5C4JH

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
144
structure length
143
Chain Sequence
b'NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 16
structure length 143
sequence length 144
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c4jH00
2YV5A 3GTPH 5LMNW 5ELOA 2I5MX 3I2ZA 1AE2A 4LF5Q 4DR4Q 4PMWA 3I55A 1D7QA 3CD6A 3CC7A 2R93G 4A4IA 3PUXA 2ATWA 1XNRQ 1E1TA 1A0IA 3I56A 1X65A 2BA0A 1EIFA 3CMAA 3CCUA 2HIVA 3KFUA 4LWCA 2UUAL 1EWIA 1Y1WH 4AYBG 4IFDJ 3G48A 4LUOA 3M3YH 1YHAA 1UE5A 1V9PA 1X3GA 4OWTB 3S16H 1PVOA 1I50H 5HY6A 3PUYA 4MZ9A 4LF4L 3HOWG 1CKMA 1YIJA 4UY8C 3T1HQ 2IHEA 1CUKA 2N3SA 3UE1A 4X64Q 5AJ3Q 3J7ZC 4IO9A 4IFDI 4JI8L 3U4ZA 5IP9G 4IFDG 4KLKA 5IYDH 2YTXA 5IYBG 4X65Q 1BBWA 3RLNA 2CKZB 2ZTCA 2KHJA 3CP0A 3RR5A 1X54A 4A3EH 1XMOL 2RF4A 1L2FA 1XPRA 1IBKQ 1BKBA 1TWGH 1HNXQ 1LM0A 3HOYH 4Y7NH 5M3MG 1YBYA 1EQRA 3HFZB 1OXTA 3J7A5 5K36G 2OQ0A 2N78A 1KRTA 4J15A 4GOPC 4DR4L 1Q12A 4PZ8A 1TXYA 4PG3A 4LF8Q 1N32L 1A8VA 4PZ7A 2VQFL 4HIOA 1R9TH 2JA9A 2A19A 2K50A 1QVGA 2A8VA 1SE8A 1UE7A 3HOUH 3A5ZB 1KAWA 2PNHA 2PQAB 4GOPB 4A3JG 1Q46A 3RZDH 1NMGA 4KHPQ 3HOZG 2KHIA 4GNXB 2OWOA 1PH1A 4QIWE 3S1NH 3HOVG 5C4XH 5JJLA 3GDEA 1PH3A 2Z6KC 3GD7A 4BBSG 2UUBQ 5IYCG 2R7ZG 1FL0A 1C0AA 4XTCS 5LMUQ 1RIPA 4P75A 2BH2A 3GTOH 1XJVA 5FJ8H 2JA7G 4IJHA 2ZTDA 2B63H 4A3DG 1Q82C 1HZ9A 5GQOA 4GOPA 4PZ6A 3T1HL 1KD1C 4OX9Q 1I3QH 4UP9A 5AJ3L 1SRUA 1HZBA 4JI3L 3A0JA 1VQEA 3D0FA 5FLMH 3HOXH 4GNXA 2E2JH 2K5HA 4X65L 3STBC 5M5WH 4UP8A 2E2IH 1X55A 2JA5G 1VQ9A 2Y0SG 3I4MG 5IP7G 1MIUA 4HJ5A 3CCEA 3S14H 3PO2G 4DV1L 4RG1A 4HJ7A 4DV2Q 1EYGA 3J80i 3AYHB 5C44H 1HNXL 3G6EA 4DR2Q 1I6HH 3UE0A 4A93G 3RN2A 4JI7Q 4A75A 1VQNA 4OXPA 3ER0A 3CCMA 4P73A 1PFSA 4BA2I 4AH6A 2MQHA 1PH9A 1UE6A 2RCNA 4LF8L 2VS1A 1XNRL 2AKWB 3PUZA 4LUVA 4A3KH 3BZCA 5M3FH 2KCMA 2AHOB 4GKJQ 4DV4Q 1HJPA 2GN5A 2PI2A 3H3VI 4LF6Q 3M4OH 3KF6B 2CWAA 1JT8A 4DR5Q 1VQHA 1N36Q 4DR7Q 4JI0Q 1LTLA 4JYAQ 1Q8KA 3ZJYC 4AQYL 1S40A 1NMFA 2A1AA 2UXDL 2F3IA 3JC66 2DGYA 1NJIC 2HHHQ 5IE8A 5LMUL 3TQYA 1QZGA 3GTKH 2QGQA 4OWWB 4A3LG 4DUYL 3BZKA 1VQ7A 2CCZA 4OX9L 2WP8J 1VQDA 3KF6A 2UXBL 4HIDA 1Y1VH 1N34L 3AFQA 4H02A 5H1SE 2JA8H 1Q81C 2K4KA 4B3TQ 3S1QH 2B3GA 4JOIC 2WB1G 4K0KL 3CAMA 1JJGA 2NVXH 3F1ZA 1M90C 4A3MG 4NXMQ 3GTMH 1OXVA 3I4NH 4A3GH 1EUJA 1VQBA 2ALYB 4X66L 4DR2L 3E9HA 4DR6Q 5C0XJ 4DV3L 1HR0W 1VQKA 4JI7L 1X56A 1WJJA 3FKIH 3PO3G 1X3EA 1UE1A 4QL5A 2YTYA 1QVCA 2I0QA 1HZCA 2BA1A 4BXXH 1ASYA 3NELA 3OTOL 4GKJL 4DV4L 1VQCA 1KXLA 3H0GH 3NBHB 1BVSA 1PYSB 4JOIA 5C0XI 5C0XG 4A3CG 1N36L 5GADC 4DR7L 2D0OA 2EQSA 1YZ6A 1EOVA 3LGJA 1NY4A 4IPGA 4JI0L 4JYAL 2C35B 3KYHC 3S24A 3CW2C 2HHHL 4DAYB 4UPAA 1WYDA 4DV0Q 2NZHA 3CPFA 3DM3A 3M4PA 4B3MQ 1Z47A 2VQEL 4IOCA 1IXRA 2R7DA 3J81c 3TEHB 3ICEA 2D0PA 4A3FH 5C4JH 3GO5A 4R4QA 4MTNA 4LW1A 2UUCQ 2DUDA 3RLFA 3A5UA 4HIKA 1KIXA 1CSPA 4ALPA 4LFBL 2F52A 2R7FA 5ELNA 1G291 4MNOA 4LFBQ 2GVAA 1C9OA 3PF4A 2R92H 1HNZQ 4DR6L 3F8TA 1UEBA 2N49A 3K81C 1GO3E 3W1GA 3KDFA 4YWMA 1GVPA 5J3BA 3L2PA 2ZJRA 3T1YQ 1Y1WG 1VQFA 3M85A 1PH5A 3GTGH 3M7NA 3K0XA 4DKAC 5BR8L 4LFCL 3FP9A 4YHHL 1SROA 1NE3A 1E22A 3I7FA 3U4VA 3PIOA 4B3RQ 2VUMH 2LSSA 4HJAA 1VS0A 4ME3A 1KL9A 3GTJH 1YNXA 1WCMH 4JI5Q 5IWAQ 4LF5L 3PSIA 5IYDG 4DV0L 3M4QA 4DR3Q 3E0EA 4GS3A 1VQMA 4KI0A 4LF9Q 1J6QA 2JQOA 3S1MH 4A3EG 4POFA 2OQKA 4OO1G 4OO1I 4QJFA 4BY1H 2UXCQ 2UUCL 4DV6Q 1I94Q 4LNQA 2JA6H 2F4VQ 2IT1A 4YCVA 5JEAJ 4BY7H 1L1OC 1SLJA 2JEBI 1SFOH 1IYJB 4L5QA 5IT9c 4WJ3M 1T9HA 2OTJA 4DK3C 2MO1A 3HKSA 4R4TA 1YHQA 4JBKA 3I4OA 4L5SA 3JAMi 1JE5A 1HNZL 1L1OB 3TRZA 1WFQA 4YWKA 2R7ZH 1W2BA 3HOUG 1XMQQ 4X64L 1Q1BA 3AQQA 2JA7H 4P74A 3T1YL 2BH8A 3HOZH 1U5KA 5C4XG 1B8AA 1E3PA 3K7UC 4OONA 1J5EQ 1YEZA 2NVYH 1SN8A 4LUZA 2Q2HA 1IBKL 4NXNQ 3PGZA 1L1OA 2Z6KA 1GKHA 1VQAA 3I4MH 3J81i 4B3RL 1HNWQ 1U0LA 5FJ8G 3PO2H 1FJGQ 4IPCA 2YU9H 3HKZE 3GTLH 2K5VA 2Z0SA 3L7ZC 5IWAL 4X62Q 5FLMG 3HOXG 1EIYB 1N9WA 3UDGA 4JCVE 3FHWA 4JG2A 1P16A 1YI2A 3K7AH 2VZAA 1IBLQ 4KHPL 5C44G 1I94L 4JI1Q 4EQ5A 2F4VL 3S17H 3TS2A 1X9NA 2UUBL 1K83H 1PH2A 3ULLA 3F2BA 3WWVA 3S2DH 4AYBE 2KENA 4R4CA 4TVAB 5EAYA 4BBRH 5M3FG 2RHSB 4A3KG 1N33Q 1HR0Q 2Q2UA 1XMQL 1YJWA 3U50C 4DNIA 4R4OA 1EQQA 3KF8B 1IBMQ 3F2CA 1H95A 2R6GA 4YCWA 1SR3A 2K14A 1D8LA 4TQUS 2LXKA 2K5NA 4DV2L 3CXCA 4A3IH 1HNWL 3CMEA 1KHIA 1FJGL 5GROA 1CKOA 5GAEC 3UDFA 1G51A 2CFMA 5LMNQ 2IHFA 4UP7A 4DK6C 4DUZQ 1K73C 1PA6A 1Y1VG 2KCTA 3W1BA 1CKNA 2CWPA 3KLWA 2JA8G 1C7YA 1TWAH 2MO0A 2KBNA 1MKHA 4LF6L 2UUAQ 2IX1A 2WFWA 3I4NG 4A3GG 3NEMA 3PCOB 2ES2A 4Y52H 1E24A 4DR5L 1A62A 2E5LQ 2RHQB 1XPUA 4JV5Q 2PMZE 3FKIG 3SGIA 1B70B 3CCJA 4XIGS 2I5LX 1YJNA 1LYLA 5GAGC 1N8RC 4BXXG 1ASZA 3BU2A 1TWCH 1E7ZA 3EBEA 3TREA 1N33L 1LUZA 4JBWA 1YHBA 3L0OA 5C3EG 3CCQA 4A76A 1VQ5A 1IBML 3H0GG 4L5RC 1QZHA 2R93H 3EIVA 3CF5A 3KDFB 1VQ8A 2YYZA 2VY3A 4OWXB 4B3TL 2JEAI 1YJ9A 1XMOQ 1KRSA 1JMCA 3STBD 1Q1EA 1JJCB 4GLAC 4NXML 1YITA 1WOCA 2D62A 2PI2E 2ASBA 5JJIA 4POGA 2Y0SE 4P72A 3CC4A 1VQOA 5LMNL 1IL2A 2NVTH 4A3FG 4JC0A 4DUZL 4LF7Q 3J80c 1N32Q 4QY7A 2VQFQ 1Y14B 2ZM6Q 3VDYA 4NPSA 1OTCA 4JI4Q 3HOWH 4DAMA 1PYBA 4FDBA 1TWHH 5IP9H 2VL6A 2WAQE 2ZTEA 5IYBH 1XTDA 2NZOA 4JI2Q 4DR1Q 1PH8A 2E5LL 2K52A 3Q8DA 3KOJA 2R92G 1GM5A 3D31A 4IPDA 4R4IA 1M1KC 4DV5Q 5DLQE 1DGSA 4JV5L 1VCIA 3PUVA 1Z9FA 2OCEA 4IOAA 1I5FA 2QEXA 4QGUA 4O0AA 5M3MH 4B3ML 4B3SQ 4GN3B 5HGQA 3S2HH 1HZAA 1X6OA 4AIMA 4JI3Q 2NVQH 3CCSA 3G71A 3HOYG 2XTIA 4C3IH 2VUMG 4RMFA 2CQOA 4IPHA 4DV1Q 3ULPA 4A3JH 4QQBX 1XNQQ 3OYYA 3RN5A 1KC8C 1WCMG 4C3JH 4C3HH 2AWNA 3CPWA 3CCVA 3DLLA 1BBUA 2V1CC 3HOVH 2EIFA 1K3RA 4BBSH 1VQPA 1K8GA 5IYCH 1S3OA 4GKKQ 1OXUA 1A63A 2WB1E 4BY1G 4LF7L 1PHJA 2JA6G 4GNXC 4A3DH 5JEAG 2ZM6L 4JI4L 3GTQH 2Q2IA 1VQGA 1FVIA 2AWOA 5FLXc 2Q2TA 4BY7G 4L5TA 4O2DA 1OXXK 1QVFA 4LFAQ 1Q7YC 2AMCB 3BJUA 3ERSX 3K8AA 4DR1L 2JA5H 5IP7H 4JI2L 3AEVA 3RZOH 4AQYQ 2B63G 2UXDQ 4APVA 2VW9A 4DV5L 4YWLA 1V1QA 1MJEA 2MNAA 4JI5L 1PH4A 4A3BG 1VQIA 1L0WA 1EFWA 4YY3Q 4A93H 4GLXA 5M5XH 4DUYQ 2PQAA 4DR3L 1Q86C 2E8GA 1JJ2A 4B3SL 4LF9L 1QUQB 1K9MC 1VQ6A 5IY0A 2UXBQ 2H5XA 1N34Q 3J81j 2UU9Q 4X6AH 2UXCL 1FGUA 4DV6L 3S1RH 5M5YH 3MXNB 2L15A 1IZ6A 1G6PA 1HH2P 4K0KQ 2HT1A 3H3VH 1S72A 3W5OA 1K8AC 1XNQL 2HQLA 4X66Q 2JE6I 3G4SA 1PH6A 1QUQA 1GD7A 4DV3Q 5GAHC 4DV7Q 2FXQA 3KJPA 2LXJA 2WAQG 4IJLA 2QA4A 1VQLA 4GKKL 1JB7A 1B7YB 2YTVA 3NENA 4HIMA 1RL2A 2B29A 4A3LH 1VQ4A 2ID0A 1UWVA 1OXSC 4GN5A 3RNUA 1CKNB 4YCUA 3OTOQ 1J5EL 4JI6Q 4LFAL 1O7IA 1NBWA 2EXDA 3EN2A 4NXNL 1W3SA 3PUWA 1TWFH 3M9BA 1CSQA 1YVCA 4KHZA 1X3FA 3CCLA 4BBRG 2JK8A 4DPGA 4A3MH 3PF5A 2I5HA 4JBJA 3MEFA 4X62L 3CCRA 4YY3L 2VNUD 1AE3A 2VQEQ 4NB3A 2IY5B 4HJ8A 3PO3H 3UDIA 3E9IA 5E7NA 1PV4A 2UU9L 3UDXA 2MFIA 3AFPA 3ULJA 4A3IG 2IX0A 1IBLL 4JI1L 3CC2A 2GVBA 4GN4B 2N8NA 3K80C 3F2DA 1NTGA 3OW2A 3B6YA 4WJ4A 4A3CH 1KQSA 4BA1I 1PH7A 1MJCA 4LF4Q 2ZJQA 1E1OA 4JBMA 4DV7L 3IRBA 4EX5A 3PIPA 2NN6I 1XPOA 2E2HH 3S15H 1AH9A 2NN6G 1HR0L 4GLVB 1WI5A 2K75A 4JI8Q 3H15A 3TS0A 4R1JA 4A3BH 3CQZH 5JJKA 1K0RA 1V43A 1P8LA 2JJQA 3RLOA 2XGTA 3HKZG 1SMXA 3JAMc 5BR8Q 4LFCQ 2HIXA 4YHHQ 3A74A 5C3EH 3PV0A 2ZJPA 3KJOA 3U58A 2OTLA 4JI6L 4HJ9A 4P71A 1VQJA 4C2MH
chains in the Genus database with same CATH superfamily
1QJOA 1VMCA 2JP1A 3I2ZA 1BBXC 1QB5D 2E75C 2A68D 5CGKA 3W2DA 3DEOA 4LWCA 2R93B 1Y1WH 4CBVA 3G48A 1HUMA 1PRTC 1V9PA 3DEPA 3S16H 2F0KA 1PVOA 1I50H 5HY6A 4AYBB 2I07B 3PUYA 3I90A 2DNCA 5M9OA 4DAVA 1YIJA 1TKWB 3EA6A 1CUKA 2N3SA 3HEJA 3MZ5A 3RMHA 2F0PA 3U4ZA 5IYBG 3SK5A 3HOWB 1BBWA 3RLNA 1C8CA 2ZTCA 3K5LA 3RR5A 4OO1H 1L2FA 4X3SA 1IBKQ 3TZUA 4O42A 4Y7NH 1DYQA 1YBYA 3BS1A 3KBXA 1Q12A 3QG1A 4PG3A 5I6WA 3G7LA 5M3MB 1NSNS 2A8VA 4IALA 1SE8A 1UE7A 3BVMA 2PQAB 4A3JG 1Q46A 1CT1D 4C3JG 4QIWE 1H9MA 3GDEA 1F77A 1IW7D 3GD7A 2Z4HA 5IYCG 4C1NI 4P75A 4C3HB 1NR2A 1XJVA 3J7AV 2ZTDA 1Q82C 4OX9Q 2R7ZB 4UP9A 2BDNA 4JI3L 3HOXH 2DY8A 2K05A 2K5HA 2K03A 3GV3A 2Z9HA 3STBC 5M5WH 2E2IH 2JA7B 5IP7G 3S14H 4HJ7A 3NTHA 3J80i 3AYHB 5IGEA 1EIHA 3GP7A 2Y0SB 4NKLA 3RZOB 4A93G 1ML0D 3RN2A 4JI7Q 4A75A 5DAUA 1EY9A 1NR4A 4AH6A 2MQHA 1PH9A 2RCNA 1F9PA 4LUVA 5JVH3 1H9KA 3BZCA 2KCMA 3J80E 1HJPA 4LF6Q 3K7AB 4HAEA 5M5YB 4JI0Q 1LTLA 3MFYA 4AQYL 3JC66 2F0IA 2X6GA 3TQYA 3MHBA 5EKIA 1Z6HA 2CCZA 2HDLA 4OX9L 2F0OA 3OIQA 1VQDA 1O7ZA 2OEOA 4HIDA 2XSCA 1N34L 3AFQA 2RQXA 2JA8H 2CHBD 2IJ0A 5K5PA 4JOIC 3H91A 1JJGA 4EQOA 1OXVA 2ALYB 1DCZA 3E9HA 1SNPA 4HN7A 1HR0W 3I72A 4JI7L 1WJJA 3EFXD 1QVCA 1GXDC 3TZDA 4J1MA 1JE4A 3SR1A 4JOIA 2D0OA 2EQSA 4JI0L 1LT4D 4DAYB 2OT2A 3M7GA 3DM3A 3M4PA 4B3MQ 1Z47A 1RF2D 4J6HA 4IOCA 2EJFC 1RODA 3TEHB 4K14A 3GO5A 2UUCQ 2CW0D 3E0JA 1B1ZA 2F3VA 4H13C 4HIKA 2K32A 4DAYA 1AZPA 1SYDA 5L37A 2F52A 3QOLA 4N8X1 1CA5A 3OWFA 3F8TA 2HCCA 2EYJA 1GO3E 2NVTB 4YWMA 3JAML 3T1YQ 1Y1WG 2ZJRA 2QKIC 3GTGH 4YHHL 1EEID 4B08A 4G7OC 4TKOB 2CQAA 5COYA 2VUMH 3M3YB 2F0EA 2DN8A 4M8AA 4ME3A 1KL9A 3GTJH 1S4ZA 1DXMA 3R8BA 2A69C 5HURA 2EYFA 3ND9A 2J0TD 4GS3A 4RGMA 3S1MH 1LT6D 3CKIB 4HCEA 4IUQA 4C3IG 2OQKA 3I73A 4POFA 4OO1G 2PZWA 4QJFA 2UUCL 1F9QA 4DV6Q 1I94Q 4LNQA 2JA6H 4KK7A 1FNVA 3D4DA 4BY7H 1L1OC 2JEBI 1IYJB 1TWGB 1PYWD 2OTJA 4K6DA 4R4TA 4C3JB 1IKLA 4LJZC 1L1OB 5CYUA 1WFQA 4YWKA 1FGBD 4X64L 1GUTA 4OIKA 3T1YL 2BH8A 1R9TB 4N8FA 1Y8PB 1J5EQ 3HOUB 2EYLA 4TSSA 5BN5A 2QILA 5C3XA 1L1OA 1SYGA 3PO2H 1LT5D 3HKZE 2P5ZX 3GTLH 4FNFA 4Q0FA 1DOMA 1EIYB 3HOXG 2O4XA 