 2UXDL 3CMEA 3KFUA 2R93H 4R4TA 4XIGS 4A3MG 3D31A 4NXNQ 2MO0A 1GD7A 1T9HA 5DLQE 5J3BA 4AIMA 2ZTEA 5AJ3L 1VQNA 3FP9A 3ZJYC 1VCIA 4JI8Q 2KCTA 2ZM6L 1X3FA 2D0PA 1L1OA 3CXCA 2JA7G 1UEBA 4APVA 2GN5A 4R1JA 1I94Q 3IRBA 3L7ZC 4DR1Q 2RCNA 4JI3L 2EXDA 1PYSB 1YHBA 4LFCQ 3HKZG 4JG2A 1NMFA 4DV1L 1EQRA 3E9IA 3M85A 3J81c 1CSQA 3HOXH 1VS0A 3L0OA 3B6YA 3CF5A 4LF8Q 2XGTA 5M5XH 3E0EA 1VQPA 3U4VA 3CC4A 2ASBA 2V1CC 4DV3Q 1M1KC 4LUVA 3CPWA 2UXBQ 3HOZH 3PCOB 4JV5Q 4FDBA 1FJGL 1X55A 1PH9A 2Y0SE 4A76A 1QVCA 1E24A 5IP7G 3PUYA 3M7NA 4JBJA 1GKHA 5HY6A 4JBKA 1PYBA 3K7AH 4JI1Q 3S2DH 1KXLA 3M9BA 1Q46A 4IFDG 4DR3L 3PGZA 4DR2L 3SGIA 4DUZL 4QQBX 4BY7H 3GTGH 3CD6A 2R7FA 4YY3Q 3S15H 4R4IA 3H3VI 1UWVA 4JC0A 3GTOH 3CCMA 2IT1A 3I7FA 1HR0Q 3E9HA 5IWAQ 2HIVA 1S40A 4YCWA 2Q2IA 3PSIA 3W5OA 2E5LQ 3CCUA 1HZAA 4OWTB 5E7NA 3VDYA 4LF7Q 4LF4Q 1YI2A 1JT8A 3GD7A 4A3EH 3KF8B 4X66Q 4JI0L 4UP8A 5LMNW 1XNRL 3K81C 2UUCL 4DV6Q 1I6HH 1N32L 4OO1G 4L5RC 2MNAA 2IHEA 1W2BA 3UDGA 3RZDH 1JMCA 3UDXA 2K5VA 1PH5A 4JOIC 1AE2A 1XPRA 4DAMA 2ZTDA 3PO3H 5C3EH 4Y52H 2OCEA 1J5EL 5IYDH 4DR6Q 3KYHC 1VQ6A 2E8GA 4GKKQ 4P75A 2VQFL 3FKIG 4HIOA 1P16A 1N36L 3BU2A 4A3LH 2F4VL 4KHPL 1NMGA 2I5MX 3H0GH 3S1NH 2RHSB 4A3GH 3RLOA 3KDFA 1Q1BA 1Q8KA 3NENA 2JA6H 3I4NG 1VQCA 3TEHB 3HOVG 4LW1A 1YHAA 1CKNA 2FXQA 4LF9Q 5BR8L 4AQYL 1QZGA 1KRTA 1XMOL 1XMQQ 1L0WA 4IPGA 3J80i 5IYBG 5GADC 2VNUD 4DV0L 3BZCA 4JCVE 5FJ8G 4NPSA 5C4JH 2Q2HA 2D0OA 4HJAA 3HOUH 3K0XA 1TWHH 2UXCL 3CC7A 1NBWA 1IBLL 3CC2A 2WAQG 4JI2L 4K0KL 3HOYH 3M3YH 2NVYH 4RG1A 3TQYA 2CQOA 1IBKQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJQ A;  1WI5 A;  4A3B G;  2JEB I;  4PZ7 A;  1UE6 A;  4A3K G;  4A3J H;  4YWL A;  1VQI A;  4B3M Q;  3CCV A;  1CKM A;  4C3H H;  2N78 A;  3H3V H;  3F2B A;  1MKH A;  4IPD A;  4JI4 L;  3RLN A;  3UDF A;  3RZO H;  1IL2 A;  3ULP A;  1KRS A;  3OTO Q;  4A93 G;  4IOA A;  1LUZ A;  3CCE A;  4A3I H;  2IX1 A;  4DR5 Q;  1MJC A;  2NZH A;  1V1Q A;  3MEF A;  2ALY B;  5GRO A;  2UU9 Q;  2BA1 A;  3CCS A;  2B63 H;  1I5F A;  2MFI A;  1VQK A;  1EOV A;  4A3C G;  1PH4 A;  3OW2 A;  4MTN A;  3HOU G;  2ZJP A;  2JQO A;  3PO2 H;  4DV7 L;  3PUV A;  4B3S Q;  1QVF A;  1PH8 A;  2HHH L;  5C0X J;  4JBM A;  4RMF A;  4NXM Q;  1KQS A;  1OXT A;  5ELO A;  4X64 Q;  2CKZ B;  2VS1 A;  4P73 A;  1QZH A;  1EYG A;  1BBW A;  3K80 C;  4YCV A;  1C7Y A;  4IO9 A;  4GLV B;  2K5N A;  4DR7 Q;  1SE8 A;  2L15 A;  1A62 A;  4PZ6 A;  3A5U A;  4OON A;  4DV5 Q;  1Z9F A;  2A1A A;  4HJ7 A;  4QY7 A;  1Y1V G;  1OXX K;  4DV4 L;  1N33 Q;  3HOZ G;  1TWC H;  1PH1 A;  2PNH A;  2UUA Q;  5FLM H;  1EIY B;  5HGQ A;  4HJ8 A;  3S1M H;  4NXN L;  3TS2 A;  2GVA A;  1HJP A;  3AFQ A;  1PVO A;  1VQB A;  1M90 C;  4BA1 I;  1NTG A;  4JI8 L;  2NVT H;  4DR4 Q;  4KHZ A;  4JI6 Q;  1I94 L;  1KIX A;  1HNZ Q;  4DR1 L;  1XNQ Q;  3G4S A;  5GAE C;  1DGS A;  3PUZ A;  2LXK A;  4LFC L;  4P71 A;  4TQU S;  4OXP A;  5IT9 c;  3PIP A;  3TS0 A;  5C44 G;  1BBU A;  1SR3 A;  3RNU A;  1IZ6 A;  1H95 A;  1TWF H;  2N8N A;  1KAW A;  4P74 A;  4HID A;  4WJ4 A;  3M4P A;  4LF5 Q;  4EQ5 A;  3STB C;  4LF8 L;  4L5S A;  3AYH B;  4DKA C;  4O0A A;  2RF4 A;  4GLX A;  4DV3 L;  4TVA B;  4LUZ A;  2UXB L;  1PH3 A;  1WCM H;  1SFO H;  5JJK A;  4JV5 L;  1HNW Q;  2ES2 A;  4QIW E;  2NN6 G;  4YWM A;  2JA7 H;  1X54 A;  2DGY A;  3OYY A;  3T1H Q;  4L5Q A;  5GAH C;  4A3E G;  5JJL A;  1JB7 A;  1X3G A;  3JC6 6;  4DV2 Q;  4R4C A;  4BBS G;  4GKJ Q;  3K7U C;  2WB1 E;  4X65 Q;  2A8V A;  3GTK H;  1BKB A;  4JI1 L;  4DPG A;  3PF5 A;  4B3R Q;  1HZB A;  3TRZ A;  1HH2 P;  3PO3 G;  5C3E G;  1C9O A;  2H5X A;  1GO3 E;  3J7A 5;  4BXX H;  2MO1 A;  1G51 A;  2CWA A;  1YJN A;  4YY3 L;  2BH8 A;  4LF6 Q;  3J80 c;  1JJ2 A;  1CKO A;  2AMC B;  1KHI A;  3RN2 A;  1HR0 L;  1TWA H;  5IWA L;  3HOW H;  1PHJ A;  5M5W H;  4IFD J;  4BBR G;  4Y7N H;  3CCR A;  1IXR A;  1JE5 A;  4NB3 A;  3T1Y Q;  2E5L L;  4HIK A;  5IP7 H;  3AFP A;  3H0G G;  1YIJ A;  4L5T A;  4LF7 L;  5ELN A;  4GNX C;  1RIP A;  4A3G G;  3Q8D A;  1IYJ B;  1OXV A;  2YTV A;  3CQZ H;  4HIM A;  4X66 L;  1K83 H;  1SRO A;  4POF A;  1Q7Y C;  4XTC S;  1VQG A;  2B3G A;  2JJQ A;  3K8A A;  2K4K A;  4DV6 L;  1JJG A;  2IY5 B;  1G6P A;  4BY1 G;  4DAY B;  2AKW B;  5M3F G;  3PF4 A;  5C0X I;  3A0J A;  2D62 A;  3ICE A;  3EIV A;  4PG3 A;  5GAG C;  1LTL A;  1B70 B;  2N3S A;  3CP0 A;  2VQE Q;  1NJI C;  4JOI A;  1N34 Q;  4JI7 Q;  1VQF A;  2F3I A;  2K75 A;  2NZO A;  4DR6 L;  2KCM A;  4R4Q A;  1VQJ A;  4A3F G;  1YJ9 A;  2JEA I;  4GKK L;  4DUY Q;  2JA5 H;  4OX9 Q;  5K36 G;  1ASY A;  3J81 j;  2R7Z G;  1X6O A;  2AHO B;  3HOY G;  3JAM i;  2R92 G;  1K0R A;  1RL2 A;  5M3M G;  3H15 A;  3CCJ A;  1C0A A;  2YV5 A;  1VQM A;  3HKZ E;  2Z0S A;  4X6A H;  3EBE A;  4A3J G;  3EN2 A;  1O7I A;  3U58 A;  1JJC B;  1FGU A;  4LF9 L;  2I5H A;  2K50 A;  3KOJ A;  1XMQ L;  1Y1W H;  2NVX H;  3I4M G;  1HZC A;  4GOP C;  1A8V A;  3WWV A;  2VUM H;  4GS3 A;  4JI5 Q;  4LFB Q;  4A3I G;  3PUW A;  1XTD A;  2EQS A;  3FKI H;  3LGJ A;  1PV4 A;  4B3T Q;  2R92 H;  1Z47 A;  3STB D;  1E7Z A;  2IHF A;  3S14 H;  4A3D G;  2IX0 A;  4R4O A;  5IE8 A;  5IP9 H;  1K73 C;  4YHH Q;  2KHJ A;  1G29 1;  3I2Z A;  4MZ9 A;  1HNX L;  3I4N H;  4PMW A;  1AE3 A;  1UE5 A;  1IBK L;  1IBM L;  2VW9 A;  3S17 H;  4GN3 B;  4LNQ A;  1I3Q H;  4DK6 C;  5C4X H;  1B7Y B;  1TXY A;  2JA9 A;  2UUB Q;  2YU9 H;  3F1Z A;  2R93 G;  2R6G A;  4JYA Q;  4LUO A;  4POG A;  3HKS A;  5JEA G;  1EIF A;  2JK8 A;  4LFA Q;  1HZ9 A;  5LMN Q;  4GOP B;  4B3M L;  4PZ8 A;  2K52 A;  4C3J H;  1YEZ A;  1IBM Q;  3ER0 A;  3UE1 A;  4LWC A;  4YCU A;  2BA0 A;  5LMU Q;  3ULJ A;  1FVI A;  2ZTC A;  4GN5 A;  3OTO L;  1KD1 C;  3CAM A;  3AEV A;  1U5K A;  4DR5 L;  1Q82 C;  2OTJ A;  1N8R C;  1HR0 W;  