5C4JH

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
144
structure length
143
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 16
structure length 143
sequence length 144
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c4jH00
3OTOL 4GLAC 1KXLA 3J80i 4B3RQ 1VQDA 1MJCA 1VS0A 4UP7A 3CCQA 4IJHA 4J15A 2BA0A 1L0WA 2I5LX 4DV2Q 3AEVA 2QA4A 4BA2I 1BKBA 2JEBI 2KCMA 4A4IA 4JV5Q 4JBJA 1HNZQ 4GOPC 1XNQQ 3E9HA 1IBKQ 4OX9L 4KHPL 1G51A 1S40A 2UXCQ 4Y7NH 2JA5H 2OTJA 4OWTB 1N36Q 3S2HH 1BBWA 3PF5A 2YTXA 1HNXQ 3OYYA 5C4XG 1KL9A 1YI2A 4A3KH 2EXDA 2K5NA 1IBMQ 4LF4L 1YEZA 3M4PA 2PI2A 1QUQB 3Q8DA 3GTMH 5C44G 3S24A 5IYBH 3FKIG 3J81c 3S1NH 1GD7A 3RN2A 2MQHA 3NEMA 2NN6I 4X64Q 1WCMG 2L15A 2AWNA 2RHQB 3KF6A 3GTPH 4P72A 3S1RH 2D0PA 2ZTEA 5HGQA 4X65L 1A62A 2LXKA 3LGJA 1EIYB 4NXMQ 4KHZA 1QUQA 2HIXA 4OONA 3I4MG 4C3IH 1VQHA 3I56A 1N9WA 1XNRL 3FP9A 3J81i 3T1HQ 2ZJPA 1Q12A 2OTLA 4R4IA 3TQYA 5LMUL 3CAMA 3PSIA 4A75A 3CPFA 1Y1WH 3T1HL 1SR3A 3ZJYC 1IBML 4LF4Q 3NELA 4LFCQ 1XNRQ 3HOZH 1CUKA 1HJPA 2ZM6L 1CSQA 1CKMA 2IHFA 3CC7A 4PZ8A 3I4MH 1V9PA 4A93H 2E2IH 1VQMA 1PH9A 4BBRG 4DR3Q 1C0AA 4XTCS 4DV2L 4AH6A 1A8VA 4YWLA 1TWHH 2A1AA 2JA9A 2JE6I 2N49A 1YJNA 2ES2A 2IX0A 3I7FA 4HIKA 1B70B 1IBLL 2JA7G 3H3VH 4B3RL 2RF4A 5EAYA 4JI4Q 4X62L 4IOCA 1JMCA 2Z6KA 2QEXA 4A3LH 1MIUA 1VQ5A 2D0OA 4GLVB 3UDGA 1MJEA 3JAMi 4LFBL 4A3KG 2MFIA 2UXBL 1TWFH 5JJLA 3GTOH 1I50H 5H1SE 2K52A 2WB1E 4YCVA 2E8GA 3L2PA 4LF5Q 3CD6A 1G6PA 1LTLA 1S3OA 4DR4L 1Q46A 1SN8A 3S2DH 4JI0Q 4OXPA 1K73C 3S1MH 1TXYA 4DUYQ 3PUXA 4JI1L 2Q2TA 5C3EG 1GM5A 2HHHQ 1S72A 4KLKA 3CCEA 2N8NA 4A3EG 3HOXG 4L5SA 3DLLA 1JB7A 3GTJH 1CKNA 4AYBG 2HHHL 1D8LA 1YJWA 4YWMA 4NB3A 3UE0A 2WAQE 1E1TA 3HOVH 4DNIA 4IFDG 4BY7G 4JBMA 2VNUD 3KF6B 4GS3A 1NE3A 1N33L 1NTGA 4C2MH 4LW1A 4P71A 5JEAJ 4GN3B 2UXBQ 2KBNA 4YY3Q 2K5VA 3GDEA 3A0JA 3T1YL 1QVGA 2E5LQ 4LWCA 3ULLA 5GAGC 1TWAH 2YV5A 1XPUA 1PVOA 4PZ6A 4JOIA 3H15A 1FJGQ 4DUZL 1HR0Q 1Q1BA 5AJ3L 1PH1A 3HOWG 1EIFA 4C3JH 1OXVA 3KYHC 1D7QA 4QGUA 5FLMG 1OTCA 3AQQA 2UUAL 1AE3A 4GNXB 2R7FA 4DV3L 3IRBA 1OXUA 4JCVE 1VQNA 2GVAA 4JYAQ 3K80C 4APVA 2HIVA 4GKJQ 1YZ6A 1EYGA 2K14A 1HZAA 3CF5A 3A74A 1TWGH 4K0KL 4L5RC 1Y14B 4DR1L 2HT1A 2FXQA 3KOJA 3KJPA 1A0IA 1VQBA 2Q2IA 3J7ZC 4K0KQ 5ELOA 1T9HA 3UDFA 5IP9G 1PH5A 4P75A 4DR1Q 3EN2A 3RLOA 1OXTA 4DKAC 3RNUA 2D62A 3GTQH 1H95A 3F2BA 1J5EL 2NVQH 2R92G 4NXML 3DM3A 4GKJL 3JAMc 1YVCA 2BA1A 5JJIA 3EIVA 2PI2E 4HJ9A 3HOYG 4LF9L 1Q86C 2RCNA 2JA5G 3U4ZA 4OWXB 1Q7YC 4ME3A 1PH7A 2OQKA 1B7YB 2IHEA 1KRSA 4QY7A 4DUZQ 2ASBA 3UE1A 2NVXH 4IPCA 4GNXC 2CWPA 1Q8KA 1VQFA 3M4OH 2VUMG 2E5LL 4DV0Q 4LNQA 1DGSA 3RZOH 1ASYA 3J80c 4A3DG 2R93G 3GTLH 1VQLA 4B3TQ 1IBKL 4DK6C 4KHPQ 4O0AA 1W2BA 1UE7A 1I3QH 1L1OC 3CCVA 1E3PA 5C0XJ 2UXDQ 2XGTA 4DV5Q 1JE5A 5GROA 1MKHA 2JJQA 4HIOA 4HIMA 1L1OB 3RR5A 4IO9A 4OWWB 3HOWH 3CXCA 1K9MC 3I4NH 1KRTA 3RN5A 2OCEA 4BBRH 4A3MG 5IYCG 2I0QA 1KAWA 1VQEA 5C44H 1M1KC 4R1JA 3L0OA 1GO3E 1VQ7A 4NXNL 3K0XA 2H5XA 4JI1Q 2JA7H 4DR4Q 2RHSB 4LF5L 3PO2H 2B29A 3L7ZC 3D31A 4EX5A 4LFBQ 4OO1G 2CQOA 4L5TA 1XTDA 3H3VI 2CWAA 1C7YA 3H0GH 4DK3C 3TRZA 1E22A 5IYCH 5BR8Q 2UU9L 3PIOA 1IBLQ 1YBYA 4QL5A 1Y1VH 2VW9A 1I94Q 2A8VA 1UE6A 4MNOA 2BH8A 1J6QA 5GADC 3E0EA 4XIGS 4DV1L 5C3EH 3CCLA 3HOZG 3F2CA 4A3BH 1HZ9A 4QQBX 1FGUA 5ELNA 3PGZA 5IY0A 2I5MX 2NVYH 4GKKQ 4LF9Q 3I55A 1PV4A 5M3FG 4RMFA 4POGA 2VUMH 4DV4Q 3CMEA 4JG2A 2XTIA 1EQRA 5GAEC 1IXRA 1J5EQ 1SMXA 1WYDA 1EUJA 3FKIH 4JI5L 4JI8L 4A3FH 2AWOA 1EFWA 4B3SL 4PG3A 1WOCA 2NN6G 2ALYB 2VL6A 4BA1I 5M5YH 1LUZA 3PO3H 1NJIC 1UEBA 4B3SQ 5LMUQ 3CQZH 2R93H 1KIXA 1HZCA 1OXXK 5IP7H 1X3EA 2IT1A 3GTKH 1OXSC 3MXNB 4POFA 1WFQA 1K83H 4A3IG 4X65Q 4DV4L 2Z6KC 3CC2A 1VQ6A 4GN5A 2PNHA 1A63A 4GLXA 2N78A 2GN5A 4X66L 2PQAA 4OO1I 5J3BA 3CPWA 4DV3Q 4A3CH 3K81C 1U0LA 5C0XG 1NMGA 4DV6Q 3U4VA 1YNXA 2EIFA 4A3MH 4HJAA 1L1OA 1YHQA 3TS0A 3HOXH 2Y0SG 5M5WH 5BR8L 3ULJA 5LMNW 3T1YQ 1PH4A 1GVPA 1HNXL 1X3GA 3RLFA 3HKSA 4NPSA 4EQ5A 1Q81C 2Z0SA 4A3GH 4DPGA 1Z47A 2GVBA 4AIMA 4GOPA 4OX9Q 2UXCL 3J7A5 4LUOA 1G291 5IYBG 1SFOH 2R7ZH 1B8AA 1PYBA 4YWKA 5IYDG 1M90C 4WJ4A 2NVTH 3M4QA 5IP9H 4QJFA 1E7ZA 1XNQL 2HQLA 4NXNQ 4JV5L 2YU9H 2VZAA 3BZCA 3STBC 1SE8A 3GO5A 4DV7Q 1PYSB 4GOPB 4MZ9A 4UP8A 3PUWA 2LSSA 4DV7L 4R4QA 4A3BG 1KD1C 3F1ZA 1Q82C 3GTGH 3WWVA 1N32L 2JA6G 1SRUA 3EBEA 4R4OA 4B3MQ 5IWAQ 2VQFQ 2F3IA 1VCIA 4RG1A 3KF8B 4IFDI 2AMCB 2MNAA 3BZKA 4LF8Q 1XMQL 1WI5A 5GAHC 5C0XI 2UUCL 1UE5A 4A3EH 4DR5Q 2F52A 3CCUA 1UE1A 1V1QA 5LMNQ 4A3IH 2Y0SE 1XJVA 4LFAL 3S17H 4DV0L 4JI4L 3UDIA 1XPRA 2E2JH 2BH2A 3HOVG 3AFQA 1N8RC 4BY7H 2EQSA 1X3FA 1JJGA 3RLNA 5JJKA 4JI7Q 4DV6L 3G6EA 4UY8C 1VQ4A 1JT8A 2ID0A 2V1CC 4A3DH 1LM0A 4DR3L 3I4NG 2JQOA 1XMOQ 4DAMA 2PQAB 2PMZE 3KDFB 3HKZE 3BJUA 4LF7L 4TQUS 1WCMH 2CFMA 1VQOA 4R4CA 2IY5B 1Z9FA 3NBHB 4JI2Q 5JEAG 3PV0A 4A3LG 5HY6A 1CKOA 1UWVA 4LFCL 1PH8A 5IYDH 1CSPA 3E9IA 2F4VQ 4P73A 1NY4A 1HNWQ 3S1QH 2JA8H 5IE8A 2C35B 4X6AH 1X54A 4L5QA 2JA8G 3M7NA 3SGIA 4X66Q 1TWCH 4JBWA 2B63G 3CP0A 4AQYL 4YCUA 4Y52H 1PFSA 2UUAQ 3J81j 4X64L 2K50A 2CCZA 1HNWL 1X9NA 4A93G 1Q1EA 4DR2L 1VQ9A 3HOUH 1KC8C 2UU9Q 3A5ZB 1HH2P 4JOIC 4IJLA 2Q2UA 1O7IA 3A5UA 1HR0W 1FJGL 2MO1A 4TVAB 2R92H 1K8AC 2YTYA 3HKZG 1NMFA 2LXJA 4P74A 1N34Q 1VQ8A 4JI8Q 1EWIA 4YHHQ 2ZJQA 2IX1A 4LF6Q 2JA6H 3M3YH 3PUVA 5FLXc 1HNZL 5C4JH 3PO3G 1C9OA 1PA6A 1I5FA 3F8TA 5M3MH 4GKKL 2K4KA 4C3HH 5M3FH 4BXXG 3GD7A 4JC0A 2N3SA 2WB1G 4JI3L 1QZHA 4JBKA 2MO0A 3M85A 3S15H 4HJ5A 1VQCA 5FJ8G 1QVFA 1VQAA 4DV1Q 2NZHA 3OTOQ 2ZTDA 5GQOA 4ALPA 3K7UC 1VQJA 4A76A 2K5HA 3RZDH 4H02A 1KQSA 2DGYA 2KHJA 4LFAQ 3CCMA 1JJ2A 2UUBL 2OWOA 4DR5L 1LYLA 2UXDL 5M3MG 4AYBE 3PCOB 4IPHA 1SLJA 3W1BA 5C4XH 1XMQQ 3FHWA 1BBUA 2R6GA 3KDFA 2AKWB 4B3TL 4IPDA 4DAYB 1IL2A 4A3GG 5IWAL 3W5OA 2VQFL 5M5XH 3ULPA 2YTVA 1N32Q 3CCRA 2Q2HA 2K75A 1P8LA 3HOYH 1VQKA 1PH6A 1X6OA 4GN4B 2B63H 3KFUA 2VY3A 1Y1WG 3CW2C 1K8GA 2I5HA 3K8AA 1BVSA 1JJCB 1QZGA 2ATWA 1YJ9A 2ZTCA 4JI6Q 3S16H 4DV5L 1X55A 3HOUG 1U5KA 3MEFA 1XPOA 2KCTA 4JI3Q 1ASZA 3CMAA 3JC66 1CKNB 1PH2A 4LF6L 1L2FA 4YHHL 1FVIA 3PIPA 2WAQG 1W3SA 2ZM6Q 4A3CG 2JK8A 1RIPA 2KENA 1NBWA 1EOVA 3S14H 4WJ3M 4HIDA 1FL0A 4GNXA 1P16A 1PH3A 1N34L 2CKZB 1K3RA 4KI0A 4BXXH 3KJOA 1YITA 5FJ8H 4DR2Q 2E2HH 3TS2A 3KLWA 4IFDJ 1K0RA 2OQ0A 4LUZA 1QVCA 4YCWA 3ERSX 1VQPA 3F2DA 4AQYQ 2R7ZG 5K36G 1HZBA 3STBD 3BU2A 2VS1A 5E7NA 4A3JG 1KHIA 3U50C 5AJ3Q 1RL2A 5IP7G 2QGQA 1HR0L 2WP8J 1I6HH 5IT9c 1AE2A 3G71A 2R7DA 4FDBA 2F4VL 4IOAA 4JI5Q 3CCSA 4UP9A 1VQGA 4YY3L 1Y1VG 1V43A 1PHJA 1N36L 1YIJA 1WJJA 1EQQA 1GKHA 4LUVA 4IPGA 4O2DA 3ER0A 1XMOL 2JEAI 4JYAL 3H0GG 3TEHB 4LF7Q 1N33Q 1SROA 3I2ZA 4BBSG 4A3JH 1AH9A 4JI6L 3D0FA 2B3GA 4MTNA 4R4TA 3TREA 3W1GA 4JI7L 3AFPA 4BY1H 1R9TH 1I94L 3NENA 3AYHB 3U58A 1IZ6A 2A19A 2WFWA 3PUYA 2DUDA 1YHBA 2YYZA 5LMNL 1X65A 4DUYL 3PF4A 4DR7Q 5FLMH 3CCJA 2NZOA 2UUCQ 4PMWA 3CC4A 3M9BA 5DLQE 4HJ8A 4JI0L 4DR6Q 3G4SA 1YHAA 3OW2A 4BBSH 4UPAA 2VQEQ 3B6YA 3I4OA 4A3FG 1E24A 2AHOB 3G48A 4BY1G 2VQEL 2ZJRA 2UUBQ 3UDXA 4B3ML 4LF8L 3ICEA 3K7AH 4DR6L 3HFZB 4JI2L 3PO2G 1IYJB 1E1OA 4PZ7A 1X56A 3PUZA 4HJ7A 4DR7L 2KHIA 1VQIA 4QIWE 4X62Q 3VDYA
chains in the Genus database with same CATH superfamily
4GLAC 1KXLA 4KJNA 1VQDA 2HQEA 1GXDC 4J15A 1QE6A 5ELBA 1QG7A 2QA4A 4NMZA 1BQQT 5KYLA 4JBJA 4KHPL 2UXCQ 4ULLA 1G51A 4Y7NH 4OWTB 3T4AC 1BBWA 2YTXA 2BCOA 1QUQB 3GTMH 2EJGC 3KF8A 1BDOA 1XX8A 2NN6I 2L15A 3GTPH 2QW7A 3S1RH 1GUSA 2D0PA 2ZTEA 1EIYB 4KHZA 1QUQA 2A73B 4C3IH 1VQHA 4KKTA 4DGZA 3HOXB 4JI2L 5LMUL 3CAMA 4LF4Q 3CPFA 1SR3A 3I4LA 2A6ED 4LFCQ 3D6WA 1K8MA 3A8IE 4L6TB 4K14A 5IGGA 4A93H 2BDOA 2E2IH 4DV2L 1A8VA 2YU9B 2N49A 1YJNA 2XWJB 3U9OA 1WTQA 1PTOH 2NVTB 4B3RL 3H3VH 2RF4A 4JI4Q 1U4MA 4X62L 4IOCA 2PPBC 3K5OA 1AN8A 4A3LH 1HA5A 2UXBL 1TWFH 5EJWA 3S15B 1I50H 5H1SE 2R7ZB 1G6PA 3P7JA 2F0FA 1K73C 2CQAA 2B8GA 1FNVA 2EYJA 3I91A 4ME5A 3ONAB 3NWTA 3PIO3 3BYTB 2RDHA 1CKNA 4AYBG 1RD9D 3E6ZX 1CA6A 3A8KE 2WAQE 3LNNA 4BY7G 2VNUD 1N33L 1WTPA 5I2XA 5JEAJ 5G3LF 1KLGD 2UXBQ 5CBAE 2A69C 3T1YL 3A0JA 1HHVA 3IAYA 1PVOA 4JOIA 3H15A 1HR0Q 1IW7C 4DAVA 4C1NK 3PMFA 3H94A 1XWEA 4JCVE 1VQNA 1HRJA 4APVA 2HIVA 4U68A 4GKJQ 4J8QA 3A74A 5JVH3 1QNKA 3MC0B 2FXQA 4A3EB 1GUGA 1SXTA 1D5MC 4I7AA 4K0KQ 5ELOA 3SE0A 1WTWA 3K0YA 1ENFA 2HD3A 4DR1Q 3RLOA 4DKAC 3GTQH 2D62A 1J5EL 2R92G 1NNXA 4GKJL 5JJIA 3EIVA 2PI2E 3CKIB 1HTPA 3HOYG 5I9OA 1Q86C 3U4ZA 1KDBA 1FYCA 3GTQB 2IHEA 4EQPA 5E4WC 1B3AA 2CWPA 1B53A 1VQFA 3SDZA 1TQOA 3M4OH 2E5LL 2Q8TA 3VYRA 4CGYB 1DGSA 3RZOH 2PZWA 3NP8A 3J80c 1NCVA 1VQLA 1MBYA 1RTOA 4O0AA 4KD3A 1I3QH 1EY5A 1JOKA 1I4PA 1LTAD 1L1OC 5E4XA 5T1GA 2B2UC 3OWEB 2IW3A 1DCZA 1L1OB 3HOWH 1K9MC 3I4NH 4A3MG 5IYCG 1G2SA 1VQ7A 2H5XA 2O2LD 4DR4Q 3PO2H 3NBIA 3L7ZC 3D31A 2F0DA 4H0LC 4LFBQ 4OO1G 1A3UA 1LT5D 1XTDA 5DM73 3H0GH 4C3IG 1XTCD 4DK3C 2K03A 5IYCH 4K2LA 5BR8Q 3DHQA 4IQZA 4QL5A 1I94Q 1CM9A 2OF1A 1J6QA 5GADC 4DV1L 3F2CA 