3LWUA 4A93B 4UAIA 5M5XB 4IUTA 5ELEA 1QILA 1I94L 1BXTA 4ILWA 1X9NA 2EXZA 2F0WA 4G57A 1K83H 1F2YA 1HR0Q 3KUPA 4DNIA 2RDFA 1IBMQ 1H95A 5BN3A 4YCWA 5M3FB 2K14A 3M4OB 2LXKA 1EWHA 2CH4A 3CMEA 4G7HC 5GROA 3BVGA 3GTKB 2L4NA 2KCTA 4OL7A 3SEBA 2CWPA 3KLWA 1EQVA 2JA8G 1BUVT 2MO0A 3DWQA 5IGDA 2F0UA 1STBA 2ES2A 3PCOB 4Y52H 4DR5L 1A62A 2FINB 2PMZE 2WINB 4JW0A 3SGIA 2NVXB 1B70B 3I4NB 3CCJA 3TBIB 2XNAC 5KGUA 3P75A 1ILPA 3BU2A 1TWCH 1E7ZA 3TREA 4DNRB 1LUZA 1SYFA 1YHBA 1KAAA 1HPCA 4A76A 3IL8A 1IBML 2R93H 1QZHA 3EIVA 3CF5A 3KDFB 4KN7C 1VQ8A 4FXDA 2DJFC 1JMCA 3NE5B 1Q1EA 4NXML 1BF4A 1JC7A 2H1EA 3D8GA 2PNRC 3C1FA 3VDYA 3HOWH 4NPSA 5A2QE 1PYBA 4NW2A 2WAQE 1C4QA 4DR1Q 3KOJA 2AQ2B 1GM5A 4IPDA 4R4IA 4XT3B 1DGSA 2V4DA 1TY2A 2DNEA 4KY6A 1VCIA 1I5FA 5M3MH 1GUSA 5K36H 4AIMA 1X6OA 1D5MC 3C1EA 2NVQH 1EZ8A 3HOYG 3P7JA 4UHVA 2A6ED 3LNNA 2VUMG 4RMFA 5EKKA 4DV1Q 2B2YC 3ULPA 1CA6A 1XNQQ 4C3HH 1G91A 4Y7NB 1SYEA 3GQBA 3V05A 4FO2A 3RUZA 1ZKOA 4GKKQ 3D3RA 3PMFA 2JSOA 4CDDC 3Q0AA 1SE2A 2C9OA 2JA6G 2NB0A 2Q2IA 3PIO3 2AWOA 5FLXc 1X3PA 4BY7G 2IWHA 2K01A 2XN9C 1Q7YC 2B2YA 3AEVA 4DR1L 4QCLA 3RZOH 5G3LD 4APVA 3FRPB 4U68A 2BCOA 2F0QA 2EVBA 1JR0D 2X69A 4LF9L 1K9MC 2SNMA 1VQ6A 2UXBQ 2H5XA 1QE6A 1UAPA 2QF7A 3J81j 4X6AH 2UXCL 2HD3A 5M5YH 3MXNB 2L15A 5CMDA 2NVYB 2K5DA 1XNQL 1ESFA 3Q23A 3G4SA 1PH6A 1GD7A 1D6EC 4F7XA 1VQLA 3KJPA 4IJLA 4GKKL 1K3BC 3NENA 1A3VA 1VQ4A 2O2LD 2F0HA 3NSWA 4K5XA 1OXSC 4YCUA 1HCZA 1NBWA 3WOFA 3EN2A 1EEFD 1H9JA 1RTNA 4FYDA 3CCLA 1BCPB 1AFPA 5FO9B 1D1KA 4OELB 4R8IA 1AE3A 2VQEQ 2EYMA 4XDXA 1QG7A 1JOOA 3FEWX 5E7NA 2Z1CA 1EL0A 3K5MA 5LHY1 3B6YA 1YNJC 5C0XH 3G6JB 1PH7A 4LF4Q 2E2HH 3M4YA 1PRTF 2HCIA 2PYKA 1T5XD 2F0NA 3H15A 1AH9A 4R1JA 1K0RA 2G5DA 1TWAB 2ZJPA 3PV0A 3U58A 3KJOA 3MA2B 5KYLA 1SAPA 1CI3M 5KEEA 2YV5A 5ELDA 5LMNW 1F2MA 1CTMA 1AE2A 1SNDA 2NZ1D 3VA5A 4LF5Q 5I4DA 1SMYD 2MHVA 1D7QA 3MVVA 2R93G 1E1TA 4PQXA 1EIFA 3CMAA 3CCUA 2HIVA 1SNCA 4AYBG 3M3YH 3R2IA 1YHAA 1SE4A 5I6YA 3K6OA 4WORA 3SDZA 4KTAA 4LF4L 3HOWG 1RJTA 4XYOA 3J7ZC 2EE1A 4RA8A 5IYDH 4R8NA 1H9RA 2H4OA 2KVMA 2CKZB 3NK9A 2KHJA 3CP0A 1TWHB 1X54A 1XMOL 2RF4A 1XPRA 3MXPA 4WJWA 1TWGH 4ZKCB 1O7LA 3K5OA 2R61A 4G4KA 5M3MG 3HFZB 3J7A5 3J80L 3IFTA 5K36G 2PCFB 4J15A 1N32L 4LF8Q 3NPPA 2VQFL 4HIOA 1R9TH 3S1MB 3HOUH 3A5ZB 1CQFA 2PNHA 3DWPA 1I4PA 5CV5A 4DN4M 4C3HG 3S9WA 5JJLA 2IW3A 1PH3A 1QNUA 2R7ZG 1C0AA 4XTCS 1B3QA 1PLFA 4XQNA 2PPBC 4OHJA 3A7LA 2JA7G 2A6HC 5KNBA 5IGFA 5AFWA 5FK9C 1VQEA 2E2JH 4E6IA 1LLRD 4L63B 2Y0SG 4HJ5A 3CCEA 2LMCB 4DV2Q 1BQQT 1TU2B 1LTAD 3G6EA 1I6HH 5D65A 3TN2A 3UE0A 3PO2B 1C48A 3ER0A 1UE6A 4LF8L 3SHLA 4QMGA 3EVQA 5M3FH 4GKJQ 3H3VI 2PI2A 5BN4A 3M4OH 1JT8A 1VQHA 2UXDL 1K83B 2DGYA 3GTKH 4ODGA 5DM73 1H9SB 2K4KA 2CH4W 3TP6A 3SVMA 2NVXH 3I4NH 3LWEA 1TWFB 5IOCA 1VQKA 4EQNA 1X56A 1X3EA 4C1NK 1WTOA 1B2TA 1KTKA 1ASYA 3PO3B 3MTSA 1MD2D 3OTOL 4GKJL 2FMMA 1VQCA 3NBHB 2N88A 1DJRD 5C0XG 4KKUA 5GADC 1STAA 1EOVA 5C5LA 3R93A 1VF5C 2RDGA 3CW2C 1WYDA 1PFMA 3CPFA 1TWCB 3J81c 4RFBA 1S5CD 3NBHA 3ICEA 2EYHA 3TMEA 4A3FH 1G6ZA 4K2KA 2DUDA 1KIXA 1Z7TA 3I70A 5ELNA 1F2LA 2B2TC 1G291 4MNOA 1EYAA 1B9MA 3GTPB 1BNZA 1PRTB 1S5ED 1ZXTA 2XWJB 1UEBA 3K81C 2D5DA 3W1GA 4RCNA 1STGA 1ICWA 1WTWA 1GVPA 1HHVA 1VQFA 2IL8A 3M7NA 4LFCL 3FP9A 4L8JA 1GUNA 2EJGC 4F87A 3IAYA 4B3RQ 2G9DA 4RHRA 4JI5Q 5IWAQ 5JAVA 3K0YA 3PSIA 5IYDG 3M4QA 5I2XA 4GZYC 1SNOA 2BE5C 4KI0A 2JQOA 4OO1I 1A2TA 2NVQB 2JYOA 4RHSA 2F4VQ 4RGNA 4A3EB 1WVLA 3QWNA 5IT9c 1AN8A 4WJ3M 3Q6SA 4L5SA 1MI2A 3I4OA 4ZCKA 1EY6A 1X3QA 3HOUG 2K04A 3AQQA 1U5KA 1DZ1A 1B8AA 1XX8A 4OONA 5C6AA 1YEZA 2NVYH 1SN8A 3RZDB 1IBKL 4N9PA 1HNWQ 3S1NB 3I4MH 3J81i 4B3RL 1O80A 1U0LA 1FJGQ 2F03A 3H09A 1QOHA 3L7ZC 5IWAL 1HTLD 2A68C 4X62Q 2FMCA 4EGVA 3UDGA 4JCVE 4JVZA 3FHWA 4JG2A 1EZ6A 3IKJA 4RAUC 1P16A 2VZAA 3J81E 1IBLQ 5J39A 4JI1Q 2F4VL 5FOBB 2KOLA 1U4LA 3HZXA 1B3AA 3BYTB 4AYBE 5EAYA 1PZID 1YNND 1XWEA 4DXGA 5M3FG 4R4OA 4JK1C 3VR3A 3F2CA 1G2TA 1SR3A 1WTXA 1L0XB 1AW7A 3U9OA 3E6ZX 2K5NA 2F3WA 1TQOA 2L9HA 1HNWL 4ZRZA 3OMCA 1KHIA 5A2QL 1FJGL 1RD9D 1WD0A 1G51A 2AQ1B 2CFMA 4DK6C 4DUZQ 1EFID 1PA6A 3NUCA 3WDNA 1R4QB 1K8MA 2PW7A 1SE3A 2NN6H 1TWAH 1IW7C 2KBNA 3QR8A 3H6MA 1Y1VB 3P1HA 2WFWA 5CV7A 2UUAQ 4LF6L 3NEMA 3I4NG 4B9WA 5J1ZA 1E24A 1I4QA 2E5LQ 4HMIA 1KLUD 1ENCA 4CKCA 4XIGS 2I5LX 3NP8A 2EYPA 1YJNA 2B8FA 4RCOA 4HEDA 3EBEA 2E2HB 3FKIB 4IQZA 3R3OA 3CCQA 3SK4A 3A55A 4RWSC 4OWXB 3T13A 3CHBD 1F9RA 1JJCB 4GLAC 2Z6BA 1PFBA 2Z8LA 1PFNA 4MHEA 2L1BA 2Y0SE 3QO2A 3CC4A 2PQEA 1VQOA 4A3FG 3QJYA 4JC0A 4DUZL 1Y14B 2ZM6Q 1F9SA 2J7ZA 4JI4Q 1TWHH 1B4OA 5IP9H 4IFDH 2ZTEA 4HSVA 1AP0A 3VYUA 1XTDA 2NZOA 4B9XA 2E5LL 3FPPA 2F0GA 3D31A 1GUGA 1ICFB 3BG3A 2WV6D 1B53A 1Z9FA 3OWEB 5CBAE 2QEXA 5E1FA 1PTOD 4O0AA 2TMPA 4B3ML 4B3SQ 2R92B 4GN3B 1HZAA 1VDZA 1PMRA 3MXGA 3CCSA 1LT3D 1MBYA 2R3ZA 3L9AX 3TP8A 3T53B 4CJ0B 2CQOA 3RN5A 1KC8C 4N9TA 2L0CA 3DLLA 2EIFA 1K3RA 4DGZA 4L6TB 1K8GA 1S3OA 4FXGC 1OXUA 1A63A 1B44D 1PHJA 3F2UA 4GNXC 2ZM6L 1CHPD 4JI4L 2XWBB 2CVRA 3CU7A 1FVIA 4IUPA 4BWGB 2WKCA 2Q2TA 4L5TA 1A3TA 1OXXK 4BY1B 3BJUA 2B2VC 5EPKA 1SFOB 4YWLA 1V1QA 1MJEA 1PH4A 3L3OC 1EFWA 4GLXA 4DUYQ 2CW0C 4B3SL 4K6LA 1QUQB 5IY0A 5I9OA 2E2JB 3T56B 3HOZB 4DV6L 1G6PA 4K0KQ 1LTRD 1K8AC 2HQLA 2MP1A 5E4XA 4X66Q 2JE6I 1I6HB 1QUQA 1BDOA 3FMCA 4DV3Q 4DV7Q 1B7YB 1HFNA 3BDLA 3IFDA 2ID0A 1UWVA 4GN5A 1LV9A 4O1NA 3RNUA 4MIUA 3C3LA 1J5EL 1L0YB 1LABA 2EXDA 2WACA 1TWFH 5CBEE 4CHTB 1LTGD 1YVCA 2OF1A 1IHZA 2JK8A 3RD4A 2FHTA 3MXUA 3MEFA 1TS5A 3S2DB 2ICIA 4R9WA 2IY5B 2EZVA 4HJ8A 3PO3H 1T5EA 4IN3A 5EBCA 1U4PA 4FXKC 3K57A 2MFIA 3ULJA 2K33A 1E0BA 1KLGD 2GVBA 4GN4B 1QCBD 1NTGA 3OW2A 5C5MA 4A3IB 4A3CH 3LX0A 2ZJQA 4JBMA 4DV7L 3IRBA 3PIPA 3OOCA 2NN6G 5I9PA 1HR0L 2K75A 4JI8Q 3TS0A 5JJKA 1V43A 2JJQA 3RLOA 4DNTB 3JAMc 5BR8Q 2HIXA 4QF4A 3A74A 4ABNA 5C3EH 4PNYA 4P71A 1BOSA 3GTPH 3VA7A 3AMUA 4PMWA 3ERQA 2MPMA 3I55A 3BZDB 3CC7A 1NNXA 4A4IA 3ZYYX 1KNAA 3DHQA 3PUXA 1VF7A 1A0IA 1X65A 2BA0A 4A3FB 3KFUA 1MGSA 1EWIA 4J8QA 1AEXA 5DNFA 1SYCA 4S3SA 3A8IE 2JN4A 4HSPA 2KEEA 2ENBA 5DM63 4X3KA 1CKMA 2EOTA 3NWSA 4G7ZC 5HGTA 3UE1A 5KYIA 5AJ3Q 1JWUD 2LS01 4JI8L 5IP9G 3C2PA 4KLKA 4IFDG 2YTXA 5JJZA 4DA2A 2SEBD 4A3EH 1AZQA 2E2DC 5EKLA 1HNXQ 3OIPA 1BCPD 1EQRA 1OXTA 1KRTA 1A6XA 1SEBD 4GOPC 4X3UA 4PZ8A 1TXYA 4CGYB 2DJGC 4PZ7A 2K50A 1QVGA 1S5DD 4GOPB 3RZDH 5EJWA 4KHPQ 1PH1A 3EROA 3S1NH 5CV9A 3TSSA 2Z6KC 2UUBQ 2QW7A 1I4GA 4KD3A 1HA6A 1I4HA 1RIPA 2BH2A 3HOVB 5FJ8H 2A73B 2B63H 4BBSB 1HZ9A 5GQOA 4GOPA 1KD1C 3QB3A 5AJ3L 4A3BH 5FLMH 3D0FA 4UP8A 4K8IA 4A3DB 1X55A 2A5HA 2K5QA 3NQIA 3GTQB 1MIUA 4QUFA 3PO2G 4DV1L 4RG1A 1EYGA 5T1GA 1HNXL 2JA5B 3I4MB 1VQNA 1D5XC 1NCVA 3VYRA 1S5FD 2VS1A 2AKWB 4F8MA 4DV4Q 4MN3A 4FP5D 1J8IA 4KJOA 5EBDA 1PZKD 4JYAQ 1ZEQX 3ZJYC 1HXYD 2A1AA 1SBBB 4DU9A 1NJIC 5JOBA 2HHHQ 5IE8A 2M2LA 3NXWA 2QGQA 1EU4A 1JCKB 3NBIA 1EY5A 2RVLA 2A6EC 2UXBL 1XYIA 1Y1VH 4CKEA 4H02A 1SNQA 5H1SE 3A8KE 1Q81C 4UDUC 4B3TQ 1GUOA 1K8OA 5D3DA 3CAMA 1Y8OB 1STNA 5F2DA 2NTTA 5J22A 4JPBW 3EJIA 4DR6Q 4I7ZC 5C0XJ 2WB1B 3K5NA 3FKIH 3KF8A 3PO3G 4A3MB 1TIID 2I0QA 1S5BD 2BA1A 2XRSD 1B9NA 1Y8NB 4CDCC 1XTCD 5ISRA 2RSNA 2RSOA 4KJNA 2F0MA 4DV4L 2I46A 5C0XI 5FLXE 4A3CG 1D1IA 1YZ6A 3LGJA 4JYAL 1NY4A 2C35B 3KYHC 2HHHL 4UPAA 4DV0Q 2NZHA 2VQEL 2R7DA 2MUYA 4HCSA 5C4HA 3ITPA 1Y69U 4MTNA 4LW1A 5CC4A 3RLFA 4WFN3 5IIFA 4ALPA 3HG9A 4LFBQ 4DAPA 2GVAA 2ICEC 3MWYW 2R92H 1HNZQ 3PF4A 1JWSD 5CR3A 4DR6L 3O13A 4RGOS 2N49A 1HFGA 4NP5A 4M1UB 1PH5A 1EQTA 1ZYRD 4DKAC 4ZUIA 1NE3A 3I7FA 1BR9A 3I3CA 1KDCA 3K59A 4HJAA 1VS0A 4DXFA 1HQMC 1FNWA 2E76C 2L5TA 4LF5L 3J81L 4DV0L 1J9OA 4DK1A 4DR3Q 2F0VA 4A3EG 1KNEA 2SOBA 4BY1H 1GHJA 1SJHD 1EY0A 1PXUA 4FF2A 2IT1A 4YCVA 5ELBA 4WRDA 1SFOH 1EYDA 4L5QA 4KV6A 2F0TA 1T9HA 4DK3C 2MO1A 3HKSA 4KY7A 4JBKA 4LFBL 1HNZL 3TRZA 1W2BA 5E3FA 1Q1BA 4FF1A 3QIAA 3HOZH 3J7YW 5DEHA 1EWCA 2G9HD 2B39A 4FF4A 2Q2HA 4NXNQ 4K5VA 1GKHA 5C4XB 1SMYC 5FJ8G 1EYCA 4IPCA 4OIJA 4ZYSA 4IZ8A 2EDGA 2K5VA 2F1MA 5FLMG 2KJXA 1N9WA 3TP7A 2EJMA 2A74C 1I3QB 1Q90A 3X3MA 2JXMB 5ELCA 4KKTA 4EQ5A 2SDFA 1A15A 1STYA 1QNKA 5C44B 3F2BA 1PRTD 3S2DH 2KENA 2Q2UA 3DUZA 1YJWA 3KBGA 2R6GA 4A3KB 2KCCA 2RBMA 4H0LC 5KNDA 4DV2L 2ZT9C 3WOEA 1STEA 1TY0A 4A3IH 5C4ZA 1GUWA 1E2WA 1CKOA 5GAEC 1CK1A 2B2UC 5LMNQ 1D5ZC 4UP7A 1K73C 1Y1VG 4DF7A 1CKNA 1RTOA 1C7YA 1MKHA 4QIWB 2IX1A 4I7AA 3S1QB 1LTTD 2MGSA 2RHQB 5FKAC 4QB4A 3FKIG 3GTMB 4K5WA 4A3GB 3MC0B 1LYLA 2B2UA 1N8RC 4NDXA 1ASZA 4JBWA 4KN4C 2AQ3B 3D4WA 4L5RC 1NUCA 3AU7A 3MFGA 2VY3A 2JEAI 1YJ9A 1KRSA 1GJXA 5C3EB 3D6CA 1JQYD 1LO5D 3STBD 3H0GB 4OEMB 2IX3A 3K58A 2PI2E 2ASBA 4POGA 1O7YA 2QEJC 4P72A 5LMNL 2Q8IB 1IL2A 3J80c 2VB2X 2F0JA 4QY7A 1ENFA 1OTCA 2EYOA 4ZLTF 4FDBA 3TP5A 3J7AF 2VL6A 1ET9A 5C4JB 3Q8DA 2R92G 2B2TA 4RKBA 5DLQE 2QCPX 3PUVA 4CJ2C 2MJ8A 2OCEA 4IOAA 4QGUA 5HGQA 4JI3Q 1A3UA 1DOLA 2XTIA 4C3IH 4KD4A 4QQBX 2IPKD 3OYYA 3U9SA 2AWNA 2EY1A 3FDTA 1BBUA 3HOVH 2HUGA 1SYBA 1VQPA 4BBSH 3SK8A 1V1OA 2F4IA 1WD1A 1WCMB 4BY1G 2FFKB 1U4MA 2X6LA 4A3DH 3GTQH 1SXTA 1VQGA 1LTID 1SJED 4O2DA 1UNSA 1QVFA 5EQ0A 1IYUA 2AMCB 3K8AA 2JA5H 4AQYQ 2C5CA 2VW9A 4JI5L 4IUVA 1VQIA 1L0WA 4YY3Q 2B63B 3HOZG 2PQAA 2E8GA 4XYQA 1PTOF 1WTRA 4A3BB 1CZGA 1N34Q 4ZKBB 2HQEA 2M9VA 2KEDA 3N6RA 5IODA 1O78A 2XIWA 1S72A 5CORA 5KNCA 4DFAA 1CFMA 5GAHC 2YU9B 2WAQG 1JB7A 2YTVA 1GHKA 4EVOA 2B29A 4ZAIA 2D2CC 4A3LH 1HUNA 4H7BA 