2UU9 L;  2ATW A;  2XTI A;  1LM0 A;  1MIU A;  3HFZ B;  4AYB G;  4X62 Q;  3KJP A;  3HOX G;  1PA6 A;  3BZK A;  2I0Q A;  4IFD I;  1V9P A;  1Q1E A;  2Z6K C;  2N49 A;  2UXD Q;  2VL6 A;  4A3B H;  4B3S L;  2PQA B;  1K8A C;  3M4Q A;  1NE3 A;  2YTX A;  4A3K H;  1KL9 A;  5AJ3 Q;  3W1B A;  4NXM L;  1YBY A;  2OQ0 A;  1PH2 A;  2ZM6 Q;  1X9N A;  1L1O C;  3DM3 A;  5IYC H;  4C3I H;  4X64 L;  3L2P A;  4MNO A;  1ASZ A;  2CWP A;  2LSS A;  4KLK A;  2JA8 H;  3U4Z A;  3F8T A;  4IJH A;  4H02 A;  4JI3 Q;  4DR7 L;  2JE6 I;  3KF6 A;  1WOC A;  4DV1 Q;  2QA4 A;  4DV5 L;  2AWN A;  1E3P A;  4EX5 A;  1OXU A;  2MQH A;  4OO1 I;  4UP9 A;  4A3C H;  3KF6 B;  1WCM G;  1N33 L;  4OWX B;  3CPF A;  1E22 A;  2UUA L;  1CUK A;  3TRE A;  4DNI A;  2ID0 A;  2PI2 E;  4P72 A;  3RN5 A;  4BA2 I;  1E1O A;  3MXN B;  4BY7 G;  2YTY A;  3CW2 C;  1SLJ A;  5M5Y H;  3J7Z C;  2KHI A;  3CCQ A;  1L1O B;  2EIF A;  4QGU A;  1FJG Q;  4DR4 L;  4JI6 L;  4A3M H;  1BVS A;  4ME3 A;  1HNZ L;  1VQ8 A;  1XNQ L;  3ULL A;  1L2F A;  1A0I A;  2PI2 A;  4DK3 C;  3F2D A;  3D0F A;  2LXJ A;  1XPO A;  1X65 A;  4BXX G;  4YWK A;  3KJO A;  2QGQ A;  1S72 A;  1V43 A;  1PH7 A;  1E1T A;  2E2J H;  1Y1V H;  1XPU A;  4LF5 L;  2OQK A;  4DR3 Q;  3HOW G;  2KEN A;  1VQA A;  2WAQ E;  4DR2 Q;  3S1R H;  4DUZ Q;  2HT1 A;  1GM5 A;  3RLF A;  1HNW L;  1SRU A;  3I56 A;  1K8G A;  5IYD G;  3I4O A;  3T1H L;  2OWO A;  5JJI A;  1S3O A;  2E2I H;  4DV2 L;  1PFS A;  5EAY A;  3JAM c;  3S1Q H;  4GKJ L;  3A5Z B;  4IOC A;  4X65 L;  5C44 H;  4HJ5 A;  1SN8 A;  4A3L G;  3UDI A;  2CCZ A;  4JI0 Q;  4B3R L;  3G71 A;  1K9M C;  3J81 i;  2UUC Q;  1XNR Q;  2CFM A;  1PH6 A;  1N32 Q;  1Q81 C;  4AH6 A;  1VQD A;  4LF4 L;  3U50 C;  2JA6 G;  4IPC A;  4UY8 C;  1EUJ A;  1OTC A;  3M4O H;  4LF6 L;  1I50 H;  5IY0 A;  3RR5 A;  2JA5 G;  5H1S E;  2WFW A;  1KC8 C;  2YYZ A;  1W3S A;  4JBW A;  1J5E Q;  3T1Y L;  1Q12 A;  1SMX A;  1FL0 A;  2VQF Q;  4BBS H;  4GNX A;  2Q2T A;  1YZ6 A;  1NY4 A;  4B3T L;  1J6Q A;  1N36 Q;  1GVP A;  1YIT A;  3GDE A;  4AYB E;  5FLX c;  2F4V Q;  4KHP Q;  1WFQ A;  2NVQ H;  1Y1W G;  4GNX B;  4UPA A;  3CCL A;  4IPH A;  3PIO A;  1VQH A;  2HIX A;  4GLA C;  4HJ9 A;  3NEM A;  3S24 A;  1QUQ A;  2VQE L;  2VUM G;  1AH9 A;  3GTM H;  5BR8 Q;  4AQY Q;  4A4I A;  1N34 L;  1MJE A;  1XMO Q;  1HNX Q;  3A74 A;  4JI7 L;  3GTP H;  2QEX A;  4BBR H;  3UE0 A;  1QUQ B;  2C35 B;  4DV0 Q;  2KBN A;  2I5L X;  3CMA A;  5IP9 G;  4DUY L;  3PUX A;  3I55 A;  4OX9 L;  3GO5 A;  1EFW A;  2Y0S G;  3GTL H;  4QJF A;  1R9T H;  2UXC Q;  4O2D A;  1K3R A;  1IBL Q;  1YHQ A;  5C4X G;  2VZA A;  1A63 A;  4JI2 Q;  1Y14 B;  3KDF B;  3G6E A;  2RHQ B;  4BY1 H;  5M3F H;  4K0K Q;  1VQ5 A;  2B63 G;  2K5H A;  2A19 A;  3GTJ H;  1QVG A;  1CKN B;  3PV0 A;  1WYD A;  3DLL A;  3AQQ A;  3PO2 G;  3NEL A;  4A75 A;  1VQ9 A;  1OXS C;  1UE1 A;  3HOV H;  4A3F H;  4JI5 L;  2HQL A;  4GOP A;  4LFB L;  1EQQ A;  4WJ3 M;  4UP7 A;  1TWG H;  2WB1 G;  4KI0 A;  5IYB H;  4ALP A;  1YJW A;  3S2H H;  2R7Z H;  4JI4 Q;  1VQE A;  2VY3 A;  5FJ8 H;  5M3M H;  3NBH B;  2BH2 A;  2DUD A;  2OTL A;  4YHH L;  2F52 A;  4J15 A;  1P8L A;  2K14 A;  3F2C A;  2B29 A;  1WJJ A;  5C0X G;  1D7Q A;  3KLW A;  2R7D A;  2PMZ E;  1YNX A;  3G48 A;  3BJU A;  2Q2U A;  3ERS X;  4GN4 B;  5IYC G;  5FLM G;  2UUB L;  4QL5 A;  4JYA L;  3I4M H;  4DV7 Q;  2PQA A;  4IJL A;  1VQ7 A;  1D8L A;  5LMN L;  1CSP A;  1LYL A;  2GVB A;  4LFA L;  2HHH Q;  2JA8 G;  3GTQ H;  2NN6 I;  1YVC A;  2AWO A;  1B8A A;  4C2M H;  1X56 A;  5LMU L;  1XJV A;  1VQO A;  1X3E A;  1UE7 A;  2WP8 J;  1Q86 C;  5JEA J;  1EWI A;  4A3D H;  3S16 H;  3W1G A;  1VQ4 A;  1N9W A;  4X62 L;  3FHW A;  5GQO A;  1U0L A;  2E2H H;  4OWW B;  1VQL A;  4A93 H;  4DV4 Q;  2ZJR A;  2Z6K A;  2UXD L;  3CME A;  3KFU A;  2R93 H;  4R4T A;  4XIG S;  4A3M G;  3D31 A;  4NXN Q;  2MO0 A;  1GD7 A;  1T9H A;  5DLQ E;  5J3B A;  4AIM A;  2ZTE A;  5AJ3 L;  1VQN A;  3FP9 A;  3ZJY C;  1VCI A;  4JI8 Q;  2KCT A;  2ZM6 L;  1X3F A;  2D0P A;  1L1O A;  3CXC A;  2JA7 G;  1UEB A;  4APV A;  2GN5 A;  4R1J A;  1I94 Q;  3IRB A;  3L7Z C;  4DR1 Q;  2RCN A;  4JI3 L;  2EXD A;  1PYS B;  1YHB A;  4LFC Q;  3HKZ G;  4JG2 A;  1NMF A;  4DV1 L;  1EQR A;  3E9I A;  3M85 A;  3J81 c;  1CSQ A;  3HOX H;  1VS0 A;  3L0O A;  3B6Y A;  3CF5 A;  4LF8 Q;  2XGT A;  5M5X H;  3E0E A;  1VQP A;  3U4V A;  3CC4 A;  2ASB A;  2V1C C;  4DV3 Q;  1M1K C;  4LUV A;  3CPW A;  2UXB Q;  3HOZ H;  3PCO B;  4JV5 Q;  4FDB A;  1FJG L;  1X55 A;  1PH9 A;  2Y0S E;  4A76 A;  1QVC A;  1E24 A;  5IP7 G;  3PUY A;  3M7N A;  4JBJ A;  1GKH A;  5HY6 A;  4JBK A;  1PYB A;  3K7A H;  4JI1 Q;  3S2D H;  1KXL A;  3M9B A;  1Q46 A;  4IFD G;  4DR3 L;  3PGZ A;  4DR2 L;  3SGI A;  4DUZ L;  4QQB X;  4BY7 H;  3GTG H;  3CD6 A;  2R7F A;  4YY3 Q;  3S15 H;  4R4I A;  3H3V I;  1UWV A;  4JC0 A;  3GTO H;  3CCM A;  2IT1 A;  3I7F A;  1HR0 Q;  3E9H A;  5IWA Q;  2HIV A;  1S40 A;  4YCW A;  2Q2I A;  3PSI A;  3W5O A;  2E5L Q;  3CCU A;  1HZA A;  4OWT B;  5E7N A;  3VDY A;  4LF7 Q;  4LF4 Q;  1YI2 A;  1JT8 A;  3GD7 A;  4A3E H;  3KF8 B;  4X66 Q;  4JI0 L;  4UP8 A;  5LMN W;  1XNR L;  3K81 C;  2UUC L;  4DV6 Q;  1I6H H;  1N32 L;  4OO1 G;  4L5R C;  2MNA A;  2IHE A;  1W2B A;  3UDG A;  3RZD H;  1JMC A;  3UDX A;  2K5V A;  1PH5 A;  4JOI C;  1AE2 A;  1XPR A;  4DAM A;  2ZTD A;  3PO3 H;  5C3E H;  4Y52 H;  2OCE A;  1J5E L;  5IYD H;  4DR6 Q;  3KYH C;  1VQ6 A;  2E8G A;  4GKK Q;  4P75 A;  2VQF L;  3FKI G;  4HIO A;  1P16 A;  1N36 L;  3BU2 A;  4A3L H;  2F4V L;  4KHP L;  1NMG A;  2I5M X;  3H0G H;  3S1N H;  2RHS B;  4A3G H;  3RLO A;  3KDF A;  1Q1B A;  1Q8K A;  3NEN A;  2JA6 H;  3I4N G;  1VQC A;  3TEH B;  3HOV G;  4LW1 A;  1YHA A;  1CKN A;  2FXQ A;  4LF9 Q;  5BR8 L;  4AQY L;  1QZG A;  1KRT A;  1XMO L;  1XMQ Q;  1L0W A;  4IPG A;  3J80 i;  5IYB G;  5GAD C;  2VNU D;  4DV0 L;  3BZC A;  4JCV E;  5FJ8 G;  4NPS A;  5C4J H;  2Q2H A;  2D0O A;  4HJA A;  3HOU H;  3K0X A;  1TWH H;  2UXC L;  3CC7 A;  1NBW A;  1IBL L;  3CC2 A;  2WAQ G;  4JI2 L;  4K0K L;  3HOY H;  3M3Y H;  2NVY H;  4RG1 A;  3TQY A;  2CQO A;  1IBK Q; 