1HZ9A 2D5DA 4EVOA 3QOLA 1TS2A 3GTPB 2NVYH 2K5QA 2EJFC 4LF9Q 4GKKQ 3I55A 4C3HG 4RMFA 4DV4Q 3HZXA 5DAUA 1SMXA 1EUJA 1EFWA 4QF4A 2SNMA 1WOCA 2ALYB 2XRQD 3PO3H 1LUZA 5I9PA 1S5DD 1HZCA 3BDCA 1OXXK 1SNOA 1WFQA 2A69D 4IFDH 1CHPD 4DV4L 2Z6KC 2H4OA 1HUNA 3CPWA 3K81C 2SDFA 4A3GB 5C0XG 1NMGA 4DV6Q 1JE4A 3EJIA 3U4VA 4XDXA 3URYA 1YNXA 1NUCA 3O13A 4F88A 5M5WH 5BR8L 2PW5A 2WINB 1PH4A 4EGVA 3T1YQ 1DZ1A 5DNFA 4EQ5A 1ET9A 2SEBD 2Z0SA 4DPGA 4GOPA 2FFKB 5IYBG 2R7ZH 3BS1A 4YWKA 3K5NA 5IYDG 1PTOB 2NVTH 2HQLA 5T1IA 1DOKA 4LJZC 1SE8A 2XWBB 4DV7L 1H9SB 4R4QA 1Q82C 1SRUA 1F2LA 3T13A 2KA7A 1JWMD 2F0GA 2JA8B 2MNAA 2Z4HA 4KN4C 2JA5B 2A6HC 4EQOA 2G9DA 2Z6BA 1V1QA 3D4RA 4YIJA 4DK0A 4JI4L 3UDIA 4CJ2C 2E2JH 4KKUA 5JOBA 5C4ZA 4RKBA 2BH2A 1EFID 1Y8NB 2K04A 2Y0SB 3GTKB 4ZKBB 4BY7H 2VUMB 4WRDA 3RLNA 4FXDA 1SYFA 1JT8A 3VA7A 2E74C 2IJ0A 4IUTA 4DR3L 1JC7A 4DAMA 3CQZB 1D6EC 4BBSB 3A8JE 3RMHA 5A35A 1PZKD 5G3LD 1PH8A 3GTLB 3E9IA 4A3BB 1KLUD 4ZCKA 1I6HB 2A6HD 2OEOA 1EU4A 2X69A 3S16B 4ID6A 4AQYL 2UUAQ 1HNWL 1X9NA 2WACA 5LHY1 4A93G 2SOBA 2UU9Q 2F0HA 3A5ZB 2JA6H 2Q2UA 1O7IA 2KEEA 3AEVA 3CU7A 4IZ8A 5FLXc 1I5FA 3F8TA 4UHVA 5M3MH 3FPPA 1KNEA 3GD7A 4JC0A 4JI3L 4JBKA 2WV6D 2EYOA 5C3XA 1LTRD 1VQAA 2B2VC 3BDLA 2RBMA 3S1RB 3E5SA 4A76A 2KCNA 2AQ2B 4KK7A 1I4RA 1SSOA 3SK6A 3K59A 2A68C 2E76C 1JJ2A 2OWOA 1LYLA 1PFMA 2UXDL 1RHPA 3W1BA 1XMQQ 4WFN3 2LKVA 2B63B 3KDFA 3G6JB 3FDTA 1AP0A 5IWAL 2QF7A 3JAME 1KNAA 1F2MA 1P8LA 3X3NA 5JJZA 2B63H 1EQTA 1JJCB 1DOLA 4JI6Q 1R4QB 1X55A 3HOUG 1U5KA 4HCSA 2I07B 1XPOA 1WVLA 4JI3Q 3H0GB 1ASZA 1U4PA 3CMAA 1CKNB 4K5VA 3S17B 1FVIA 4K8JA 1RIPA 2L0CA 1NBWA 4HIDA 1PH3A 1H9MA 4BXXH 5FJ8H 1WTVA 2E2HH 1ET6A 5M3MB 1QNUA 3OWFA 4IFDJ 4LUZA 5IGBA 4OIJA 1VQPA 2R7ZG 4RHSA 5K36G 4WORA 1HZBA 2B2VA 1VMCA 1PFNA 4A3JG 5AJ3Q 1CT1D 2QGQA 5M5YB 1FNWA 2F4VL 3T56B 1TWCB 1PHJA 1PMRA 1VF5C 1YIJA 4LUVA 2JEAI 4O2DA 3TEHB 1KTKA 1Q90A 3R3OA 2B3GA 4R4TA 3W1GA 2X6LA 4JI7L 4K6DA 1A15A 1Y69U 2WIIB 1PRTC 1IZ6A 2A19A 4BS9A 5C44B 1NR2A 4C3JG 3PF4A 4JI0L 1Y8OB 3WDNA 3MXGA 3GQBA 2VQEQ 3I4OA 4A3FG 2JN4A 2AHOB 3UDXA 3ICEA 4N8X1 1PDQA 2HUGA 1EY8A 3PUZA 4HJ7A 4DR7L 1D2BA 2EYFA 1S5ED 2L9HA 3OTOL 4OO1H 1MJCA 3NSWA 4UP7A 3CCQA 1MHWC 1JR0D 1NAPA 3KLSX 1L0WA 1BKBA 4A4IA 2QDLA 5AFWA 1PRTF 1IBKQ 1S40A 1TIID 2OTJA 3HOYB 3C1EA 3S2HH 5C4XG 4A3KH 2G9HD 3QO2A 2EYHA 1LTTD 2EY6A 1CQFA 2Q8RE 3K5MA 2KOLA 2O5IC 3A7AB 2F0EA 2MQHA 4X64Q 3VR3A 2RHQB 1TKWB 2WKCA 5HGQA 4NXMQ 2RSOA 1UAPA 2G5DA 2NB0A 3I72A 1GOZA 3PO2B 5LL6X 3D8GA 1N9WA 3BVGA 1Q12A 2OTLA 4QMGA 5EPKA 2A68D 1IBML 1Y1WH 3DWQA 2B2YC 3HOZH 4A3MB 1FD7D 2ZM6L 4FXGC 3DWPA 1CKMA 5C6AA 2QKIC 1V9PA 1SYDA 2CH4W 1SE3A 3VYSA 1WD1A 4DAPA 1KDAA 2ES2A 1TWHH 2JA9A 2JE6I 4JI6L 1KABA 2IX0A 2KEDA 4J1MA 1B70B 2JA7G 2VB3X 2Z6KA 5JEAH 3HOWB 1MIUA 2D0OA 2A5HA 4GLVB 2QDBA 1MJEA 4LFBL 2LMCB 3GTOH 2F3VA 2WKDA 2WB1E 4YCVA 1SNPA 3L2PA 3CD6A 1LTLA 1S3OA 3U9SA 4XQQA 4C3HB 4JI1L 2Q2TA 1QWYA 3CCEA 4XXEA 2N8NA 3HOXG 1JB7A 3GTJH 3G7LA 1O7YA 4YWMA 4FF1A 4NB3A 5M5WB 4GS3A 4P71A 4LK1C 3VR4A 2E5LQ 2RSNA 1BCPD 3KBXA 5GAGC 1TWAH 2YV5A 1TY0A 4PZ6A 1FGBD 2F0OA 1FJGQ 1MSHA 1B1ZA 1Q1BA 1CA5A 2B2TA 3T16A 5C4HA 1EOTA 5J39A 4QGUA 1OTCA 2UUAL 2KECA 1TVXA 2R7FA 4DV3L 3IRBA 1B2TA 1C8CA 1D5XC 4EQNA 1OO9B 1EYGA 1K3BC 4L5RC 3BZDB 3IFTA 1B3QA 1X32A 4DR1L 4K5WA 1WTOA 2AUKA 2O4XA 3J7YW 1LLRD 2Q2IA 4K5XA 4AYBB 3J7ZC 3MFGA 1OXTA 5KGUA 3DM3A 1PTOD 3JAMc 4C1NI 4K6LA 1W6JA 2JA5G 4OWXB 1Q7YC 1WTRA 1AW7A 1KRSA 2PYKA 2ASBA 1ICFB 2F0PA 4L8JA 4L63B 5NUCA 5FO9B 2BE5D 4TRDA 1PRTB 1S5CD 2VUMG 5L37A 1AZPA 1F9RA 1ASYA 3WOFA 4A3DG 4FF4A 1AEXA 1NSNS 1SBBB 2QCPX 4DFAA 2K5WA 4CJ1B 3S9WA 4B3TQ 4DNRB 1CQVA 3CCVA 1E3PA 4WJWA 1MKHA 4HIMA 3J7AV 3RR5A 4IO9A 4OWWB 3CXCA 4FVMA 1KRTA 4K2KA 4BBRH 2FMMA 2ZT9C 3RN5A 2I0QA 2NYZD 1GO3E 5IGFA 4NXNL 3MA2B 2L5TA 2RHSB 3DUZA 4LMQD 3S2DB 2GA4B 2QILA 5LL6S 3C1FA 3HS0C 1S5FD 3S2HB 1STEA 2B39A 2RA4A 1SAPA 1Y1VH 1UE6A 3CCLA 2FMCA 4XIGS 5C3EH 4A3BH 1SNQA 1VMPA 5ELNA 1E0BA 3PGZA 5IY0A 1GUOA 4POGA 1UNSA 5D65A 3CMEA 1K0SA 1IXRA 2RKSA 3OHXC 5FLXE 1YNJD 4PG3A 2NN6G 2VL6A 1SYEA 2CVRA 1NJIC 5LMUQ 2R93H 1DM0B 2JA6B 2I46A 2M2LA 4A3IG 3MXNB 5CV4A 5JPNC 4KMUC 2N78A 2GN5A 4OO1I 4DV3Q 1STBA 1TWHB 4C3IB 3OIPA 1ZKOA 1GHJA 2EIFA 4A3MH 1D1IA 2HDMA 1QOHA 1GVPA 3GV6A 5C3WA 4A3GH 3HKSA 2EVBA 4RAUC 1Z47A 5EBDA 3J81E 3J7A5 1EY4A 3HOUB 1AFPA 1B8AA 4ZLTF 3M4QA 4KD4A 1E7ZA 1T5EA 4FYDA 2BE5C 5C4JB 1PYSB 3MTSA 4MZ9A 3TP7A 2K28A 4OL7A 3F1ZA 4RGMA 1N32L 3EBEA 2VQFQ 2F3IA 4RG1A 4IFDI 1B9NA 2AMCB 3BZKA 4KV6A 4LF8Q 1WI5A 1NR4A 3KUPA 2UUCL 1RKNA 4DR5Q 3CCUA 4RA8A 4LFAL 3S17H 4DV0L 1XPRA 4M8AA 1LACA 2IPKD 4JI7Q 2O5JC 5M5XB 1QCBD 5KYIA 3NBHA 3M7GA 2E2HB 1BR9A 2JQOA 2PMZE 3KDFB 3HKZE 3BJUA 3PQIA 3HG9A 2CFMA 2KJXA 5EKKA 2F0SA 1U4RA 1UWVA 2EDGA 5IYDH 1CSPA 2CHBD 3IL8A 3HP3A 4KY7A 4ZAIA 4C3JB 5EKLA 2KUMA 4L5QA 2JA8G 1YNND 4BWGB 3EA6A 5CBEE 1TWCH 2HCCA 4JBWA 3TP5A 1B4OA 2CCZA 4X64L 2K50A 1TWGB 2L12A 4DR2L 1JOOA 1HH2P 4JOIC 4IJLA 1Y1WB 3A5UA 1F77A 1HR0W 4BA2I 3HOZB 2YTYA 1N34Q 2EYPA 4P74A 2JA8H 1EWIA 1PTOC 1HA6A 3PO3G 4PNYA 4GKKL 5D14A 5M3FH 3GTGB 1D7QA 4Q0FA 3M85A 3J81L 4DV1Q 1BUVT 2ZTDA 5GQOA 4RGNA 2K5HA 1HFGA 2QEJC 2R3ZA 4LFAQ 3M4OB 4FF2A 2UUBL 2EZVA 4DR5L 2PW7A 5C4XH 2EY2A 3FHWA 1BBUA 1LABA 1BCPB 3H91A 3KLRA 2VQFL 3ULPA 1GUTA 2YTVA 1N32Q 3CCRA 5KNBA 2EOTA 4MHEA 4RWSC 1PH6A 3A55A 4GN4B 2VY3A 1K83B 1IHZA 1G6ZA 1AZQA 1D5ZC 4DN4M 1O7LA 1QZGA 3K7AB 2ATWA 2DY7A 1CHQD 1KAAA 3S16H 3MEFA 2KCTA 1PH2A 4IUUA 2JK8A 4HSVA 2KENA 2CW0C 4WJ3M 1A2TA 1FL0A 2F0TA 1P16A 1K3RA 4NKLA 1CZGA 1J8IA 4YCWA 4CDEC 1KDCA 2M9VA 4FO2A 3EQLC 4XT3B 1KHIA 3U50C 2J0TD 2WP8J 1AE2A 3G71A 1EY7A 1TS5A 4FDBA 4JI5Q 4QUCA 3SEBA 4YY3L 3MZ5A 1LT6D 1V43A 5IODA 1EQQA 1WJJA 3ER0A 4JYAL 1S5BD 3H0GG 3QJYA 1I50B 4XT1B 3TREA 4BY1H 4RHRA 3NENA 2DUDA 1YHBA 4DUYL 1CFMA 1ONLA 4PMCA 4XYOA 3CC4A 3OSOA 4ODGA 1SDFA 4IUNA 1WCMB 1DD2A 2L55A 3MAQA 2XN9C 4BY1G 2UUBQ 4ZK9B 3HFZB 4DR6L 3I4MB 1IYJB 1E1OA 1X56A 2F0UA 3VDYA 3R8BA 5FO8B 4CKEA 3J80i 5HGTA 1O80A 5CV6A 4OIKA 4IJHA 1U9RA 5JPMC 2BA0A 2I5LX 2IL8A 2JEBI 2KCMA 5ELCA 4JV5Q 1HNZQ 3LWUA 4GOPC 2B2TC 1W6KA 3E9HA 1F9QA 5HURA 5FK9C 1TU2B 2N88A 2RDGA 3PF5A 5FO7B 3R2TA 3OYYA 1KL9A 1YI2A 1IBMQ 1YNJC 1M8AA 2TSSA 4KY5A 2EJMA 5C44G 2DNCA 4CKBA 3J81c 3S1NH 1SNCA 5I6WA 2PZTA 2AWNA 4A3DB 3KF6A 1A62A 2LXKA 3LGJA 4UDUC 2HIXA 4OONA 3VR5A 1Z6HA 4IUVA 3RZDB 3I56A 2F03A 3FP9A 3J81i 2FHTA 1SYBA 2F0QA 1HFNA 4R4IA 3TQYA 1VQKA 4X6AH 2CH4A 2L1BA 3T1HL 3ZJYC 5DM63 4G7ZC 1CUKA 1EZ6A 1F9SA 3P1HA 2AUJD 2IHFA 3OPOA 3CC7A 4PZ8A 3TP8A 1JORA 4DR3Q 4XTCS 4YWLA 4LNQA 1ML0D 1B50A 3X3MA 1SJED 1ZEQX 4HIKA 1IBLL 1PYWD 3D4WA 1X3PA 3TDQA 1VQ5A 4MN3A 3SHLA 1PXUA 4CJ0B 5JJLA 2E8GA 4HMIA 1J9OA 2EE1A 4ILWA 4HCEA 4DR4L 2NVXB 1MGSA 2XIWA 3GV3A 2Z1CA 1Q46A 1SN8A 1TR5A 1R9TB 4JI0Q 2F0MA 1TXYA 4DUYQ 5E3FA 1GM5A 2HHHQ 4DA2A 1S72A 5JVG3 3DLLA 1EY0A 2NZ1D 2HHHL 1T5XD 3Q6SA 1D8LA 1I4QA 2EY5A 1Y1VB 4IFDG 3HOVH 1E1TA 4DNIA 1NTGA 5D3DA 4LW1A 2L4NA 4GN3B 4JVZA 4YY3Q 2K5VA 3GDEA 3H6MA 1JB3A 3ULLA 3PIP3 5IGEA 3RUZA 2JA7B 2PQEA 1XPUA 1IL8A 3IKJA 3NWSA 1XXGA 3Q24A 4DUZL 1RCVD 3N6RA 3C3LA 3HOWG 1EIFA 4KKSA 5FLMG 3AQQA 2R93B 4GNXB 1QJOA 4R9WA 3K80C 1EYDA 1YZ6A 2EYMA 2K14A 4JPBW 1LV9A 4K0KL 4ZUIA 2JXMB 3V2TA 2Z4IA 1A0IA 2MP1A 4DK1A 1WD0A 3BDOA 1PH5A 4P75A 5ELFA 3EN2A 3RNUA 3F2BA 4KTAA 1Y8PB 4S3SA 1V8QA 2BA1A 4HJ9A 1EYCA 2RCNA 4DAYA 2EY1A 4ME3A 1PH7A 2K05A 1B7YB 2OQKA 4QY7A 1G8ZD 4R8IA 2D9UA 4IPCA 4GNXC 3FKIB 2N55A 2F0KA 5CORA 5ELEA 2JP1A 5CGKA 3GTLH 3I70A 1DJRD 1O7ZA 1IBKL 4DK6C 1W2BA 1UE7A 1GUNA 2XGTA 4DV5Q 4QUFA 2JJQA 2F0LA 2B2WA 2OCEA 4FF3A 1VQEA 4R1JA 3NXWA 2F0IA 3TZDA 2B29A 4BBRB 5I6YA 4EX5A 2VB2X 1V1OA 3ND9A 4L5TA 2CWAA 2BOSA 4HTHA 3PIOA 2A6EC 1YBYA 4V0BA 5KRUA 3DXJC 4MNOA 3E0EA 3HOZG 1I4HA 1FGUA 1L0YB 2ZXRA 1PV4A 5M3FG 2RVLA 2NUCA 5GAEC 1EQRA 1J5EQ 5C3EB 4JI8L 1WYDA 4JI5L 4A3FH 2HCIA 4B3SL 4BA1I 3VR2A 1STAA 1UEBA 3CQZH 2OT2A 1KIXA 3DM1A 1H9RA 1X3EA 2IT1A 4X65Q 3JAML 4GN5A 2PNHA 3A7LA 1SMYC 4X66L 2PQAA 3SK5A 1EYAA 3NTHA 4A3CH 1XYIA 1U0LA 4F7XA 1I6VC 3TS0A 2ICEC 1I3QB 4E6IA 3HOXH 3Q0AA 4N9PA 3ULJA 3RLFA 2NVQB 4NPSA 3EVQA 4XQNA 4AIMA 2UXCL 3FRPB 1ESFA 3A54A 1G291 3I4NB 1PYBA 2M00A 1M90C 4WJ4A 5IP9H 4QJFA 2SNSA 1XNQL 4JV5L 2YU9H 2VZAA 2MHVA 3SXHA 5CMDA 1GHKA 4HSPA 3STBC 1JOQA 1EY6A 2J4XA 3GO5A 4B9WA 4GOPB 4UP8A 1STGA 2MPMA 1IKMA 3QG1A 3WWVA 2JA6G 4A3IB 4RCNA 3WOEA 5IWAQ 4G7OC 1VCIA 3KF8B 5C5MA 3Q22A 3M3YB 1XMQL 4K8IA 5C0XI 4A3EH 1UE1A 4A3IH 5LMNQ 2Y0SE 1EEFD 3GTJB 1MD2D 3IFDA 3TSSA 4Y7NB 3HOVG 1N8RC 1UUPA 4DV6L 4UY8C 1VQ4A 2ID0A 3MXNA 3BVZA 1BBXC 1F2ZA 1LM0A 5I2YA 5IT9E 2AQ3B 1XMOQ 1RF2D 4IURA 4LF7L 1I4GA 4ZQ3A 5EBCA 3P75A 1WCMH 4M1UB 1MSGA 1VQOA 1LTGD 4R4CA 1Z9FA 3NBHB 1ENAA 3PV0A 3V96A 4A3LG 5HY6A 2RQXA 1CKOA 3ERQA 1IYUA 3VYTA 1BNZA 4XYQA 2NVYB 5A2QE 1FR3A 1HQMC 1X54A 3M7NA 1EEID 5IIFA 4Y52H 1BF4A 