2FJ2A 2NTSA 4ULLA 3X3NA 1I6VC 3M9BA 3S17B 2ZXPA 1X3FA 3V2TA 1I4XA 4A3MH 3PF5A 1KDBA 1STHA 3DXJC 4X62L 3CCRA 4YY3L 4BBRB 1SNMA 2KUMA 2A69D 3E9IA 4CDFC 2NBFA 3UDXA 3AFPA 4A3IG 1IBLL 2IX0A 4JI1L 4I65A 3CC2A 4Q5VA 3SXHA 3K80C 3Q24A 4RGTA 4WJ4A 1Q3LA 1MJCA 5IT9E 4XQJA 2RCFA 2Q8RE 3KLSA 5EGTA 2NN6I 4EX5A 1XPOA 1WI5A 2BDOA 1EY4A 1P8LA 3GV6A 2L55A 1SMXA 4YHHQ 3E5SA 3HKZB 4C2MH 5ELOA 2QDBA 2I5MX 4XXEA 4DR4Q 2HDMA 3CD6A 4V0BA 2ATWA 3I56A 3NWTA 1KABA 1RDPD 2UUAL 1CHQD 4IFDJ 1HTPA 4LUOA 1UE5A 1RCVD 4OWTB 1X3GA 2PW5A 2WKDA 4KHVA 5JPNC 1YNNC 4MZ9A 4UY8C 1I4RA 3T1HQ 1EIGA 2IHEA 4IO9A 1GOZA 4X64Q 1OO9B 1UUPA 4IFDI 4PMBA 4X65Q 4KKSA 5KRUA 4PV1C 1EU3A 3NQTA 4NMZA 2L12A 1BO0A 1M8AA 1BKBA 5CV8A 1ILQA 4U673 1LM0A 1B50A 3HOYH 1EY8A 2OQ0A 2N78A 3P20A 4DR4L 4V190 1A8VA 2LKVA 1XNRQ 2JA9A 2A19A 3S2HB 1HA5A 1KAWA 2VB3X 1NMGA 2KHIA 4GNXB 2OWOA 2PMZB 1MHWC 5C4XH 3HOVG 1RKNA 4A3JB 4BBSG 1FL0A 3OW7A 5LMUQ 3GTOH 2KCNA 4IJHA 5JPMC 4A3DG 1FD7D 4PZ6A 3T1HL 2RDHA 1I3QH 1SRUA 4BS9A 1HZBA 5EPLA 3A0JA 4GNXA 4X65L 2JA5G 1VQ9A 3I4MG 1JWMD 2GA4B 2B2VA 5C44H 1F2ZA 4DR2Q 5E4WC 3D4RA 4OXPA 3CCMA 4P73A 1PFSA 4BA2I 1BCPF 1MSGA 1WTVA 5FLXL 1IKMA 1DOKA 2AUKA 1XNRL 4A3KH 3PUZA 2WAQB 1II3A 3D6WA 2AHOB 2GN5A 3H3VC 4RH6A 3KF6B 2CWAA 3S1RB 1TR5A 4DR5Q 1N36Q 4DR7Q 2XRQD 1Q8KA 1S40A 1PTOC 1NMFA 4FVMA 3H94A 2F3IA 2TSSA 3A56A 4KMUC 1JOQA 3W3AA 5G3LF 5LMUL 1QZGA 3CRKC 4OWWB 4A3LG 1PTOB 4DUYL 3BZKA 1VQ7A 2WP8J 3KF6A 3HP3A 2OXPA 3S1QH 1IYVA 2B3GA 1E2VA 1X32A 2WB1G 4K0KL 1UEAB 3F1ZA 1M90C 4A3MG 4NXMQ 3GTMH 4A3GH 1EUJA 1VQBA 3EQLC 3ONAB 4X66L 4DR2L 4DV3L 1DONA 1UE1A 4QL5A 2YTYA 1HZCA 4ZQ3A 2K1BA 3URYA 4BXXH 1CM9A 1EOTA 2F0DA 3NELA 1U4RA 4K8JA 1KXLA 3H0GH 1BVSA 1PYSB 3MEHA 1PDQA 5ELFA 1N36L 4TRDA 4DR7L 4IPGA 1VMPA 2PO4A 1A2UA 2N55A 3S24A 3A7AB 3FPUB 1V8QA 4ME5A 1IXRA 3S15B 2D0PA 5C4JH 4R4QA 3CQZB 3NTIA 3OHXC 3DM1A 3DWAA 3A5UA 1CSPA 1DM0B 4MTKA 2Z4IA 5NUCA 2D9UA 2R7FA 3PIP3 1JORA 3HRZC 1C9OA 4ZK9B 5KIXA 3DMUA 4HR7B 3KDFA 1ENAA 5J3BA 3L2PA 3M85A 3K0XA 5BR8L 1SROA 1E22A 1Y1WB 3BDCA 3U4VA 3PIOA 2LSSA 3S16B 4CKBA 1YNXA 5LL6S 1WCMH 1I50B 1G2SA 1MSHA 3E0EA 1VQMA 4LF9Q 2EY5A 1J6QA 3I8ZA 1LTSD 1K28A 4YIJA 1HRJA 1JOKA 3VR4A 2UXCQ 2DY7A 5JEAH 5D3IB 4C3IB 3A54A 5JEAJ 1SLJA 3I4LA 1NAPA 1ESRA 1RHPA 2M00A 1YHQA 3C46A 3JAMi 1JE5A 1D2BA 3ND8A 1YNJD 3T4AC 2R7ZH 1XMQQ 2ZXOA 2B2WC 2JA7H 4P74A 5CV6A 5C4XG 1E3PA 3K7UC 2NUCA 4LUZA 1SDFA 2KECA 2PZUA 3JAME 3PGZA 2Z6KA 1VQAA 3KLSX 5A35A 2KQ3A 2YU9H 4CDEC 3MAQA 4HTHA 4IUNA 4Z9CB 2Z0SA 3T51B 2RKSA 2E74C 2Q8TA 2B2WA 1U9RA 4IURA 1YI2A 2F0FA 3K7AH 3HOXB 5IGBA 2E2IB 5M5WB 4KHPL 5C44G 1QWYA 3S17H 3TS2A 3S14B 2UUBL 1PH2A 3ULLA 4IUUA 3WWVA 3NTKA 4A3KG 4R4CA 4TVAB 4BBRH 1N33Q 3UI2A 1WTHA 2RHSB 3TDQA 1XMQL 1PZJD 3U50C 1EQQA 3KF8B 3MXNA 1D8LA 1KDAA 3N52A 1BCPC 4TQUS 1Q8IA 3CXCA 4CJ1B 1TS2A 3UDFA 2IHFA 4ZUJA 2O5IC 3BVZA 3Q22A 1R4PB 3W1BA 1EY7A 3HGBA 4KY5A 2SNSA 4A3GG 2JA8B 2K5WA 4H44C 5C3WA 2KA7A 5JVG3 1XPUA 1V1PB 4JV5Q 4LAAA 3E3XA 3NHHA 3CRLC 4X3TA 5GAGC 4BXXG 1N33L 2K7VA 4C56C 3L0OA 5C3EG 1JB3A 1VQ5A 3H0GG 5TSSA 3VYSA 1V1PA 2AUJD 2A6HD 2YYZA 4B3TL 1XMOQ 4LK1C 5EPJA 1E2ZA 1HQRD 1YITA 4C2MB 1WOCA 2D62A 5JJIA 1G8ZD 2VXWA 1TVXA 2NVTH 4LF7Q 1N32Q 3KLRA 2VQFQ 3I91A 4DAMA 3OPOA 4LMQD 3VR5A 4OGQC 5IYBH 4JI2Q 1PH8A 3QOJA 5LL6X 1W6KA 2K52A 4JV5L 5I2YA 1M1KC 4DV5Q 3OMGA 2LY7A 2PZTA 3S2HH 2WIIB 1K0SA 2BOSA 3G71A 1LTBD 3GTGB 4IPHA 4A3JH 2K6AA 2EY6A 1WCMG 4C3JH 5FO8B 3CPWA 1WTQA 3HOYB 3CCVA 2V1CC 2QDLA 2VUMB 3GTJB 5IYCH 2K28A 5D14A 2WB1E 1JICA 1W6JA 1IL8A 2ZXRA 4LF7L 1TS4A 5JEAG 3BYYB 2RA4A 1WTPA 1ET6A 4LFAQ 2JA6B 1DD2A 1ONLA 3ERSX 4JI2L 5IP7H 4BY7B 2B63G 2UXDQ 4DV5L 2MNAA 2B8GA 4QUCA 1TT2A 4A3BG 4K2LA 1LACA 3GTOB 4A93H 3FVQA 5M5XH 4DR3L 1Q86C 1JJ2A 1XXGA 2UU9Q 1FGUA 1FNUA 2EY2A 4ID6A 3SK6A 3S1RH 5IT9L 1IZ6A 2XVSA 1HH2P 2HT1A 3H3VH 3W5OA 3PQIA 4RKLA 2F0SA 1PTOH 2FXQA 2LFNA 2LXJA 5T1IA 2QA4A 3GTLB 1ZYRC 4PMCA 4HIMA 1FR3A 1RL2A 2J4XA 3KK7A 1CKNB 3OTOQ 3V96A 4JI6Q 4LFAL 1O7IA 5IGGA 3SE0A 4NXNL 1W3SA 3PUWA 4HMJA 5CV4A 1CSQA 4KHZA 4XQQA 4XT1B 4P2CB 3T16A 4BBRG 1TS3A 5FO7B 3VYTA 4DPGA 4F88A 2I5HA 4DK0A 4JBJA 3A8JE 2VNUD 2F0LA 4NB3A 3BDOA 3HS0C 3UDIA 1PV4A 1M4VA 2UU9L 2BE5D 3AB9A 2NWGA 2KHSA 1FYCA 2NYZD 2N8NA 4EQPA 5IGCA 3F2DA 3R2TA 3OSOA 1KQSA 4BA1I 1E1OA 2O5JC 3S15H 1H9SA 4GLVB 3CQZH 2EPBA 3VR6A 2XGTA 3HKZG 1CZWA 4LFCQ 2OTLA 4FF3A 4JI6L 2L11A 4HJ9A 1CQVA 1VQJA 1SSOA 3VR2A
chains in the Genus database with same CATH topology
2YV5A 3GTPH 5LMNW 5ELOA 2I5MX 3I2ZA 1AE2A 4LF5Q 4DR4Q 4PMWA 3I55A 1D7QA 3CD6A 3CC7A 2R93G 4A4IA 3PUXA 2ATWA 1XNRQ 1E1TA 1A0IA 3I56A 1X65A 2BA0A 1EIFA 3CMAA 3CCUA 2HIVA 3KFUA 4LWCA 2UUAL 1EWIA 1Y1WH 4AYBG 4IFDJ 3G48A 4LUOA 3M3YH 1YHAA 1UE5A 1V9PA 1X3GA 4OWTB 3S16H 1PVOA 1I50H 5HY6A 3PUYA 4MZ9A 4LF4L 3HOWG 1CKMA 1YIJA 4UY8C 3T1HQ 2IHEA 1CUKA 2N3SA 3UE1A 4X64Q 5AJ3Q 3J7ZC 4IO9A 4IFDI 4JI8L 3U4ZA 5IP9G 4IFDG 4KLKA 5IYDH 2YTXA 5IYBG 4X65Q 1BBWA 3RLNA 2CKZB 2ZTCA 2KHJA 3CP0A 3RR5A 1X54A 4A3EH 1XMOL 2RF4A 1L2FA 1XPRA 1IBKQ 1BKBA 1TWGH 1HNXQ 1LM0A 3HOYH 4Y7NH 5M3MG 1YBYA 1EQRA 3HFZB 1OXTA 3J7A5 5K36G 2OQ0A 2N78A 1KRTA 4J15A 4GOPC 4DR4L 1Q12A 4PZ8A 1TXYA 4PG3A 4LF8Q 1N32L 1A8VA 4PZ7A 2VQFL 4HIOA 1R9TH 2JA9A 2A19A 2K50A 1QVGA 2A8VA 1SE8A 1UE7A 3HOUH 3A5ZB 1KAWA 2PNHA 2PQAB 4GOPB 4A3JG 1Q46A 3RZDH 1NMGA 4KHPQ 3HOZG 2KHIA 4GNXB 2OWOA 1PH1A 4QIWE 3S1NH 3HOVG 5C4XH 5JJLA 3GDEA 1PH3A 2Z6KC 3GD7A 4BBSG 2UUBQ 5IYCG 2R7ZG 1FL0A 1C0AA 4XTCS 5LMUQ 1RIPA 4P75A 2BH2A 3GTOH 1XJVA 5FJ8H 2JA7G 4IJHA 2ZTDA 2B63H 4A3DG 1Q82C 1HZ9A 5GQOA 4GOPA 4PZ6A 3T1HL 1KD1C 4OX9Q 1I3QH 4UP9A 5AJ3L 1SRUA 1HZBA 4JI3L 3A0JA 1VQEA 3D0FA 5FLMH 3HOXH 4GNXA 2E2JH 2K5HA 4X65L 3STBC 5M5WH 4UP8A 2E2IH 1X55A 2JA5G 1VQ9A 2Y0SG 3I4MG 5IP7G 1MIUA 4HJ5A 3CCEA 3S14H 3PO2G 4DV1L 4RG1A 4HJ7A 4DV2Q 1EYGA 3J80i 3AYHB 5C44H 1HNXL 3G6EA 4DR2Q 1I6HH 3UE0A 4A93G 3RN2A 4JI7Q 4A75A 1VQNA 4OXPA 3ER0A 3CCMA 4P73A 1PFSA 4BA2I 4AH6A 2MQHA 1PH9A 1UE6A 2RCNA 4LF8L 2VS1A 1XNRL 2AKWB 3PUZA 4LUVA 4A3KH 3BZCA 5M3FH 2KCMA 2AHOB 4GKJQ 4DV4Q 1HJPA 2GN5A 2PI2A 3H3VI 4LF6Q 3M4OH 3KF6B 2CWAA 1JT8A 4DR5Q 1VQHA 1N36Q 4DR7Q 4JI0Q 1LTLA 4JYAQ 1Q8KA 3ZJYC 4AQYL 1S40A 1NMFA 2A1AA 2UXDL 2F3IA 3JC66 2DGYA 1NJIC 2HHHQ 5IE8A 5LMUL 3TQYA 1QZGA 3GTKH 2QGQA 4OWWB 4A3LG 4DUYL 3BZKA 1VQ7A 2CCZA 4OX9L 2WP8J 1VQDA 3KF6A 2UXBL 4HIDA 1Y1VH 1N34L 3AFQA 4H02A 5H1SE 2JA8H 1Q81C 2K4KA 4B3TQ 3S1QH 2B3GA 4JOIC 2WB1G 4K0KL 3CAMA 1JJGA 2NVXH 3F1ZA 1M90C 4A3MG 4NXMQ 3GTMH 1OXVA 3I4NH 4A3GH 1EUJA 1VQBA 2ALYB 4X66L 4DR2L 3E9HA 4DR6Q 5C0XJ 4DV3L 1HR0W 1VQKA 4JI7L 1X56A 1WJJA 3FKIH 3PO3G 1X3EA 1UE1A 4QL5A 2YTYA 1QVCA 2I0QA 1HZCA 2BA1A 4BXXH 1ASYA 3NELA 3OTOL 4GKJL 4DV4L 1VQCA 1KXLA 3H0GH 3NBHB 1BVSA 1PYSB 4JOIA 5C0XI 5C0XG 4A3CG 1N36L 5GADC 4DR7L 2D0OA 2EQSA 1YZ6A 1EOVA 3LGJA 1NY4A 4IPGA 4JI0L 4JYAL 2C35B 3KYHC 3S24A 3CW2C 2HHHL 4DAYB 4UPAA 1WYDA 4DV0Q 2NZHA 3CPFA 3DM3A 3M4PA 4B3MQ 1Z47A 2VQEL 4IOCA 1IXRA 2R7DA 3J81c 3TEHB 3ICEA 2D0PA 4A3FH 5C4JH 3GO5A 4R4QA 4MTNA 4LW1A 2UUCQ 2DUDA 3RLFA 3A5UA 4HIKA 1KIXA 1CSPA 4ALPA 4LFBL 2F52A 2R7FA 5ELNA 1G291 4MNOA 4LFBQ 2GVAA 1C9OA 3PF4A 2R92H 1HNZQ 4DR6L 3F8TA 1UEBA 2N49A 3K81C 1GO3E 3W1GA 3KDFA 4YWMA 1GVPA 5J3BA 3L2PA 2ZJRA 3T1YQ 1Y1WG 1VQFA 3M85A 1PH5A 3GTGH 3M7NA 3K0XA 4DKAC 5BR8L 4LFCL 3FP9A 4YHHL 1SROA 1NE3A 1E22A 3I7FA 3U4VA 3PIOA 4B3RQ 2VUMH 2LSSA 4HJAA 1VS0A 4ME3A 1KL9A 3GTJH 1YNXA 1WCMH 4JI5Q 5IWAQ 4LF5L 3PSIA 5IYDG 4DV0L 3M4QA 4DR3Q 3E0EA 4GS3A 1VQMA 4KI0A 4LF9Q 1J6QA 2JQOA 3S1MH 4A3EG 4POFA 2OQKA 4OO1G 4OO1I 4QJFA 4BY1H 2UXCQ 2UUCL 4DV6Q 1I94Q 4LNQA 2JA6H 2F4VQ 2IT1A 4YCVA 5JEAJ 4BY7H 1L1OC 1SLJA 2JEBI 1SFOH 1IYJB 4L5QA 5IT9c 4WJ3M 1T9HA 2OTJA 4DK3C 2MO1A 3HKSA 4R4TA 1YHQA 4JBKA 3I4OA 4L5SA 3JAMi 1JE5A 1HNZL 1L1OB 3TRZA 1WFQA 4YWKA 2R7ZH 1W2BA 3HOUG 1XMQQ 4X64L 1Q1BA 3AQQA 2JA7H 4P74A 3T1YL 2BH8A 3HOZH 1U5KA 5C4XG 1B8AA 1E3PA 3K7UC 4OONA 1J5EQ 1YEZA 2NVYH 1SN8A 4LUZA 2Q2HA 1IBKL 4NXNQ 3PGZA 1L1OA 2Z6KA 1GKHA 1VQAA 3I4MH 3J81i 4B3RL 1HNWQ 1U0LA 5FJ8G 3PO2H 1FJGQ 4IPCA 2YU9H 3HKZE 3GTLH 2K5VA 2Z0SA 3L7ZC 5IWAL 4X62Q 5FLMG 3HOXG 1EIYB 1N9WA 3UDGA 4JCVE 3FHWA 4JG2A 1P16A 1YI2A 3K7AH 2VZAA 1IBLQ 4KHPL 5C44G 1I94L 4JI1Q 4EQ5A 2F4VL 3S17H 3TS2A 1X9NA 2UUBL 1K83H 1PH2A 3ULLA 3F2BA 3WWVA 3S2DH 4AYBE 2KENA 4R4CA 4TVAB 5EAYA 4BBRH 5M3FG 2RHSB 4A3KG 1N33Q 1HR0Q 2Q2UA 1XMQL 1YJWA 3U50C 4DNIA 4R4OA 1EQQA 3KF8B 1IBMQ 3F2CA 1H95A 2R6GA 4YCWA 1SR3A 2K14A 1D8LA 4TQUS 2LXKA 2K5NA 4DV2L 3CXCA 4A3IH 1HNWL 3CMEA 1KHIA 1FJGL 5GROA 1CKOA 5GAEC 3UDFA 1G51A 2CFMA 5LMNQ 2IHFA 4UP7A 4DK6C 4DUZQ 1K73C 1PA6A 1Y1VG 2KCTA 3W1BA 1CKNA 2CWPA 3KLWA 2JA8G 1C7YA 1TWAH 2MO0A 2KBNA 1MKHA 4LF6L 2UUAQ 2IX1A 2WFWA 3I4NG 4A3GG 3NEMA 3PCOB 2ES2A 4Y52H 1E24A 4DR5L 1A62A 2E5LQ 2RHQB 1XPUA 4JV5Q 2PMZE 3FKIG 3SGIA 1B70B 3CCJA 4XIGS 2I5LX 1YJNA 1LYLA 5GAGC 1N8RC 4BXXG 1ASZA 3BU2A 1TWCH 1E7ZA 3EBEA 3TREA 1N33L 1LUZA 4JBWA 1YHBA 3L0OA 5C3EG 3CCQA 4A76A 1VQ5A 1IBML 3H0GG 4L5RC 1QZHA 2R93H 3EIVA 3CF5A 3KDFB 1VQ8A 2YYZA 2VY3A 4OWXB 4B3TL 2JEAI 1YJ9A 1XMOQ 1KRSA 1JMCA 3STBD 1Q1EA 1JJCB 4GLAC 4NXML 1YITA 1WOCA 2D62A 2PI2E 2ASBA 5JJIA 4POGA 2Y0SE 4P72A 3CC4A 1VQOA 5LMNL 1IL2A 2NVTH 4A3FG 4JC0A 4DUZL 4LF7Q 3J80c 1N32Q 4QY7A 2VQFQ 1Y14B 2ZM6Q 3VDYA 4NPSA 1OTCA 4JI4Q 3HOWH 4DAMA 1PYBA 4FDBA 1TWHH 5IP9H 