#chains in the Genus database with same CATH topology
 2L1B A;  3NTH A;  4PZ7 A;  2LKV A;  1UAP A;  1PRT D;  1ZYR D;  1W6K A;  3CCV A;  1CM9 A;  3OSO A;  3F2B A;  3RLN A;  5BN5 A;  3ULP A;  1KRS A;  5FO9 B;  1RJT A;  4A3I H;  2IX1 A;  3MEF A;  2ALY B;  2BOS A;  2BA1 A;  2B63 H;  4KY7 A;  5M5W B;  1EOV A;  4FF1 A;  4TKO B;  1PH4 A;  3GQB A;  1U4M A;  4U68 A;  4KY5 A;  3PO2 H;  3PUV A;  1L0Y B;  1PH8 A;  2HHH L;  3D4D A;  3BVM A;  3CQZ B;  4RMF A;  3PIP 3;  2KCN A;  2PZU A;  5ELO A;  1B9N A;  1I4X A;  5KEE A;  1QZH A;  1EYG A;  1BBW A;  4G57 A;  1TU2 B;  4DR7 Q;  3I90 A;  2RDH A;  4PZ6 A;  3KLR A;  2D2C C;  1Z9F A;  1LTR D;  4HJ7 A;  2B2Y A;  3NPP A;  2PNH A;  5IGG A;  5I6W A;  2JA5 B;  4NXN L;  1F2M A;  2F1M A;  4BA1 I;  1NTG A;  4JI8 L;  3OHX C;  3TSS A;  3CHB D;  1HNZ Q;  4DR1 L;  1DGS A;  4M8A A;  3SK6 A;  4OXP A;  5IT9 c;  4C1N I;  1HHV A;  1BBU A;  1SR3 A;  1TT2 A;  1Y1W B;  1B3Q A;  1IZ6 A;  2NVX B;  1H95 A;  1TWF H;  2F4I A;  3FRP B;  2AQ3 B;  3CRL C;  1PH3 A;  2KJX A;  1NNX A;  1D6E C;  1ET9 A;  2ES2 A;  4C1N K;  3OYY A;  3T1H Q;  4L5Q A;  4KD4 A;  5GAH C;  1DOL A;  1X3G A;  3S17 B;  4GKJ Q;  5C4X B;  2IJ0 A;  1CHP D;  1BBX C;  4IUT A;  4DPG A;  1F9Q A;  1HZB A;  1ESR A;  2L11 A;  5KNB A;  5C3E G;  1CI3 M;  2ZT9 C;  1YJN A;  2EYF A;  1JJ2 A;  1CKO A;  3RN2 A;  5KYL A;  5M5W H;  4IFD J;  1QG7 A;  5EQ0 A;  3CCR A;  4NB3 A;  3WOF A;  3OIQ A;  2QCP X;  2ENB A;  5ELN A;  1IYJ B;  3CQZ H;  2ASB A;  4A3B B;  5TSS A;  4XTC S;  4DV6 L;  4A3K B;  1EL0 A;  2AKW B;  3A0J A;  1B70 B;  3CP0 A;  3N52 A;  5C6A A;  1N34 Q;  2F3I A;  2F0K A;  4ZCK A;  4R4Q A;  4A3F G;  2DY8 A;  2JEA I;  2JA5 H;  1ASY A;  3J81 j;  2R7Z G;  3HOY G;  4R9W A;  2R92 G;  5CBE E;  2SEB D;  3CCJ A;  2XRQ D;  4RKL A;  1VQM A;  4A3J G;  1O7I A;  5LL6 X;  1XMQ L;  1Y1W H;  2NVX H;  2A6H C;  5EPK A;  4GOP C;  3WWV A;  4GS3 A;  4LFB Q;  1EU4 A;  2C5C A;  3PUW A;  2E2J B;  3G7L A;  1SE4 A;  3LGJ A;  3HKZ B;  2LY7 A;  1RCV D;  4A3D G;  1FYC A;  1K73 C;  2B8F A;  2MUY A;  3IKJ A;  1V1O A;  1C8C A;  1HNX L;  3S17 H;  1AE3 A;  5ISR A;  1IBK L;  1IBM L;  4UDU C;  4DK6 C;  5C4X H;  1QCB D;  2PZT A;  2E2I B;  2R6G A;  2DN8 A;  1K8M A;  5LMN Q;  2B8G A;  4KJO A;  4PZ8 A;  1YEZ A;  3K5N A;  1SMY C;  5FOB B;  4LWC A;  3D6W A;  4GN5 A;  2A5H A;  1G6Z A;  1U5K A;  1Q82 C;  1I50 B;  1HR0 W;  1O78 A;  4AYB G;  3KJP A;  3A8K E;  3BZK A;  1AN8 A;  1KTK A;  5E1F A;  1SYE A;  2D9U A;  1I4H A;  4Q0F A;  2NUC A;  4A3B H;  3NBI A;  4A3K H;  1QNU A;  4BBS B;  1KL9 A;  5C4H A;  3W1B A;  3MXP A;  1L1O C;  3DM3 A;  4XQJ A;  1WTP A;  1PXU A;  4DR7 L;  5C4Z A;  1WOC A;  3CU7 A;  2MQH A;  4KKT A;  2B2T C;  4UP9 A;  5D14 A;  1GUN A;  3KF6 B;  4BBR B;  4F8M A;  3I73 A;  3TRE A;  2PI2 E;  2O4X A;  3KLS X;  3TP7 A;  1E1O A;  2YTY A;  3GTL B;  3VYU A;  1SLJ A;  1U4L A;  2SNM A;  4WJW A;  2EIF A;  4RGT A;  2MJ8 A;  4ME3 A;  1HNZ L;  4BY1 B;  2AQ2 B;  1CFM A;  2JYO A;  3D0F A;  1PH7 A;  1E1T A;  2E2J H;  2A69 D;  2OQK A;  1WTV A;  2KEN A;  5A35 A;  4RHS A;  1GM5 A;  3S2H B;  4JVZ A;  3S9W A;  3RLF A;  3D4R A;  3NE5 B;  5M3M B;  4OEM B;  5IYD G;  3T1H L;  2E2I H;  2R61 A;  1LT3 D;  3VA5 A;  4GKJ L;  2C9O A;  1HQM C;  2WKC A;  2CCZ A;  1JWM D;  1K3B C;  3J81 i;  1PH6 A;  1N32 Q;  3GTQ B;  5KYI A;  1Q81 C;  4DAY A;  3U50 C;  4IPC A;  1OTC A;  1LT6 D;  1I50 H;  5IY0 A;  3RR5 A;  1SE3 A;  5JPN C;  5EBD A;  3J81 L;  1KC8 C;  2N55 A;  3AB9 A;  1JWS D;  1W3S A;  2SDF A;  2O5J C;  1Q3L A;  2E2H B;  2VQF Q;  4BBS H;  1K0S A;  2Q2T A;  4KTA A;  1HPC A;  4B9W A;  1GVP A;  3GDE A;  2WV6 D;  2EY1 A;  4HCS A;  4DXG A;  5FLX c;  1WFQ A;  4G7Z C;  4IUQ A;  4UPA A;  3CCL A;  3HOU B;  1HCZ A;  3PIO A;  2VUM G;  5BR8 Q;  1N34 L;  1BNZ A;  4HTH A;  2LS0 1;  2QEX A;  2BE5 D;  3UE0 A;  4BBR H;  1QUQ B;  2KED A;  4N9P A;  2NTT A;  1IW7 C;  1B2T A;  3I70 A;  4CJ2 C;  2Y0S G;  3GTL H;  5M5X B;  2E74 C;  1K3R A;  5FLX E;  4H7B A;  5ELF A;  1A63 A;  4JI2 Q;  5JPM C;  3G6E A;  4BY1 H;  3HOZ B;  2M9V A;  1SDF A;  3PV0 A;  2K03 A;  3C3L A;  2M2L A;  3AQQ A;  4A75 A;  1VQ9 A;  3EQL C;  1FD7 D;  1UE1 A;  4GOP A;  2HQL A;  4LFB L;  2AUK A;  4WFN 3;  3K7A B;  4UP7 A;  2WB1 G;  1YJW A;  4KI0 A;  5IYB H;  3S2H H;  2H4O A;  2VY3 A;  1MD2 D;  1TS3 A;  3OPO A;  1EFI D;  1EY7 A;  3DWQ A;  5M3M H;  3S15 B;  2DUD A;  3GTO B;  1DZ1 A;  4ZUI A;  2K14 A;  5C0X G;  4JK1 C;  2A68 C;  1YNX A;  2R7D A;  3BJU A;  5FLM G;  4QL5 A;  3U9O A;  5LMN L;  1LYL A;  3GTQ H;  4A3E B;  5BN4 A;  3I91 A;  2F0L A;  1X56 A;  2TMP A;  3RZD B;  5EKL A;  2PMZ B;  1ICW A;  1N9W A;  3FHW A;  2E2H H;  1VQL A;  3FEW X;  3CME A;  1TR5 A;  4ILW A;  3D31 A;  5C3W A;  1PTO F;  2ZTE A;  3HOU H;  1L1O A;  4R1J A;  1I94 Q;  3NHH A;  2JA6 B;  2EXD A;  4JG2 A;  1MGS A;  1U4P A;  5CV7 A;  1GXD C;  2B2T A;  4ZYS A;  1RTO A;  5CMD A;  3PQI A;  5M5X H;  5E4W C;  2V1C C;  1WTR A;  3OIP A;  4LUV A;  1ILP A;  2UXB Q;  1R4P B;  3HOZ H;  3PCO B;  4JV5 Q;  1XTC D;  2K6A A;  5IP7 G;  4WOR A;  2LFN A;  3P75 A;  4JBJ A;  1GKH A;  2F0S A;  1BCP B;  3K7A H;  4OEL B;  3W3A A;  3NTK A;  4FVM A;  4QQB X;  2A6E D;  3BVZ A;  4C3H B;  4YY3 Q;  3S15 H;  3H3V I;  3GTO H;  5IWA Q;  2HIV A;  3MTS A;  4ID6 A;  3V96 A;  2Q2I A;  3NK9 A;  5E7N A;  1LTA D;  4LF4 Q;  5CBA E;  3HS0 C;  4A3E H;  4X66 Q;  4UP8 A;  