3J81j 1EL0A 1Q1EA 3UI2A 1Q3LA 3SVMA 1KC8C 3TRZA 3T53B 4G57A 1E2VA 4ZUJA 3HKZG 1K8AC 1VQ8A 1L0XB 2HDLA 4JI8Q 2ZJQA 3KK7A 5EGTA 4LF6Q 3M3YH 1A6XA 1STHA 1HNZL 1C9OA 1PA6A 2VXWA 4BXXG 2N3SA 1G91A 5FJ8G 2KCCA 1QVFA 3OTOQ 4ALPA 4CKCA 1ILQA 1S4ZA 1KQSA 2DGYA 2KHJA 2E75C 3L9AX 2ZXOA 3RZOB 4IPHA 1SLJA 3CHBD 4OHJA 1JICA 3MHBA 3NK9A 1HCZA 1DOMA 4R8NA 2R6GA 4B3TL 2K33A 1IL2A 2Z8LA 4LAAA 1BCPC 1ZXTA 3HOYH 4HEDA 1X6OA 3I90A 3KFUA 1Y1WG 1MI2A 3CW2C 1ESRA 2I5HA 3K6OA 1BVSA 4V190 1YJ9A 5TSSA 2LS01 5CC4A 3PO3B 4FP5D 3JC66 2JYOA 4LF6L 4YHHL 3PIPA 4HN7A 4HAEA 2C9OA 3P20A 2B2YA 1EOVA 1X3QA 2DN8A 1H9JA 4KI0A 1YITA 4DU9A 3TS2A 4P2CB 1QVCA 3ERSX 5EPJA 2PMZB 3H3VC 4RH6A 4ZRZA 1ZYRD 5CYUA 1M4VA 4X3UA 1RDPD 3MXPA 4I65A 3VA5A 3V05A 1RL2A 5IOCA 5IP7G 1HR0L 1LTID 3OOCA 3S1QB 1II3A 3CCSA 2RDFA 1A3TA 1Y1VG 1N36L 1GKHA 4IPGA 1XMOL 2MJ8A 2RCFA 3DEOA 4LF7Q 4Q5VA 1SROA 3I2ZA 3I73A 1ENCA 4U673 1AH9A 1SYGA 1R9TH 1I94L 2K5DA 1EIHA 2WFWA 4ZKCB 1QILA 3OW7A 1PTOF 3QB3A 1F9PA 4PMWA 5DLQE 4DR6Q 2EPBA 3G4SA 1YHAA 3NQIA 3OW2A 2ICIA 2J7ZA 3B6YA 1E24A 3NUCA 4LF8L 4B3ML 2F0WA 4GZYC 2NWGA 4QIWE 1YJWA 1DYQA 4X3TA 4RGOS 2B2WC 1EWHA 1IYVA 5CV5A 4B3RQ 4UAIA 1VS0A 4DV2Q 3MEHA 3N52A 2Z9HA 5K36H 1XNQQ 3HGBA 3TMEA 2WB1B 4OX9L 2JA5H 1TY2A 3F2UA 1N36Q 3MWYW 1HNXQ 1UEAB 3KLSA 2EXDA 2K5NA 4LF4L 3E3XA 1YEZA 1GJXA 3M4PA 3S1MB 2PI2A 3Q8DA 2IX3A 3S24A 5ISRA 5IYBH 3FKIG 1GD7A 5F2DA 3RN2A 2TMPA 3FEWX 1SYCA 2DJGC 4CHTB 3NEMA 3J7AF 1WCMG 2F3WA 3J80L 3FVQA 4P72A 4X65L 4BY1B 5FLXL 3I4MG 1XNRL 2ENBA 3T1HQ 2ZJPA 4PV1C 3W2DA 2IWHA 2NBFA 4MIUA 3PSIA 4A75A 1PZJD 2E2IB 3NELA 1XNRQ 2L11A 3NTIA 1HJPA 3HEJA 4QIWB 1CSQA 3Q23A 2F4IA 3I4MH 3TBIB 1VQMA 2WAQB 3E0JA 4BBRG 1PH9A 1C0AA 3VR6A 4AH6A 2A1AA 2PCFB 4JK1C 1RJTA 2P5ZX 3I7FA 3D6CA 4ABNA 2Q8IB 4H7BA 1K28A 5EAYA 1ILPA 3TZUA 1JMCA 2QEXA 3UDGA 4KHVA 3DMUA 1R4PB 3OMGA 3JAMi 2MFIA 4A3KG 1GUWA 1SEBD 1Z7TA 2K52A 1SFOB 4LF5Q 1DXMA 2X6GA 3R93A 5M3FB 3S2DH 3SK8A 4OXPA 3S1MH 3LWEA 3PUXA 5C3EG 4KLKA 4FNFA 4A3EG 4L5SA 4C2MB 3QIAA 2PNRC 1PFBA 1C48A 3UE0A 2JSOA 2B2UA 4H44C 4JBMA 3KF6B 1NE3A 4PQXA 4C2MH 3LX0A 3K57A 2KBNA 1QVGA 4LWCA 5KIXA 5BN4A 2NTSA 1TT2A 5J1ZA 1U4LA 5AJ3L 1PH1A 3DWAA 4C3JH 1OXVA 2DY8A 3KYHC 4O42A 4X3KA 4XQJA 1AE3A 4HR7B 5C5LA 1OXUA 3I8ZA 2PO4A 4JYAQ 2GVAA 2H1EA 1E2WA 4F87A 4O1NA 1HZAA 3CF5A 1TWGH 1HUMA 5CV8A 1Y14B 2HT1A 3KOJA 3KJPA 1TS3A 1VQBA 3NQTA 1T9HA 3UDFA 5IP9G 2DNEA 1H95A 2NVQH 4IALA 4NXML 1YVCA 4LF9L 3AU7A 5FKAC 4DUZQ 3UE1A 2NVXH 2DJFC 1Q8KA 3HOVB 2NN6H 4DV0Q 4C56C 4NDXA 2R93G 1JQYD 1RODA 3M4YA 4TKOB 2XVSA 4KJOA 3FPUB 2FINB 4KHPQ 3TP6A 2LFNA 5C0XJ 2UXDQ 2KQ3A 1JE5A 3MVVA 1SNDA 5KNDA 4JW0A 1ZYRC 5GROA 4HIOA 3RD4A 5C0XH 5BN5A 1EY9A 4DXGA 1KAWA 1PZID 5C44H 1M1KC 3SR1A 3L0OA 3K0XA 2JA7H 1F2YA 4MTKA 4JI1Q 4LF5L 4F8MA 2V4DA 1CTMA 3D4DA 5CV7A 2R61A 2CQOA 3H3VI 1C7YA 1E22A 1BO0A 4DXFA 2K7VA 2CW0D 2UU9L 1IBLQ 2VW9A 1PRTD 4N9TA 5EPLA 2A8VA 3GTMB 2BH8A 4QQBX 1TS4A 2I5MX 1B44D 3NTKA 4QCLA 2VUMH 4I7ZC 4JG2A 1TWAB 3QOJA 2XTIA 1V1PB 3FKIH 2AWOA 3S1NB 5D3IB 3J80E 5M5YH 1H9KA 3GTOB 4B3SQ 1WTHA 4ZYSA 4G7HC 3A56A 5IP7H 3GTKH 4BY7B 1OXSC 1SE2A 4POFA 1K83H 3CC2A 1VQ6A 1A63A 4GLXA 1SJHD 5J3BA 4G4KA 4HJAA 1L1OA 2K01A 1YHQA 1CI3M 3ITPA 2K6AA 4IUPA 5LMNW 2Y0SG 1HNXL 1X3GA 3I3CA 1HQRD 1Q81C 1RTNA 2GVBA 4OX9Q 2BDNA 4LUOA 1IKLA 1SFOH 1A2UA 1EWCA 4FXKC 3GP7A 4NXNQ 1LTBD 3BZCA 4CDDC 4DV7Q 3PUWA 1CK1A 2LSSA 4N8FA 3D3RA 4A3BG 1KD1C 2XSCA 3GTGH 3MFYA 4CDFC 5IGCA 3KBGA 4R4OA 4B3MQ 2R92B 3CRKC 4KN7C 2E2JB 3AMUA 4J6HA 3SK4A 2KHSA 3L3OC 5GAHC 1UE5A 2F52A 1XJVA 1EU3A 3BVMA 4IN3A 5M9OA 4HMJA 1K8OA 3AFQA 2C5CA 2EQSA 1X3FA 2OXPA 1JJGA 3NPPA 5JJKA 4NP5A 3G6EA 2LY7A 1B9MA 2V1CC 5CR3A 4A3DH 4QB4A 1JWUD 2B8FA 3I4NG 5COYA 1DONA 2D2CC 1LT4D 2PQAB 1EQVA 3BYYB 4TQUS 1LTSD 1BCPF 2IY5B 3T51B 1HTLD 4JI2Q 3H09A 5JEAG 1LO5D 4LFCL 1SE4A 2F4VQ 1ICWA 1H9SA 4P73A 1NY4A 1HNWQ 3S1QH 5IE8A 2C35B 1STNA 3EFXD 5IGDA 3C2PA 2AQ1B 3VYUA 3SGIA 4X66Q 4RFBA 4TSSA 2B63G 3CP0A 1CZWA 3FMCA 4YCUA 3MXUA 3K5LA 1PFSA 1JWSD 1HPCA 1JCKB 5KNCA 3HOUH 4NW2A 1VQ9A 3DEPA 2EYLA 5CV9A 2F0VA 1FJGL 2R92H 2MO1A 4TVAB 1NMFA 2LXJA 2IX1A 1A3VA 4YHHQ 2K1BA 4KY6A 3PUVA 5C4JH 4B9XA 1E2ZA 2K4KA 4C3HH 1TWFB 1QZHA 2WB1G 3S15H 2MO0A 4OEMB 5E1FA 4HJ5A 1VQCA 2NZHA 4PMBA 3K7UC 1VQJA 3RZDH 4H02A 1D1KA 4OGQC 3QR8A 3BG3A 2KVMA 3CCMA 2E2DC 4RGTA 5M3MG 1BXTA 3PCOB 4AYBE 1FNUA 3OMCA 4Z9CB 2AKWB 3K58A 4IPDA 4DAYB 2MGSA 4A3GG 3W5OA 5M5XH 3HRZC 2Q2HA 2K75A 4A3JB 2XNAC 4X3SA 2FJ2A 3EROA 5KEEA 3NHHA 1K8GA 1VF7A 3HKZB 1IW7D 3K8AA 2F1MA 1I4XA 2ZTCA 4DV5L 2EXZA 2XRSD 3NE5B 4DF7A 5BN3A 1SNMA 2ZXPA 1L2FA 2WAQG 1W3SA 2ZM6Q 4A3CG 4IUQA 2F0JA 5K5PA 3S14H 4GNXA 1VDZA 1N34L 2CKZB 2F0NA 5A2QL 3ZYYX 3KJOA 1STYA 4DR2Q 1V1PA 3KLWA 1K0RA 4A3KB 2OQ0A 4RCOA 4RKLA 4A3FB 3F2DA 4DNTB 4AQYQ 4CBVA 2NTTA 3OIQA 1C4QA 3STBD 1Q8IA 3BU2A 5I4DA 2VS1A 5E7NA 1HXYD 5IT9L 1I6HH 5IT9c 2PZUA 2R7DA 4IOAA 1EIGA 2A74C 1BOSA 4UP9A 1VQGA 1YNNC 3AB9A 1SMYD 3CRLC 1N33Q 5EKIA 4BBSG 4A3JH 5FOBB 3TN2A 3C46A 3D0FA 1G2TA 4MTNA 3AFPA 3QWNA 4CDCC 5C4XB 3ND8A 3AYHB 3W3AA 1QB5D 3U58A 1PLFA 4B08A 3PUYA 4H13C 2MUYA 2YYZA 5LMNL 1X65A 4DR7Q 5FLMH 3CCJA 2NZOA 2UUCQ 4OELB 3M9BA 1O78A 1EZ8A 4HJ8A 1WTXA 4BBSH 5J22A 4UPAA 5EQ0A 3R2IA 3G48A 2VQEL 5DEHA 5ELDA 5JAVA 2ZJRA 3S14B 1LT3D 3K7AH 3PO2G 4A93B 4PZ7A 2K32A 2KHIA 1VQIA 4X62Q
chains in the Genus database with same CATH topology
3OTOL 4GLAC 1KXLA 3J80i 4B3RQ 1VQDA 1MJCA 1VS0A 4UP7A 3CCQA 4IJHA 4J15A 2BA0A 1L0WA 2I5LX 4DV2Q 3AEVA 2QA4A 4BA2I 1BKBA 2JEBI 2KCMA 4A4IA 4JV5Q 4JBJA 1HNZQ 4GOPC 1XNQQ 3E9HA 1IBKQ 4OX9L 4KHPL 1G51A 1S40A 2UXCQ 4Y7NH 2JA5H 2OTJA 4OWTB 1N36Q 3S2HH 1BBWA 3PF5A 2YTXA 1HNXQ 3OYYA 5C4XG 1KL9A 1YI2A 4A3KH 2EXDA 2K5NA 1IBMQ 4LF4L 1YEZA 3M4PA 2PI2A 1QUQB 3Q8DA 3GTMH 5C44G 3S24A 5IYBH 3FKIG 3J81c 3S1NH 1GD7A 3RN2A 2MQHA 3NEMA 2NN6I 4X64Q 1WCMG 2L15A 2AWNA 2RHQB 3KF6A 3GTPH 4P72A 3S1RH 2D0PA 2ZTEA 5HGQA 4X65L 1A62A 2LXKA 3LGJA 1EIYB 4NXMQ 4KHZA 1QUQA 2HIXA 4OONA 3I4MG 4C3IH 1VQHA 3I56A 1N9WA 1XNRL 3FP9A 3J81i 3T1HQ 2ZJPA 1Q12A 2OTLA 4R4IA 3TQYA 5LMUL 3CAMA 3PSIA 4A75A 3CPFA 1Y1WH 3T1HL 1SR3A 3ZJYC 1IBML 4LF4Q 3NELA 4LFCQ 1XNRQ 3HOZH 1CUKA 1HJPA 2ZM6L 1CSQA 1CKMA 2IHFA 3CC7A 4PZ8A 3I4MH 1V9PA 4A93H 2E2IH 1VQMA 1PH9A 4BBRG 4DR3Q 1C0AA 4XTCS 4DV2L 4AH6A 1A8VA 4YWLA 1TWHH 2A1AA 2JA9A 2JE6I 2N49A 1YJNA 2ES2A 2IX0A 3I7FA 4HIKA 1B70B 1IBLL 2JA7G 3H3VH 4B3RL 2RF4A 5EAYA 4JI4Q 4X62L 4IOCA 1JMCA 2Z6KA 2QEXA 4A3LH 1MIUA 1VQ5A 2D0OA 4GLVB 3UDGA 1MJEA 3JAMi 4LFBL 4A3KG 2MFIA 2UXBL 1TWFH 5JJLA 3GTOH 1I50H 5H1SE 2K52A 2WB1E 4YCVA 2E8GA 3L2PA 4LF5Q 3CD6A 1G6PA 1LTLA 1S3OA 4DR4L 1Q46A 1SN8A 3S2DH 4JI0Q 4OXPA 1K73C 3S1MH 1TXYA 4DUYQ 3PUXA 4JI1L 2Q2TA 5C3EG 1GM5A 2HHHQ 1S72A 4KLKA 3CCEA 2N8NA 4A3EG 3HOXG 4L5SA 3DLLA 1JB7A 3GTJH 1CKNA 4AYBG 2HHHL 1D8LA 1YJWA 4YWMA 4NB3A 3UE0A 2WAQE 1E1TA 3HOVH 4DNIA 4IFDG 4BY7G 4JBMA 2VNUD 3KF6B 4GS3A 1NE3A 1N33L 1NTGA 4C2MH 4LW1A 4P71A 5JEAJ 4GN3B 2UXBQ 2KBNA 4YY3Q 2K5VA 3GDEA 3A0JA 3T1YL 1QVGA 2E5LQ 4LWCA 3ULLA 5GAGC 1TWAH 2YV5A 1XPUA 1PVOA 4PZ6A 4JOIA 3H15A 1FJGQ 4DUZL 1HR0Q 1Q1BA 5AJ3L 1PH1A 3HOWG 1EIFA 4C3JH 1OXVA 3KYHC 1D7QA 4QGUA 5FLMG 1OTCA 3AQQA 2UUAL 1AE3A 4GNXB 2R7FA 4DV3L 3IRBA 1OXUA 4JCVE 1VQNA 2GVAA 4JYAQ 3K80C 4APVA 2HIVA 4GKJQ 1YZ6A 1EYGA 2K14A 1HZAA 3CF5A 3A74A 1TWGH 4K0KL 4L5RC 1Y14B 4DR1L 2HT1A 2FXQA 3KOJA 3KJPA 1A0IA 1VQBA 2Q2IA 3J7ZC 4K0KQ 5ELOA 1T9HA 3UDFA 5IP9G 1PH5A 4P75A 4DR1Q 3EN2A 3RLOA 1OXTA 4DKAC 3RNUA 2D62A 3GTQH 1H95A 3F2BA 1J5EL 2NVQH 2R92G 4NXML 3DM3A 4GKJL 3JAMc 1YVCA 2BA1A 5JJIA 3EIVA 2PI2E 4HJ9A 3HOYG 4LF9L 1Q86C 2RCNA 2JA5G 3U4ZA 4OWXB 1Q7YC 4ME3A 1PH7A 2OQKA 1B7YB 2IHEA 1KRSA 4QY7A 4DUZQ 2ASBA 3UE1A 2NVXH 4IPCA 4GNXC 2CWPA 1Q8KA 1VQFA 3M4OH 2VUMG 2E5LL 4DV0Q 4LNQA 1DGSA 3RZOH 1ASYA 3J80c 4A3DG 2R93G 3GTLH 1VQLA 4B3TQ 1IBKL 4DK6C 4KHPQ 4O0AA 1W2BA 1UE7A 1I3QH 1L1OC 3CCVA 1E3PA 5C0XJ 2UXDQ 2XGTA 4DV5Q 1JE5A 5GROA 1MKHA 2JJQA 4HIOA 4HIMA 1L1OB 3RR5A 4IO9A 4OWWB 3HOWH 3CXCA 1K9MC 3I4NH 1KRTA 3RN5A 2OCEA 4BBRH 4A3MG 5IYCG 2I0QA 1KAWA 1VQEA 5C44H 1M1KC 4R1JA 3L0OA 1GO3E 1VQ7A 4NXNL 3K0XA 2H5XA 4JI1Q 2JA7H 4DR4Q 2RHSB 4LF5L 3PO2H 2B29A 3L7ZC 3D31A 4EX5A 4LFBQ 4OO1G 2CQOA 4L5TA 1XTDA 3H3VI 2CWAA 1C7YA 3H0GH 4DK3C 3TRZA 1E22A 5IYCH 5BR8Q 2UU9L 3PIOA 1IBLQ 1YBYA 4QL5A 1Y1VH 2VW9A 1I94Q 2A8VA 1UE6A 4MNOA 2BH8A 1J6QA 5GADC 3E0EA 4XIGS 4DV1L 5C3EH 3CCLA 3HOZG 3F2CA 4A3BH 1HZ9A 4QQBX 1FGUA 5ELNA 3PGZA 5IY0A 2I5MX 2NVYH 4GKKQ 4LF9Q 3I55A 1PV4A 5M3FG 4RMFA 4POGA 2VUMH 4DV4Q 3CMEA 4JG2A 2XTIA 1EQRA 5GAEC 1IXRA 1J5EQ 1SMXA 1WYDA 1EUJA 3FKIH 4JI5L 4JI8L 4A3FH 2AWOA 1EFWA 4B3SL 4PG3A 1WOCA 2NN6G 2ALYB 2VL6A 4BA1I 5M5YH 1LUZA 3PO3H 1NJIC 1UEBA 4B3SQ 5LMUQ 3CQZH 2R93H 1KIXA 1HZCA 1OXXK 5IP7H 1X3EA 2IT1A 3GTKH 1OXSC 3MXNB 4POFA 1WFQA 1K83H 4A3IG 4X65Q 4DV4L 2Z6KC 3CC2A 1VQ6A 4GN5A 2PNHA 1A63A 4GLXA 2N78A 2GN5A 