2VL6A 2WAQE 2ZTEA 5IYBH 1XTDA 2NZOA 4JI2Q 4DR1Q 1PH8A 2E5LL 2K52A 3Q8DA 3KOJA 2R92G 1GM5A 3D31A 4IPDA 4R4IA 1M1KC 4DV5Q 5DLQE 1DGSA 4JV5L 1VCIA 3PUVA 1Z9FA 2OCEA 4IOAA 1I5FA 2QEXA 4QGUA 4O0AA 5M3MH 4B3ML 4B3SQ 4GN3B 5HGQA 3S2HH 1HZAA 1X6OA 4AIMA 4JI3Q 2NVQH 3CCSA 3G71A 3HOYG 2XTIA 4C3IH 2VUMG 4RMFA 2CQOA 4IPHA 4DV1Q 3ULPA 4A3JH 4QQBX 1XNQQ 3OYYA 3RN5A 1KC8C 1WCMG 4C3JH 4C3HH 2AWNA 3CPWA 3CCVA 3DLLA 1BBUA 2V1CC 3HOVH 2EIFA 1K3RA 4BBSH 1VQPA 1K8GA 5IYCH 1S3OA 4GKKQ 1OXUA 1A63A 2WB1E 4BY1G 4LF7L 1PHJA 2JA6G 4GNXC 4A3DH 5JEAG 2ZM6L 4JI4L 3GTQH 2Q2IA 1VQGA 1FVIA 2AWOA 5FLXc 2Q2TA 4BY7G 4L5TA 4O2DA 1OXXK 1QVFA 4LFAQ 1Q7YC 2AMCB 3BJUA 3ERSX 3K8AA 4DR1L 2JA5H 5IP7H 4JI2L 3AEVA 3RZOH 4AQYQ 2B63G 2UXDQ 4APVA 2VW9A 4DV5L 4YWLA 1V1QA 1MJEA 2MNAA 4JI5L 1PH4A 4A3BG 1VQIA 1L0WA 1EFWA 4YY3Q 4A93H 4GLXA 5M5XH 4DUYQ 2PQAA 4DR3L 1Q86C 2E8GA 1JJ2A 4B3SL 4LF9L 1QUQB 1K9MC 1VQ6A 5IY0A 2UXBQ 2H5XA 1N34Q 3J81j 2UU9Q 4X6AH 2UXCL 1FGUA 4DV6L 3S1RH 5M5YH 3MXNB 2L15A 1IZ6A 1G6PA 1HH2P 4K0KQ 2HT1A 3H3VH 1S72A 3W5OA 1K8AC 1XNQL 2HQLA 4X66Q 2JE6I 3G4SA 1PH6A 1QUQA 1GD7A 4DV3Q 5GAHC 4DV7Q 2FXQA 3KJPA 2LXJA 2WAQG 4IJLA 2QA4A 1VQLA 4GKKL 1JB7A 1B7YB 2YTVA 3NENA 4HIMA 1RL2A 2B29A 4A3LH 1VQ4A 2ID0A 1UWVA 1OXSC 4GN5A 3RNUA 1CKNB 4YCUA 3OTOQ 1J5EL 4JI6Q 4LFAL 1O7IA 1NBWA 2EXDA 3EN2A 4NXNL 1W3SA 3PUWA 1TWFH 3M9BA 1CSQA 1YVCA 4KHZA 1X3FA 3CCLA 4BBRG 2JK8A 4DPGA 4A3MH 3PF5A 2I5HA 4JBJA 3MEFA 4X62L 3CCRA 4YY3L 2VNUD 1AE3A 2VQEQ 4NB3A 2IY5B 4HJ8A 3PO3H 3UDIA 3E9IA 5E7NA 1PV4A 2UU9L 3UDXA 2MFIA 3AFPA 3ULJA 4A3IG 2IX0A 1IBLL 4JI1L 3CC2A 2GVBA 4GN4B 2N8NA 3K80C 3F2DA 1NTGA 3OW2A 3B6YA 4WJ4A 4A3CH 1KQSA 4BA1I 1PH7A 1MJCA 4LF4Q 2ZJQA 1E1OA 4JBMA 4DV7L 3IRBA 4EX5A 3PIPA 2NN6I 1XPOA 2E2HH 3S15H 1AH9A 2NN6G 1HR0L 4GLVB 1WI5A 2K75A 4JI8Q 3H15A 3TS0A 4R1JA 4A3BH 3CQZH 5JJKA 1K0RA 1V43A 1P8LA 2JJQA 3RLOA 2XGTA 3HKZG 1SMXA 3JAMc 5BR8Q 4LFCQ 2HIXA 4YHHQ 3A74A 5C3EH 3PV0A 2ZJPA 3KJOA 3U58A 2OTLA 4JI6L 4HJ9A 4P71A 1VQJA 4C2MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YV5 A;  3GTP H;  5LMN W;  5ELO A;  2I5M X;  3I2Z A;  1AE2 A;  4LF5 Q;  4DR4 Q;  4PMW A;  3I55 A;  1D7Q A;  3CD6 A;  3CC7 A;  2R93 G;  4A4I A;  3PUX A;  2ATW A;  1XNR Q;  1E1T A;  1A0I A;  3I56 A;  1X65 A;  2BA0 A;  1EIF A;  3CMA A;  3CCU A;  2HIV A;  3KFU A;  4LWC A;  2UUA L;  1EWI A;  1Y1W H;  4AYB G;  4IFD J;  3G48 A;  4LUO A;  3M3Y H;  1YHA A;  1UE5 A;  1V9P A;  1X3G A;  4OWT B;  3S16 H;  1PVO A;  1I50 H;  5HY6 A;  3PUY A;  4MZ9 A;  4LF4 L;  3HOW G;  1CKM A;  1YIJ A;  4UY8 C;  3T1H Q;  2IHE A;  1CUK A;  2N3S A;  3UE1 A;  4X64 Q;  5AJ3 Q;  3J7Z C;  4IO9 A;  4IFD I;  4JI8 L;  3U4Z A;  5IP9 G;  4IFD G;  4KLK A;  5IYD H;  2YTX A;  5IYB G;  4X65 Q;  1BBW A;  3RLN A;  2CKZ B;  2ZTC A;  2KHJ A;  3CP0 A;  3RR5 A;  1X54 A;  4A3E H;  1XMO L;  2RF4 A;  1L2F A;  1XPR A;  1IBK Q;  1BKB A;  1TWG H;  1HNX Q;  1LM0 A;  3HOY H;  4Y7N H;  5M3M G;  1YBY A;  1EQR A;  3HFZ B;  1OXT A;  3J7A 5;  5K36 G;  2OQ0 A;  2N78 A;  1KRT A;  4J15 A;  4GOP C;  4DR4 L;  1Q12 A;  4PZ8 A;  1TXY A;  4PG3 A;  4LF8 Q;  1N32 L;  1A8V A;  4PZ7 A;  2VQF L;  4HIO A;  1R9T H;  2JA9 A;  2A19 A;  2K50 A;  1QVG A;  2A8V A;  1SE8 A;  1UE7 A;  3HOU H;  3A5Z B;  1KAW A;  2PNH A;  2PQA B;  4GOP B;  4A3J G;  1Q46 A;  3RZD H;  1NMG A;  4KHP Q;  3HOZ G;  2KHI A;  4GNX B;  2OWO A;  1PH1 A;  4QIW E;  3S1N H;  3HOV G;  5C4X H;  5JJL A;  3GDE A;  1PH3 A;  2Z6K C;  3GD7 A;  4BBS G;  2UUB Q;  5IYC G;  2R7Z G;  1FL0 A;  1C0A A;  4XTC S;  5LMU Q;  1RIP A;  4P75 A;  2BH2 A;  3GTO H;  1XJV A;  5FJ8 H;  2JA7 G;  4IJH A;  2ZTD A;  2B63 H;  4A3D G;  1Q82 C;  1HZ9 A;  5GQO A;  4GOP A;  4PZ6 A;  3T1H L;  1KD1 C;  4OX9 Q;  1I3Q H;  4UP9 A;  5AJ3 L;  1SRU A;  1HZB A;  4JI3 L;  3A0J A;  1VQE A;  3D0F A;  5FLM H;  3HOX H;  4GNX A;  2E2J H;  2K5H A;  4X65 L;  3STB C;  5M5W H;  4UP8 A;  2E2I H;  1X55 A;  2JA5 G;  1VQ9 A;  2Y0S G;  3I4M G;  5IP7 G;  1MIU A;  4HJ5 A;  3CCE A;  3S14 H;  3PO2 G;  4DV1 L;  4RG1 A;  4HJ7 A;  4DV2 Q;  1EYG A;  3J80 i;  3AYH B;  5C44 H;  1HNX L;  3G6E A;  4DR2 Q;  1I6H H;  3UE0 A;  4A93 G;  3RN2 A;  4JI7 Q;  4A75 A;  1VQN A;  4OXP A;  3ER0 A;  3CCM A;  4P73 A;  1PFS A;  4BA2 I;  4AH6 A;  2MQH A;  1PH9 A;  1UE6 A;  2RCN A;  4LF8 L;  2VS1 A;  1XNR L;  2AKW B;  3PUZ A;  4LUV A;  4A3K H;  3BZC A;  5M3F H;  2KCM A;  2AHO B;  4GKJ Q;  4DV4 Q;  1HJP A;  2GN5 A;  2PI2 A;  3H3V I;  4LF6 Q;  3M4O H;  3KF6 B;  2CWA A;  1JT8 A;  4DR5 Q;  1VQH A;  1N36 Q;  4DR7 Q;  4JI0 Q;  1LTL A;  4JYA Q;  1Q8K A;  3ZJY C;  4AQY L;  1S40 A;  1NMF A;  2A1A A;  2UXD L;  2F3I A;  3JC6 6;  2DGY A;  1NJI C;  2HHH Q;  5IE8 A;  5LMU L;  3TQY A;  1QZG A;  3GTK H;  2QGQ A;  4OWW B;  4A3L G;  4DUY L;  3BZK A;  1VQ7 A;  2CCZ A;  4OX9 L;  2WP8 J;  1VQD A;  3KF6 A;  2UXB L;  4HID A;  1Y1V H;  1N34 L;  3AFQ A;  4H02 A;  5H1S E;  2JA8 H;  1Q81 C;  2K4K A;  4B3T Q;  3S1Q H;  2B3G A;  4JOI C;  2WB1 G;  4K0K L;  3CAM A;  1JJG A;  2NVX H;  3F1Z A;  1M90 C;  4A3M G;  4NXM Q;  3GTM H;  1OXV A;  3I4N H;  4A3G H;  1EUJ A;  1VQB A;  2ALY B;  4X66 L;  4DR2 L;  3E9H A;  4DR6 Q;  5C0X J;  4DV3 L;  1HR0 W;  1VQK A;  4JI7 L;  1X56 A;  1WJJ A;  3FKI H;  3PO3 G;  1X3E A;  1UE1 A;  4QL5 A;  2YTY A;  1QVC A;  2I0Q A;  1HZC A;  2BA1 A;  4BXX H;  1ASY A;  3NEL A;  3OTO L;  4GKJ L;  4DV4 L;  1VQC A;  1KXL A;  3H0G H;  3NBH B;  1BVS A;  1PYS B;  4JOI A;  5C0X I;  5C0X G;  4A3C G;  1N36 L;  5GAD C;  4DR7 L;  2D0O A;  2EQS A;  1YZ6 A;  1EOV A;  3LGJ A;  1NY4 A;  4IPG A;  4JI0 L;  4JYA L;  2C35 B;  3KYH C;  3S24 A;  3CW2 C;  2HHH L;  4DAY B;  4UPA A;  1WYD A;  4DV0 Q;  2NZH A;  3CPF A;  3DM3 A;  3M4P A;  4B3M Q;  1Z47 A;  2VQE L;  4IOC A;  1IXR A;  2R7D A;  3J81 c;  3TEH B;  3ICE A;  2D0P A;  4A3F H;  5C4J H;  3GO5 A;  4R4Q A;  4MTN A;  4LW1 A;  2UUC Q;  2DUD A;  3RLF A;  3A5U A;  4HIK A;  1KIX A;  1CSP A;  4ALP A;  4LFB L;  2F52 A;  2R7F A;  5ELN A;  1G29 1;  4MNO A;  4LFB Q;  2GVA A;  1C9O A;  3PF4 A;  2R92 H;  1HNZ Q;  4DR6 L;  3F8T A;  1UEB A;  2N49 A;  3K81 C;  1GO3 E;  3W1G A;  3KDF A;  4YWM A;  1GVP A;  5J3B A;  3L2P A;  2ZJR A;  3T1Y Q;  1Y1W G;  1VQF A;  3M85 A;  1PH5 A;  3GTG H;  3M7N A;  3K0X A;  4DKA C;  5BR8 L;  4LFC L;  3FP9 A;  4YHH L;  1SRO A;  1NE3 A;  1E22 A;  3I7F A;  3U4V A;  3PIO A;  4B3R Q;  2VUM H;  2LSS A;  4HJA A;  1VS0 A;  4ME3 A;  1KL9 A;  3GTJ H;  1YNX A;  1WCM H;  4JI5 Q;  5IWA Q;  4LF5 L;  3PSI A;  5IYD G;  4DV0 L;  3M4Q A;  4DR3 Q;  3E0E A;  4GS3 A;  1VQM A;  4KI0 A;  4LF9 Q;  1J6Q A;  2JQO A;  3S1M H;  4A3E G;  4POF A;  2OQK A;  4OO1 G;  4OO1 I;  4QJF A;  4BY1 H;  2UXC Q;  2UUC L;  4DV6 Q;  1I94 Q;  4LNQ A;  2JA6 H;  2F4V Q;  2IT1 A;  4YCV A;  5JEA J;  4BY7 H;  1L1O C;  1SLJ A;  2JEB I;  1SFO H;  1IYJ B;  4L5Q A;  5IT9 c;  4WJ3 M;  1T9H A;  2OTJ A;  4DK3 C;  2MO1 A;  3HKS A;  4R4T A;  1YHQ A;  4JBK A;  3I4O A;  4L5S A;  3JAM i;  1JE5 A;  1HNZ L;  1L1O B;  3TRZ A;  1WFQ A;  4YWK A;  2R7Z H;  1W2B A;  3HOU G;  1XMQ Q;  4X64 L;  1Q1B A;  3AQQ A;  2JA7 H;  4P74 A;  3T1Y L;  2BH8 A;  3HOZ H;  1U5K A;  5C4X G;  1B8A A;  1E3P A;  3K7U C;  4OON A;  1J5E Q;  1YEZ A;  2NVY H;  1SN8 A;  4LUZ A;  2Q2H A;  1IBK L;  4NXN Q;  3PGZ A;  1L1O A;  2Z6K A;  1GKH A;  1VQA A;  3I4M H;  3J81 i;  4B3R L;  1HNW Q;  1U0L A;  5FJ8 G;  3PO2 H;  1FJG Q;  4IPC A;  2YU9 H;  3HKZ E;  3GTL H;  2K5V A;  2Z0S A;  3L7Z C;  5IWA L;  4X62 Q;  5FLM G;  3HOX G;  1EIY B;  1N9W A;  3UDG A;  4JCV E;  3FHW A;  4JG2 A;  1P16 A;  1YI2 A;  3K7A H;  2VZA A;  1IBL Q;  4KHP L;  5C44 G;  1I94 L;  4JI1 Q;  4EQ5 A;  2F4V L;  3S17 H;  3TS2 A;  1X9N A;  2UUB L;  1K83 H;  1PH2 A;  3ULL A;  3F2B A;  3WWV A;  3S2D H;  4AYB E;  2KEN A;  4R4C A;  4TVA B;  5EAY A;  4BBR H;  5M3F G;  2RHS B;  4A3K G;  1N33 Q;  1HR0 Q;  2Q2U A;  1XMQ L;  1YJW A;  3U50 C;  4DNI A;  4R4O A;  1EQQ A;  3KF8 B;  1IBM Q;  3F2C A;  1H95 A;  2R6G A;  4YCW A;  1SR3 A;  2K14 A;  1D8L A;  4TQU S;  2LXK A;  2K5N A;  4DV2 L;  3CXC A;  4A3I H;  1HNW L;  3CME A;  1KHI A;  1FJG L;  5GRO A;  1CKO A;  5GAE C;  3UDF A;  1G51 A;  2CFM A;  5LMN Q;  2IHF A;  4UP7 A;  4DK6 C;  4DUZ Q;  1K73 C;  1PA6 A;  1Y1V G;  2KCT A;  3W1B A;  1CKN A;  2CWP A;  3KLW A;  2JA8 G;  1C7Y A;  1TWA H;  2MO0 A;  2KBN A;  1MKH A;  4LF6 L;  2UUA Q;  2IX1 A;  2WFW A;  3I4N G;  4A3G G;  3NEM A;  3PCO B;  2ES2 A;  4Y52 H;  1E24 A;  4DR5 L;  1A62 A;  2E5L Q;  2RHQ B;  1XPU A;  4JV5 Q;  2PMZ E;  3FKI G;  3SGI A;  1B70 B;  3CCJ A;  4XIG S;  2I5L X;  1YJN A;  1LYL A;  5GAG C;  1N8R C;  4BXX G;  1ASZ A;  3BU2 A;  1TWC H;  1E7Z A;  3EBE A;  3TRE A;  1N33 L;  1LUZ A;  4JBW A;  1YHB A;  3L0O A;  5C3E G;  3CCQ A;  4A76 A;  1VQ5 A;  1IBM L;  3H0G G;  4L5R C;  1QZH A;  2R93 H;  3EIV A;  3CF5 A;  3KDF B;  1VQ8 A;  2YYZ A;  2VY3 A;  4OWX B;  4B3T L;  2JEA I;  1YJ9 A;  1XMO Q;  1KRS A;  1JMC A;  3STB D;  1Q1E A;  1JJC B;  4GLA C;  4NXM L;  1YIT A;  1WOC A;  2D62 A;  2PI2 E;  2ASB A;  5JJI A;  4POG A;  2Y0S E;  4P72 A;  3CC4 A;  1VQO A;  5LMN L;  1IL2 A;  2NVT H;  4A3F G;  4JC0 A;  4DUZ L;  4LF7 Q;  3J80 c;  1N32 Q;  4QY7 A;  2VQF Q;  1Y14 B;  2ZM6 Q;  3VDY A;  4NPS A;  1OTC A;  4JI4 Q;  3HOW H;  4DAM A;  1PYB A;  4FDB A;  1TWH H;  5IP9 H;  2VL6 