1N32 L;  4OO1 G;  2MNA A;  3RZD H;  2Q8T A;  3UDX A;  1FR3 A;  2XVS A;  2EYM A;  4XT1 B;  4DAM A;  3Q22 A;  1KLG D;  1SYB A;  1IKL A;  1SBB B;  3F2U A;  2G5D A;  4GKK Q;  2VQF L;  3FKI G;  4HIO A;  1P16 A;  1CA5 A;  4A3L H;  1NAP A;  1MBY A;  3S1M B;  1LV9 A;  3N6R A;  2RHS B;  3R3O A;  3RLO A;  3KDF A;  1Q1B A;  2JA6 H;  2CH4 W;  4JPB W;  4LW1 A;  1YHA A;  2IX3 A;  5BR8 L;  1QZG A;  4N9T A;  4JCV E;  2K33 A;  5JJZ A;  1IHZ A;  2EOT A;  2G9D A;  2LMC B;  3GV3 A;  2L12 A;  1S5F D;  4FNF A;  2WAQ G;  4JI2 L;  4IAL A;  4DF7 A;  1UEA B;  2CQO A;  4K6L A;  3TQY A;  3M4Y A;  2AQ1 B;  4K6D A;  4YWL A;  1HTP A;  1GJX A;  4K5W A;  4C3H H;  3H3V H;  1XYI A;  4A93 G;  1HFG A;  3MC0 B;  2NZH A;  5GRO A;  1V1Q A;  2M00 A;  2UU9 Q;  5ELB A;  1TWA B;  5ELE A;  3HOW B;  1VQK A;  1HUN A;  1F9R A;  1JOK A;  5KGU A;  2L4N A;  2EYO A;  2MP1 A;  4KKS A;  4HMI A;  1DJR D;  4I7A A;  4J8Q A;  5C0X J;  3NSW A;  1H9S A;  1J8I A;  3QWN A;  4X64 Q;  2CKZ B;  4P73 A;  2CW0 D;  3K80 C;  5G3L F;  4IO9 A;  1STE A;  1A62 A;  3J7Y W;  4OON A;  3QOJ A;  2A1A A;  1Y1V G;  2K04 A;  3NP8 A;  2UUA Q;  5HGQ A;  3S1M H;  2GVA A;  1HJP A;  1NCV A;  1M90 C;  3M7G A;  1D5X C;  1U9R A;  3DXJ C;  3HG9 A;  5CV5 A;  1I94 L;  1XNQ Q;  4DXF A;  4P71 A;  3PIP A;  1PFN A;  5C44 G;  4RGN A;  3TP8 A;  3QIA A;  4MN3 A;  5KNC A;  1KAW A;  4ZKC B;  2XWB B;  1V1P B;  3AYH B;  4L5S A;  1E0B A;  4LUZ A;  2UXB L;  4JV5 L;  1HNW Q;  4DGZ A;  3FPU B;  1X54 A;  3HZX A;  5JJL A;  3JC6 6;  4R4C A;  3K7U C;  2WB1 E;  2A8V A;  1BKB A;  1TQO A;  4B3R Q;  2H1E A;  1S4Z A;  1WTH A;  4QIW B;  2CWA A;  2F0E A;  4I7Z C;  3TDQ A;  4YY3 L;  2AMC B;  1TWA H;  5IWA L;  3HOW H;  4OL7 A;  3TN2 A;  1YNN D;  2DNE A;  3QJY A;  3H0G G;  4X3K A;  4L5T A;  5CV9 A;  2HUG A;  4CHT B;  4TRD A;  1OXV A;  4B3T Q;  2YTV A;  4HIM A;  4X66 L;  4POF A;  1Q7Y C;  2JJQ A;  2IY5 B;  1A2T A;  2OT2 A;  4IFD H;  3I3C A;  5M3F G;  3PF4 A;  5GAG C;  2FMC A;  1LTL A;  2HDL A;  4C3I B;  2VQE Q;  1NJI C;  2F03 A;  2RSO A;  2JA8 B;  1G2T A;  2NZO A;  2KCM A;  4CKC A;  4FXG C;  4LMQ D;  4GKK L;  4HSV A;  4DUY Q;  3BDL A;  1X6O A;  5FKA C;  1B9M A;  3RMH A;  3JAM i;  1K0R A;  3T51 B;  4KN4 C;  3ONA B;  1BCP D;  3H15 A;  1C0A A;  1DON A;  2Z0S A;  2WIN B;  1KAB A;  4KHV A;  3JAM L;  4ZUJ A;  2K50 A;  3FMC A;  3I4M G;  3VR6 A;  4XDX A;  1HZC A;  3E3X A;  5DM6 3;  1EY0 A;  1D1I A;  4HCE A;  4A3I G;  4QUF A;  1XTD A;  2EQS A;  2PCF B;  4RGO S;  1Z47 A;  3DWA A;  5IE8 A;  1C4Q A;  5ELC A;  4YHH Q;  2KHJ A;  1G29 1;  2F0V A;  3I2Z A;  1HRJ A;  4PMW A;  1M8A A;  4GN3 B;  4LNQ A;  1B7Y B;  2JA9 A;  1RDP D;  3DEO A;  4JYA Q;  3S1Q B;  4LUO A;  5D3D A;  5JEA G;  2JK8 A;  4LFA Q;  4OHJ A;  5CYU A;  1G91 A;  1FGB D;  2G9H D;  5C3X A;  3ULJ A;  3NUC A;  1STN A;  3CAM A;  2OTJ A;  2F0P A;  1N8R C;  4FXK C;  4Q5V A;  2UU9 L;  2XTI A;  2I0Q A;  5FK9 C;  1RD9 D;  4L6T B;  5I9O A;  1MSG A;  1Y8O B;  3LWU A;  2YTX A;  3TP6 A;  1YBY A;  1PH2 A;  2ZM6 Q;  5IYC H;  4C3I H;  4X64 L;  2JP1 A;  4C56 C;  4MNO A;  1ASZ A;  1TS4 A;  4KLK A;  2JA8 H;  3F8T A;  2WII B;  4H02 A;  4JI3 Q;  3KF6 A;  4DV1 Q;  2AWN A;  1E3P A;  4EX5 A;  1OXU A;  1TY0 A;  2F3V A;  3IL8 A;  2UUA L;  1STB A;  4DNI A;  4BA2 I;  4P72 A;  2NB0 A;  1E2V A;  2CHB D;  3CW2 C;  1R9T B;  3CCQ A;  2OF1 A;  3H91 A;  1FJG Q;  4ME5 A;  1VQ8 A;  1XNQ L;  3DMU A;  2LXJ A;  4YWK A;  2QGQ A;  1S72 A;  3H3V C;  5AFW A;  2A6H D;  2WKD A;  1XPU A;  3I72 A;  3VR5 A;  4A3F B;  1KDA A;  5IT9 E;  2WAQ E;  1ENA A;  4FXD A;  4ODG A;  3SK8 A;  2HT1 A;  4ZLT F;  2DJF C;  2R7Z B;  1HNW L;  4H44 C;  1PRT C;  1SRU A;  1SYD A;  4FO2 A;  1ZYR C;  1K8G A;  3I4O A;  2OWO A;  1S3O A;  1LAB A;  1EY4 A;  1PFS A;  5EAY A;  3S1Q H;  4A3J B;  3HRZ C;  3A5Z B;  1SE2 A;  4QCL A;  2KUM A;  4JI0 Q;  4B3R L;  1EWC A;  3G71 A;  1XNR Q;  2Z6B A;  2UUC Q;  2CFM A;  4AH6 A;  2HD3 A;  1EUJ A;  4XYQ A;  1Y8P B;  2JA5 G;  1SNC A;  2WFW A;  4A3D B;  3S16 B;  5HUR A;  5J22 A;  5ELD A;  1FL0 A;  1F9S A;  1YZ6 A;  4B3T L;  1J6Q A;  2NWG A;  1YIT A;  2JSO A;  1Y1W G;  5KND A;  4EQO A;  4IPH A;  4GLA C;  3S24 A;  3T56 B;  1QUQ A;  2VQE L;  5IGD A;  1Z7T A;  2DY7 A;  4AQY Q;  1O7Y A;  3R8B A;  1H9M A;  2KBN A;  2I5L X;  4DUY L;  4AYB B;  1ML0 D;  3PUX A;  1H9K A;  3GO5 A;  1EFW A;  2K5D A;  5E3F A;  1DXM A;  1WVL A;  1R9T H;  2UXC Q;  3QOL A;  4O2D A;  3Q24 A;  2MGS A;  1IBL Q;  4F88 A;  4RHR A;  2VZA A;  5C4X G;  2EY2 A;  1HQR D;  2K5H A;  1QVG A;  1I4G A;  2L0C A;  1B44 D;  1BDO A;  3H09 A;  3NEL A;  1E2Z A;  4CDC C;  2Z8L A;  1JIC A;  2XWJ B;  4A3F H;  1HUM A;  4J1M A;  3J7A V;  4WJ3 M;  2EY5 A;  2R7Z H;  4JI4 Q;  1Y69 U;  2CQA A;  2NYZ D;  3GTG B;  4MTK A;  4YHH L;  3AMU A;  2B29 A;  1WJJ A;  1JE4 A;  2CH4 A;  5A2Q E;  3ERS X;  4GN4 B;  3IFT A;  4JYA L;  4EVO A;  3NTI A;  4DV7 Q;  1CQF A;  2PQA A;  2F0F A;  1D8L A;  1CSP A;  2GVB A;  4LFA L;  2NN6 I;  4P2C B;  1WD1 A;  2AWO A;  4IUV A;  4L63 B;  4ZAI A;  2KHS A;  3WDN A;  5JEA J;  3E0J A;  1HTL D;  4A3D H;  2IWH A;  3S16 H;  3A8I E;  1VQ4 A;  3QG1 A;  4FF4 A;  3PO3 B;  4O1N A;  4CJ1 B;  4OWW B;  4OIK A;  4DA2 A;  1GHK A;  5EGT A;  3KFU A;  3SR1 A;  3A7L A;  3MXN A;  1GD7 A;  5DLQ E;  4NKL A;  2ZM6 L;  1VCI A;  2JA7 G;  2F0N A;  4A3G B;  1B50 A;  2RCN A;  4LAA A;  4JI3 L;  4CBV A;  1RTN A;  2ICI A;  3HKZ G;  1NMF A;  4HAE A;  4DV1 L;  1EQR A;  3E9I A;  3J81 c;  2OXP A;  1YNJ D;  3C1F A;  4QUC A;  2XGT A;  3E0E A;  3U4V A;  1IW7 D;  2HDM A;  4DV3 Q;  3VR3 A;  3ND9 A;  1GUO A;  2EYJ A;  2VXW A;  2RA4 A;  4FDB A;  1FJG L;  2RQX A;  1KAA A;  1PH9 A;  1QVC A;  1B4O A;  1UUP A;  2BDO A;  4JBK A;  4PV1 C;  5FO7 B;  3J81 