4X66L 2PQAA 4OO1I 5J3BA 3CPWA 4DV3Q 4A3CH 3K81C 1U0LA 5C0XG 1NMGA 4DV6Q 3U4VA 1YNXA 2EIFA 4A3MH 4HJAA 1L1OA 1YHQA 3TS0A 3HOXH 2Y0SG 5M5WH 5BR8L 3ULJA 5LMNW 3T1YQ 1PH4A 1GVPA 1HNXL 1X3GA 3RLFA 3HKSA 4NPSA 4EQ5A 1Q81C 2Z0SA 4A3GH 4DPGA 1Z47A 2GVBA 4AIMA 4GOPA 4OX9Q 2UXCL 3J7A5 4LUOA 1G291 5IYBG 1SFOH 2R7ZH 1B8AA 1PYBA 4YWKA 5IYDG 1M90C 4WJ4A 2NVTH 3M4QA 5IP9H 4QJFA 1E7ZA 1XNQL 2HQLA 4NXNQ 4JV5L 2YU9H 2VZAA 3BZCA 3STBC 1SE8A 3GO5A 4DV7Q 1PYSB 4GOPB 4MZ9A 4UP8A 3PUWA 2LSSA 4DV7L 4R4QA 4A3BG 1KD1C 3F1ZA 1Q82C 3GTGH 3WWVA 1N32L 2JA6G 1SRUA 3EBEA 4R4OA 4B3MQ 5IWAQ 2VQFQ 2F3IA 1VCIA 4RG1A 3KF8B 4IFDI 2AMCB 2MNAA 3BZKA 4LF8Q 1XMQL 1WI5A 5GAHC 5C0XI 2UUCL 1UE5A 4A3EH 4DR5Q 2F52A 3CCUA 1UE1A 1V1QA 5LMNQ 4A3IH 2Y0SE 1XJVA 4LFAL 3S17H 4DV0L 4JI4L 3UDIA 1XPRA 2E2JH 2BH2A 3HOVG 3AFQA 1N8RC 4BY7H 2EQSA 1X3FA 1JJGA 3RLNA 5JJKA 4JI7Q 4DV6L 3G6EA 4UY8C 1VQ4A 1JT8A 2ID0A 2V1CC 4A3DH 1LM0A 4DR3L 3I4NG 2JQOA 1XMOQ 4DAMA 2PQAB 2PMZE 3KDFB 3HKZE 3BJUA 4LF7L 4TQUS 1WCMH 2CFMA 1VQOA 4R4CA 2IY5B 1Z9FA 3NBHB 4JI2Q 5JEAG 3PV0A 4A3LG 5HY6A 1CKOA 1UWVA 4LFCL 1PH8A 5IYDH 1CSPA 3E9IA 2F4VQ 4P73A 1NY4A 1HNWQ 3S1QH 2JA8H 5IE8A 2C35B 4X6AH 1X54A 4L5QA 2JA8G 3M7NA 3SGIA 4X66Q 1TWCH 4JBWA 2B63G 3CP0A 4AQYL 4YCUA 4Y52H 1PFSA 2UUAQ 3J81j 4X64L 2K50A 2CCZA 1HNWL 1X9NA 4A93G 1Q1EA 4DR2L 1VQ9A 3HOUH 1KC8C 2UU9Q 3A5ZB 1HH2P 4JOIC 4IJLA 2Q2UA 1O7IA 3A5UA 1HR0W 1FJGL 2MO1A 4TVAB 2R92H 1K8AC 2YTYA 3HKZG 1NMFA 2LXJA 4P74A 1N34Q 1VQ8A 4JI8Q 1EWIA 4YHHQ 2ZJQA 2IX1A 4LF6Q 2JA6H 3M3YH 3PUVA 5FLXc 1HNZL 5C4JH 3PO3G 1C9OA 1PA6A 1I5FA 3F8TA 5M3MH 4GKKL 2K4KA 4C3HH 5M3FH 4BXXG 3GD7A 4JC0A 2N3SA 2WB1G 4JI3L 1QZHA 4JBKA 2MO0A 3M85A 3S15H 4HJ5A 1VQCA 5FJ8G 1QVFA 1VQAA 4DV1Q 2NZHA 3OTOQ 2ZTDA 5GQOA 4ALPA 3K7UC 1VQJA 4A76A 2K5HA 3RZDH 4H02A 1KQSA 2DGYA 2KHJA 4LFAQ 3CCMA 1JJ2A 2UUBL 2OWOA 4DR5L 1LYLA 2UXDL 5M3MG 4AYBE 3PCOB 4IPHA 1SLJA 3W1BA 5C4XH 1XMQQ 3FHWA 1BBUA 2R6GA 3KDFA 2AKWB 4B3TL 4IPDA 4DAYB 1IL2A 4A3GG 5IWAL 3W5OA 2VQFL 5M5XH 3ULPA 2YTVA 1N32Q 3CCRA 2Q2HA 2K75A 1P8LA 3HOYH 1VQKA 1PH6A 1X6OA 4GN4B 2B63H 3KFUA 2VY3A 1Y1WG 3CW2C 1K8GA 2I5HA 3K8AA 1BVSA 1JJCB 1QZGA 2ATWA 1YJ9A 2ZTCA 4JI6Q 3S16H 4DV5L 1X55A 3HOUG 1U5KA 3MEFA 1XPOA 2KCTA 4JI3Q 1ASZA 3CMAA 3JC66 1CKNB 1PH2A 4LF6L 1L2FA 4YHHL 1FVIA 3PIPA 2WAQG 1W3SA 2ZM6Q 4A3CG 2JK8A 1RIPA 2KENA 1NBWA 1EOVA 3S14H 4WJ3M 4HIDA 1FL0A 4GNXA 1P16A 1PH3A 1N34L 2CKZB 1K3RA 4KI0A 4BXXH 3KJOA 1YITA 5FJ8H 4DR2Q 2E2HH 3TS2A 3KLWA 4IFDJ 1K0RA 2OQ0A 4LUZA 1QVCA 4YCWA 3ERSX 1VQPA 3F2DA 4AQYQ 2R7ZG 5K36G 1HZBA 3STBD 3BU2A 2VS1A 5E7NA 4A3JG 1KHIA 3U50C 5AJ3Q 1RL2A 5IP7G 2QGQA 1HR0L 2WP8J 1I6HH 5IT9c 1AE2A 3G71A 2R7DA 4FDBA 2F4VL 4IOAA 4JI5Q 3CCSA 4UP9A 1VQGA 4YY3L 1Y1VG 1V43A 1PHJA 1N36L 1YIJA 1WJJA 1EQQA 1GKHA 4LUVA 4IPGA 4O2DA 3ER0A 1XMOL 2JEAI 4JYAL 3H0GG 3TEHB 4LF7Q 1N33Q 1SROA 3I2ZA 4BBSG 4A3JH 1AH9A 4JI6L 3D0FA 2B3GA 4MTNA 4R4TA 3TREA 3W1GA 4JI7L 3AFPA 4BY1H 1R9TH 1I94L 3NENA 3AYHB 3U58A 1IZ6A 2A19A 2WFWA 3PUYA 2DUDA 1YHBA 2YYZA 5LMNL 1X65A 4DUYL 3PF4A 4DR7Q 5FLMH 3CCJA 2NZOA 2UUCQ 4PMWA 3CC4A 3M9BA 5DLQE 4HJ8A 4JI0L 4DR6Q 3G4SA 1YHAA 3OW2A 4BBSH 4UPAA 2VQEQ 3B6YA 3I4OA 4A3FG 1E24A 2AHOB 3G48A 4BY1G 2VQEL 2ZJRA 2UUBQ 3UDXA 4B3ML 4LF8L 3ICEA 3K7AH 4DR6L 3HFZB 4JI2L 3PO2G 1IYJB 1E1OA 4PZ7A 1X56A 3PUZA 4HJ7A 4DR7L 2KHIA 1VQIA 4QIWE 4X62Q 3VDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO L;  4GLA C;  1KXL A;  3J80 i;  4B3R Q;  1VQD A;  1MJC A;  1VS0 A;  4UP7 A;  3CCQ A;  4IJH A;  4J15 A;  2BA0 A;  1L0W A;  2I5L X;  4DV2 Q;  3AEV A;  2QA4 A;  4BA2 I;  1BKB A;  2JEB I;  2KCM A;  4A4I A;  4JV5 Q;  4JBJ A;  1HNZ Q;  4GOP C;  1XNQ Q;  3E9H A;  1IBK Q;  4OX9 L;  4KHP L;  1G51 A;  1S40 A;  2UXC Q;  4Y7N H;  2JA5 H;  2OTJ A;  4OWT B;  1N36 Q;  3S2H H;  1BBW A;  3PF5 A;  2YTX A;  1HNX Q;  3OYY A;  5C4X G;  1KL9 A;  1YI2 A;  4A3K H;  2EXD A;  2K5N A;  1IBM Q;  4LF4 L;  1YEZ A;  3M4P A;  2PI2 A;  1QUQ B;  3Q8D A;  3GTM H;  5C44 G;  3S24 A;  5IYB H;  3FKI G;  3J81 c;  3S1N H;  1GD7 A;  3RN2 A;  2MQH A;  3NEM A;  2NN6 I;  4X64 Q;  1WCM G;  2L15 A;  2AWN A;  2RHQ B;  3KF6 A;  3GTP H;  4P72 A;  3S1R H;  2D0P A;  2ZTE A;  5HGQ A;  4X65 L;  1A62 A;  2LXK A;  3LGJ A;  1EIY B;  4NXM Q;  4KHZ A;  1QUQ A;  2HIX A;  4OON A;  3I4M G;  4C3I H;  1VQH A;  3I56 A;  1N9W A;  1XNR L;  3FP9 A;  3J81 i;  3T1H Q;  2ZJP A;  1Q12 A;  2OTL A;  4R4I A;  3TQY A;  5LMU L;  3CAM A;  3PSI A;  4A75 A;  3CPF A;  1Y1W H;  3T1H L;  1SR3 A;  3ZJY C;  1IBM L;  4LF4 Q;  3NEL A;  4LFC Q;  1XNR Q;  3HOZ H;  1CUK A;  1HJP A;  2ZM6 L;  1CSQ A;  1CKM A;  2IHF A;  3CC7 A;  4PZ8 A;  3I4M H;  1V9P A;  4A93 H;  2E2I H;  1VQM A;  1PH9 A;  4BBR G;  4DR3 Q;  1C0A A;  4XTC S;  4DV2 L;  4AH6 A;  1A8V A;  4YWL A;  1TWH H;  2A1A A;  2JA9 A;  2JE6 I;  2N49 A;  1YJN A;  2ES2 A;  2IX0 A;  3I7F A;  4HIK A;  1B70 B;  1IBL L;  2JA7 G;  3H3V H;  4B3R L;  2RF4 A;  5EAY A;  4JI4 Q;  4X62 L;  4IOC A;  1JMC A;  2Z6K A;  2QEX A;  4A3L H;  1MIU A;  1VQ5 A;  2D0O A;  4GLV B;  3UDG A;  1MJE A;  3JAM i;  4LFB L;  4A3K G;  2MFI A;  2UXB L;  1TWF H;  5JJL A;  3GTO H;  1I50 H;  5H1S E;  2K52 A;  2WB1 E;  4YCV A;  2E8G A;  3L2P A;  4LF5 Q;  3CD6 A;  1G6P A;  1LTL A;  1S3O A;  4DR4 L;  1Q46 A;  1SN8 A;  3S2D H;  4JI0 Q;  4OXP A;  1K73 C;  3S1M H;  1TXY A;  4DUY Q;  3PUX A;  4JI1 L;  2Q2T A;  5C3E G;  1GM5 A;  2HHH Q;  1S72 A;  4KLK A;  3CCE A;  2N8N A;  4A3E G;  3HOX G;  4L5S A;  3DLL A;  1JB7 A;  3GTJ H;  1CKN A;  4AYB G;  2HHH L;  1D8L A;  1YJW A;  4YWM A;  4NB3 A;  3UE0 A;  2WAQ E;  1E1T A;  3HOV H;  4DNI A;  4IFD G;  4BY7 G;  4JBM A;  2VNU D;  3KF6 B;  4GS3 A;  1NE3 A;  1N33 L;  1NTG A;  4C2M H;  4LW1 A;  4P71 A;  5JEA J;  4GN3 B;  2UXB Q;  2KBN A;  4YY3 Q;  2K5V A;  3GDE A;  3A0J A;  3T1Y L;  1QVG A;  2E5L Q;  4LWC A;  3ULL A;  5GAG C;  1TWA H;  2YV5 A;  1XPU A;  1PVO A;  4PZ6 A;  4JOI A;  3H15 A;  1FJG Q;  4DUZ L;  1HR0 Q;  1Q1B A;  5AJ3 L;  1PH1 A;  3HOW G;  1EIF A;  4C3J H;  1OXV A;  3KYH C;  1D7Q A;  4QGU A;  5FLM G;  1OTC A;  3AQQ A;  2UUA L;  1AE3 A;  4GNX B;  2R7F A;  4DV3 L;  3IRB A;  1OXU A;  4JCV E;  1VQN A;  2GVA A;  4JYA Q;  3K80 C;  4APV A;  2HIV A;  4GKJ Q;  1YZ6 A;  1EYG A;  2K14 A;  1HZA A;  3CF5 A;  3A74 A;  1TWG H;  4K0K L;  4L5R C;  1Y14 B;  4DR1 L;  2HT1 A;  2FXQ A;  3KOJ A;  3KJP A;  1A0I A;  1VQB A;  2Q2I A;  3J7Z C;  4K0K Q;  5ELO A;  1T9H A;  3UDF A;  5IP9 G;  1PH5 A;  4P75 A;  4DR1 Q;  3EN2 A;  3RLO A;  1OXT A;  4DKA C;  3RNU A;  2D62 A;  3GTQ H;  1H95 A;  3F2B A;  1J5E L;  2NVQ H;  2R92 G;  4NXM L;  3DM3 A;  4GKJ L;  3JAM c;  1YVC A;  2BA1 A;  5JJI A;  3EIV A;  2PI2 E;  4HJ9 A;  3HOY G;  4LF9 L;  1Q86 C;  2RCN A;  2JA5 G;  3U4Z A;  4OWX B;  1Q7Y C;  4ME3 A;  1PH7 A;  2OQK A;  1B7Y B;  2IHE A;  1KRS A;  4QY7 A;  4DUZ Q;  2ASB A;  3UE1 A;  2NVX H;  4IPC A;  4GNX C;  2CWP A;  1Q8K A;  1VQF A;  3M4O H;  2VUM G;  2E5L L;  4DV0 Q;  4LNQ A;  1DGS A;  3RZO H;  1ASY A;  3J80 c;  4A3D G;  2R93 G;  3GTL H;  1VQL A;  4B3T Q;  1IBK L;  4DK6 C;  4KHP Q;  4O0A A;  1W2B A;  1UE7 A;  1I3Q H;  1L1O C;  3CCV A;  1E3P A;  5C0X J;  2UXD Q;  2XGT A;  4DV5 Q;  1JE5 A;  5GRO A;  1MKH A;  2JJQ A;  4HIO A;  4HIM A;  1L1O B;  3RR5 A;  4IO9 A;  4OWW B;  3HOW H;  3CXC A;  1K9M C;  3I4N H;  1KRT A;  3RN5 A;  2OCE A;  4BBR H;  4A3M G;  5IYC G;  2I0Q A;  1KAW A;  1VQE A;  5C44 H;  1M1K C;  4R1J A;  3L0O A;  1GO3 E;  1VQ7 A;  4NXN L;  3K0X A;  2H5X A;  4JI1 Q;  2JA7 H;  4DR4 Q;  2RHS B;  4LF5 L;  3PO2 H;  2B29 A;  3L7Z C;  3D31 A;  4EX5 A;  4LFB Q;  4OO1 G;  2CQO A;  4L5T A;  1XTD A;  3H3V I;  2CWA A;  1C7Y A;  3H0G H;  4DK3 C;  3TRZ A;  1E22 A;  5IYC H;  5BR8 Q;  2UU9 L;  3PIO A;  1IBL Q;  1YBY A;  4QL5 A;  1Y1V H;  2VW9 A;  1I94 Q;  2A8V A;  1UE6 A;  4MNO A;  2BH8 A;  1J6Q A;  5GAD C;  3E0E A;  4XIG S;  4DV1 L;  5C3E H;  3CCL A;  3HOZ G;  3F2C A;  4A3B H;  1HZ9 A;  4QQB X;  1FGU A;  5ELN A;  3PGZ A;  5IY0 A;  2I5M X;  2NVY H;  4GKK Q;  4LF9 Q;  3I55 A;  1PV4 A;  5M3F G;  4RMF A;  4POG A;  2VUM H;  4DV4 Q;  3CME A;  4JG2 A;  2XTI A;  1EQR A;  5GAE C;  1IXR A;  1J5E Q;  1SMX A;  1WYD A;  1EUJ A;  3FKI H;  4JI5 L;  4JI8 L;  4A3F H;  2AWO A;  1EFW A;  4B3S L;  4PG3 A;  1WOC A;  2NN6 G;  2ALY B;  2VL6 A;  4BA1 I;  5M5Y H;  1LUZ A;  3PO3 H;  1NJI C;  1UEB A;  4B3S Q;  5LMU Q;  3CQZ H;  2R93 H;  1KIX A;  1HZC A;  1OXX K;  5IP7 H;  1X3E A;  2IT1 A;  3GTK H;  1OXS C;  3MXN B;  4POF A;  1WFQ A;  1K83 H;  4A3I G;  4X65 Q;  4DV4 L;  2Z6K C;  3CC2 A;  1VQ6 A;  4GN5 A;  2PNH A;  1A63 A;  4GLX A;  2N78 A;  2GN5 A;  4X66 L;  2PQA A;  4OO1 I;  5J3B A;  3CPW A;  4DV3 Q;  4A3C H;  3K81 C;  1U0L A;  5C0X G;  1NMG A;  4DV6 Q;  3U4V A;  1YNX A;  2EIF A;  4A3M H;  4HJA A;  1L1O A;  1YHQ A;  3TS0 A;  3HOX H;  2Y0S G;  5M5W H;  