A;  2WAQ E;  2ZTE A;  5IYB H;  1XTD A;  2NZO A;  4JI2 Q;  4DR1 Q;  1PH8 A;  2E5L L;  2K52 A;  3Q8D A;  3KOJ A;  2R92 G;  1GM5 A;  3D31 A;  4IPD A;  4R4I A;  1M1K C;  4DV5 Q;  5DLQ E;  1DGS A;  4JV5 L;  1VCI A;  3PUV A;  1Z9F A;  2OCE A;  4IOA A;  1I5F A;  2QEX A;  4QGU A;  4O0A A;  5M3M H;  4B3M L;  4B3S Q;  4GN3 B;  5HGQ A;  3S2H H;  1HZA A;  1X6O A;  4AIM A;  4JI3 Q;  2NVQ H;  3CCS A;  3G71 A;  3HOY G;  2XTI A;  4C3I H;  2VUM G;  4RMF A;  2CQO A;  4IPH A;  4DV1 Q;  3ULP A;  4A3J H;  4QQB X;  1XNQ Q;  3OYY A;  3RN5 A;  1KC8 C;  1WCM G;  4C3J H;  4C3H H;  2AWN A;  3CPW A;  3CCV A;  3DLL A;  1BBU A;  2V1C C;  3HOV H;  2EIF A;  1K3R A;  4BBS H;  1VQP A;  1K8G A;  5IYC H;  1S3O A;  4GKK Q;  1OXU A;  1A63 A;  2WB1 E;  4BY1 G;  4LF7 L;  1PHJ A;  2JA6 G;  4GNX C;  4A3D H;  5JEA G;  2ZM6 L;  4JI4 L;  3GTQ H;  2Q2I A;  1VQG A;  1FVI A;  2AWO A;  5FLX c;  2Q2T A;  4BY7 G;  4L5T A;  4O2D A;  1OXX K;  1QVF A;  4LFA Q;  1Q7Y C;  2AMC B;  3BJU A;  3ERS X;  3K8A A;  4DR1 L;  2JA5 H;  5IP7 H;  4JI2 L;  3AEV A;  3RZO H;  4AQY Q;  2B63 G;  2UXD Q;  4APV A;  2VW9 A;  4DV5 L;  4YWL A;  1V1Q A;  1MJE A;  2MNA A;  4JI5 L;  1PH4 A;  4A3B G;  1VQI A;  1L0W A;  1EFW A;  4YY3 Q;  4A93 H;  4GLX A;  5M5X H;  4DUY Q;  2PQA A;  4DR3 L;  1Q86 C;  2E8G A;  1JJ2 A;  4B3S L;  4LF9 L;  1QUQ B;  1K9M C;  1VQ6 A;  5IY0 A;  2UXB Q;  2H5X A;  1N34 Q;  3J81 j;  2UU9 Q;  4X6A H;  2UXC L;  1FGU A;  4DV6 L;  3S1R H;  5M5Y H;  3MXN B;  2L15 A;  1IZ6 A;  1G6P A;  1HH2 P;  4K0K Q;  2HT1 A;  3H3V H;  1S72 A;  3W5O A;  1K8A C;  1XNQ L;  2HQL A;  4X66 Q;  2JE6 I;  3G4S A;  1PH6 A;  1QUQ A;  1GD7 A;  4DV3 Q;  5GAH C;  4DV7 Q;  2FXQ A;  3KJP A;  2LXJ A;  2WAQ G;  4IJL A;  2QA4 A;  1VQL A;  4GKK L;  1JB7 A;  1B7Y B;  2YTV A;  3NEN A;  4HIM A;  1RL2 A;  2B29 A;  4A3L H;  1VQ4 A;  2ID0 A;  1UWV A;  1OXS C;  4GN5 A;  3RNU A;  1CKN B;  4YCU A;  3OTO Q;  1J5E L;  4JI6 Q;  4LFA L;  1O7I A;  1NBW A;  2EXD A;  3EN2 A;  4NXN L;  1W3S A;  3PUW A;  1TWF H;  3M9B A;  1CSQ A;  1YVC A;  4KHZ A;  1X3F A;  3CCL A;  4BBR G;  2JK8 A;  4DPG A;  4A3M H;  3PF5 A;  2I5H A;  4JBJ A;  3MEF A;  4X62 L;  3CCR A;  4YY3 L;  2VNU D;  1AE3 A;  2VQE Q;  4NB3 A;  2IY5 B;  4HJ8 A;  3PO3 H;  3UDI A;  3E9I A;  5E7N A;  1PV4 A;  2UU9 L;  3UDX A;  2MFI A;  3AFP A;  3ULJ A;  4A3I G;  2IX0 A;  1IBL L;  4JI1 L;  3CC2 A;  2GVB A;  4GN4 B;  2N8N A;  3K80 C;  3F2D A;  1NTG A;  3OW2 A;  3B6Y A;  4WJ4 A;  4A3C H;  1KQS A;  4BA1 I;  1PH7 A;  1MJC A;  4LF4 Q;  2ZJQ A;  1E1O A;  4JBM A;  4DV7 L;  3IRB A;  4EX5 A;  3PIP A;  2NN6 I;  1XPO A;  2E2H H;  3S15 H;  1AH9 A;  2NN6 G;  1HR0 L;  4GLV B;  1WI5 A;  2K75 A;  4JI8 Q;  3H15 A;  3TS0 A;  4R1J A;  4A3B H;  3CQZ H;  5JJK A;  1K0R A;  1V43 A;  1P8L A;  2JJQ A;  3RLO A;  2XGT A;  3HKZ G;  1SMX A;  3JAM c;  5BR8 Q;  4LFC Q;  2HIX A;  4YHH Q;  3A74 A;  5C3E H;  3PV0 A;  2ZJP A;  3KJO A;  3U58 A;  2OTL A;  4JI6 L;  4HJ9 A;  4P71 A;  1VQJ A;  4C2M H; 
#chains in the Genus database with same CATH topology
 1QJO A;  1VMC A;  2JP1 A;  3I2Z A;  1BBX C;  1QB5 D;  2E75 C;  2A68 D;  5CGK A;  3W2D A;  3DEO A;  4LWC A;  2R93 B;  1Y1W H;  4CBV A;  3G48 A;  1HUM A;  1PRT C;  1V9P A;  3DEP A;  3S16 H;  2F0K A;  1PVO A;  1I50 H;  5HY6 A;  4AYB B;  2I07 B;  3PUY A;  3I90 A;  2DNC A;  5M9O A;  4DAV A;  1YIJ A;  1TKW B;  3EA6 A;  1CUK A;  2N3S A;  3HEJ A;  3MZ5 A;  3RMH A;  2F0P A;  3U4Z A;  5IYB G;  3SK5 A;  3HOW B;  1BBW A;  3RLN A;  1C8C A;  2ZTC A;  3K5L A;  3RR5 A;  4OO1 H;  1L2F A;  4X3S A;  1IBK Q;  3TZU A;  4O42 A;  4Y7N H;  1DYQ A;  1YBY A;  3BS1 A;  3KBX A;  1Q12 A;  3QG1 A;  4PG3 A;  5I6W A;  3G7L A;  5M3M B;  1NSN S;  2A8V A;  4IAL A;  1SE8 A;  1UE7 A;  3BVM A;  2PQA B;  4A3J G;  1Q46 A;  1CT1 D;  4C3J G;  4QIW E;  1H9M A;  3GDE A;  1F77 A;  1IW7 D;  3GD7 A;  2Z4H A;  5IYC G;  4C1N I;  4P75 A;  4C3H B;  1NR2 A;  1XJV A;  3J7A V;  2ZTD A;  1Q82 C;  4OX9 Q;  2R7Z B;  4UP9 A;  2BDN A;  4JI3 L;  3HOX H;  2DY8 A;  2K05 A;  2K5H A;  2K03 A;  3GV3 A;  2Z9H A;  3STB C;  5M5W H;  2E2I H;  2JA7 B;  5IP7 G;  3S14 H;  4HJ7 A;  3NTH A;  3J80 i;  3AYH B;  5IGE A;  1EIH A;  3GP7 A;  2Y0S B;  4NKL A;  3RZO B;  4A93 G;  1ML0 D;  3RN2 A;  4JI7 Q;  4A75 A;  5DAU A;  1EY9 A;  1NR4 A;  4AH6 A;  2MQH A;  1PH9 A;  2RCN A;  1F9P A;  4LUV A;  5JVH 3;  1H9K A;  3BZC A;  2KCM A;  3J80 E;  1HJP A;  4LF6 Q;  3K7A B;  4HAE A;  5M5Y B;  4JI0 Q;  1LTL A;  3MFY A;  4AQY L;  3JC6 6;  2F0I A;  2X6G A;  3TQY A;  3MHB A;  5EKI A;  1Z6H A;  2CCZ A;  2HDL A;  4OX9 L;  2F0O A;  3OIQ A;  1VQD A;  1O7Z A;  2OEO A;  4HID A;  2XSC A;  1N34 L;  3AFQ A;  2RQX A;  2JA8 H;  2CHB D;  2IJ0 A;  5K5P A;  4JOI C;  3H91 A;  1JJG A;  4EQO A;  1OXV A;  2ALY B;  1DCZ A;  3E9H A;  1SNP A;  4HN7 A;  1HR0 W;  3I72 A;  4JI7 L;  1WJJ A;  3EFX D;  1QVC A;  1GXD C;  3TZD A;  4J1M A;  1JE4 A;  3SR1 A;  4JOI A;  2D0O A;  2EQS A;  4JI0 L;  1LT4 D;  4DAY B;  2OT2 A;  3M7G A;  3DM3 A;  3M4P A;  4B3M Q;  1Z47 A;  1RF2 D;  4J6H A;  4IOC A;  2EJF C;  1ROD A;  3TEH B;  4K14 A;  3GO5 A;  2UUC Q;  2CW0 D;  3E0J A;  1B1Z A;  2F3V A;  4H13 C;  4HIK A;  2K32 A;  4DAY A;  1AZP A;  1SYD A;  5L37 A;  2F52 A;  3QOL A;  4N8X 1;  1CA5 A;  3OWF A;  3F8T A;  2HCC A;  2EYJ A;  1GO3 E;  2NVT B;  4YWM A;  3JAM L;  3T1Y Q;  1Y1W G;  2ZJR A;  2QKI C;  3GTG H;  4YHH L;  1EEI D;  4B08 A;  4G7O C;  4TKO B;  2CQA A;  5COY A;  2VUM H;  3M3Y B;  2F0E A;  2DN8 A;  4M8A A;  4ME3 A;  1KL9 A;  3GTJ H;  1S4Z A;  1DXM A;  3R8B A;  2A69 C;  5HUR A;  2EYF A;  3ND9 A;  2J0T D;  4GS3 A;  4RGM A;  3S1M H;  1LT6 D;  3CKI B;  4HCE A;  4IUQ A;  4C3I G;  2OQK A;  3I73 A;  4POF A;  4OO1 G;  2PZW A;  4QJF A;  2UUC L;  1F9Q A;  4DV6 Q;  1I94 Q;  4LNQ A;  2JA6 H;  4KK7 A;  1FNV A;  3D4D A;  4BY7 H;  1L1O C;  2JEB I;  1IYJ B;  1TWG B;  1PYW D;  2OTJ A;  4K6D A;  4R4T A;  4C3J B;  1IKL A;  4LJZ C;  1L1O B;  5CYU A;  1WFQ A;  4YWK A;  1FGB D;  4X64 L;  1GUT A;  4OIK A;  3T1Y L;  2BH8 A;  1R9T B;  4N8F A;  1Y8P B;  1J5E Q;  3HOU B;  2EYL A;  4TSS A;  5BN5 A;  2QIL A;  5C3X A;  1L1O A;  1SYG A;  3PO2 H;  1LT5 D;  3HKZ E;  2P5Z X;  3GTL H;  4FNF A;  4Q0F A;  1DOM A;  1EIY B;  3HOX G;  2O4X A;  3LWU A;  4A93 B;  4UAI A;  5M5X B;  4IUT A;  5ELE A;  1QIL A;  1I94 L;  1BXT A;  4ILW A;  1X9N A;  2EXZ A;  2F0W A;  4G57 A;  1K83 H;  1F2Y A;  1HR0 Q;  3KUP A;  4DNI A;  2RDF A;  1IBM Q;  1H95 A;  5BN3 A;  4YCW A;  5M3F B;  2K14 A;  3M4O B;  2LXK A;  1EWH A;  2CH4 A;  3CME A;  4G7H C;  5GRO A;  3BVG A;  3GTK B;  2L4N A;  2KCT A;  4OL7 A;  3SEB A;  2CWP A;  3KLW A;  1EQV A;  2JA8 G;  1BUV T;  2MO0 A;  3DWQ A;  5IGD A;  2F0U A;  1STB A;  2ES2 A;  3PCO B;  4Y52 H;  4DR5 L;  1A62 A;  2FIN B;  2PMZ E;  2WIN B;  4JW0 A;  3SGI A;  2NVX B;  1B70 B;  3I4N B;  3CCJ A;  3TBI B;  2XNA C;  5KGU A;  3P75 A;  1ILP A;  3BU2 A;  1TWC H;  1E7Z A;  3TRE A;  4DNR B;  1LUZ A;  1SYF A;  1YHB A;  1KAA A;  1HPC A;  4A76 A;  3IL8 A;  1IBM L;  2R93 H;  1QZH A;  3EIV A;  3CF5 A;  3KDF B;  4KN7 C;  1VQ8 A;  4FXD A;  2DJF C;  1JMC A;  3NE5 B;  1Q1E A;  4NXM L;  1BF4 A;  1JC7 A;  2H1E A;  3D8G A;  2PNR C;  3C1F A;  3VDY A;  3HOW H;  4NPS A;  5A2Q E;  1PYB A;  4NW2 A;  2WAQ E;  1C4Q A;  4DR1 Q;  3KOJ A;  2AQ2 B;  1GM5 A;  4IPD A;  4R4I A;  4XT3 B;  1DGS A;  2V4D A;  1TY2 A;  2DNE A;  4KY6 A;  1VCI A;  1I5F A;  5M3M H;  1GUS A;  5K36 H;  4AIM A;  1X6O A;  1D5M C;  3C1E A;  2NVQ H;  1EZ8 A;  3HOY G;  3P7J A;  4UHV A;  2A6E D;  3LNN A;  2VUM G;  4RMF A;  5EKK A;  4DV1 Q;  2B2Y C;  3ULP A;  1CA6 A;  1XNQ Q;  4C3H H;  1G91 A;  4Y7N B;  1SYE A;  3GQB A;  3V05 A;  4FO2 A;  3RUZ A;  1ZKO A;  4GKK Q;  3D3R A;  3PMF A;  2JSO A;  4CDD C;  3Q0A A;  1SE2 A;  2C9O A;  2JA6 G;  2NB0 A;  2Q2I A;  3PIO 3;  2AWO A;  5FLX c;  1X3P A;  4BY7 G;  2IWH A;  2K01 A;  2XN9 C;  1Q7Y C;  2B2Y A;  3AEV A;  4DR1 L;  4QCL A;  3RZO H;  5G3L D;  4APV A;  3FRP B;  4U68 A;  2BCO A;  2F0Q A;  2EVB A;  1JR0 D;  2X69 A;  4LF9 L;  1K9M C;  2SNM A;  1VQ6 A;  2UXB Q;  2H5X A;  1QE6 A;  1UAP A;  2QF7 A;  3J81 j;  4X6A H;  2UXC L;  2HD3 A;  5M5Y H;  3MXN B;  2L15 A;  5CMD A;  2NVY B;  2K5D A;  1XNQ L;  1ESF A;  3Q23 A;  3G4S A;  1PH6 A;  1GD7 A;  1D6E C;  4F7X A;  1VQL A;  3KJP A;  4IJL A;  4GKK L;  1K3B C;  3NEN A;  1A3V A;  1VQ4 A;  2O2L D;  2F0H A;  3NSW A;  4K5X A;  1OXS C;  4YCU A;  1HCZ A;  1NBW A;  3WOF A;  3EN2 A;  1EEF D;  1H9J A;  1RTN A;  4FYD A;  3CCL A;  1BCP B;  1AFP A;  5FO9 B;  1D1K A;  4OEL B;  4R8I A;  1AE3 A;  2VQE Q;  2EYM A;  4XDX A;  1QG7 A;  1JOO A;  3FEW X;  5E7N A;  2Z1C A;  1EL0 A;  3K5M A;  5LHY 1;  3B6Y A;  1YNJ C;  5C0X H;  3G6J B;  1PH7 A;  4LF4 Q;  2E2H H;  3M4Y A;  1PRT F;  2HCI A;  2PYK A;  1T5X D;  2F0N A;  3H15 A;  1AH9 A;  4R1J A;  1K0R A;  2G5D A;  1TWA B;  2ZJP A;  3PV0 A;  3U58 A;  3KJO A;  3MA2 B;  5KYL A;  1SAP A;  1CI3 M;  5KEE A;  2YV5 A;  5ELD A;  5LMN W;  1F2M A;  1CTM A;  1AE2 A;  1SND A;  2NZ1 D;  3VA5 A;  4LF5 Q;  5I4D A;  1SMY D;  2MHV A;  1D7Q A;  3MVV A;  2R93 G;  1E1T A;  4PQX A;  1EIF A;  3CMA A;  3CCU A;  2HIV A;  1SNC A;  4AYB G;  3M3Y H;  3R2I A;  1YHA A;  1SE4 A;  5I6Y A;  3K6O A;  4WOR A;  3SDZ A;  4KTA A;  4LF4 L;  3HOW G;  1RJT A;  4XYO A;  