E;  3M9B A;  1Q46 A;  3PGZ A;  4HSP A;  1TVX A;  3L3O C;  3SGI A;  3GTG H;  4ZKB B;  1ICF B;  4R4I A;  2Y0S B;  1UWV A;  2IT1 A;  1HR0 Q;  5I9P A;  3WOE A;  2PQE A;  4TSS A;  4YCW A;  3PSI A;  4CDD C;  1WTQ A;  1G2S A;  2NN6 H;  4MHE A;  4ZK9 B;  1YI2 A;  4JI0 L;  1NUC A;  3FDT A;  1XNR L;  2UUC L;  1IKM A;  1W2B A;  2K5V A;  2WB1 B;  4JOI C;  1PH5 A;  1B3A A;  3A7A B;  3PO3 H;  4Y52 H;  4X3T A;  3R2I A;  4DR6 Q;  5IYD H;  2E8G A;  2F0O A;  2I46 A;  3CKI B;  1TWC B;  5C5L A;  4EQP A;  4A3G H;  3NEN A;  3I4N G;  2NVT B;  1STY A;  1VQC A;  4CGY B;  1CKN A;  2FXQ A;  4LF9 Q;  4AQY L;  3X3M A;  3HGB A;  5EKK A;  4IPG A;  3J80 i;  5IYB G;  2GA4 B;  4NP5 A;  1WTO A;  3R93 A;  1I6V C;  2Q2H A;  2D0O A;  4IUR A;  1PYW D;  4HJA A;  3J80 L;  3KBG A;  2UXC L;  1LTG D;  1IBL L;  3LNN A;  3NBH A;  5K36 H;  5NUC A;  4NW2 A;  1WCM B;  1SFO B;  2A69 C;  4K2K A;  4RG1 A;  5CV6 A;  2RDF A;  2HCC A;  1WI5 A;  1I4Q A;  2KVM A;  1UE6 A;  3K6O A;  1VQI A;  2NZ1 D;  3GTK B;  1CKM A;  1ONL A;  2N78 A;  1MKH A;  1CZW A;  4JI4 L;  1IL2 A;  1VF5 C;  1LUZ A;  4UAI A;  4XYO A;  2QDL A;  1S5E D;  3NWS A;  1EY9 A;  3CCS A;  5FLX L;  2MFI A;  1ROD A;  4A3C G;  2TSS A;  1QOH A;  2RKS A;  2Z9H A;  4MTN A;  3HOU G;  1MI2 A;  4DV7 L;  4B3S Q;  1QVF A;  3P1H A;  4NXM Q;  4JBM A;  1E2W A;  1K83 B;  4CKB A;  1OXT A;  3A54 A;  4DK0 A;  4YCV A;  4B9X A;  1ZKO A;  3K58 A;  1ESF A;  2KEE A;  1SE8 A;  2L15 A;  5K5P A;  1I4R A;  3TZD A;  4QY7 A;  3P20 A;  1OXX K;  3T4A C;  3HOZ G;  1TWC H;  3DM1 A;  1PH1 A;  3NQT A;  5FLM H;  1EIY B;  3VYR A;  4QB4 A;  3D4W A;  4EGV A;  2BE5 C;  2NVT H;  2K1B A;  4JI6 Q;  3PUZ A;  2LXK A;  3BYY B;  4TQU S;  1SNO A;  5EKI A;  3RNU A;  3VYS A;  4IZ8 A;  5CGK A;  4P74 A;  4HID A;  4WJ4 A;  3M4P A;  3STB C;  4DV3 L;  3FKI B;  3QR8 A;  1WCM H;  3FVQ A;  1SFO H;  5JJK A;  1TS5 A;  2DGY A;  3ITP A;  1PDQ A;  4A3E G;  2F0D A;  4KY6 A;  1X32 A;  2F0U A;  4RAU C;  5CC4 A;  3L9A X;  5E4X A;  3V05 A;  3SHL A;  3GTK H;  3KF8 A;  1PTO D;  3PF5 A;  3TRZ A;  4BXX H;  2H5X A;  3J7A 5;  2EVB A;  2MO1 A;  4C3J B;  1GOZ A;  1F2Z A;  4LF6 Q;  3KUP A;  1JWU D;  5JVG 3;  1HR0 L;  1JE5 A;  5JAV A;  3NWT A;  4FP5 D;  4HIK A;  5IP7 H;  1YIJ A;  1RIP A;  2PW5 A;  2B39 A;  3Q8D A;  1PVO A;  1K83 H;  1SRO A;  1VQG A;  2B3G A;  3KBX A;  1G6P A;  4DAY B;  2FJ2 A;  1CA6 A;  3ICE A;  1H9R A;  2N3S A;  4CDF C;  4JOI A;  3TBI B;  2V4D A;  1VQF A;  3QO2 A;  4DR6 L;  3OW7 A;  1KLU D;  2E2D C;  1RL2 A;  1SSO A;  2XIW A;  2YV5 A;  1EEI D;  5FO8 B;  4OO1 H;  4X6A H;  3HKZ E;  2BDN A;  2A73 B;  3EBE A;  1WD0 A;  3U58 A;  1JJC B;  1FGU A;  1RKN A;  4A3M B;  4LF9 L;  2I5H A;  1K28 A;  1A15 A;  2B2V C;  2XRS D;  1CQV A;  2K32 A;  1CT1 D;  1A8V A;  1EIH A;  1AZQ A;  2Q8I B;  1Y1V B;  3FKI H;  1F2Y A;  5COR A;  1SNM A;  4X3S A;  1E7Z A;  2QIL A;  3S1R B;  4QMG A;  2IX0 A;  5IP9 H;  1PMR A;  3T13 A;  2VW9 A;  2R93 G;  2X6L A;  4GOP B;  5C44 B;  2K52 A;  3OWF A;  3VR2 A;  4C3J H;  1IBM Q;  2EJG C;  2XN9 C;  2QEJ C;  3ER0 A;  2HQE A;  5LMU Q;  2BA0 A;  1FVI A;  2ZTC A;  1KD1 C;  3OMC A;  4KKU A;  1LM0 A;  1MIU A;  3HFZ B;  4X62 Q;  3HOX G;  1PA6 A;  4IFD I;  1V9P A;  4K5X A;  1XWE A;  2O5I C;  2N49 A;  1IYU A;  4B3S L;  5DNF A;  3M4Q A;  1NE3 A;  4OGQ C;  1OO9 B;  5AJ3 Q;  4NXM L;  3V2T A;  1RHP A;  1MHW C;  2SNS A;  2NVQ B;  1BR9 A;  3U4Z A;  4IJH A;  1JR0 D;  2QF7 A;  2JE6 I;  2EJF C;  1A3U A;  3MZ5 A;  5DM7 3;  3GTM B;  2JN4 A;  2QA4 A;  2MHV A;  3GTP B;  1IYV A;  1Q8I A;  1A6X A;  4OWX B;  3CPF A;  1E22 A;  5T1I A;  1CUK A;  3KLS A;  4BY7 G;  3EFX D;  2DNC A;  3TP5 A;  1SNP A;  3UI2 A;  3FPP A;  4CJ0 B;  2KHI A;  3SDZ A;  1L1O B;  4QGU A;  4JI6 L;  2VB3 X;  4A3M H;  5M3F B;  3ULL A;  1L2F A;  1A0I A;  3D6C A;  3GTJ B;  1K8O A;  1XPO A;  1X65 A;  3KJO A;  1TII D;  5IOD A;  4N8X 1;  1Y1V H;  5L37 A;  2EY6 A;  5IIF A;  4DR3 Q;  3HOW G;  3HOV B;  4DR2 Q;  3S1R H;  1SND A;  4DUZ Q;  5G3L D;  1AW7 A;  3C1E A;  3I56 A;  2RSN A;  5I2Y A;  4HED A;  3JAM c;  3OMG A;  4PNY A;  5I4D A;  2EYP A;  5C44 H;  4HJ5 A;  1SN8 A;  3I4M B;  1K9M C;  3VYT A;  3EA6 A;  1EQV A;  4LF4 L;  3TME A;  4UY8 C;  4A3I B;  4C2M B;  4LF6 L;  4R8N A;  5IOC A;  1IL8 A;  5KRU A;  2F0T A;  2F0J A;  1TKW B;  1J5E Q;  3AU7 A;  3I4L A;  1WTW A;  1SMX A;  4DU9 A;  1U4R A;  1AFP A;  1II3 A;  3JAM E;  4NDX A;  2CW0 C;  4H13 C;  1TS2 A;  1NY4 A;  1Y8N B;  1N36 Q;  2EDG A;  4KN7 C;  1PRT F;  4KHP Q;  3T16 A;  2F0Q A;  2NVQ H;  1SYC A;  4GNX B;  2B2W C;  1VQH A;  3GTM H;  4A4I A;  1MJE A;  3GTP H;  3A74 A;  1ILQ A;  1EYD A;  2C35 B;  1PZK D;  4QJF A;  4FF2 A;  3K5O A;  1FNV A;  1YHQ A;  1JOQ A;  1QNK A;  1Y14 B;  3KDF B;  5M3F H;  1VQ5 A;  2B63 G;  1BUV T;  3GTJ H;  3C46 A;  1WYD A;  3DHQ A;  3PO2 G;  4X3U A;  1OXS C;  2B2V A;  3HOV H;  2RCF A;  3BG3 A;  1EQQ A;  1C48 A;  3S2D B;  4ALP A;  3EVQ A;  1VQE A;  1DCZ A;  3MWY W;  5FJ8 H;  4JW0 A;  2F52 A;  3F2C A;  1D7Q A;  3KLW A;  2PMZ E;  3G48 A;  4B08 A;  2Q2U A;  4M1U B;  1ZEQ X;  2Z4I A;  4L8J A;  4C3I G;  5IYC G;  4K2L A;  3I4M H;  2EXZ A;  4J6H A;  4G4K A;  2JA8 G;  1SEB D;  4K5V A;  3IFD A;  5T1G A;  1LO5 D;  1YNN C;  1B8A A;  1GUT A;  4C2M H;  4DNT B;  1F77 A;  5LMU L;  1SJE D;  1AEX A;  1XJV A;  2K01 A;  1VQO A;  2WP8 J;  3HEJ A;  1EWI A;  3W1G A;  4X62 L;  5C3E B;  4DV4 Q;  1PFB A;  3ERO A;  4R4T A;  4HMJ A;  1T9H A;  4AIM A;  5JEA H;  5AJ3 L;  4BWG B;  1H9S B;  3ZJY C;  3CXC A;  1KNE A;  2KCT A;  4OIJ A;  2D0P A;  5EBC A;  1GUW A;  1UEB A;  2GN5 A;  3S1N B;  3L7Z C;  5JVH 3;  4LFC Q;  4RFB A;  1ENF A;  2J7Z A;  3I8Z A;  1BCP C;  1SAP A;  4O42 A;  4RCN A;  3CF5 A;  3BDO A;  3CC4 A;  1VQP A;  