5BR8 L;  3ULJ A;  5LMN W;  3T1Y Q;  1PH4 A;  1GVP A;  1HNX L;  1X3G A;  3RLF A;  3HKS A;  4NPS A;  4EQ5 A;  1Q81 C;  2Z0S A;  4A3G H;  4DPG A;  1Z47 A;  2GVB A;  4AIM A;  4GOP A;  4OX9 Q;  2UXC L;  3J7A 5;  4LUO A;  1G29 1;  5IYB G;  1SFO H;  2R7Z H;  1B8A A;  1PYB A;  4YWK A;  5IYD G;  1M90 C;  4WJ4 A;  2NVT H;  3M4Q A;  5IP9 H;  4QJF A;  1E7Z A;  1XNQ L;  2HQL A;  4NXN Q;  4JV5 L;  2YU9 H;  2VZA A;  3BZC A;  3STB C;  1SE8 A;  3GO5 A;  4DV7 Q;  1PYS B;  4GOP B;  4MZ9 A;  4UP8 A;  3PUW A;  2LSS A;  4DV7 L;  4R4Q A;  4A3B G;  1KD1 C;  3F1Z A;  1Q82 C;  3GTG H;  3WWV A;  1N32 L;  2JA6 G;  1SRU A;  3EBE A;  4R4O A;  4B3M Q;  5IWA Q;  2VQF Q;  2F3I A;  1VCI A;  4RG1 A;  3KF8 B;  4IFD I;  2AMC B;  2MNA A;  3BZK A;  4LF8 Q;  1XMQ L;  1WI5 A;  5GAH C;  5C0X I;  2UUC L;  1UE5 A;  4A3E H;  4DR5 Q;  2F52 A;  3CCU A;  1UE1 A;  1V1Q A;  5LMN Q;  4A3I H;  2Y0S E;  1XJV A;  4LFA L;  3S17 H;  4DV0 L;  4JI4 L;  3UDI A;  1XPR A;  2E2J H;  2BH2 A;  3HOV G;  3AFQ A;  1N8R C;  4BY7 H;  2EQS A;  1X3F A;  1JJG A;  3RLN A;  5JJK A;  4JI7 Q;  4DV6 L;  3G6E A;  4UY8 C;  1VQ4 A;  1JT8 A;  2ID0 A;  2V1C C;  4A3D H;  1LM0 A;  4DR3 L;  3I4N G;  2JQO A;  1XMO Q;  4DAM A;  2PQA B;  2PMZ E;  3KDF B;  3HKZ E;  3BJU A;  4LF7 L;  4TQU S;  1WCM H;  2CFM A;  1VQO A;  4R4C A;  2IY5 B;  1Z9F A;  3NBH B;  4JI2 Q;  5JEA G;  3PV0 A;  4A3L G;  5HY6 A;  1CKO A;  1UWV A;  4LFC L;  1PH8 A;  5IYD H;  1CSP A;  3E9I A;  2F4V Q;  4P73 A;  1NY4 A;  1HNW Q;  3S1Q H;  2JA8 H;  5IE8 A;  2C35 B;  4X6A H;  1X54 A;  4L5Q A;  2JA8 G;  3M7N A;  3SGI A;  4X66 Q;  1TWC H;  4JBW A;  2B63 G;  3CP0 A;  4AQY L;  4YCU A;  4Y52 H;  1PFS A;  2UUA Q;  3J81 j;  4X64 L;  2K50 A;  2CCZ A;  1HNW L;  1X9N A;  4A93 G;  1Q1E A;  4DR2 L;  1VQ9 A;  3HOU H;  1KC8 C;  2UU9 Q;  3A5Z B;  1HH2 P;  4JOI C;  4IJL A;  2Q2U A;  1O7I A;  3A5U A;  1HR0 W;  1FJG L;  2MO1 A;  4TVA B;  2R92 H;  1K8A C;  2YTY A;  3HKZ G;  1NMF A;  2LXJ A;  4P74 A;  1N34 Q;  1VQ8 A;  4JI8 Q;  1EWI A;  4YHH Q;  2ZJQ A;  2IX1 A;  4LF6 Q;  2JA6 H;  3M3Y H;  3PUV A;  5FLX c;  1HNZ L;  5C4J H;  3PO3 G;  1C9O A;  1PA6 A;  1I5F A;  3F8T A;  5M3M H;  4GKK L;  2K4K A;  4C3H H;  5M3F H;  4BXX G;  3GD7 A;  4JC0 A;  2N3S A;  2WB1 G;  4JI3 L;  1QZH A;  4JBK A;  2MO0 A;  3M85 A;  3S15 H;  4HJ5 A;  1VQC A;  5FJ8 G;  1QVF A;  1VQA A;  4DV1 Q;  2NZH A;  3OTO Q;  2ZTD A;  5GQO A;  4ALP A;  3K7U C;  1VQJ A;  4A76 A;  2K5H A;  3RZD H;  4H02 A;  1KQS A;  2DGY A;  2KHJ A;  4LFA Q;  3CCM A;  1JJ2 A;  2UUB L;  2OWO A;  4DR5 L;  1LYL A;  2UXD L;  5M3M G;  4AYB E;  3PCO B;  4IPH A;  1SLJ A;  3W1B A;  5C4X H;  1XMQ Q;  3FHW A;  1BBU A;  2R6G A;  3KDF A;  2AKW B;  4B3T L;  4IPD A;  4DAY B;  1IL2 A;  4A3G G;  5IWA L;  3W5O A;  2VQF L;  5M5X H;  3ULP A;  2YTV A;  1N32 Q;  3CCR A;  2Q2H A;  2K75 A;  1P8L A;  3HOY H;  1VQK A;  1PH6 A;  1X6O A;  4GN4 B;  2B63 H;  3KFU A;  2VY3 A;  1Y1W G;  3CW2 C;  1K8G A;  2I5H A;  3K8A A;  1BVS A;  1JJC B;  1QZG A;  2ATW A;  1YJ9 A;  2ZTC A;  4JI6 Q;  3S16 H;  4DV5 L;  1X55 A;  3HOU G;  1U5K A;  3MEF A;  1XPO A;  2KCT A;  4JI3 Q;  1ASZ A;  3CMA A;  3JC6 6;  1CKN B;  1PH2 A;  4LF6 L;  1L2F A;  4YHH L;  1FVI A;  3PIP A;  2WAQ G;  1W3S A;  2ZM6 Q;  4A3C G;  2JK8 A;  1RIP A;  2KEN A;  1NBW A;  1EOV A;  3S14 H;  4WJ3 M;  4HID A;  1FL0 A;  4GNX A;  1P16 A;  1PH3 A;  1N34 L;  2CKZ B;  1K3R A;  4KI0 A;  4BXX H;  3KJO A;  1YIT A;  5FJ8 H;  4DR2 Q;  2E2H H;  3TS2 A;  3KLW A;  4IFD J;  1K0R A;  2OQ0 A;  4LUZ A;  1QVC A;  4YCW A;  3ERS X;  1VQP A;  3F2D A;  4AQY Q;  2R7Z G;  5K36 G;  1HZB A;  3STB D;  3BU2 A;  2VS1 A;  5E7N A;  4A3J G;  1KHI A;  3U50 C;  5AJ3 Q;  1RL2 A;  5IP7 G;  2QGQ A;  1HR0 L;  2WP8 J;  1I6H H;  5IT9 c;  1AE2 A;  3G71 A;  2R7D A;  4FDB A;  2F4V L;  4IOA A;  4JI5 Q;  3CCS A;  4UP9 A;  1VQG A;  4YY3 L;  1Y1V G;  1V43 A;  1PHJ A;  1N36 L;  1YIJ A;  1WJJ A;  1EQQ A;  1GKH A;  4LUV A;  4IPG A;  4O2D A;  3ER0 A;  1XMO L;  2JEA I;  4JYA L;  3H0G G;  3TEH B;  4LF7 Q;  1N33 Q;  1SRO A;  3I2Z A;  4BBS G;  4A3J H;  1AH9 A;  4JI6 L;  3D0F A;  2B3G A;  4MTN A;  4R4T A;  3TRE A;  3W1G A;  4JI7 L;  3AFP A;  4BY1 H;  1R9T H;  1I94 L;  3NEN A;  3AYH B;  3U58 A;  1IZ6 A;  2A19 A;  2WFW A;  3PUY A;  2DUD A;  1YHB A;  2YYZ A;  5LMN L;  1X65 A;  4DUY L;  3PF4 A;  4DR7 Q;  5FLM H;  3CCJ A;  2NZO A;  2UUC Q;  4PMW A;  3CC4 A;  3M9B A;  5DLQ E;  4HJ8 A;  4JI0 L;  4DR6 Q;  3G4S A;  1YHA A;  3OW2 A;  4BBS H;  4UPA A;  2VQE Q;  3B6Y A;  3I4O A;  4A3F G;  1E24 A;  2AHO B;  3G48 A;  4BY1 G;  2VQE L;  2ZJR A;  2UUB Q;  3UDX A;  4B3M L;  4LF8 L;  3ICE A;  3K7A H;  4DR6 L;  3HFZ B;  4JI2 L;  3PO2 G;  1IYJ B;  1E1O A;  4PZ7 A;  1X56 A;  3PUZ A;  4HJ7 A;  4DR7 L;  2KHI A;  1VQI A;  4QIW E;  4X62 Q;  3VDY A; 
#chains in the Genus database with same CATH topology
 4GLA C;  1KXL A;  4KJN A;  1VQD A;  2HQE A;  1GXD C;  4J15 A;  1QE6 A;  5ELB A;  1QG7 A;  2QA4 A;  4NMZ A;  1BQQ T;  5KYL A;  4JBJ A;  4KHP L;  2UXC Q;  4ULL A;  1G51 A;  4Y7N H;  4OWT B;  3T4A C;  1BBW A;  2YTX A;  2BCO A;  1QUQ B;  3GTM H;  2EJG C;  3KF8 A;  1BDO A;  1XX8 A;  2NN6 I;  2L15 A;  3GTP H;  2QW7 A;  3S1R H;  1GUS A;  2D0P A;  2ZTE A;  1EIY B;  4KHZ A;  1QUQ A;  2A73 B;  4C3I H;  1VQH A;  4KKT A;  4DGZ A;  3HOX B;  4JI2 L;  5LMU L;  3CAM A;  4LF4 Q;  3CPF A;  1SR3 A;  3I4L A;  2A6E D;  4LFC Q;  3D6W A;  1K8M A;  3A8I E;  4L6T B;  4K14 A;  5IGG A;  4A93 H;  2BDO A;  2E2I H;  4DV2 L;  1A8V A;  2YU9 B;  2N49 A;  1YJN A;  2XWJ B;  3U9O A;  1WTQ A;  1PTO H;  2NVT B;  4B3R L;  3H3V H;  2RF4 A;  4JI4 Q;  1U4M A;  4X62 L;  4IOC A;  2PPB C;  3K5O A;  1AN8 A;  4A3L H;  1HA5 A;  2UXB L;  1TWF H;  5EJW A;  3S15 B;  1I50 H;  5H1S E;  2R7Z B;  1G6P A;  3P7J A;  2F0F A;  1K73 C;  2CQA A;  2B8G A;  1FNV A;  2EYJ A;  3I91 A;  4ME5 A;  3ONA B;  3NWT A;  3PIO 3;  3BYT B;  2RDH A;  1CKN A;  4AYB G;  1RD9 D;  3E6Z X;  1CA6 A;  3A8K E;  2WAQ E;  3LNN A;  4BY7 G;  2VNU D;  1N33 L;  1WTP A;  5I2X A;  5JEA J;  5G3L F;  1KLG D;  2UXB Q;  5CBA E;  2A69 C;  3T1Y L;  3A0J A;  1HHV A;  3IAY A;  1PVO A;  4JOI A;  3H15 A;  1HR0 Q;  1IW7 C;  4DAV A;  4C1N K;  3PMF A;  3H94 A;  1XWE A;  4JCV E;  1VQN A;  1HRJ A;  4APV A;  2HIV A;  4U68 A;  4GKJ Q;  4J8Q A;  3A74 A;  5JVH 3;  1QNK A;  3MC0 B;  2FXQ A;  4A3E B;  1GUG A;  1SXT A;  1D5M C;  4I7A A;  4K0K Q;  5ELO A;  3SE0 A;  1WTW A;  3K0Y A;  1ENF A;  2HD3 A;  4DR1 Q;  3RLO A;  4DKA C;  3GTQ H;  2D62 A;  1J5E L;  2R92 G;  1NNX A;  4GKJ L;  5JJI A;  3EIV A;  2PI2 E;  3CKI B;  1HTP A;  3HOY G;  5I9O A;  1Q86 C;  3U4Z A;  1KDB A;  1FYC A;  3GTQ B;  2IHE A;  4EQP A;  5E4W C;  1B3A A;  2CWP A;  1B53 A;  1VQF A;  3SDZ A;  1TQO A;  3M4O H;  2E5L L;  2Q8T A;  3VYR A;  4CGY B;  1DGS A;  3RZO H;  2PZW A;  3NP8 A;  3J80 c;  1NCV A;  1VQL A;  1MBY A;  1RTO A;  4O0A A;  4KD3 A;  1I3Q H;  1EY5 A;  1JOK A;  1I4P A;  1LTA D;  1L1O C;  5E4X A;  5T1G A;  2B2U C;  3OWE B;  2IW3 A;  1DCZ A;  1L1O B;  3HOW H;  1K9M C;  3I4N H;  4A3M G;  5IYC G;  1G2S A;  1VQ7 A;  2H5X A;  2O2L D;  4DR4 Q;  3PO2 H;  3NBI A;  3L7Z C;  3D31 A;  2F0D A;  4H0L C;  4LFB Q;  4OO1 G;  1A3U A;  1LT5 D;  1XTD A;  5DM7 3;  3H0G H;  4C3I G;  1XTC D;  4DK3 C;  2K03 A;  5IYC H;  4K2L A;  5BR8 Q;  3DHQ A;  4IQZ A;  4QL5 A;  1I94 Q;  1CM9 A;  2OF1 A;  1J6Q A;  5GAD C;  4DV1 L;  3F2C A;  1HZ9 A;  2D5D A;  4EVO A;  3QOL A;  1TS2 A;  3GTP B;  2NVY H;  2K5Q A;  2EJF C;  4LF9 Q;  4GKK Q;  3I55 A;  4C3H G;  4RMF A;  4DV4 Q;  3HZX A;  5DAU A;  1SMX A;  1EUJ A;  1EFW A;  4QF4 A;  2SNM A;  1WOC A;  2ALY B;  2XRQ D;  3PO3 H;  1LUZ A;  5I9P A;  1S5D D;  1HZC A;  3BDC A;  1OXX K;  1SNO A;  1WFQ A;  2A69 D;  4IFD H;  1CHP D;  4DV4 L;  2Z6K C;  2H4O A;  1HUN A;  3CPW A;  3K81 C;  2SDF A;  4A3G B;  5C0X G;  1NMG A;  4DV6 Q;  1JE4 A;  3EJI A;  3U4V A;  4XDX A;  3URY A;  1YNX A;  1NUC A;  3O13 A;  4F88 A;  5M5W H;  5BR8 L;  2PW5 A;  2WIN B;  1PH4 A;  4EGV A;  3T1Y Q;  1DZ1 A;  5DNF A;  4EQ5 A;  1ET9 A;  2SEB D;  2Z0S A;  4DPG A;  4GOP A;  2FFK B;  5IYB G;  2R7Z H;  3BS1 A;  4YWK A;  3K5N A;  5IYD G;  1PTO B;  2NVT H;  2HQL A;  5T1I A;  1DOK A;  4LJZ C;  1SE8 A;  2XWB B;  4DV7 L;  1H9S B;  4R4Q A;  1Q82 C;  1SRU A;  1F2L A;  3T13 A;  2KA7 A;  1JWM D;  2F0G A;  2JA8 B;  2MNA A;  2Z4H A;  4KN4 C;  2JA5 B;  2A6H C;  4EQO A;  2G9D A;  2Z6B A;  1V1Q A;  3D4R A;  4YIJ A;  4DK0 A;  4JI4 L;  3UDI A;  4CJ2 C;  2E2J H;  4KKU A;  5JOB A;  5C4Z A;  4RKB A;  2BH2 A;  1EFI D;  1Y8N B;  2K04 A;  2Y0S B;  3GTK B;  4ZKB B;  4BY7 H;  2VUM B;  4WRD A;  3RLN A;  4FXD A;  1SYF A;  1JT8 A;  3VA7 A;  2E74 C;  2IJ0 A;  4IUT A;  4DR3 L;  1JC7 A;  4DAM A;  3CQZ B;  1D6E C;  4BBS B;  3A8J E;  3RMH A;  5A35 A;  1PZK D;  5G3L D;  1PH8 A;  3GTL B;  3E9I A;  