3J7Z C;  2EE1 A;  4RA8 A;  5IYD H;  4R8N A;  1H9R A;  2H4O A;  2KVM A;  2CKZ B;  3NK9 A;  2KHJ A;  3CP0 A;  1TWH B;  1X54 A;  1XMO L;  2RF4 A;  1XPR A;  3MXP A;  4WJW A;  1TWG H;  4ZKC B;  1O7L A;  3K5O A;  2R61 A;  4G4K A;  5M3M G;  3HFZ B;  3J7A 5;  3J80 L;  3IFT A;  5K36 G;  2PCF B;  4J15 A;  1N32 L;  4LF8 Q;  3NPP A;  2VQF L;  4HIO A;  1R9T H;  3S1M B;  3HOU H;  3A5Z B;  1CQF A;  2PNH A;  3DWP A;  1I4P A;  5CV5 A;  4DN4 M;  4C3H G;  3S9W A;  5JJL A;  2IW3 A;  1PH3 A;  1QNU A;  2R7Z G;  1C0A A;  4XTC S;  1B3Q A;  1PLF A;  4XQN A;  2PPB C;  4OHJ A;  3A7L A;  2JA7 G;  2A6H C;  5KNB A;  5IGF A;  5AFW A;  5FK9 C;  1VQE A;  2E2J H;  4E6I A;  1LLR D;  4L63 B;  2Y0S G;  4HJ5 A;  3CCE A;  2LMC B;  4DV2 Q;  1BQQ T;  1TU2 B;  1LTA D;  3G6E A;  1I6H H;  5D65 A;  3TN2 A;  3UE0 A;  3PO2 B;  1C48 A;  3ER0 A;  1UE6 A;  4LF8 L;  3SHL A;  4QMG A;  3EVQ A;  5M3F H;  4GKJ Q;  3H3V I;  2PI2 A;  5BN4 A;  3M4O H;  1JT8 A;  1VQH A;  2UXD L;  1K83 B;  2DGY A;  3GTK H;  4ODG A;  5DM7 3;  1H9S B;  2K4K A;  2CH4 W;  3TP6 A;  3SVM A;  2NVX H;  3I4N H;  3LWE A;  1TWF B;  5IOC A;  1VQK A;  4EQN A;  1X56 A;  1X3E A;  4C1N K;  1WTO A;  1B2T A;  1KTK A;  1ASY A;  3PO3 B;  3MTS A;  1MD2 D;  3OTO L;  4GKJ L;  2FMM A;  1VQC A;  3NBH B;  2N88 A;  1DJR D;  5C0X G;  4KKU A;  5GAD C;  1STA A;  1EOV A;  5C5L A;  3R93 A;  1VF5 C;  2RDG A;  3CW2 C;  1WYD A;  1PFM A;  3CPF A;  1TWC B;  3J81 c;  4RFB A;  1S5C D;  3NBH A;  3ICE A;  2EYH A;  3TME A;  4A3F H;  1G6Z A;  4K2K A;  2DUD A;  1KIX A;  1Z7T A;  3I70 A;  5ELN A;  1F2L A;  2B2T C;  1G29 1;  4MNO A;  1EYA A;  1B9M A;  3GTP B;  1BNZ A;  1PRT B;  1S5E D;  1ZXT A;  2XWJ B;  1UEB A;  3K81 C;  2D5D A;  3W1G A;  4RCN A;  1STG A;  1ICW A;  1WTW A;  1GVP A;  1HHV A;  1VQF A;  2IL8 A;  3M7N A;  4LFC L;  3FP9 A;  4L8J A;  1GUN A;  2EJG C;  4F87 A;  3IAY A;  4B3R Q;  2G9D A;  4RHR A;  4JI5 Q;  5IWA Q;  5JAV A;  3K0Y A;  3PSI A;  5IYD G;  3M4Q A;  5I2X A;  4GZY C;  1SNO A;  2BE5 C;  4KI0 A;  2JQO A;  4OO1 I;  1A2T A;  2NVQ B;  2JYO A;  4RHS A;  2F4V Q;  4RGN A;  4A3E B;  1WVL A;  3QWN A;  5IT9 c;  1AN8 A;  4WJ3 M;  3Q6S A;  4L5S A;  1MI2 A;  3I4O A;  4ZCK A;  1EY6 A;  1X3Q A;  3HOU G;  2K04 A;  3AQQ A;  1U5K A;  1DZ1 A;  1B8A A;  1XX8 A;  4OON A;  5C6A A;  1YEZ A;  2NVY H;  1SN8 A;  3RZD B;  1IBK L;  4N9P A;  1HNW Q;  3S1N B;  3I4M H;  3J81 i;  4B3R L;  1O80 A;  1U0L A;  1FJG Q;  2F03 A;  3H09 A;  1QOH A;  3L7Z C;  5IWA L;  1HTL D;  2A68 C;  4X62 Q;  2FMC A;  4EGV A;  3UDG A;  4JCV E;  4JVZ A;  3FHW A;  4JG2 A;  1EZ6 A;  3IKJ A;  4RAU C;  1P16 A;  2VZA A;  3J81 E;  1IBL Q;  5J39 A;  4JI1 Q;  2F4V L;  5FOB B;  2KOL A;  1U4L A;  3HZX A;  1B3A A;  3BYT B;  4AYB E;  5EAY A;  1PZI D;  1YNN D;  1XWE A;  4DXG A;  5M3F G;  4R4O A;  4JK1 C;  3VR3 A;  3F2C A;  1G2T A;  1SR3 A;  1WTX A;  1L0X B;  1AW7 A;  3U9O A;  3E6Z X;  2K5N A;  2F3W A;  1TQO A;  2L9H A;  1HNW L;  4ZRZ A;  3OMC A;  1KHI A;  5A2Q L;  1FJG L;  1RD9 D;  1WD0 A;  1G51 A;  2AQ1 B;  2CFM A;  4DK6 C;  4DUZ Q;  1EFI D;  1PA6 A;  3NUC A;  3WDN A;  1R4Q B;  1K8M A;  2PW7 A;  1SE3 A;  2NN6 H;  1TWA H;  1IW7 C;  2KBN A;  3QR8 A;  3H6M A;  1Y1V B;  3P1H A;  2WFW A;  5CV7 A;  2UUA Q;  4LF6 L;  3NEM A;  3I4N G;  4B9W A;  5J1Z A;  1E24 A;  1I4Q A;  2E5L Q;  4HMI A;  1KLU D;  1ENC A;  4CKC A;  4XIG S;  2I5L X;  3NP8 A;  2EYP A;  1YJN A;  2B8F A;  4RCO A;  4HED A;  3EBE A;  2E2H B;  3FKI B;  4IQZ A;  3R3O A;  3CCQ A;  3SK4 A;  3A55 A;  4RWS C;  4OWX B;  3T13 A;  3CHB D;  1F9R A;  1JJC B;  4GLA C;  2Z6B A;  1PFB A;  2Z8L A;  1PFN A;  4MHE A;  2L1B A;  2Y0S E;  3QO2 A;  3CC4 A;  2PQE A;  1VQO A;  4A3F G;  3QJY A;  4JC0 A;  4DUZ L;  1Y14 B;  2ZM6 Q;  1F9S A;  2J7Z A;  4JI4 Q;  1TWH H;  1B4O A;  5IP9 H;  4IFD H;  2ZTE A;  4HSV A;  1AP0 A;  3VYU A;  1XTD A;  2NZO A;  4B9X A;  2E5L L;  3FPP A;  2F0G A;  3D31 A;  1GUG A;  1ICF B;  3BG3 A;  2WV6 D;  1B53 A;  1Z9F A;  3OWE B;  5CBA E;  2QEX A;  5E1F A;  1PTO D;  4O0A A;  2TMP A;  4B3M L;  4B3S Q;  2R92 B;  4GN3 B;  1HZA A;  1VDZ A;  1PMR A;  3MXG A;  3CCS A;  1LT3 D;  1MBY A;  2R3Z A;  3L9A X;  3TP8 A;  3T53 B;  4CJ0 B;  2CQO A;  3RN5 A;  1KC8 C;  4N9T A;  2L0C A;  3DLL A;  2EIF A;  1K3R A;  4DGZ A;  4L6T B;  1K8G A;  1S3O A;  4FXG C;  1OXU A;  1A63 A;  1B44 D;  1PHJ A;  3F2U A;  4GNX C;  2ZM6 L;  1CHP D;  4JI4 L;  2XWB B;  2CVR A;  3CU7 A;  1FVI A;  4IUP A;  4BWG B;  2WKC A;  2Q2T A;  4L5T A;  1A3T A;  1OXX K;  4BY1 B;  3BJU A;  2B2V C;  5EPK A;  1SFO B;  4YWL A;  1V1Q A;  1MJE A;  1PH4 A;  3L3O C;  1EFW A;  4GLX A;  4DUY Q;  2CW0 C;  4B3S L;  4K6L A;  1QUQ B;  5IY0 A;  5I9O A;  2E2J B;  3T56 B;  3HOZ B;  4DV6 L;  1G6P A;  4K0K Q;  1LTR D;  1K8A C;  2HQL A;  2MP1 A;  5E4X A;  4X66 Q;  2JE6 I;  1I6H B;  1QUQ A;  1BDO A;  3FMC A;  4DV3 Q;  4DV7 Q;  1B7Y B;  1HFN A;  3BDL A;  3IFD A;  2ID0 A;  1UWV A;  4GN5 A;  1LV9 A;  4O1N A;  3RNU A;  4MIU A;  3C3L A;  1J5E L;  1L0Y B;  1LAB A;  2EXD A;  2WAC A;  1TWF H;  5CBE E;  4CHT B;  1LTG D;  1YVC A;  2OF1 A;  1IHZ A;  2JK8 A;  3RD4 A;  2FHT A;  3MXU A;  3MEF A;  1TS5 A;  3S2D B;  2ICI A;  4R9W A;  2IY5 B;  2EZV A;  4HJ8 A;  3PO3 H;  1T5E A;  4IN3 A;  5EBC A;  1U4P A;  4FXK C;  3K57 A;  2MFI A;  3ULJ A;  2K33 A;  1E0B A;  1KLG D;  2GVB A;  4GN4 B;  1QCB D;  1NTG A;  3OW2 A;  5C5M A;  4A3I B;  4A3C H;  3LX0 A;  2ZJQ A;  4JBM A;  4DV7 L;  3IRB A;  3PIP A;  3OOC A;  2NN6 G;  5I9P A;  1HR0 L;  2K75 A;  4JI8 Q;  3TS0 A;  5JJK A;  1V43 A;  2JJQ A;  3RLO A;  4DNT B;  3JAM c;  5BR8 Q;  2HIX A;  4QF4 A;  3A74 A;  4ABN A;  5C3E H;  4PNY A;  4P71 A;  1BOS A;  3GTP H;  3VA7 A;  3AMU A;  4PMW A;  3ERQ A;  2MPM A;  3I55 A;  3BZD B;  3CC7 A;  1NNX A;  4A4I A;  3ZYY X;  1KNA A;  3DHQ A;  3PUX A;  1VF7 A;  1A0I A;  1X65 A;  2BA0 A;  4A3F B;  3KFU A;  1MGS A;  1EWI A;  4J8Q A;  1AEX A;  5DNF A;  1SYC A;  4S3S A;  3A8I E;  2JN4 A;  4HSP A;  2KEE A;  2ENB A;  5DM6 3;  4X3K A;  1CKM A;  2EOT A;  3NWS A;  4G7Z C;  5HGT A;  3UE1 A;  5KYI A;  5AJ3 Q;  1JWU D;  2LS0 1;  4JI8 L;  5IP9 G;  3C2P A;  4KLK A;  4IFD G;  2YTX A;  5JJZ A;  4DA2 A;  2SEB D;  4A3E H;  1AZQ A;  2E2D C;  5EKL A;  1HNX Q;  3OIP A;  1BCP D;  1EQR A;  1OXT A;  1KRT A;  1A6X A;  1SEB D;  4GOP C;  4X3U A;  4PZ8 A;  1TXY A;  4CGY B;  2DJG C;  4PZ7 A;  2K50 A;  1QVG A;  1S5D D;  4GOP B;  3RZD H;  5EJW A;  4KHP Q;  1PH1 A;  3ERO A;  3S1N H;  5CV9 A;  3TSS A;  2Z6K C;  2UUB Q;  2QW7 A;  1I4G A;  4KD3 A;  1HA6 A;  1I4H A;  1RIP A;  2BH2 A;  3HOV B;  5FJ8 H;  2A73 B;  2B63 H;  4BBS B;  1HZ9 A;  5GQO A;  4GOP A;  1KD1 C;  3QB3 A;  5AJ3 L;  4A3B H;  5FLM H;  3D0F A;  4UP8 A;  4K8I A;  4A3D B;  1X55 A;  2A5H A;  2K5Q A;  3NQI A;  3GTQ B;  1MIU A;  4QUF A;  3PO2 G;  4DV1 L;  4RG1 A;  1EYG A;  5T1G A;  1HNX L;  2JA5 B;  3I4M B;  1VQN A;  1D5X C;  1NCV A;  3VYR A;  1S5F D;  2VS1 A;  2AKW B;  4F8M A;  4DV4 Q;  4MN3 A;  4FP5 D;  1J8I A;  4KJO A;  5EBD A;  1PZK D;  4JYA Q;  1ZEQ X;  3ZJY C;  1HXY D;  2A1A A;  1SBB B;  4DU9 A;  1NJI C;  5JOB A;  2HHH Q;  5IE8 A;  2M2L A;  3NXW A;  2QGQ A;  1EU4 A;  1JCK B;  3NBI A;  1EY5 A;  2RVL A;  2A6E C;  2UXB L;  1XYI A;  1Y1V H;  4CKE A;  4H02 A;  1SNQ A;  5H1S E;  3A8K E;  1Q81 C;  4UDU C;  4B3T Q;  1GUO A;  1K8O A;  5D3D A;  3CAM A;  1Y8O B;  1STN A;  5F2D A;  2NTT A;  5J22 A;  4JPB W;  3EJI A;  4DR6 Q;  4I7Z C;  5C0X J;  2WB1 B;  3K5N A;  3FKI H;  3KF8 A;  3PO3 G;  4A3M B;  1TII D;  2I0Q A;  1S5B D;  2BA1 A;  2XRS D;  1B9N A;  1Y8N B;  4CDC C;  1XTC D;  5ISR A;  2RSN A;  2RSO A;  4KJN A;  2F0M A;  4DV4 L;  2I46 A;  5C0X I;  5FLX E;  4A3C G;  1D1I A;  1YZ6 A;  3LGJ A;  4JYA L;  1NY4 A;  2C35 B;  3KYH C;  2HHH L;  4UPA A;  4DV0 Q;  2NZH A;  2VQE L;  2R7D A;  2MUY A;  4HCS A;  5C4H A;  3ITP A;  1Y69 U;  4MTN A;  4LW1 A;  5CC4 A;  3RLF A;  4WFN 3;  5IIF A;  4ALP A;  3HG9 A;  4LFB Q;  4DAP A;  2GVA A;  2ICE C;  3MWY W;  2R92 H;  1HNZ Q;  3PF4 A;  1JWS D;  5CR3 A;  4DR6 L;  3O13 A;  4RGO S;  2N49 A;  1HFG A;  4NP5 A;  4M1U B;  1PH5 A;  1EQT A;  1ZYR D;  4DKA C;  4ZUI A;  1NE3 A;  3I7F A;  1BR9 A;  3I3C A;  1KDC A;  3K59 A;  4HJA A;  1VS0 A;  4DXF A;  1HQM C;  1FNW A;  2E76 C;  2L5T A;  4LF5 L;  3J81 L;  4DV0 L;  1J9O A;  4DK1 A;  4DR3 Q;  2F0V A;  4A3E G;  1KNE A;  2SOB A;  4BY1 H;  1GHJ A;  1SJH D;  1EY0 A;  1PXU A;  4FF2 A;  2IT1 A;  4YCV A;  5ELB A;  4WRD A;  1SFO H;  1EYD A;  4L5Q A;  4KV6 A;  2F0T A;  1T9H A;  4DK3 C;  2MO1 A;  3HKS A;  4KY7 A;  4JBK A;  4LFB L;  1HNZ L;  3TRZ A;  1W2B A;  5E3F A;  1Q1B A;  4FF1 A;  3QIA A;  3HOZ H;  3J7Y W;  5DEH A;  1EWC A;  2G9H D;  2B39 A;  4FF4 A;  2Q2H A;  4NXN Q;  4K5V A;  1GKH A;  5C4X B;  1SMY C;  5FJ8 G;  1EYC A;  4IPC A;  4OIJ A;  4ZYS A;  4IZ8 A;  2EDG A;  2K5V A;  2F1M A;  5FLM G;  2KJX A;  1N9W A;  3TP7 A;  2EJM A;  2A74 C;  1I3Q B;  1Q90 A;  3X3M A;  2JXM B;  5ELC A;  4KKT A;  4EQ5 A;  2SDF A;  1A15 A;  1STY A;  1QNK A;  5C44 B;  3F2B A;  1PRT D;  3S2D H;  2KEN A;  2Q2U A;  3DUZ A;  1YJW A;  3KBG A;  2R6G A;  4A3K B;  2KCC A;  2RBM A;  4H0L C;  5KND A;  4DV2 L;  2ZT9 C;  3WOE A;  1STE A;  1TY0 A;  4A3I H;  5C4Z A;  1GUW A;  1E2W A;  1CKO A;  5GAE C;  1CK1 A;  2B2U C;  5LMN Q;  1D5Z C;  4UP7 A;  