4LF8 Q;  4PQX A;  5C4J B;  1EU3 A;  1QIL A;  5J39 A;  1X55 A;  1H9J A;  1PFM A;  3HOY B;  2R92 B;  4DFA A;  5HY6 A;  3SK5 A;  4JI1 Q;  3S2D H;  4IUN A;  1XX8 A;  2KEC A;  4DR3 L;  1I4P A;  4DR2 L;  4DUZ L;  1SYG A;  3CD6 A;  2Z4H A;  3RZO B;  3I7F A;  4HN7 A;  1SMY D;  3W5O A;  1AZP A;  2E5L Q;  2L5T A;  4MIU A;  4LF7 Q;  2IL8 A;  1CTM A;  5LMN W;  3MEH A;  4L5R C;  3CRK C;  2IHE A;  4F7X A;  3E6Z X;  1JMC A;  5IT9 L;  1D5Z C;  5F2D A;  2ZTD A;  1XPR A;  4KJN A;  5C3E H;  4CKE A;  1O7L A;  1J5E L;  1NR4 A;  3KYH C;  1VQ6 A;  1HA6 A;  2R3Z A;  2F0H A;  1N36 L;  3BU2 A;  4KHP L;  2I5M X;  1BOS A;  3K0Y A;  3S1N H;  1F2L A;  2Z1C A;  2ICE C;  5EPJ A;  2B2W A;  2PW7 A;  1EEF D;  2F3W A;  2FFK B;  1KRT A;  1L0W A;  2F0I A;  4ZRZ A;  1VF7 A;  4XQQ A;  5GAD C;  1LAC A;  2VNU D;  3H94 A;  2P5Z X;  1BQQ T;  1JB3 A;  5C4J H;  4XXE A;  1JOO A;  1SNQ A;  3K0X A;  5J1Z A;  2OEO A;  3R2T A;  3GV6 A;  1ENC A;  3CC7 A;  1BF4 A;  4IUP A;  3HOY H;  3TZU A;  2R92 H;  2BCO A;  2JA7 B;  3Q0A A;  2ZJQ A;  4A3B G;  4DAV A;  2JEB I;  4CDE C;  4K14 A;  4A3K G;  4A3J H;  3O13 A;  2X69 A;  4B3M Q;  4DAP A;  1STA A;  1VMP A;  1DYQ A;  4IPD A;  3UDF A;  3RZO H;  3K5L A;  3OTO Q;  4IOA A;  3CCE A;  1MSH A;  1MJC A;  4DR5 Q;  2KCC A;  2IW3 A;  1I5F A;  2NTS A;  3DWP A;  4Y7N B;  3OW2 A;  3MHB A;  2ZJP A;  1EYC A;  2JQO A;  1PTO B;  1V8Q A;  4S3S A;  2ZXP A;  1KQS A;  5LL6 S;  2VS1 A;  4I65 A;  4IUU A;  1C7Y A;  4GLV B;  2K5N A;  2F0W A;  5I6Y A;  4FYD A;  2K5W A;  5JOB A;  3A5U A;  4DV5 Q;  3NQI A;  4DV4 L;  1N33 Q;  4HJ8 A;  5DAU A;  3TS2 A;  5A2Q L;  3Q23 A;  3AFQ A;  1VQB A;  1KDC A;  2I07 B;  1VMC A;  3QB3 A;  4RWS C;  4DR4 Q;  3SVM A;  4KHZ A;  1KIX A;  2KOL A;  1D1K A;  3G4S A;  1SJH D;  5GAE C;  4LFC L;  1A3V A;  3TS0 A;  2EPB A;  3LWE A;  1NR2 A;  1KNA A;  1DD2 A;  1W6J A;  2B2U C;  3DEP A;  5IGC A;  1JOR A;  2N8N A;  1EZ6 A;  4LF5 Q;  1SYF A;  4EQ5 A;  2VUM B;  4LF8 L;  3MXU A;  4DKA C;  4O0A A;  2RF4 A;  4GLX A;  4TVA B;  1CHQ D;  4IQZ A;  3S14 B;  4QIW E;  2NN6 G;  4YWM A;  2JA7 H;  1JB7 A;  1EIG A;  4DV2 Q;  3I4N B;  2VB2 X;  4BBS G;  1I3Q B;  3PMF A;  4X65 Q;  4EQN A;  2YU9 B;  4JI1 L;  3X3N A;  4ABN A;  1HH2 P;  3PO3 G;  2A68 D;  1C9O A;  1GO3 E;  3C2P A;  4KV6 A;  1G51 A;  1EWH A;  2BH8 A;  2PYK A;  2K5Q A;  3J80 c;  1KHI A;  1PHJ A;  4BBR G;  4Y7N H;  1IXR A;  3T1Y Q;  3ERQ A;  1GUS A;  2E5L L;  4KK7 A;  1PTO H;  3AFP A;  1AP0 A;  4LF7 L;  3NXW A;  4GNX C;  4A3G G;  2QDB A;  1XXG A;  1JJG A;  3K8A A;  4RCO A;  2K4K A;  4HR7 B;  4BY1 G;  2QW7 A;  3MFG A;  5C0X I;  2D62 A;  2JXM B;  3EIV A;  4PG3 A;  2E75 C;  2PO4 A;  4NMZ A;  3J80 E;  4JI7 Q;  2K75 A;  5D3I B;  1VQJ A;  1YJ9 A;  2NBF A;  2PPB C;  3U9S A;  1O80 A;  4OX9 Q;  4E6I A;  5K36 G;  3SXH A;  1B53 A;  3Q6S A;  1D5M C;  2AHO B;  1LTS D;  2WAC A;  5EJW A;  5M3M G;  2K28 A;  1FNW A;  1YNJ C;  1S5C D;  5HGT A;  5M5Y B;  2EYL A;  3EN2 A;  3KOJ A;  1JQY D;  4FF3 A;  5BN3 A;  2FIN B;  5EPL A;  2VUM H;  4JI5 Q;  1PV4 A;  3LX0 A;  1EY8 A;  3STB D;  1LT4 D;  2IHF A;  3S14 H;  3K57 A;  4R4O A;  3BVG A;  3T53 B;  4ULL A;  5IGB A;  4MZ9 A;  3I4N H;  1M4V A;  1GUG A;  1UE5 A;  3W2D A;  1QJO A;  1I3Q H;  1TXY A;  2UUB Q;  2X6G A;  3F1Z A;  2YU9 H;  4YIJ A;  4POG A;  1B1Z A;  3HKS A;  1EIF A;  1HZ9 A;  4B3M L;  3J7A F;  3K59 A;  3UE1 A;  4YCU A;  3OTO L;  3D3R A;  3M4O B;  1DOK A;  3AEV A;  4IN3 A;  4DR5 L;  1LTB D;  2ATW A;  1Q1E A;  2Z6K C;  1DOM A;  2UXD Q;  1T5X D;  2VL6 A;  3G6J B;  2PQA B;  1K8A C;  1CK1 A;  2L9H A;  5C0X H;  2OQ0 A;  1X9N A;  3L2P A;  1KDB A;  2CWP A;  2LSS A;  3BYT B;  5C5M A;  4DV5 L;  3MXG A;  1LTT D;  4OO1 I;  4A3C H;  1N33 L;  1WCM G;  1S5B D;  1A2U A;  1SXT A;  1V1P A;  2ID0 A;  3RN5 A;  3MXN B;  2PNR C;  2ZXR A;  5M5Y H;  3J7Z C;  4DR4 L;  2E76 C;  2K05 A;  3MVV A;  4PMB A;  1BVS A;  1QE6 A;  2PI2 A;  4DK3 C;  3F2D A;  3MFY A;  1EZ8 A;  4BXX G;  4RGM A;  1V43 A;  1UNS A;  3K5M A;  2B2U A;  4LF5 L;  5CV8 A;  3SEB A;  1VQA A;  1TWG B;  3MAQ A;  3BS1 A;  3SE0 A;  1DM0 B;  1O7Z A;  4XT3 B;  5JJI A;  4DV2 L;  1QWY A;  2EJM A;  1WTX A;  3PIO 3;  2FMM A;  4QF4 A;  4IOC A;  2IPK D;  4X65 L;  2WAQ B;  4A3L G;  3UDI A;  4KMU C;  1ZXT A;  1VQD A;  2JA6 G;  2A74 C;  3OOC A;  3M4O H;  3ND8 A;  2N88 A;  4DNR B;  1STG A;  3HP3 A;  4Z9C B;  3VA7 A;  1J9O A;  4UHV A;  5H1S E;  2YYZ A;  4JBW A;  1PRT B;  3T1Y L;  1NSN S;  1Q12 A;  1FNU A;  3H6M A;  1X3Q A;  4A93 B;  4GNX A;  1T5E A;  2R93 B;  2F4V Q;  4AYB E;  4LJZ C;  3A56 A;  1HFN A;  2F0G A;  2HIX A;  4HJ9 A;  2EZV A;  3NEM A;  1AH9 A;  4KD3 A;  4JI7 L;  1XMO Q;  1LLR D;  4LK1 C;  4DV0 Q;  4K8J A;  1EQT A;  3SK4 A;  2J0T D;  1RF2 D;  3IAY A;  3CMA A;  5IP9 G;  3GP7 A;  3HOX B;  1LT5 D;  4C3H G;  3I55 A;  4OX9 L;  4U67 3;  5M9O A;  3OWE B;  3A8J E;  3DUZ A;  2RHQ B;  5LHY 1;  3EJI A;  4K0K Q;  2A19 A;  1CKN B;  1BO0 A;  3DLL A;  4C3J G;  1JC7 A;  3RUZ A;  5CV4 A;  4JI5 L;  4F87 A;  2KA7 A;  2A6E C;  4DN4 M;  1TWG H;  4BY7 B;  3NBH B;  2BH2 A;  2OTL A;  1S5D D;  1PTO C;  4J15 A;  1P8L A;  5KIX A;  2UUB L;  4RA8 A;  3URY A;  1VQ7 A;  4IJL A;  3D8G A;  1EY5 A;  1L0X B;  2HHH Q;  4PMC A;  1YVC A;  1X3P A;  1I6H B;  3E5S A;  1X3E A;  1UE7 A;  2EYH A;  1Q86 C;  1LTI D;  3ZYY X;  2RVL A;  3A55 A;  1R4Q B;  5GQO A;  1U0L A;  2EE1 A;  2B2Y C;  1QB5 D;  2ZJR A;  2Z6K A;  4A93 H;  2SOB A;  2UXD L;  1PZI D;  2R93 H;  2K7V A;  2O2L D;  4XIG S;  4A3M G;  4NXN Q;  2MO0 A;  5J3B A;  1VQN A;  1HA5 A;  1EY6 A;  3FP9 A;  1PLF A;  2RDG A;  1BXT A;  1TY2 A;  4K8I A;  1X3F A;  4ZQ3 A;  4JI8 Q;  4APV A;  3H0G B;  3IRB A;  1D2B A;  4DR1 Q;  4H0L C;  1PYS B;  1YHB A;  2KQ3 A;  3M85 