4A3B B;  1KLU D;  4ZCK A;  1I6H B;  2A6H D;  2OEO A;  1EU4 A;  2X69 A;  3S16 B;  4ID6 A;  4AQY L;  2UUA Q;  1HNW L;  1X9N A;  2WAC A;  5LHY 1;  4A93 G;  2SOB A;  2UU9 Q;  2F0H A;  3A5Z B;  2JA6 H;  2Q2U A;  1O7I A;  2KEE A;  3AEV A;  3CU7 A;  4IZ8 A;  5FLX c;  1I5F A;  3F8T A;  4UHV A;  5M3M H;  3FPP A;  1KNE A;  3GD7 A;  4JC0 A;  4JI3 L;  4JBK A;  2WV6 D;  2EYO A;  5C3X A;  1LTR D;  1VQA A;  2B2V C;  3BDL A;  2RBM A;  3S1R B;  3E5S A;  4A76 A;  2KCN A;  2AQ2 B;  4KK7 A;  1I4R A;  1SSO A;  3SK6 A;  3K59 A;  2A68 C;  2E76 C;  1JJ2 A;  2OWO A;  1LYL A;  1PFM A;  2UXD L;  1RHP A;  3W1B A;  1XMQ Q;  4WFN 3;  2LKV A;  2B63 B;  3KDF A;  3G6J B;  3FDT A;  1AP0 A;  5IWA L;  2QF7 A;  3JAM E;  1KNA A;  1F2M A;  1P8L A;  3X3N A;  5JJZ A;  2B63 H;  1EQT A;  1JJC B;  1DOL A;  4JI6 Q;  1R4Q B;  1X55 A;  3HOU G;  1U5K A;  4HCS A;  2I07 B;  1XPO A;  1WVL A;  4JI3 Q;  3H0G B;  1ASZ A;  1U4P A;  3CMA A;  1CKN B;  4K5V A;  3S17 B;  1FVI A;  4K8J A;  1RIP A;  2L0C A;  1NBW A;  4HID A;  1PH3 A;  1H9M A;  4BXX H;  5FJ8 H;  1WTV A;  2E2H H;  1ET6 A;  5M3M B;  1QNU A;  3OWF A;  4IFD J;  4LUZ A;  5IGB A;  4OIJ A;  1VQP A;  2R7Z G;  4RHS A;  5K36 G;  4WOR A;  1HZB A;  2B2V A;  1VMC A;  1PFN A;  4A3J G;  5AJ3 Q;  1CT1 D;  2QGQ A;  5M5Y B;  1FNW A;  2F4V L;  3T56 B;  1TWC B;  1PHJ A;  1PMR A;  1VF5 C;  1YIJ A;  4LUV A;  2JEA I;  4O2D A;  3TEH B;  1KTK A;  1Q90 A;  3R3O A;  2B3G A;  4R4T A;  3W1G A;  2X6L A;  4JI7 L;  4K6D A;  1A15 A;  1Y69 U;  2WII B;  1PRT C;  1IZ6 A;  2A19 A;  4BS9 A;  5C44 B;  1NR2 A;  4C3J G;  3PF4 A;  4JI0 L;  1Y8O B;  3WDN A;  3MXG A;  3GQB A;  2VQE Q;  3I4O A;  4A3F G;  2JN4 A;  2AHO B;  3UDX A;  3ICE A;  4N8X 1;  1PDQ A;  2HUG A;  1EY8 A;  3PUZ A;  4HJ7 A;  4DR7 L;  1D2B A;  2EYF A;  1S5E D;  2L9H A;  3OTO L;  4OO1 H;  1MJC A;  3NSW A;  4UP7 A;  3CCQ A;  1MHW C;  1JR0 D;  1NAP A;  3KLS X;  1L0W A;  1BKB A;  4A4I A;  2QDL A;  5AFW A;  1PRT F;  1IBK Q;  1S40 A;  1TII D;  2OTJ A;  3HOY B;  3C1E A;  3S2H H;  5C4X G;  4A3K H;  2G9H D;  3QO2 A;  2EYH A;  1LTT D;  2EY6 A;  1CQF A;  2Q8R E;  3K5M A;  2KOL A;  2O5I C;  3A7A B;  2F0E A;  2MQH A;  4X64 Q;  3VR3 A;  2RHQ B;  1TKW B;  2WKC A;  5HGQ A;  4NXM Q;  2RSO A;  1UAP A;  2G5D A;  2NB0 A;  3I72 A;  1GOZ A;  3PO2 B;  5LL6 X;  3D8G A;  1N9W A;  3BVG A;  1Q12 A;  2OTL A;  4QMG A;  5EPK A;  2A68 D;  1IBM L;  1Y1W H;  3DWQ A;  2B2Y C;  3HOZ H;  4A3M B;  1FD7 D;  2ZM6 L;  4FXG C;  3DWP A;  1CKM A;  5C6A A;  2QKI C;  1V9P A;  1SYD A;  2CH4 W;  1SE3 A;  3VYS A;  1WD1 A;  4DAP A;  1KDA A;  2ES2 A;  1TWH H;  2JA9 A;  2JE6 I;  4JI6 L;  1KAB A;  2IX0 A;  2KED A;  4J1M A;  1B70 B;  2JA7 G;  2VB3 X;  2Z6K A;  5JEA H;  3HOW B;  1MIU A;  2D0O A;  2A5H A;  4GLV B;  2QDB A;  1MJE A;  4LFB L;  2LMC B;  3GTO H;  2F3V A;  2WKD A;  2WB1 E;  4YCV A;  1SNP A;  3L2P A;  3CD6 A;  1LTL A;  1S3O A;  3U9S A;  4XQQ A;  4C3H B;  4JI1 L;  2Q2T A;  1QWY A;  3CCE A;  4XXE A;  2N8N A;  3HOX G;  1JB7 A;  3GTJ H;  3G7L A;  1O7Y A;  4YWM A;  4FF1 A;  4NB3 A;  5M5W B;  4GS3 A;  4P71 A;  4LK1 C;  3VR4 A;  2E5L Q;  2RSN A;  1BCP D;  3KBX A;  5GAG C;  1TWA H;  2YV5 A;  1TY0 A;  4PZ6 A;  1FGB D;  2F0O A;  1FJG Q;  1MSH A;  1B1Z A;  1Q1B A;  1CA5 A;  2B2T A;  3T16 A;  5C4H A;  1EOT A;  5J39 A;  4QGU A;  1OTC A;  2UUA L;  2KEC A;  1TVX A;  2R7F A;  4DV3 L;  3IRB A;  1B2T A;  1C8C A;  1D5X C;  4EQN A;  1OO9 B;  1EYG A;  1K3B C;  4L5R C;  3BZD B;  3IFT A;  1B3Q A;  1X32 A;  4DR1 L;  4K5W A;  1WTO A;  2AUK A;  2O4X A;  3J7Y W;  1LLR D;  2Q2I A;  4K5X A;  4AYB B;  3J7Z C;  3MFG A;  1OXT A;  5KGU A;  3DM3 A;  1PTO D;  3JAM c;  4C1N I;  4K6L A;  1W6J A;  2JA5 G;  4OWX B;  1Q7Y C;  1WTR A;  1AW7 A;  1KRS A;  2PYK A;  2ASB A;  1ICF B;  2F0P A;  4L8J A;  4L63 B;  5NUC A;  5FO9 B;  2BE5 D;  4TRD A;  1PRT B;  1S5C D;  2VUM G;  5L37 A;  1AZP A;  1F9R A;  1ASY A;  3WOF A;  4A3D G;  4FF4 A;  1AEX A;  1NSN S;  1SBB B;  2QCP X;  4DFA A;  2K5W A;  4CJ1 B;  3S9W A;  4B3T Q;  4DNR B;  1CQV A;  3CCV A;  1E3P A;  4WJW A;  1MKH A;  4HIM A;  3J7A V;  3RR5 A;  4IO9 A;  4OWW B;  3CXC A;  4FVM A;  1KRT A;  4K2K A;  4BBR H;  2FMM A;  2ZT9 C;  3RN5 A;  2I0Q A;  2NYZ D;  1GO3 E;  5IGF A;  4NXN L;  3MA2 B;  2L5T A;  2RHS B;  3DUZ A;  4LMQ D;  3S2D B;  2GA4 B;  2QIL A;  5LL6 S;  3C1F A;  3HS0 C;  1S5F D;  3S2H B;  1STE A;  2B39 A;  2RA4 A;  1SAP A;  1Y1V H;  1UE6 A;  3CCL A;  2FMC A;  4XIG S;  5C3E H;  4A3B H;  1SNQ A;  1VMP A;  5ELN A;  1E0B A;  3PGZ A;  5IY0 A;  1GUO A;  4POG A;  1UNS A;  5D65 A;  3CME A;  1K0S A;  1IXR A;  2RKS A;  3OHX C;  5FLX E;  1YNJ D;  4PG3 A;  2NN6 G;  2VL6 A;  1SYE A;  2CVR A;  1NJI C;  5LMU Q;  2R93 H;  1DM0 B;  2JA6 B;  2I46 A;  2M2L A;  4A3I G;  3MXN B;  5CV4 A;  5JPN C;  4KMU C;  2N78 A;  2GN5 A;  4OO1 I;  4DV3 Q;  1STB A;  1TWH B;  4C3I B;  3OIP A;  1ZKO A;  1GHJ A;  2EIF A;  4A3M H;  1D1I A;  2HDM A;  1QOH A;  1GVP A;  3GV6 A;  5C3W A;  4A3G H;  3HKS A;  2EVB A;  4RAU C;  1Z47 A;  5EBD A;  3J81 E;  3J7A 5;  1EY4 A;  3HOU B;  1AFP A;  1B8A A;  4ZLT F;  3M4Q A;  4KD4 A;  1E7Z A;  1T5E A;  4FYD A;  2BE5 C;  5C4J B;  1PYS B;  3MTS A;  4MZ9 A;  3TP7 A;  2K28 A;  4OL7 A;  3F1Z A;  4RGM A;  1N32 L;  3EBE A;  2VQF Q;  2F3I A;  4RG1 A;  4IFD I;  1B9N A;  2AMC B;  3BZK A;  4KV6 A;  4LF8 Q;  1WI5 A;  1NR4 A;  3KUP A;  2UUC L;  1RKN A;  4DR5 Q;  3CCU A;  4RA8 A;  4LFA L;  3S17 H;  4DV0 L;  1XPR A;  4M8A A;  1LAC A;  2IPK D;  4JI7 Q;  2O5J C;  5M5X B;  1QCB D;  5KYI A;  3NBH A;  3M7G A;  2E2H B;  1BR9 A;  2JQO A;  2PMZ E;  3KDF B;  3HKZ E;  3BJU A;  3PQI A;  3HG9 A;  2CFM A;  2KJX A;  5EKK A;  2F0S A;  1U4R A;  1UWV A;  2EDG A;  5IYD H;  1CSP A;  2CHB D;  3IL8 A;  3HP3 A;  4KY7 A;  4ZAI A;  4C3J B;  5EKL A;  2KUM A;  4L5Q A;  2JA8 G;  1YNN D;  4BWG B;  3EA6 A;  5CBE E;  1TWC H;  2HCC A;  4JBW A;  3TP5 A;  1B4O A;  2CCZ A;  4X64 L;  2K50 A;  1TWG B;  2L12 A;  4DR2 L;  1JOO A;  1HH2 P;  4JOI C;  4IJL A;  1Y1W B;  3A5U A;  1F77 A;  1HR0 W;  4BA2 I;  3HOZ B;  2YTY A;  1N34 Q;  2EYP A;  4P74 A;  2JA8 H;  1EWI A;  1PTO C;  1HA6 A;  3PO3 G;  4PNY A;  4GKK L;  5D14 A;  5M3F H;  3GTG B;  1D7Q A;  4Q0F A;  3M85 A;  3J81 L;  4DV1 Q;  1BUV T;  2ZTD A;  5GQO A;  4RGN A;  2K5H A;  1HFG A;  2QEJ C;  2R3Z A;  4LFA Q;  3M4O B;  4FF2 A;  2UUB L;  2EZV A;  4DR5 L;  2PW7 A;  5C4X H;  2EY2 A;  3FHW A;  1BBU A;  1LAB A;  1BCP B;  3H91 A;  3KLR A;  2VQF L;  3ULP A;  1GUT A;  2YTV A;  1N32 Q;  3CCR A;  5KNB A;  2EOT A;  4MHE A;  4RWS C;  1PH6 A;  3A55 A;  4GN4 B;  2VY3 A;  1K83 B;  1IHZ A;  1G6Z A;  1AZQ A;  1D5Z C;  4DN4 M;  1O7L A;  1QZG A;  3K7A B;  2ATW A;  2DY7 A;  1CHQ D;  1KAA A;  3S16 H;  3MEF A;  2KCT A;  1PH2 A;  4IUU A;  2JK8 A;  4HSV A;  2KEN A;  2CW0 C;  4WJ3 M;  1A2T A;  1FL0 A;  2F0T A;  1P16 A;  1K3R A;  4NKL A;  1CZG A;  1J8I A;  4YCW A;  4CDE C;  1KDC A;  2M9V A;  4FO2 A;  3EQL C;  4XT3 B;  1KHI A;  3U50 C;  2J0T D;  2WP8 J;  1AE2 A;  3G71 A;  1EY7 A;  1TS5 A;  4FDB A;  4JI5 Q;  4QUC A;  3SEB A;  4YY3 L;  3MZ5 A;  1LT6 D;  1V43 A;  5IOD A;  1EQQ A;  1WJJ A;  3ER0 A;  4JYA L;  1S5B D;  3H0G G;  3QJY A;  1I50 B;  4XT1 B;  3TRE A;  4BY1 H;  4RHR A;  3NEN A;  2DUD A;  1YHB A;  4DUY L;  1CFM A;  1ONL A;  4PMC A;  4XYO A;  3CC4 A;  3OSO A;  4ODG A;  1SDF A;  4IUN A;  1WCM B;  1DD2 A;  2L55 A;  3MAQ A;  2XN9 C;  4BY1 G;  2UUB Q;  4ZK9 B;  3HFZ B;  4DR6 L;  3I4M B;  1IYJ B;  1E1O A;  1X56 A;  2F0U A;  3VDY A;  3R8B A;  5FO8 B;  4CKE A;  3J80 i;  5HGT A;  1O80 A;  5CV6 A;  4OIK A;  4IJH A;  1U9R A;  5JPM C;  2BA0 A;  2I5L X;  2IL8 A;  2JEB I;  2KCM A;  5ELC A;  4JV5 Q;  1HNZ Q;  3LWU A;  4GOP C;  2B2T C;  1W6K A;  3E9H A;  1F9Q A;  5HUR A;  5FK9 C;  1TU2 B;  2N88 A;  2RDG A;  3PF5 A;  5FO7 B;  3R2T A;  3OYY A;  1KL9 A;  1YI2 A;  1IBM Q;  1YNJ C;  1M8A A;  2TSS A;  4KY5 A;  2EJM A;  5C44 G;  2DNC A;  4CKB A;  3J81 c;  3S1N H;  1SNC A;  5I6W A;  2PZT A;  2AWN A;  4A3D B;  3KF6 A;  1A62 A;  2LXK A;  3LGJ A;  4UDU C;  2HIX A;  4OON A;  3VR5 A;  1Z6H A;  4IUV A;  3RZD B;  3I56 A;  2F03 A;  3FP9 A;  3J81 i;  2FHT A;  1SYB A;  2F0Q A;  1HFN A;  4R4I A;  3TQY A;  1VQK A;  4X6A H;  2CH4 A;  2L1B A;  3T1H L;  3ZJY C;  5DM6 3;  4G7Z C;  1CUK A;  1EZ6 A;  1F9S A;  3P1H A;  2AUJ D;  2IHF A;  3OPO A;  3CC7 A;  4PZ8 A;  3TP8 A;  1JOR A;  4DR3 Q;  4XTC S;  4YWL A;  4LNQ A;  1ML0 D;  1B50 A;  3X3M A;  1SJE D;  1ZEQ X;  4HIK A;  1IBL L;  1PYW D;  3D4W A;  1X3P A;  3TDQ A;  1VQ5 A;  4MN3 A;  3SHL A;  1PXU A;  4CJ0 B;  5JJL A;  2E8G A;  4HMI A;  1J9O A;  2EE1 A;  4ILW A;  4HCE A;  4DR4 L;  2NVX B;  1MGS A;  2XIW A;  3GV3 A;  2Z1C A;  1Q46 A;  1SN8 A;  1TR5 A;  1R9T B;  4JI0 Q;  2F0M A;  1TXY A;  4DUY Q;  5E3F A;  1GM5 A;  2HHH Q;  4DA2 A;  1S72 A;  5JVG 3;  3DLL