1K73 C;  1Y1V G;  4DF7 A;  1CKN A;  1RTO A;  1C7Y A;  1MKH A;  4QIW B;  2IX1 A;  4I7A A;  3S1Q B;  1LTT D;  2MGS A;  2RHQ B;  5FKA C;  4QB4 A;  3FKI G;  3GTM B;  4K5W A;  4A3G B;  3MC0 B;  1LYL A;  2B2U A;  1N8R C;  4NDX A;  1ASZ A;  4JBW A;  4KN4 C;  2AQ3 B;  3D4W A;  4L5R C;  1NUC A;  3AU7 A;  3MFG A;  2VY3 A;  2JEA I;  1YJ9 A;  1KRS A;  1GJX A;  5C3E B;  3D6C A;  1JQY D;  1LO5 D;  3STB D;  3H0G B;  4OEM B;  2IX3 A;  3K58 A;  2PI2 E;  2ASB A;  4POG A;  1O7Y A;  2QEJ C;  4P72 A;  5LMN L;  2Q8I B;  1IL2 A;  3J80 c;  2VB2 X;  2F0J A;  4QY7 A;  1ENF A;  1OTC A;  2EYO A;  4ZLT F;  4FDB A;  3TP5 A;  3J7A F;  2VL6 A;  1ET9 A;  5C4J B;  3Q8D A;  2R92 G;  2B2T A;  4RKB A;  5DLQ E;  2QCP X;  3PUV A;  4CJ2 C;  2MJ8 A;  2OCE A;  4IOA A;  4QGU A;  5HGQ A;  4JI3 Q;  1A3U A;  1DOL A;  2XTI A;  4C3I H;  4KD4 A;  4QQB X;  2IPK D;  3OYY A;  3U9S A;  2AWN A;  2EY1 A;  3FDT A;  1BBU A;  3HOV H;  2HUG A;  1SYB A;  1VQP A;  4BBS H;  3SK8 A;  1V1O A;  2F4I A;  1WD1 A;  1WCM B;  4BY1 G;  2FFK B;  1U4M A;  2X6L A;  4A3D H;  3GTQ H;  1SXT A;  1VQG A;  1LTI D;  1SJE D;  4O2D A;  1UNS A;  1QVF A;  5EQ0 A;  1IYU A;  2AMC B;  3K8A A;  2JA5 H;  4AQY Q;  2C5C A;  2VW9 A;  4JI5 L;  4IUV A;  1VQI A;  1L0W A;  4YY3 Q;  2B63 B;  3HOZ G;  2PQA A;  2E8G A;  4XYQ A;  1PTO F;  1WTR A;  4A3B B;  1CZG A;  1N34 Q;  4ZKB B;  2HQE A;  2M9V A;  2KED A;  3N6R A;  5IOD A;  1O78 A;  2XIW A;  1S72 A;  5COR A;  5KNC A;  4DFA A;  1CFM A;  5GAH C;  2YU9 B;  2WAQ G;  1JB7 A;  2YTV A;  1GHK A;  4EVO A;  2B29 A;  4ZAI A;  2D2C C;  4A3L H;  1HUN A;  4H7B A;  2FJ2 A;  2NTS A;  4ULL A;  3X3N A;  1I6V C;  3M9B A;  3S17 B;  2ZXP A;  1X3F A;  3V2T A;  1I4X A;  4A3M H;  3PF5 A;  1KDB A;  1STH A;  3DXJ C;  4X62 L;  3CCR A;  4YY3 L;  4BBR B;  1SNM A;  2KUM A;  2A69 D;  3E9I A;  4CDF C;  2NBF A;  3UDX A;  3AFP A;  4A3I G;  1IBL L;  2IX0 A;  4JI1 L;  4I65 A;  3CC2 A;  4Q5V A;  3SXH A;  3K80 C;  3Q24 A;  4RGT A;  4WJ4 A;  1Q3L A;  1MJC A;  5IT9 E;  4XQJ A;  2RCF A;  2Q8R E;  3KLS A;  5EGT A;  2NN6 I;  4EX5 A;  1XPO A;  1WI5 A;  2BDO A;  1EY4 A;  1P8L A;  3GV6 A;  2L55 A;  1SMX A;  4YHH Q;  3E5S A;  3HKZ B;  4C2M H;  5ELO A;  2QDB A;  2I5M X;  4XXE A;  4DR4 Q;  2HDM A;  3CD6 A;  4V0B A;  2ATW A;  3I56 A;  3NWT A;  1KAB A;  1RDP D;  2UUA L;  1CHQ D;  4IFD J;  1HTP A;  4LUO A;  1UE5 A;  1RCV D;  4OWT B;  1X3G A;  2PW5 A;  2WKD A;  4KHV A;  5JPN C;  1YNN C;  4MZ9 A;  4UY8 C;  1I4R A;  3T1H Q;  1EIG A;  2IHE A;  4IO9 A;  1GOZ A;  4X64 Q;  1OO9 B;  1UUP A;  4IFD I;  4PMB A;  4X65 Q;  4KKS A;  5KRU A;  4PV1 C;  1EU3 A;  3NQT A;  4NMZ A;  2L12 A;  1BO0 A;  1M8A A;  1BKB A;  5CV8 A;  1ILQ A;  4U67 3;  1LM0 A;  1B50 A;  3HOY H;  1EY8 A;  2OQ0 A;  2N78 A;  3P20 A;  4DR4 L;  4V19 0;  1A8V A;  2LKV A;  1XNR Q;  2JA9 A;  2A19 A;  3S2H B;  1HA5 A;  1KAW A;  2VB3 X;  1NMG A;  2KHI A;  4GNX B;  2OWO A;  2PMZ B;  1MHW C;  5C4X H;  3HOV G;  1RKN A;  4A3J B;  4BBS G;  1FL0 A;  3OW7 A;  5LMU Q;  3GTO H;  2KCN A;  4IJH A;  5JPM C;  4A3D G;  1FD7 D;  4PZ6 A;  3T1H L;  2RDH A;  1I3Q H;  1SRU A;  4BS9 A;  1HZB A;  5EPL A;  3A0J A;  4GNX A;  4X65 L;  2JA5 G;  1VQ9 A;  3I4M G;  1JWM D;  2GA4 B;  2B2V A;  5C44 H;  1F2Z A;  4DR2 Q;  5E4W C;  3D4R A;  4OXP A;  3CCM A;  4P73 A;  1PFS A;  4BA2 I;  1BCP F;  1MSG A;  1WTV A;  5FLX L;  1IKM A;  1DOK A;  2AUK A;  1XNR L;  4A3K H;  3PUZ A;  2WAQ B;  1II3 A;  3D6W A;  2AHO B;  2GN5 A;  3H3V C;  4RH6 A;  3KF6 B;  2CWA A;  3S1R B;  1TR5 A;  4DR5 Q;  1N36 Q;  4DR7 Q;  2XRQ D;  1Q8K A;  1S40 A;  1PTO C;  1NMF A;  4FVM A;  3H94 A;  2F3I A;  2TSS A;  3A56 A;  4KMU C;  1JOQ A;  3W3A A;  5G3L F;  5LMU L;  1QZG A;  3CRK C;  4OWW B;  4A3L G;  1PTO B;  4DUY L;  3BZK A;  1VQ7 A;  2WP8 J;  3KF6 A;  3HP3 A;  2OXP A;  3S1Q H;  1IYV A;  2B3G A;  1E2V A;  1X32 A;  2WB1 G;  4K0K L;  1UEA B;  3F1Z A;  1M90 C;  4A3M G;  4NXM Q;  3GTM H;  4A3G H;  1EUJ A;  1VQB A;  3EQL C;  3ONA B;  4X66 L;  4DR2 L;  4DV3 L;  1DON A;  1UE1 A;  4QL5 A;  2YTY A;  1HZC A;  4ZQ3 A;  2K1B A;  3URY A;  4BXX H;  1CM9 A;  1EOT A;  2F0D A;  3NEL A;  1U4R A;  4K8J A;  1KXL A;  3H0G H;  1BVS A;  1PYS B;  3MEH A;  1PDQ A;  5ELF A;  1N36 L;  4TRD A;  4DR7 L;  4IPG A;  1VMP A;  2PO4 A;  1A2U A;  2N55 A;  3S24 A;  3A7A B;  3FPU B;  1V8Q A;  4ME5 A;  1IXR A;  3S15 B;  2D0P A;  5C4J H;  4R4Q A;  3CQZ B;  3NTI A;  3OHX C;  3DM1 A;  3DWA A;  3A5U A;  1CSP A;  1DM0 B;  4MTK A;  2Z4I A;  5NUC A;  2D9U A;  2R7F A;  3PIP 3;  1JOR A;  3HRZ C;  1C9O A;  4ZK9 B;  5KIX A;  3DMU A;  4HR7 B;  3KDF A;  1ENA A;  5J3B A;  3L2P A;  3M85 A;  3K0X A;  5BR8 L;  1SRO A;  1E22 A;  1Y1W B;  3BDC A;  3U4V A;  3PIO A;  2LSS A;  3S16 B;  4CKB A;  1YNX A;  5LL6 S;  1WCM H;  1I50 B;  1G2S A;  1MSH A;  3E0E A;  1VQM A;  4LF9 Q;  2EY5 A;  1J6Q A;  3I8Z A;  1LTS D;  1K28 A;  4YIJ A;  1HRJ A;  1JOK A;  3VR4 A;  2UXC Q;  2DY7 A;  5JEA H;  5D3I B;  4C3I B;  3A54 A;  5JEA J;  1SLJ A;  3I4L A;  1NAP A;  1ESR A;  1RHP A;  2M00 A;  1YHQ A;  3C46 A;  3JAM i;  1JE5 A;  1D2B A;  3ND8 A;  1YNJ D;  3T4A C;  2R7Z H;  1XMQ Q;  2ZXO A;  2B2W C;  2JA7 H;  4P74 A;  5CV6 A;  5C4X G;  1E3P A;  3K7U C;  2NUC A;  4LUZ A;  1SDF A;  2KEC A;  2PZU A;  3JAM E;  3PGZ A;  2Z6K A;  1VQA A;  3KLS X;  5A35 A;  2KQ3 A;  2YU9 H;  4CDE C;  3MAQ A;  4HTH A;  4IUN A;  4Z9C B;  2Z0S A;  3T51 B;  2RKS A;  2E74 C;  2Q8T A;  2B2W A;  1U9R A;  4IUR A;  1YI2 A;  2F0F A;  3K7A H;  3HOX B;  5IGB A;  2E2I B;  5M5W B;  4KHP L;  5C44 G;  1QWY A;  3S17 H;  3TS2 A;  3S14 B;  2UUB L;  1PH2 A;  3ULL A;  4IUU A;  3WWV A;  3NTK A;  4A3K G;  4R4C A;  4TVA B;  4BBR H;  1N33 Q;  3UI2 A;  1WTH A;  2RHS B;  3TDQ A;  1XMQ L;  1PZJ D;  3U50 C;  1EQQ A;  3KF8 B;  3MXN A;  1D8L A;  1KDA A;  3N52 A;  1BCP C;  4TQU S;  1Q8I A;  3CXC A;  4CJ1 B;  1TS2 A;  3UDF A;  2IHF A;  4ZUJ A;  2O5I C;  3BVZ A;  3Q22 A;  1R4P B;  3W1B A;  1EY7 A;  3HGB A;  4KY5 A;  2SNS A;  4A3G G;  2JA8 B;  2K5W A;  4H44 C;  5C3W A;  2KA7 A;  5JVG 3;  1XPU A;  1V1P B;  4JV5 Q;  4LAA A;  3E3X A;  3NHH A;  3CRL C;  4X3T A;  5GAG C;  4BXX G;  1N33 L;  2K7V A;  4C56 C;  3L0O A;  5C3E G;  1JB3 A;  1VQ5 A;  3H0G G;  5TSS A;  3VYS A;  1V1P A;  2AUJ D;  2A6H D;  2YYZ A;  4B3T L;  1XMO Q;  4LK1 C;  5EPJ A;  1E2Z A;  1HQR D;  1YIT A;  4C2M B;  1WOC A;  2D62 A;  5JJI A;  1G8Z D;  2VXW A;  1TVX A;  2NVT H;  4LF7 Q;  1N32 Q;  3KLR A;  2VQF Q;  3I91 A;  4DAM A;  3OPO A;  4LMQ D;  3VR5 A;  4OGQ C;  5IYB H;  4JI2 Q;  1PH8 A;  3QOJ A;  5LL6 X;  1W6K A;  2K52 A;  4JV5 L;  5I2Y A;  1M1K C;  4DV5 Q;  3OMG A;  2LY7 A;  2PZT A;  3S2H H;  2WII B;  1K0S A;  2BOS A;  3G71 A;  1LTB D;  3GTG B;  4IPH A;  4A3J H;  2K6A A;  2EY6 A;  1WCM G;  4C3J H;  5FO8 B;  3CPW A;  1WTQ A;  3HOY B;  3CCV A;  2V1C C;  2QDL A;  2VUM B;  3GTJ B;  5IYC H;  2K28 A;  5D14 A;  2WB1 E;  1JIC A;  1W6J A;  1IL8 A;  2ZXR A;  4LF7 L;  1TS4 A;  5JEA G;  3BYY B;  2RA4 A;  1WTP A;  1ET6 A;  4LFA Q;  2JA6 B;  1DD2 A;  1ONL A;  3ERS X;  4JI2 L;  5IP7 H;  4BY7 B;  2B63 G;  2UXD Q;  4DV5 L;  2MNA A;  2B8G A;  4QUC A;  1TT2 A;  4A3B G;  4K2L A;  1LAC A;  3GTO B;  4A93 H;  3FVQ A;  5M5X H;  4DR3 L;  1Q86 C;  1JJ2 A;  1XXG A;  2UU9 Q;  1FGU A;  1FNU A;  2EY2 A;  4ID6 A;  3SK6 A;  3S1R H;  5IT9 L;  1IZ6 A;  2XVS A;  1HH2 P;  2HT1 A;  3H3V H;  3W5O A;  3PQI A;  4RKL A;  2F0S A;  1PTO H;  2FXQ A;  2LFN A;  2LXJ A;  5T1I A;  2QA4 A;  3GTL B;  1ZYR C;  4PMC A;  4HIM A;  1FR3 A;  1RL2 A;  2J4X A;  3KK7 A;  1CKN B;  3OTO Q;  3V96 A;  4JI6 Q;  4LFA L;  1O7I A;  5IGG A;  3SE0 A;  4NXN L;  1W3S A;  3PUW A;  4HMJ A;  5CV4 A;  1CSQ A;  4KHZ A;  4XQQ A;  4XT1 B;  4P2C B;  3T16 A;  4BBR G;  1TS3 A;  5FO7 B;  3VYT A;  4DPG A;  4F88 A;  2I5H A;  4DK0 A;  4JBJ A;  3A8J E;  2VNU D;  2F0L A;  4NB3 A;  3BDO A;  3HS0 C;  3UDI A;  1PV4 A;  1M4V A;  2UU9 L;  2BE5 D;  3AB9 A;  2NWG A;  2KHS A;  1FYC A;  2NYZ D;  2N8N A;  4EQP A;  5IGC A;  3F2D A;  3R2T A;  3OSO A;  1KQS A;  4BA1 I;  1E1O A;  2O5J C;  3S15 H;  1H9S A;  4GLV B;  3CQZ H;  2EPB A;  3VR6 A;  2XGT A;  3HKZ G;  1CZW A;  4LFC Q;  2OTL A;  4FF3 A;  4JI6 L;  2L11 A;  4HJ9 A;  1CQV A;  1VQJ A;  1SSO A;  3VR2 A; 
#chains in the Genus database with same CATH homology