A;  1CSQ A;  3HOX H;  1CZG A;  1VS0 A;  2PZW A;  5DEH A;  3L0O A;  3B6Y A;  2XNA C;  5IGF A;  4XQN A;  1M1K C;  3CPW A;  1TWH B;  2HCI A;  1Z6H A;  3BZD B;  1PZJ D;  4RH6 A;  1EOT A;  2Y0S E;  1F9P A;  4A76 A;  1E24 A;  4V0B A;  2NVY B;  3PUY A;  3M3Y B;  5I2X A;  1ET6 A;  3M7N A;  3MA2 B;  1PYB A;  5D65 A;  2QKI C;  1KXL A;  4G7O C;  3RD4 A;  4IFD G;  4BY7 H;  2R7F A;  4JC0 A;  1BCP F;  3CCM A;  3E9H A;  1S40 A;  1GHJ A;  4DK1 A;  3CCU A;  1HZA A;  2B63 B;  4OWT B;  3VDY A;  4RKB A;  1JT8 A;  3GD7 A;  3KF8 B;  3PO2 B;  2AUJ D;  2Q8R E;  3K81 C;  4DV6 Q;  1I6H H;  1HXY D;  1EYA A;  4WRD A;  3UDG A;  4GZY C;  2J4X A;  4N8F A;  1AE2 A;  2FHT A;  2OCE A;  3BDC A;  5COY A;  5CR3 A;  1G8Z D;  1JCK B;  4P75 A;  2XSC A;  2F4V L;  1NMG A;  3VR4 A;  2ZXO A;  3H0G H;  2RBM A;  2D5D A;  4G7H C;  1Q8K A;  3TEH B;  3HOV G;  3P7J A;  2MPM A;  1XMO L;  1XMQ Q;  5IGE A;  2DJG C;  2CVR A;  4R8I A;  4DV0 L;  3BZC A;  5FJ8 G;  4V19 0;  4NPS A;  1TWF B;  1A3T A;  4BS9 A;  2L55 A;  1TWH H;  3KK7 A;  1NBW A;  3CC2 A;  1VDZ A;  1Q90 A;  4K0K L;  2F0M A;  3M3Y H;  2NVY H;  1HNX Q;  1STH A;  1IBK Q; 
#chains in the Genus database with same CATH homology
 2ZJQ A;  1WI5 A;  4A3B G;  2JEB I;  4PZ7 A;  1UE6 A;  4A3K G;  4A3J H;  4YWL A;  1VQI A;  4B3M Q;  3CCV A;  1CKM A;  4C3H H;  2N78 A;  3H3V H;  3F2B A;  1MKH A;  4IPD A;  4JI4 L;  3RLN A;  3UDF A;  3RZO H;  1IL2 A;  3ULP A;  1KRS A;  3OTO Q;  4A93 G;  4IOA A;  1LUZ A;  3CCE A;  4A3I H;  2IX1 A;  4DR5 Q;  1MJC A;  2NZH A;  1V1Q A;  3MEF A;  2ALY B;  5GRO A;  2UU9 Q;  2BA1 A;  3CCS A;  2B63 H;  1I5F A;  2MFI A;  1VQK A;  1EOV A;  4A3C G;  1PH4 A;  3OW2 A;  4MTN A;  3HOU G;  2ZJP A;  2JQO A;  3PO2 H;  4DV7 L;  3PUV A;  4B3S Q;  1QVF A;  1PH8 A;  2HHH L;  5C0X J;  4JBM A;  4RMF A;  4NXM Q;  1KQS A;  1OXT A;  5ELO A;  4X64 Q;  2CKZ B;  2VS1 A;  4P73 A;  1QZH A;  1EYG A;  1BBW A;  3K80 C;  4YCV A;  1C7Y A;  4IO9 A;  4GLV B;  2K5N A;  4DR7 Q;  1SE8 A;  2L15 A;  1A62 A;  4PZ6 A;  3A5U A;  4OON A;  4DV5 Q;  1Z9F A;  2A1A A;  4HJ7 A;  4QY7 A;  1Y1V G;  1OXX K;  4DV4 L;  1N33 Q;  3HOZ G;  1TWC H;  1PH1 A;  2PNH A;  2UUA Q;  5FLM H;  1EIY B;  5HGQ A;  4HJ8 A;  3S1M H;  4NXN L;  3TS2 A;  2GVA A;  1HJP A;  3AFQ A;  1PVO A;  1VQB A;  1M90 C;  4BA1 I;  1NTG A;  4JI8 L;  2NVT H;  4DR4 Q;  4KHZ A;  4JI6 Q;  1I94 L;  1KIX A;  1HNZ Q;  4DR1 L;  1XNQ Q;  3G4S A;  5GAE C;  1DGS A;  3PUZ A;  2LXK A;  4LFC L;  4P71 A;  4TQU S;  4OXP A;  5IT9 c;  3PIP A;  3TS0 A;  5C44 G;  1BBU A;  1SR3 A;  3RNU A;  1IZ6 A;  1H95 A;  1TWF H;  2N8N A;  1KAW A;  4P74 A;  4HID A;  4WJ4 A;  3M4P A;  4LF5 Q;  4EQ5 A;  3STB C;  4LF8 L;  4L5S A;  3AYH B;  4DKA C;  4O0A A;  2RF4 A;  4GLX A;  4DV3 L;  4TVA B;  4LUZ A;  2UXB L;  1PH3 A;  1WCM H;  1SFO H;  5JJK A;  4JV5 L;  1HNW Q;  2ES2 A;  4QIW E;  2NN6 G;  4YWM A;  2JA7 H;  1X54 A;  2DGY A;  3OYY A;  3T1H Q;  4L5Q A;  5GAH C;  4A3E G;  5JJL A;  1JB7 A;  1X3G A;  3JC6 6;  4DV2 Q;  4R4C A;  4BBS G;  4GKJ Q;  3K7U C;  2WB1 E;  4X65 Q;  2A8V A;  3GTK H;  1BKB A;  4JI1 L;  4DPG A;  3PF5 A;  4B3R Q;  1HZB A;  3TRZ A;  1HH2 P;  3PO3 G;  5C3E G;  1C9O A;  2H5X A;  1GO3 E;  3J7A 5;  4BXX H;  2MO1 A;  1G51 A;  2CWA A;  1YJN A;  4YY3 L;  2BH8 A;  4LF6 Q;  3J80 c;  1JJ2 A;  1CKO A;  2AMC B;  1KHI A;  3RN2 A;  1HR0 L;  1TWA H;  5IWA L;  3HOW H;  1PHJ A;  5M5W H;  4IFD J;  4BBR G;  4Y7N H;  3CCR A;  1IXR A;  1JE5 A;  4NB3 A;  3T1Y Q;  2E5L L;  4HIK A;  5IP7 H;  3AFP A;  3H0G G;  1YIJ A;  4L5T A;  4LF7 L;  5ELN A;  4GNX C;  1RIP A;  4A3G G;  3Q8D A;  1IYJ B;  1OXV A;  2YTV A;  3CQZ H;  4HIM A;  4X66 L;  1K83 H;  1SRO A;  4POF A;  1Q7Y C;  4XTC S;  1VQG A;  2B3G A;  2JJQ A;  3K8A A;  2K4K A;  4DV6 L;  1JJG A;  2IY5 B;  1G6P A;  4BY1 G;  4DAY B;  2AKW B;  5M3F G;  3PF4 A;  5C0X I;  3A0J A;  2D62 A;  3ICE A;  3EIV A;  4PG3 A;  5GAG C;  1LTL A;  1B70 B;  2N3S A;  3CP0 A;  2VQE Q;  1NJI C;  4JOI A;  1N34 Q;  4JI7 Q;  1VQF A;  2F3I A;  2K75 A;  2NZO A;  4DR6 L;  2KCM A;  4R4Q A;  1VQJ A;  4A3F G;  1YJ9 A;  2JEA I;  4GKK L;  4DUY Q;  2JA5 H;  4OX9 Q;  5K36 G;  1ASY A;  3J81 j;  2R7Z G;  1X6O A;  2AHO B;  3HOY G;  3JAM i;  2R92 G;  1K0R A;  1RL2 A;  5M3M G;  3H15 A;  3CCJ A;  1C0A A;  2YV5 A;  1VQM A;  3HKZ E;  2Z0S A;  4X6A H;  3EBE A;  4A3J G;  3EN2 A;  1O7I A;  3U58 A;  1JJC B;  1FGU A;  4LF9 L;  2I5H A;  2K50 A;  3KOJ A;  1XMQ L;  1Y1W H;  2NVX H;  3I4M G;  1HZC A;  4GOP C;  1A8V A;  3WWV A;  2VUM H;  4GS3 A;  4JI5 Q;  4LFB Q;  4A3I G;  3PUW A;  1XTD A;  2EQS A;  3FKI H;  3LGJ A;  1PV4 A;  4B3T Q;  2R92 H;  1Z47 A;  3STB D;  1E7Z A;  2IHF A;  3S14 H;  4A3D G;  2IX0 A;  4R4O A;  5IE8 A;  5IP9 H;  1K73 C;  4YHH Q;  2KHJ A;  1G29 1;  3I2Z A;  4MZ9 A;  1HNX L;  3I4N H;  4PMW A;  1AE3 A;  1UE5 A;  1IBK L;  1IBM L;  2VW9 A;  3S17 H;  4GN3 B;  4LNQ A;  1I3Q H;  4DK6 C;  5C4X H;  1B7Y B;  1TXY A;  2JA9 A;  2UUB Q;  2YU9 H;  3F1Z A;  2R93 G;  2R6G A;  4JYA Q;  4LUO A;  4POG A;  3HKS A;  5JEA G;  1EIF A;  2JK8 A;  4LFA Q;  1HZ9 A;  5LMN Q;  4GOP B;  4B3M L;  4PZ8 A;  2K52 A;  4C3J H;  1YEZ A;  1IBM Q;  3ER0 A;  3UE1 A;  4LWC A;  4YCU A;  2BA0 A;  5LMU Q;  3ULJ A;  1FVI A;  2ZTC A;  4GN5 A;  3OTO L;  1KD1 C;  3CAM A;  3AEV A;  1U5K A;  4DR5 L;  1Q82 C;  2OTJ A;  1N8R C;  1HR0 W;  2UU9 L;  2ATW A;  2XTI A;  1LM0 A;  1MIU A;  3HFZ B;  4AYB G;  4X62 Q;  3KJP A;  3HOX G;  1PA6 A;  3BZK A;  2I0Q A;  4IFD I;  1V9P A;  1Q1E A;  2Z6K C;  2N49 A;  2UXD Q;  2VL6 A;  4A3B H;  4B3S L;  2PQA B;  1K8A C;  3M4Q A;  1NE3 A;  2YTX A;  4A3K H;  1KL9 A;  5AJ3 Q;  3W1B A;  4NXM L;  1YBY A;  2OQ0 A;  1PH2 A;  2ZM6 Q;  1X9N A;  1L1O C;  3DM3 A;  5IYC H;  4C3I H;  4X64 L;  