A;  1EY0 A;  2NZ1 D;  2HHH L;  1T5X D;  3Q6S A;  1D8L A;  1I4Q A;  2EY5 A;  1Y1V B;  4IFD G;  3HOV H;  1E1T A;  4DNI A;  1NTG A;  5D3D A;  4LW1 A;  2L4N A;  4GN3 B;  4JVZ A;  4YY3 Q;  2K5V A;  3GDE A;  3H6M A;  1JB3 A;  3ULL A;  3PIP 3;  5IGE A;  3RUZ A;  2JA7 B;  2PQE A;  1XPU A;  1IL8 A;  3IKJ A;  3NWS A;  1XXG A;  3Q24 A;  4DUZ L;  1RCV D;  3N6R A;  3C3L A;  3HOW G;  1EIF A;  4KKS A;  5FLM G;  3AQQ A;  2R93 B;  4GNX B;  1QJO A;  4R9W A;  3K80 C;  1EYD A;  1YZ6 A;  2EYM A;  2K14 A;  4JPB W;  1LV9 A;  4K0K L;  4ZUI A;  2JXM B;  3V2T A;  2Z4I A;  1A0I A;  2MP1 A;  4DK1 A;  1WD0 A;  3BDO A;  1PH5 A;  4P75 A;  5ELF A;  3EN2 A;  3RNU A;  3F2B A;  4KTA A;  1Y8P B;  4S3S A;  1V8Q A;  2BA1 A;  4HJ9 A;  1EYC A;  2RCN A;  4DAY A;  2EY1 A;  4ME3 A;  1PH7 A;  2K05 A;  1B7Y B;  2OQK A;  4QY7 A;  1G8Z D;  4R8I A;  2D9U A;  4IPC A;  4GNX C;  3FKI B;  2N55 A;  2F0K A;  5COR A;  5ELE A;  2JP1 A;  5CGK A;  3GTL H;  3I70 A;  1DJR D;  1O7Z A;  1IBK L;  4DK6 C;  1W2B A;  1UE7 A;  1GUN A;  2XGT A;  4DV5 Q;  4QUF A;  2JJQ A;  2F0L A;  2B2W A;  2OCE A;  4FF3 A;  1VQE A;  4R1J A;  3NXW A;  2F0I A;  3TZD A;  2B29 A;  4BBR B;  5I6Y A;  4EX5 A;  2VB2 X;  1V1O A;  3ND9 A;  4L5T A;  2CWA A;  2BOS A;  4HTH A;  3PIO A;  2A6E C;  1YBY A;  4V0B A;  5KRU A;  3DXJ C;  4MNO A;  3E0E A;  3HOZ G;  1I4H A;  1FGU A;  1L0Y B;  2ZXR A;  1PV4 A;  5M3F G;  2RVL A;  2NUC A;  5GAE C;  1EQR A;  1J5E Q;  5C3E B;  4JI8 L;  1WYD A;  4JI5 L;  4A3F H;  2HCI A;  4B3S L;  4BA1 I;  3VR2 A;  1STA A;  1UEB A;  3CQZ H;  2OT2 A;  1KIX A;  3DM1 A;  1H9R A;  1X3E A;  2IT1 A;  4X65 Q;  3JAM L;  4GN5 A;  2PNH A;  3A7L A;  1SMY C;  4X66 L;  2PQA A;  3SK5 A;  1EYA A;  3NTH A;  4A3C H;  1XYI A;  1U0L A;  4F7X A;  1I6V C;  3TS0 A;  2ICE C;  1I3Q B;  4E6I A;  3HOX H;  3Q0A A;  4N9P A;  3ULJ A;  3RLF A;  2NVQ B;  4NPS A;  3EVQ A;  4XQN A;  4AIM A;  2UXC L;  3FRP B;  1ESF A;  3A54 A;  1G29 1;  3I4N B;  1PYB A;  2M00 A;  1M90 C;  4WJ4 A;  5IP9 H;  4QJF A;  2SNS A;  1XNQ L;  4JV5 L;  2YU9 H;  2VZA A;  2MHV A;  3SXH A;  5CMD A;  1GHK A;  4HSP A;  3STB C;  1JOQ A;  1EY6 A;  2J4X A;  3GO5 A;  4B9W A;  4GOP B;  4UP8 A;  1STG A;  2MPM A;  1IKM A;  3QG1 A;  3WWV A;  2JA6 G;  4A3I B;  4RCN A;  3WOE A;  5IWA Q;  4G7O C;  1VCI A;  3KF8 B;  5C5M A;  3Q22 A;  3M3Y B;  1XMQ L;  4K8I A;  5C0X I;  4A3E H;  1UE1 A;  4A3I H;  5LMN Q;  2Y0S E;  1EEF D;  3GTJ B;  1MD2 D;  3IFD A;  3TSS A;  4Y7N B;  3HOV G;  1N8R C;  1UUP A;  4DV6 L;  4UY8 C;  1VQ4 A;  2ID0 A;  3MXN A;  3BVZ A;  1BBX C;  1F2Z A;  1LM0 A;  5I2Y A;  5IT9 E;  2AQ3 B;  1XMO Q;  1RF2 D;  4IUR A;  4LF7 L;  1I4G A;  4ZQ3 A;  5EBC A;  3P75 A;  1WCM H;  4M1U B;  1MSG A;  1VQO A;  1LTG D;  4R4C A;  1Z9F A;  3NBH B;  1ENA A;  3PV0 A;  3V96 A;  4A3L G;  5HY6 A;  2RQX A;  1CKO A;  3ERQ A;  1IYU A;  3VYT A;  1BNZ A;  4XYQ A;  2NVY B;  5A2Q E;  1FR3 A;  1HQM C;  1X54 A;  3M7N A;  1EEI D;  5IIF A;  4Y52 H;  1BF4 A;  3J81 j;  1EL0 A;  1Q1E A;  3UI2 A;  1Q3L A;  3SVM A;  1KC8 C;  3TRZ A;  3T53 B;  4G57 A;  1E2V A;  4ZUJ A;  3HKZ G;  1K8A C;  1VQ8 A;  1L0X B;  2HDL A;  4JI8 Q;  2ZJQ A;  3KK7 A;  5EGT A;  4LF6 Q;  3M3Y H;  1A6X A;  1STH A;  1HNZ L;  1C9O A;  1PA6 A;  2VXW A;  4BXX G;  2N3S A;  1G91 A;  5FJ8 G;  2KCC A;  1QVF A;  3OTO Q;  4ALP A;  4CKC A;  1ILQ A;  1S4Z A;  1KQS A;  2DGY A;  2KHJ A;  2E75 C;  3L9A X;  2ZXO A;  3RZO B;  4IPH A;  1SLJ A;  3CHB D;  4OHJ A;  1JIC A;  3MHB A;  3NK9 A;  1HCZ A;  1DOM A;  4R8N A;  2R6G A;  4B3T L;  2K33 A;  1IL2 A;  2Z8L A;  4LAA A;  1BCP C;  1ZXT A;  3HOY H;  4HED A;  1X6O A;  3I90 A;  3KFU A;  1Y1W G;  1MI2 A;  3CW2 C;  1ESR A;  2I5H A;  3K6O A;  1BVS A;  4V19 0;  1YJ9 A;  5TSS A;  2LS0 1;  5CC4 A;  3PO3 B;  4FP5 D;  3JC6 6;  2JYO A;  4LF6 L;  4YHH L;  3PIP A;  4HN7 A;  4HAE A;  2C9O A;  3P20 A;  2B2Y A;  1EOV A;  1X3Q A;  2DN8 A;  1H9J A;  4KI0 A;  1YIT A;  4DU9 A;  3TS2 A;  4P2C B;  1QVC A;  3ERS X;  5EPJ A;  2PMZ B;  3H3V C;  4RH6 A;  4ZRZ A;  1ZYR D;  5CYU A;  1M4V A;  4X3U A;  1RDP D;  3MXP A;  4I65 A;  3VA5 A;  3V05 A;  1RL2 A;  5IOC A;  5IP7 G;  1HR0 L;  1LTI D;  3OOC A;  3S1Q B;  1II3 A;  3CCS A;  2RDF A;  1A3T A;  1Y1V G;  1N36 L;  1GKH A;  4IPG A;  1XMO L;  2MJ8 A;  2RCF A;  3DEO A;  4LF7 Q;  4Q5V A;  1SRO A;  3I2Z A;  3I73 A;  1ENC A;  4U67 3;  1AH9 A;  1SYG A;  1R9T H;  1I94 L;  2K5D A;  1EIH A;  2WFW A;  4ZKC B;  1QIL A;  3OW7 A;  1PTO F;  3QB3 A;  1F9P A;  4PMW A;  5DLQ E;  4DR6 Q;  2EPB A;  3G4S A;  1YHA A;  3NQI A;  3OW2 A;  2ICI A;  2J7Z A;  3B6Y A;  1E24 A;  3NUC A;  4LF8 L;  4B3M L;  2F0W A;  4GZY C;  2NWG A;  4QIW E;  1YJW A;  1DYQ A;  4X3T A;  4RGO S;  2B2W C;  1EWH A;  1IYV A;  5CV5 A;  4B3R Q;  4UAI A;  1VS0 A;  4DV2 Q;  3MEH A;  3N52 A;  2Z9H A;  5K36 H;  1XNQ Q;  3HGB A;  3TME A;  2WB1 B;  4OX9 L;  2JA5 H;  1TY2 A;  3F2U A;  1N36 Q;  3MWY W;  1HNX Q;  1UEA B;  3KLS A;  2EXD A;  2K5N A;  4LF4 L;  3E3X A;  1YEZ A;  1GJX A;  3M4P A;  3S1M B;  2PI2 A;  3Q8D A;  2IX3 A;  3S24 A;  5ISR A;  5IYB H;  3FKI G;  1GD7 A;  5F2D A;  3RN2 A;  2TMP A;  3FEW X;  1SYC A;  2DJG C;  4CHT B;  3NEM A;  3J7A F;  1WCM G;  2F3W A;  3J80 L;  3FVQ A;  4P72 A;  4X65 L;  4BY1 B;  5FLX L;  3I4M G;  1XNR L;  2ENB A;  3T1H Q;  2ZJP A;  4PV1 C;  3W2D A;  2IWH A;  2NBF A;  4MIU A;  3PSI A;  4A75 A;  1PZJ D;  2E2I B;  3NEL A;  1XNR Q;  2L11 A;  3NTI A;  1HJP A;  3HEJ A;  4QIW B;  1CSQ A;  3Q23 A;  2F4I A;  3I4M H;  3TBI B;  1VQM A;  2WAQ B;  3E0J A;  4BBR G;  1PH9 A;  1C0A A;  3VR6 A;  4AH6 A;  2A1A A;  2PCF B;  4JK1 C;  1RJT A;  2P5Z X;  3I7F A;  3D6C A;  4ABN A;  2Q8I B;  4H7B A;  1K28 A;  5EAY A;  1ILP A;  3TZU A;  1JMC A;  2QEX A;  3UDG A;  4KHV A;  3DMU A;  1R4P B;  3OMG A;  3JAM i;  2MFI A;  4A3K G;  1GUW A;  1SEB D;  1Z7T A;  2K52 A;  1SFO B;  4LF5 Q;  1DXM A;  2X6G A;  3R93 A;  5M3F B;  3S2D H;  3SK8 A;  4OXP A;  3S1M H;  3LWE A;  3PUX A;  5C3E G;  4KLK A;  4FNF A;  4A3E G;  4L5S A;  4C2M B;  3QIA A;  2PNR C;  1PFB A;  1C48 A;  3UE0 A;  2JSO A;  2B2U A;  4H44 C;  4JBM A;  3KF6 B;  1NE3 A;  4PQX A;  4C2M H;  3LX0 A;  3K57 A;  2KBN A;  1QVG A;  4LWC A;  5KIX A;  5BN4 A;  2NTS A;  1TT2 A;  5J1Z A;  1U4L A;  5AJ3 L;  1PH1 A;  3DWA A;  4C3J H;  1OXV A;  2DY8 A;  3KYH C;  4O42 A;  4X3K A;  4XQJ A;  1AE3 A;  4HR7 B;  5C5L A;  1OXU A;  3I8Z A;  2PO4 A;  4JYA Q;  2GVA A;  2H1E A;  1E2W A;  4F87 A;  4O1N A;  1HZA A;  3CF5 A;  1TWG H;  1HUM A;  5CV8 A;  1Y14 B;  2HT1 A;  3KOJ A;  3KJP A;  1TS3 A;  1VQB A;  3NQT A;  1T9H A;  3UDF A;  5IP9 G;  2DNE A;  1H95 A;  2NVQ H;  4IAL A;  4NXM L;  1YVC A;  4LF9 L;  3AU7 A;  5FKA C;  4DUZ Q;  3UE1 A;  2NVX H;  2DJF C;  1Q8K A;  3HOV B;  2NN6 H;  4DV0 Q;  4C56 C;  4NDX A;  2R93 G;  1JQY D;  1ROD A;  3M4Y A;  4TKO B;  2XVS A;  4KJO A;  3FPU B;  2FIN B;  4KHP Q;  3TP6 A;  2LFN A;  5C0X J;  2UXD Q;  2KQ3 A;  1JE5 A;  3MVV A;  1SND A;  5KND A;  4JW0 A;  1ZYR C;  5GRO A;  4HIO A;  3RD4 A;  5C0X H;  5BN5 A;  1EY9 A;  4DXG A;  1KAW A;  1PZI D;  5C44 H;  1M1K C;  3SR1 A;  3L0O A;  3K0X A;  2JA7 H;  1F2Y A;  4MTK A;  4JI1 Q;  4LF5 L;  4F8M A;  2V4D A;  1CTM A;  3D4D A;  5CV7 A;  2R61 A;  2CQO A;  3H3V I;  1C7Y A;  1E22 A;  1BO0 A;  4DXF A;  2K7V A;  2CW0 D;  2UU9 L;  1IBL Q;  2VW9 A;  1PRT D;  4N9T A;  5EPL A;  2A8V A;  3GTM B;  2BH8 A;  4QQB X;  1TS4 A;  2I5M X;  1B44 D;  3NTK A;  4QCL A;  2VUM H;  4I7Z C;  4JG2 A;  1TWA B;  3QOJ A;  2XTI A;  1V1P B;  3FKI H;  2AWO A;  3S1N B;  5D3I B;  3J80 E;  5M5Y H;  1H9K A;  3GTO B;  4B3S Q;  1WTH A;  4ZYS A;  4G7H C;  3A56 A;  5IP7 H;  3GTK H;  4BY7 B;  1OXS C;  1SE2 A;  4POF A;  1K83 H;  3CC2 A;  1VQ6 A;  1A63 A;  4GLX A;  1SJH D;  5J3B A;  4G4K A;  4HJA A;  1L1O A;  2K01 A;  1YHQ A;  1CI3 M;  3ITP A;  2K6A A;  4IUP A;  5LMN W;  2Y0S G;  1HNX L;  1X3G A;  3I3C A;  1HQR D;  1Q81 C;  1RTN A;  2GVB A;  4OX9 Q;  2BDN A;  4LUO A;  1IKL A;  1SFO H;  1A2U A;  1EWC A;  4FXK C;  3GP7 A;  4NXN Q;  1LTB D;  3BZC A;  4CDD C;  4DV7 Q;  3PUW A;  1CK1 A;  2LSS A;  4N8F A;  3D3R A;  4A3B G;  1KD1 C;  2XSC A;  3GTG H;  3MFY A;  4CDF C;  5IGC A;  3KBG A;  4R4O A;  4B3M Q;  2R92 B;  3CRK C;  4KN7 C;  2E2J B;  3AMU A;  4J6H A;  3SK4 A;  2KHS A;  3L3O C;  5GAH C;  1UE5 A;  2F52 A;  1XJV A;  1EU3 A;  3BVM A;  4IN3 A;  5M9O A;  4HMJ A;  1K8O A;  3AFQ A;  2C5C A;  2EQS A;  1X3F A;  2OXP A;  1JJG A;  3NPP A;  5JJK A;  4NP5 A;  3G6E A;  2LY7 A;  1B9M A;  2V1C C;  5CR3 A;  4A3D H;  4QB4 A;  1JWU D;  2B8F A;  3I4N G;  5COY A;  1DON A;  2D2C C;  1LT4 D;  2PQA B;  1EQV A;  3BYY B;  4TQU S;  1LTS D;  1BCP F;  2IY5 B;  3T51 B;  1HTL D;  4JI2 Q;  3H09 A;  5JEA G;  1LO5 D;  4LFC L;  1SE4 A;  2F4V Q;  1ICW A;  1H9S A;  4P73 A;  1NY4 A;  1HNW Q;  3S1Q H;  5IE8 A;  2C35 B;  1STN A;  3EFX