 2YV5 A;  3GTP H;  5LMN W;  5ELO A;  2I5M X;  3I2Z A;  1AE2 A;  4LF5 Q;  4DR4 Q;  4PMW A;  3I55 A;  1D7Q A;  3CD6 A;  3CC7 A;  2R93 G;  4A4I A;  3PUX A;  2ATW A;  1XNR Q;  1E1T A;  1A0I A;  3I56 A;  1X65 A;  2BA0 A;  1EIF A;  3CMA A;  3CCU A;  2HIV A;  3KFU A;  4LWC A;  2UUA L;  1EWI A;  1Y1W H;  4AYB G;  4IFD J;  3G48 A;  4LUO A;  3M3Y H;  1YHA A;  1UE5 A;  1V9P A;  1X3G A;  4OWT B;  3S16 H;  1PVO A;  1I50 H;  5HY6 A;  3PUY A;  4MZ9 A;  4LF4 L;  3HOW G;  1CKM A;  1YIJ A;  4UY8 C;  3T1H Q;  2IHE A;  1CUK A;  2N3S A;  3UE1 A;  4X64 Q;  5AJ3 Q;  3J7Z C;  4IO9 A;  4IFD I;  4JI8 L;  3U4Z A;  5IP9 G;  4IFD G;  4KLK A;  5IYD H;  2YTX A;  5IYB G;  4X65 Q;  1BBW A;  3RLN A;  2CKZ B;  2ZTC A;  2KHJ A;  3CP0 A;  3RR5 A;  1X54 A;  4A3E H;  1XMO L;  2RF4 A;  1L2F A;  1XPR A;  1IBK Q;  1BKB A;  1TWG H;  1HNX Q;  1LM0 A;  3HOY H;  4Y7N H;  5M3M G;  1YBY A;  1EQR A;  3HFZ B;  1OXT A;  3J7A 5;  5K36 G;  2OQ0 A;  2N78 A;  1KRT A;  4J15 A;  4GOP C;  4DR4 L;  1Q12 A;  4PZ8 A;  1TXY A;  4PG3 A;  4LF8 Q;  1N32 L;  1A8V A;  4PZ7 A;  2VQF L;  4HIO A;  1R9T H;  2JA9 A;  2A19 A;  2K50 A;  1QVG A;  2A8V A;  1SE8 A;  1UE7 A;  3HOU H;  3A5Z B;  1KAW A;  2PNH A;  2PQA B;  4GOP B;  4A3J G;  1Q46 A;  3RZD H;  1NMG A;  4KHP Q;  3HOZ G;  2KHI A;  4GNX B;  2OWO A;  1PH1 A;  4QIW E;  3S1N H;  3HOV G;  5C4X H;  5JJL A;  3GDE A;  1PH3 A;  2Z6K C;  3GD7 A;  4BBS G;  2UUB Q;  5IYC G;  2R7Z G;  1FL0 A;  1C0A A;  4XTC S;  5LMU Q;  1RIP A;  4P75 A;  2BH2 A;  3GTO H;  1XJV A;  5FJ8 H;  2JA7 G;  4IJH A;  2ZTD A;  2B63 H;  4A3D G;  1Q82 C;  1HZ9 A;  5GQO A;  4GOP A;  4PZ6 A;  3T1H L;  1KD1 C;  4OX9 Q;  1I3Q H;  4UP9 A;  5AJ3 L;  1SRU A;  1HZB A;  4JI3 L;  3A0J A;  1VQE A;  3D0F A;  5FLM H;  3HOX H;  4GNX A;  2E2J H;  2K5H A;  4X65 L;  3STB C;  5M5W H;  4UP8 A;  2E2I H;  1X55 A;  2JA5 G;  1VQ9 A;  2Y0S G;  3I4M G;  5IP7 G;  1MIU A;  4HJ5 A;  3CCE A;  3S14 H;  3PO2 G;  4DV1 L;  4RG1 A;  4HJ7 A;  4DV2 Q;  1EYG A;  3J80 i;  3AYH B;  5C44 H;  1HNX L;  3G6E A;  4DR2 Q;  1I6H H;  3UE0 A;  4A93 G;  3RN2 A;  4JI7 Q;  4A75 A;  1VQN A;  4OXP A;  3ER0 A;  3CCM A;  4P73 A;  1PFS A;  4BA2 I;  4AH6 A;  2MQH A;  1PH9 A;  1UE6 A;  2RCN A;  4LF8 L;  2VS1 A;  1XNR L;  2AKW B;  3PUZ A;  4LUV A;  4A3K H;  3BZC A;  5M3F H;  2KCM A;  2AHO B;  4GKJ Q;  4DV4 Q;  1HJP A;  2GN5 A;  2PI2 A;  3H3V I;  4LF6 Q;  3M4O H;  3KF6 B;  2CWA A;  1JT8 A;  4DR5 Q;  1VQH A;  1N36 Q;  4DR7 Q;  4JI0 Q;  1LTL A;  4JYA Q;  1Q8K A;  3ZJY C;  4AQY L;  1S40 A;  1NMF A;  2A1A A;  2UXD L;  2F3I A;  3JC6 6;  2DGY A;  1NJI C;  2HHH Q;  5IE8 A;  5LMU L;  3TQY A;  1QZG A;  3GTK H;  2QGQ A;  4OWW B;  4A3L G;  4DUY L;  3BZK A;  1VQ7 A;  2CCZ A;  4OX9 L;  2WP8 J;  1VQD A;  3KF6 A;  2UXB L;  4HID A;  1Y1V H;  1N34 L;  3AFQ A;  4H02 A;  5H1S E;  2JA8 H;  1Q81 C;  2K4K A;  4B3T Q;  3S1Q H;  2B3G A;  4JOI C;  2WB1 G;  4K0K L;  3CAM A;  1JJG A;  2NVX H;  3F1Z A;  1M90 C;  4A3M G;  4NXM Q;  3GTM H;  1OXV A;  3I4N H;  4A3G H;  1EUJ A;  1VQB A;  2ALY B;  4X66 L;  4DR2 L;  3E9H A;  4DR6 Q;  5C0X J;  4DV3 L;  1HR0 W;  1VQK A;  4JI7 L;  1X56 A;  1WJJ A;  3FKI H;  3PO3 G;  1X3E A;  1UE1 A;  4QL5 A;  2YTY A;  1QVC A;  2I0Q A;  1HZC A;  2BA1 A;  4BXX H;  1ASY A;  3NEL A;  3OTO L;  4GKJ L;  4DV4 L;  1VQC A;  1KXL A;  3H0G H;  3NBH B;  1BVS A;  1PYS B;  4JOI A;  5C0X I;  5C0X G;  4A3C G;  1N36 L;  5GAD C;  4DR7 L;  2D0O A;  2EQS A;  1YZ6 A;  1EOV A;  3LGJ A;  1NY4 A;  4IPG A;  4JI0 L;  4JYA L;  2C35 B;  3KYH C;  3S24 A;  3CW2 C;  2HHH L;  4DAY B;  4UPA A;  1WYD A;  4DV0 Q;  2NZH A;  3CPF A;  3DM3 A;  3M4P A;  4B3M Q;  1Z47 A;  2VQE L;  4IOC A;  1IXR A;  2R7D A;  3J81 c;  3TEH B;  3ICE A;  2D0P A;  4A3F H;  5C4J H;  3GO5 A;  4R4Q A;  4MTN A;  4LW1 A;  2UUC Q;  2DUD A;  3RLF A;  3A5U A;  4HIK A;  1KIX A;  1CSP A;  4ALP A;  4LFB L;  2F52 A;  2R7F A;  5ELN A;  1G29 1;  4MNO A;  4LFB Q;  2GVA A;  1C9O A;  3PF4 A;  2R92 H;  1HNZ Q;  4DR6 L;  3F8T A;  1UEB A;  2N49 A;  3K81 C;  1GO3 E;  3W1G A;  3KDF A;  4YWM A;  1GVP A;  5J3B A;  3L2P A;  2ZJR A;  3T1Y Q;  1Y1W G;  1VQF A;  3M85 A;  1PH5 A;  3GTG H;  3M7N A;  3K0X A;  4DKA C;  5BR8 L;  4LFC L;  3FP9 A;  4YHH L;  1SRO A;  1NE3 A;  1E22 A;  3I7F A;  3U4V A;  3PIO A;  4B3R Q;  2VUM H;  2LSS A;  4HJA A;  1VS0 A;  4ME3 A;  1KL9 A;  3GTJ H;  1YNX A;  1WCM H;  4JI5 Q;  5IWA Q;  4LF5 L;  3PSI A;  5IYD G;  4DV0 L;  3M4Q A;  4DR3 Q;  3E0E A;  4GS3 A;  1VQM A;  4KI0 A;  4LF9 Q;  1J6Q A;  2JQO A;  3S1M H;  4A3E G;  4POF A;  2OQK A;  4OO1 G;  4OO1 I;  4QJF A;  4BY1 H;  2UXC Q;  2UUC L;  4DV6 Q;  1I94 Q;  4LNQ A;  2JA6 H;  2F4V Q;  2IT1 A;  4YCV A;  5JEA J;  4BY7 H;  1L1O C;  1SLJ A;  2JEB I;  1SFO H;  1IYJ B;  4L5Q A;  5IT9 c;  4WJ3 M;  1T9H A;  2OTJ A;  4DK3 C;  2MO1 A;  3HKS A;  4R4T A;  1YHQ A;  4JBK A;  3I4O A;  4L5S A;  3JAM i;  1JE5 A;  1HNZ L;  1L1O B;  3TRZ A;  1WFQ A;  4YWK A;  2R7Z H;  1W2B A;  3HOU G;  1XMQ Q;  4X64 L;  1Q1B A;  3AQQ A;  2JA7 H;  4P74 A;  3T1Y L;  2BH8 A;  3HOZ H;  1U5K A;  5C4X G;  1B8A A;  1E3P A;  3K7U C;  4OON A;  1J5E Q;  1YEZ A;  2NVY H;  1SN8 A;  4LUZ A;  2Q2H A;  1IBK L;  4NXN Q;  3PGZ A;  1L1O A;  2Z6K A;  1GKH A;  1VQA A;  3I4M H;  3J81 i;  4B3R L;  1HNW Q;  1U0L A;  5FJ8 G;  3PO2 H;  1FJG Q;  4IPC A;  2YU9 H;  3HKZ E;  3GTL H;  2K5V A;  2Z0S A;  3L7Z C;  5IWA L;  4X62 Q;  5FLM G;  3HOX G;  1EIY B;  1N9W A;  3UDG A;  4JCV E;  3FHW A;  4JG2 A;  1P16 A;  1YI2 A;  3K7A H;  2VZA A;  1IBL Q;  4KHP L;  5C44 G;  1I94 L;  4JI1 Q;  4EQ5 A;  2F4V L;  3S17 H;  3TS2 A;  1X9N A;  2UUB L;  1K83 H;  1PH2 A;  3ULL A;  3F2B A;  3WWV A;  3S2D H;  4AYB E;  2KEN A;  4R4C A;  4TVA B;  5EAY A;  4BBR H;  5M3F G;  2RHS B;  4A3K G;  1N33 Q;  1HR0 Q;  2Q2U A;  1XMQ L;  1YJW A;  3U50 C;  4DNI A;  4R4O A;  1EQQ A;  3KF8 B;  1IBM Q;  3F2C A;  1H95 A;  2R6G A;  4YCW A;  1SR3 A;  2K14 A;  1D8L A;  4TQU S;  2LXK A;  2K5N A;  4DV2 L;  3CXC A;  4A3I H;  1HNW L;  3CME A;  1KHI A;  1FJG L;  5GRO A;  1CKO A;  5GAE C;  3UDF A;  1G51 A;  2CFM A;  5LMN Q;  2IHF A;  4UP7 A;  4DK6 C;  4DUZ Q;  1K73 C;  1PA6 A;  1Y1V G;  2KCT A;  3W1B A;  1CKN A;  2CWP A;  3KLW A;  2JA8 G;  1C7Y A;  1TWA H;  2MO0 A;  2KBN A;  1MKH A;  4LF6 L;  2UUA Q;  2IX1 A;  2WFW A;  3I4N G;  4A3G G;  3NEM A;  3PCO B;  2ES2 A;  4Y52 H;  1E24 A;  4DR5 L;  1A62 A;  2E5L Q;  2RHQ B;  1XPU A;  4JV5 Q;  2PMZ E;  3FKI G;  3SGI A;  1B70 B;  3CCJ A;  4XIG S;  2I5L X;  1YJN A;  1LYL A;  5GAG C;  1N8R C;  4BXX G;  1ASZ A;  3BU2 A;  1TWC H;  1E7Z A;  3EBE A;  3TRE A;  1N33 L;  1LUZ A;  4JBW A;  1YHB A;  3L0O A;  5C3E G;  3CCQ A;  4A76 A;  1VQ5 A;  1IBM L;  3H0G G;  4L5R C;  1QZH A;  2R93 H;  3EIV A;  3CF5 A;  3KDF B;  1VQ8 A;  2YYZ A;  2VY3 A;  4OWX B;  4B3T L;  2JEA I;  1YJ9 A;  1XMO Q;  1KRS A;  1JMC A;  3STB D;  1Q1E A;  1JJC B;  4GLA C;  4NXM L;  1YIT A;  1WOC A;  2D62 A;  2PI2 E;  2ASB A;  5JJI A;  4POG A;  2Y0S E;  4P72 A;  3CC4 A;  1VQO A;  5LMN L;  1IL2 A;  2NVT H;  4A3F G;  4JC0 A;  4DUZ L;  4LF7 Q;  3J80 c;  1N32 Q;  4QY7 A;  2VQF Q;  1Y14 B;  2ZM6 Q;  3VDY A;  4NPS A;  1OTC A;  4JI4 Q;  3HOW H;  4DAM A;  1PYB A;  4FDB A;  1TWH H;  5IP9 H;  2VL6 A;  2WAQ E;  2ZTE A;  5IYB H;  1XTD A;  2NZO A;  4JI2 Q;  4DR1 Q;  1PH8 A;  2E5L L;  2K52 A;  3Q8D A;  3KOJ A;  2R92 G;  1GM5 A;  3D31 A;  4IPD A;  4R4I A;  1M1K C;  4DV5 Q;  5DLQ E;  1DGS A;  4JV5 L;  1VCI A;  3PUV A;  1Z9F A;  2OCE A;  4IOA A;  1I5F A;  2QEX A;  4QGU A;  4O0A A;  5M3M H;  4B3M L;  4B3S Q;  4GN3 B;  5HGQ A;  3S2H H;  1HZA A;  1X6O A;  4AIM A;  4JI3 Q;  2NVQ H;  3CCS A;  3G71 A;  3HOY G;  2XTI A;  4C3I H;  2VUM G;  4RMF A;  2CQO A;  4IPH A;  4DV1 Q;  3ULP A;  4A3J H;  4QQB X;  1XNQ Q;  3OYY A;  3RN5 A;  1KC8 C;  1WCM G;  4C3J H;  4C3H H;  2AWN A;  3CPW A;  3CCV A;  3DLL A;  1BBU A;  2V1C C;  3HOV H;  2EIF A;  1K3R A;  4BBS H;  1VQP A;  1K8G A;  5IYC H;  1S3O A;  4GKK Q;  1OXU A;  1A63 A;  2WB1 E;  4BY1 G;  4LF7 L;  1PHJ A;  2JA6 G;  4GNX C;  4A3D H;  5JEA G;  2ZM6 L;  4JI4 L;  3GTQ H;  2Q2I A;  1VQG A;  1FVI A;  2AWO A;  5FLX c;  2Q2T A;  4BY7 G;  4L5T A;  4O2D A;  1OXX K;  1QVF A;  4LFA Q;  1Q7Y C;  2AMC B;  3BJU A;  3ERS X;  3K8A A;  4DR1 L;  2JA5 H;  5IP7 H;  4JI2 L;  3AEV A;  3RZO H;  4AQY Q;  2B63 G;  2UXD Q;  4APV A;  2VW9 A;  4DV5 L;  4YWL A;  1V1Q A;  1MJE A;  2MNA A;  4JI5 L;  1PH4 A;  4A3B G;  1VQI A;  1L0W A;  1EFW A;  4YY3 Q;  4A93 H;  4GLX A;  5M5X H;  4DUY Q;  2PQA A;  4DR3 L;  1Q86 C;  2E8G A;  1JJ2 A;  4B3S L;  4LF9 L;  1QUQ B;  1K9M C;  1VQ6 A;  5IY0 A;  2UXB Q;  2H5X A;  1N34 Q;  3J81 j;  2UU9 Q;  4X6A H;  2UXC L;  1FGU A;  4DV6 L;  3S1R H;  5M5Y H;  3MXN B;  2L15 A;  1IZ6 A;  1G6P A;  1HH2 P;  4K0K Q;  2HT1 A;  3H3V H;  1S72 A;  3W5O A;  1K8A C;  1XNQ L;  2HQL A;  4X66 Q;  2JE6 I;  3G4S A;  1PH6 A;  1QUQ A;  1GD7 A;  4DV3 Q;  5GAH C;  4DV7 Q;  2FXQ A;  3KJP A;  2LXJ A;  2WAQ G;  4IJL A;  2QA4 A;  1VQL A;  4GKK L;  1JB7 A;  1B7Y B;  2YTV A;  3NEN A;  4HIM A;  1RL2 A;  2B29 A;  4A3L H;  1VQ4 A;  2ID0 A;  1UWV A;  1OXS C;  4GN5 A;  3RNU A;  1CKN B;  4YCU A;  3OTO Q;  1J5E L;  4JI6 Q;  4LFA L;  1O7I A;  1NBW A;  2EXD A;  3EN2 A;  4NXN L;  1W3S A;  3PUW A;  1TWF H;  3M9B A;  1CSQ A;  1YVC A;  4KHZ A;  1X3F A;  3CCL A;  4BBR G;  2JK8 A;  4DPG A;  4A3M H;  3PF5 A;  2I5H A;  4JBJ A;  3MEF A;  4X62 L;  3CCR A;  4YY3 L;  2VNU D;  1AE3 A;  2VQE Q;  4NB3 A;  2IY5 B;  4HJ8 A;  3PO3 H;  3UDI A;  3E9I A;  5E7N A;  1PV4 A;  2UU9 L;  3UDX A;  2MFI A;  3AFP A;  3ULJ A;  4A3I G;  2IX0 A;  1IBL L;  4JI1 L;  3CC2 A;  2GVB A;  4GN4 B;  2N8N A;  3K80 C;  3F2D A;  1NTG A;  3OW2 A;  3B6Y A;  4WJ4 A;  4A3C H;  1KQS A;  4BA1 I;  1PH7 A;  1MJC A;  4LF4 Q;  2ZJQ A;  1E1O A;  4JBM A;  4DV7 L;  3IRB A;  4EX5 A;  3PIP A;  2NN6 I;  1XPO A;  2E2H H;  3S15 H;  1AH9 A;  2NN6 G;  1HR0 L;  4GLV B;  1WI5 A;  2K75 A;  4JI8 Q;  3H15 A;  3TS0 A;  4R1J A;  4A3B H;  3CQZ H;  5JJK A;  1K0R A;  1V43 A;  1P8L A;  2JJQ A;  3RLO A;  2XGT A;  3HKZ G;  1SMX A;  3JAM c;  5BR8 Q;  4LFC Q;  2HIX A;  4YHH Q;  3A74 A;  5C3E H;  3PV0 A;  2ZJP A;  3KJO A;  3U58 A;  2OTL A;  4JI6 L;  4HJ9 A;  4P71 A;  1VQJ A;  4C2M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...