3L2P A;  4MNO A;  1ASZ A;  2CWP A;  2LSS A;  4KLK A;  2JA8 H;  3U4Z A;  3F8T A;  4IJH A;  4H02 A;  4JI3 Q;  4DR7 L;  2JE6 I;  3KF6 A;  1WOC A;  4DV1 Q;  2QA4 A;  4DV5 L;  2AWN A;  1E3P A;  4EX5 A;  1OXU A;  2MQH A;  4OO1 I;  4UP9 A;  4A3C H;  3KF6 B;  1WCM G;  1N33 L;  4OWX B;  3CPF A;  1E22 A;  2UUA L;  1CUK A;  3TRE A;  4DNI A;  2ID0 A;  2PI2 E;  4P72 A;  3RN5 A;  4BA2 I;  1E1O A;  3MXN B;  4BY7 G;  2YTY A;  3CW2 C;  1SLJ A;  5M5Y H;  3J7Z C;  2KHI A;  3CCQ A;  1L1O B;  2EIF A;  4QGU A;  1FJG Q;  4DR4 L;  4JI6 L;  4A3M H;  1BVS A;  4ME3 A;  1HNZ L;  1VQ8 A;  1XNQ L;  3ULL A;  1L2F A;  1A0I A;  2PI2 A;  4DK3 C;  3F2D A;  3D0F A;  2LXJ A;  1XPO A;  1X65 A;  4BXX G;  4YWK A;  3KJO A;  2QGQ A;  1S72 A;  1V43 A;  1PH7 A;  1E1T A;  2E2J H;  1Y1V H;  1XPU A;  4LF5 L;  2OQK A;  4DR3 Q;  3HOW G;  2KEN A;  1VQA A;  2WAQ E;  4DR2 Q;  3S1R H;  4DUZ Q;  2HT1 A;  1GM5 A;  3RLF A;  1HNW L;  1SRU A;  3I56 A;  1K8G A;  5IYD G;  3I4O A;  3T1H L;  2OWO A;  5JJI A;  1S3O A;  2E2I H;  4DV2 L;  1PFS A;  5EAY A;  3JAM c;  3S1Q H;  4GKJ L;  3A5Z B;  4IOC A;  4X65 L;  5C44 H;  4HJ5 A;  1SN8 A;  4A3L G;  3UDI A;  2CCZ A;  4JI0 Q;  4B3R L;  3G71 A;  1K9M C;  3J81 i;  2UUC Q;  1XNR Q;  2CFM A;  1PH6 A;  1N32 Q;  1Q81 C;  4AH6 A;  1VQD A;  4LF4 L;  3U50 C;  2JA6 G;  4IPC A;  4UY8 C;  1EUJ A;  1OTC A;  3M4O H;  4LF6 L;  1I50 H;  5IY0 A;  3RR5 A;  2JA5 G;  5H1S E;  2WFW A;  1KC8 C;  2YYZ A;  1W3S A;  4JBW A;  1J5E Q;  3T1Y L;  1Q12 A;  1SMX A;  1FL0 A;  2VQF Q;  4BBS H;  4GNX A;  2Q2T A;  1YZ6 A;  1NY4 A;  4B3T L;  1J6Q A;  1N36 Q;  1GVP A;  1YIT A;  3GDE A;  4AYB E;  5FLX c;  2F4V Q;  4KHP Q;  1WFQ A;  2NVQ H;  1Y1W G;  4GNX B;  4UPA A;  3CCL A;  4IPH A;  3PIO A;  1VQH A;  2HIX A;  4GLA C;  4HJ9 A;  3NEM A;  3S24 A;  1QUQ A;  2VQE L;  2VUM G;  1AH9 A;  3GTM H;  5BR8 Q;  4AQY Q;  4A4I A;  1N34 L;  1MJE A;  1XMO Q;  1HNX Q;  3A74 A;  4JI7 L;  3GTP H;  2QEX A;  4BBR H;  3UE0 A;  1QUQ B;  2C35 B;  4DV0 Q;  2KBN A;  2I5L X;  3CMA A;  5IP9 G;  4DUY L;  3PUX A;  3I55 A;  4OX9 L;  3GO5 A;  1EFW A;  2Y0S G;  3GTL H;  4QJF A;  1R9T H;  2UXC Q;  4O2D A;  1K3R A;  1IBL Q;  1YHQ A;  5C4X G;  2VZA A;  1A63 A;  4JI2 Q;  1Y14 B;  3KDF B;  3G6E A;  2RHQ B;  4BY1 H;  5M3F H;  4K0K Q;  1VQ5 A;  2B63 G;  2K5H A;  2A19 A;  3GTJ H;  1QVG A;  1CKN B;  3PV0 A;  1WYD A;  3DLL A;  3AQQ A;  3PO2 G;  3NEL A;  4A75 A;  1VQ9 A;  1OXS C;  1UE1 A;  3HOV H;  4A3F H;  4JI5 L;  2HQL A;  4GOP A;  4LFB L;  1EQQ A;  4WJ3 M;  4UP7 A;  1TWG H;  2WB1 G;  4KI0 A;  5IYB H;  4ALP A;  1YJW A;  3S2H H;  2R7Z H;  4JI4 Q;  1VQE A;  2VY3 A;  5FJ8 H;  5M3M H;  3NBH B;  2BH2 A;  2DUD A;  2OTL A;  4YHH L;  2F52 A;  4J15 A;  1P8L A;  2K14 A;  3F2C A;  2B29 A;  1WJJ A;  5C0X G;  1D7Q A;  3KLW A;  2R7D A;  2PMZ E;  1YNX A;  3G48 A;  3BJU A;  2Q2U A;  3ERS X;  4GN4 B;  5IYC G;  5FLM G;  2UUB L;  4QL5 A;  4JYA L;  3I4M H;  4DV7 Q;  2PQA A;  4IJL A;  1VQ7 A;  1D8L A;  5LMN L;  1CSP A;  1LYL A;  2GVB A;  4LFA L;  2HHH Q;  2JA8 G;  3GTQ H;  2NN6 I;  1YVC A;  2AWO A;  1B8A A;  4C2M H;  1X56 A;  5LMU L;  1XJV A;  1VQO A;  1X3E A;  1UE7 A;  2WP8 J;  1Q86 C;  5JEA J;  1EWI A;  4A3D H;  3S16 H;  3W1G A;  1VQ4 A;  1N9W A;  4X62 L;  3FHW A;  5GQO A;  1U0L A;  2E2H H;  4OWW B;  1VQL A;  4A93 H;  4DV4 Q;  2ZJR A;  2Z6K A;  2UXD L;  3CME A;  3KFU A;  2R93 H;  4R4T A;  4XIG S;  4A3M G;  3D31 A;  4NXN Q;  2MO0 A;  1GD7 A;  1T9H A;  5DLQ E;  5J3B A;  4AIM A;  2ZTE A;  5AJ3 L;  1VQN A;  3FP9 A;  3ZJY C;  1VCI A;  4JI8 Q;  2KCT A;  2ZM6 L;  1X3F A;  2D0P A;  1L1O A;  3CXC A;  2JA7 G;  1UEB A;  4APV A;  2GN5 A;  4R1J A;  1I94 Q;  3IRB A;  3L7Z C;  4DR1 Q;  2RCN A;  4JI3 L;  2EXD A;  1PYS B;  1YHB A;  4LFC Q;  3HKZ G;  4JG2 A;  1NMF A;  4DV1 L;  1EQR A;  3E9I A;  3M85 A;  3J81 c;  1CSQ A;  3HOX H;  1VS0 A;  3L0O A;  3B6Y A;  3CF5 A;  4LF8 Q;  2XGT A;  5M5X H;  3E0E A;  1VQP A;  3U4V A;  3CC4 A;  2ASB A;  2V1C C;  4DV3 Q;  1M1K C;  4LUV A;  3CPW A;  2UXB Q;  3HOZ H;  3PCO B;  4JV5 Q;  4FDB A;  1FJG L;  1X55 A;  1PH9 A;  2Y0S E;  4A76 A;  1QVC A;  1E24 A;  5IP7 G;  3PUY A;  3M7N A;  4JBJ A;  1GKH A;  5HY6 A;  4JBK A;  1PYB A;  3K7A H;  4JI1 Q;  3S2D H;  1KXL A;  3M9B A;  1Q46 A;  4IFD G;  4DR3 L;  3PGZ A;  4DR2 L;  3SGI A;  4DUZ L;  4QQB X;  4BY7 H;  3GTG H;  3CD6 A;  2R7F A;  4YY3 Q;  3S15 H;  4R4I A;  3H3V I;  1UWV A;  4JC0 A;  3GTO H;  3CCM A;  2IT1 A;  3I7F A;  1HR0 Q;  3E9H A;  5IWA Q;  2HIV A;  1S40 A;  4YCW A;  2Q2I A;  3PSI A;  3W5O A;  2E5L Q;  3CCU A;  1HZA A;  4OWT B;  5E7N A;  3VDY A;  4LF7 Q;  4LF4 Q;  1YI2 A;  1JT8 A;  3GD7 A;  4A3E H;  3KF8 B;  4X66 Q;  4JI0 L;  4UP8 A;  5LMN W;  1XNR L;  3K81 C;  2UUC L;  4DV6 Q;  1I6H H;  1N32 L;  4OO1 G;  4L5R C;  2MNA A;  2IHE A;  1W2B A;  3UDG A;  3RZD H;  1JMC A;  3UDX A;  2K5V A;  1PH5 A;  4JOI C;  1AE2 A;  1XPR A;  4DAM A;  2ZTD A;  3PO3 H;  5C3E H;  4Y52 H;  2OCE A;  1J5E L;  5IYD H;  4DR6 Q;  3KYH C;  1VQ6 A;  2E8G A;  4GKK Q;  4P75 A;  2VQF L;  3FKI G;  4HIO A;  1P16 A;  1N36 L;  3BU2 A;  4A3L H;  2F4V L;  4KHP L;  1NMG A;  2I5M X;  3H0G H;  3S1N H;  2RHS B;  4A3G H;  3RLO A;  3KDF A;  1Q1B A;  1Q8K A;  3NEN A;  2JA6 H;  3I4N G;  1VQC A;  3TEH B;  3HOV G;  4LW1 A;  1YHA A;  1CKN A;  2FXQ A;  4LF9 Q;  5BR8 L;  4AQY L;  1QZG A;  1KRT A;  1XMO L;  1XMQ Q;  1L0W A;  4IPG A;  3J80 i;  5IYB G;  5GAD C;  2VNU D;  4DV0 L;  3BZC A;  4JCV E;  5FJ8 G;  4NPS A;  5C4J H;  2Q2H A;  2D0O A;  4HJA A;  3HOU H;  3K0X A;  1TWH H;  2UXC L;  3CC7 A;  1NBW A;  1IBL L;  3CC2 A;  2WAQ G;  4JI2 L;  4K0K L;  3HOY H;  3M3Y H;  2NVY H;  4RG1 A;  3TQY A;  2CQO A;  1IBK Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...