D;  5IGD A;  3C2P A;  2AQ1 B;  3VYU A;  3SGI A;  4X66 Q;  4RFB A;  4TSS A;  2B63 G;  3CP0 A;  1CZW A;  3FMC A;  4YCU A;  3MXU A;  3K5L A;  1PFS A;  1JWS D;  1HPC A;  1JCK B;  5KNC A;  3HOU H;  4NW2 A;  1VQ9 A;  3DEP A;  2EYL A;  5CV9 A;  2F0V A;  1FJG L;  2R92 H;  2MO1 A;  4TVA B;  1NMF A;  2LXJ A;  2IX1 A;  1A3V A;  4YHH Q;  2K1B A;  4KY6 A;  3PUV A;  5C4J H;  4B9X A;  1E2Z A;  2K4K A;  4C3H H;  1TWF B;  1QZH A;  2WB1 G;  3S15 H;  2MO0 A;  4OEM B;  5E1F A;  4HJ5 A;  1VQC A;  2NZH A;  4PMB A;  3K7U C;  1VQJ A;  3RZD H;  4H02 A;  1D1K A;  4OGQ C;  3QR8 A;  3BG3 A;  2KVM A;  3CCM A;  2E2D C;  4RGT A;  5M3M G;  1BXT A;  3PCO B;  4AYB E;  1FNU A;  3OMC A;  4Z9C B;  2AKW B;  3K58 A;  4IPD A;  4DAY B;  2MGS A;  4A3G G;  3W5O A;  5M5X H;  3HRZ C;  2Q2H A;  2K75 A;  4A3J B;  2XNA C;  4X3S A;  2FJ2 A;  3ERO A;  5KEE A;  3NHH A;  1K8G A;  1VF7 A;  3HKZ B;  1IW7 D;  3K8A A;  2F1M A;  1I4X A;  2ZTC A;  4DV5 L;  2EXZ A;  2XRS D;  3NE5 B;  4DF7 A;  5BN3 A;  1SNM A;  2ZXP A;  1L2F A;  2WAQ G;  1W3S A;  2ZM6 Q;  4A3C G;  4IUQ A;  2F0J A;  5K5P A;  3S14 H;  4GNX A;  1VDZ A;  1N34 L;  2CKZ B;  2F0N A;  5A2Q L;  3ZYY X;  3KJO A;  1STY A;  4DR2 Q;  1V1P A;  3KLW A;  1K0R A;  4A3K B;  2OQ0 A;  4RCO A;  4RKL A;  4A3F B;  3F2D A;  4DNT B;  4AQY Q;  4CBV A;  2NTT A;  3OIQ A;  1C4Q A;  3STB D;  1Q8I A;  3BU2 A;  5I4D A;  2VS1 A;  5E7N A;  1HXY D;  5IT9 L;  1I6H H;  5IT9 c;  2PZU A;  2R7D A;  4IOA A;  1EIG A;  2A74 C;  1BOS A;  4UP9 A;  1VQG A;  1YNN C;  3AB9 A;  1SMY D;  3CRL C;  1N33 Q;  5EKI A;  4BBS G;  4A3J H;  5FOB B;  3TN2 A;  3C46 A;  3D0F A;  1G2T A;  4MTN A;  3AFP A;  3QWN A;  4CDC C;  5C4X B;  3ND8 A;  3AYH B;  3W3A A;  1QB5 D;  3U58 A;  1PLF A;  4B08 A;  3PUY A;  4H13 C;  2MUY A;  2YYZ A;  5LMN L;  1X65 A;  4DR7 Q;  5FLM H;  3CCJ A;  2NZO A;  2UUC Q;  4OEL B;  3M9B A;  1O78 A;  1EZ8 A;  4HJ8 A;  1WTX A;  4BBS H;  5J22 A;  4UPA A;  5EQ0 A;  3R2I A;  3G48 A;  2VQE L;  5DEH A;  5ELD A;  5JAV A;  2ZJR A;  3S14 B;  1LT3 D;  3K7A H;  3PO2 G;  4A93 B;  4PZ7 A;  2K32 A;  2KHI A;  1VQI A;  4X62 Q; 
#chains in the Genus database with same CATH homology
 3OTO L;  4GLA C;  1KXL A;  3J80 i;  4B3R Q;  1VQD A;  1MJC A;  1VS0 A;  4UP7 A;  3CCQ A;  4IJH A;  4J15 A;  2BA0 A;  1L0W A;  2I5L X;  4DV2 Q;  3AEV A;  2QA4 A;  4BA2 I;  1BKB A;  2JEB I;  2KCM A;  4A4I A;  4JV5 Q;  4JBJ A;  1HNZ Q;  4GOP C;  1XNQ Q;  3E9H A;  1IBK Q;  4OX9 L;  4KHP L;  1G51 A;  1S40 A;  2UXC Q;  4Y7N H;  2JA5 H;  2OTJ A;  4OWT B;  1N36 Q;  3S2H H;  1BBW A;  3PF5 A;  2YTX A;  1HNX Q;  3OYY A;  5C4X G;  1KL9 A;  1YI2 A;  4A3K H;  2EXD A;  2K5N A;  1IBM Q;  4LF4 L;  1YEZ A;  3M4P A;  2PI2 A;  1QUQ B;  3Q8D A;  3GTM H;  5C44 G;  3S24 A;  5IYB H;  3FKI G;  3J81 c;  3S1N H;  1GD7 A;  3RN2 A;  2MQH A;  3NEM A;  2NN6 I;  4X64 Q;  1WCM G;  2L15 A;  2AWN A;  2RHQ B;  3KF6 A;  3GTP H;  4P72 A;  3S1R H;  2D0P A;  2ZTE A;  5HGQ A;  4X65 L;  1A62 A;  2LXK A;  3LGJ A;  1EIY B;  4NXM Q;  4KHZ A;  1QUQ A;  2HIX A;  4OON A;  3I4M G;  4C3I H;  1VQH A;  3I56 A;  1N9W A;  1XNR L;  3FP9 A;  3J81 i;  3T1H Q;  2ZJP A;  1Q12 A;  2OTL A;  4R4I A;  3TQY A;  5LMU L;  3CAM A;  3PSI A;  4A75 A;  3CPF A;  1Y1W H;  3T1H L;  1SR3 A;  3ZJY C;  1IBM L;  4LF4 Q;  3NEL A;  4LFC Q;  1XNR Q;  3HOZ H;  1CUK A;  1HJP A;  2ZM6 L;  1CSQ A;  1CKM A;  2IHF A;  3CC7 A;  4PZ8 A;  3I4M H;  1V9P A;  4A93 H;  2E2I H;  1VQM A;  1PH9 A;  4BBR G;  4DR3 Q;  1C0A A;  4XTC S;  4DV2 L;  4AH6 A;  1A8V A;  4YWL A;  1TWH H;  2A1A A;  2JA9 A;  2JE6 I;  2N49 A;  1YJN A;  2ES2 A;  2IX0 A;  3I7F A;  4HIK A;  1B70 B;  1IBL L;  2JA7 G;  3H3V H;  4B3R L;  2RF4 A;  5EAY A;  4JI4 Q;  4X62 L;  4IOC A;  1JMC A;  2Z6K A;  2QEX A;  4A3L H;  1MIU A;  1VQ5 A;  2D0O A;  4GLV B;  3UDG A;  1MJE A;  3JAM i;  4LFB L;  4A3K G;  2MFI A;  2UXB L;  1TWF H;  5JJL A;  3GTO H;  1I50 H;  5H1S E;  2K52 A;  2WB1 E;  4YCV A;  2E8G A;  3L2P A;  4LF5 Q;  3CD6 A;  1G6P A;  1LTL A;  1S3O A;  4DR4 L;  1Q46 A;  1SN8 A;  3S2D H;  4JI0 Q;  4OXP A;  1K73 C;  3S1M H;  1TXY A;  4DUY Q;  3PUX A;  4JI1 L;  2Q2T A;  5C3E G;  1GM5 A;  2HHH Q;  1S72 A;  4KLK A;  3CCE A;  2N8N A;  4A3E G;  3HOX G;  4L5S A;  3DLL A;  1JB7 A;  3GTJ H;  1CKN A;  4AYB G;  2HHH L;  1D8L A;  1YJW A;  4YWM A;  4NB3 A;  3UE0 A;  2WAQ E;  1E1T A;  3HOV H;  4DNI A;  4IFD G;  4BY7 G;  4JBM A;  2VNU D;  3KF6 B;  4GS3 A;  1NE3 A;  1N33 L;  1NTG A;  4C2M H;  4LW1 A;  4P71 A;  5JEA J;  4GN3 B;  2UXB Q;  2KBN A;  4YY3 Q;  2K5V A;  3GDE A;  3A0J A;  3T1Y L;  1QVG A;  2E5L Q;  4LWC A;  3ULL A;  5GAG C;  1TWA H;  2YV5 A;  1XPU A;  1PVO A;  4PZ6 A;  4JOI A;  3H15 A;  1FJG Q;  4DUZ L;  1HR0 Q;  1Q1B A;  5AJ3 L;  1PH1 A;  3HOW G;  1EIF A;  4C3J H;  1OXV A;  3KYH C;  1D7Q A;  4QGU A;  5FLM G;  1OTC A;  3AQQ A;  2UUA L;  1AE3 A;  4GNX B;  2R7F A;  4DV3 L;  3IRB A;  1OXU A;  4JCV E;  1VQN A;  2GVA A;  4JYA Q;  3K80 C;  4APV A;  2HIV A;  4GKJ Q;  1YZ6 A;  1EYG A;  2K14 A;  1HZA A;  3CF5 A;  3A74 A;  1TWG H;  4K0K L;  4L5R C;  1Y14 B;  4DR1 L;  2HT1 A;  2FXQ A;  3KOJ A;  3KJP A;  1A0I A;  1VQB A;  2Q2I A;  3J7Z C;  4K0K Q;  5ELO A;  1T9H A;  3UDF A;  5IP9 G;  1PH5 A;  4P75 A;  4DR1 Q;  3EN2 A;  3RLO A;  1OXT A;  4DKA C;  3RNU A;  2D62 A;  3GTQ H;  1H95 A;  3F2B A;  1J5E L;  2NVQ H;  2R92 G;  4NXM L;  3DM3 A;  4GKJ L;  3JAM c;  1YVC A;  2BA1 A;  5JJI A;  3EIV A;  2PI2 E;  4HJ9 A;  3HOY G;  4LF9 L;  1Q86 C;  2RCN A;  2JA5 G;  3U4Z A;  4OWX B;  1Q7Y C;  4ME3 A;  1PH7 A;  2OQK A;  1B7Y B;  2IHE A;  1KRS A;  4QY7 A;  4DUZ Q;  2ASB A;  3UE1 A;  2NVX H;  4IPC A;  4GNX C;  2CWP A;  1Q8K A;  1VQF A;  3M4O H;  2VUM G;  2E5L L;  4DV0 Q;  4LNQ A;  1DGS A;  3RZO H;  1ASY A;  3J80 c;  4A3D G;  2R93 G;  3GTL H;  1VQL A;  4B3T Q;  1IBK L;  4DK6 C;  4KHP Q;  4O0A A;  1W2B A;  1UE7 A;  1I3Q H;  1L1O C;  3CCV A;  1E3P A;  5C0X J;  2UXD Q;  2XGT A;  4DV5 Q;  1JE5 A;  5GRO A;  1MKH A;  2JJQ A;  4HIO A;  4HIM A;  1L1O B;  3RR5 A;  4IO9 A;  4OWW B;  3HOW H;  3CXC A;  1K9M C;  3I4N H;  1KRT A;  3RN5 A;  2OCE A;  4BBR H;  4A3M G;  5IYC G;  2I0Q A;  1KAW A;  1VQE A;  5C44 H;  1M1K C;  4R1J A;  3L0O A;  1GO3 E;  1VQ7 A;  4NXN L;  3K0X A;  2H5X A;  4JI1 Q;  2JA7 H;  4DR4 Q;  2RHS B;  4LF5 L;  3PO2 H;  2B29 A;  3L7Z C;  3D31 A;  4EX5 A;  4LFB Q;  4OO1 G;  2CQO A;  4L5T A;  1XTD A;  3H3V I;  2CWA A;  1C7Y A;  3H0G H;  4DK3 C;  3TRZ A;  1E22 A;  5IYC H;  5BR8 Q;  2UU9 L;  3PIO A;  1IBL Q;  1YBY A;  4QL5 A;  1Y1V H;  2VW9 A;  1I94 Q;  2A8V A;  1UE6 A;  4MNO A;  2BH8 A;  1J6Q A;  5GAD C;  3E0E A;  4XIG S;  4DV1 L;  5C3E H;  3CCL A;  3HOZ G;  3F2C A;  4A3B H;  1HZ9 A;  4QQB X;  1FGU A;  5ELN A;  3PGZ A;  5IY0 A;  2I5M X;  2NVY H;  4GKK Q;  4LF9 Q;  3I55 A;  1PV4 A;  5M3F G;  4RMF A;  4POG A;  2VUM H;  4DV4 Q;  3CME A;  4JG2 A;  2XTI A;  1EQR A;  5GAE C;  1IXR A;  1J5E Q;  1SMX A;  1WYD A;  1EUJ A;  3FKI H;  4JI5 L;  4JI8 L;  4A3F H;  2AWO A;  1EFW A;  4B3S L;  4PG3 A;  1WOC A;  2NN6 G;  2ALY B;  2VL6 A;  4BA1 I;  5M5Y H;  1LUZ A;  3PO3 H;  1NJI C;  1UEB A;  4B3S Q;  5LMU Q;  3CQZ H;  2R93 H;  1KIX A;  1HZC A;  1OXX K;  5IP7 H;  1X3E A;  2IT1 A;  3GTK H;  1OXS C;  3MXN B;  4POF A;  1WFQ A;  1K83 H;  4A3I G;  4X65 Q;  4DV4 L;  2Z6K C;  3CC2 A;  1VQ6 A;  4GN5 A;  2PNH A;  1A63 A;  4GLX A;  2N78 A;  2GN5 A;  4X66 L;  2PQA A;  4OO1 I;  5J3B A;  3CPW A;  4DV3 Q;  4A3C H;  3K81 C;  1U0L A;  5C0X G;  1NMG A;  4DV6 Q;  3U4V A;  1YNX A;  2EIF A;  4A3M H;  4HJA A;  1L1O A;  1YHQ A;  3TS0 A;  3HOX H;  2Y0S G;  5M5W H;  5BR8 L;  3ULJ A;  5LMN W;  3T1Y Q;  1PH4 A;  1GVP A;  1HNX L;  1X3G A;  3RLF A;  3HKS A;  4NPS A;  4EQ5 A;  1Q81 C;  2Z0S A;  4A3G H;  4DPG A;  1Z47 A;  2GVB A;  4AIM A;  4GOP A;  4OX9 Q;  2UXC L;  3J7A 5;  4LUO A;  1G29 1;  5IYB G;  1SFO H;  2R7Z H;  1B8A A;  1PYB A;  4YWK A;  5IYD G;  1M90 C;  4WJ4 A;  2NVT H;  3M4Q A;  5IP9 H;  4QJF A;  1E7Z A;  1XNQ L;  2HQL A;  4NXN Q;  4JV5 L;  2YU9 H;  2VZA A;  3BZC A;  3STB C;  1SE8 A;  3GO5 A;  4DV7 Q;  1PYS B;  4GOP B;  4MZ9 A;  4UP8 A;  3PUW A;  2LSS A;  4DV7 L;  4R4Q A;  4A3B G;  1KD1 C;  3F1Z A;  1Q82 C;  3GTG H;  3WWV A;  1N32 L;  2JA6 G;  1SRU A;  3EBE A;  4R4O A;  4B3M Q;  5IWA Q;  2VQF Q;  2F3I A;  1VCI A;  4RG1 A;  3KF8 B;  4IFD I;  2AMC B;  2MNA A;  3BZK A;  4LF8 Q;  1XMQ L;  1WI5 A;  5GAH C;  5C0X I;  2UUC L;  1UE5 A;  4A3E H;  4DR5 Q;  2F52 A;  3CCU A;  1UE1 A;  1V1Q A;  5LMN Q;  4A3I H;  2Y0S E;  1XJV A;  4LFA L;  3S17 H;  4DV0 L;  4JI4 L;  3UDI A;  1XPR A;  2E2J H;  2BH2 A;  3HOV G;  3AFQ A;  1N8R C;  4BY7 H;  2EQS A;  1X3F A;  1JJG A;  3RLN A;  5JJK A;  4JI7 Q;  4DV6 L;  3G6E A;  4UY8 C;  1VQ4 A;  1JT8 A;  2ID0 A;  2V1C C;  4A3D H;  1LM0 A;  4DR3 L;  3I4N G;  2JQO A;  1XMO Q;  4DAM A;  2PQA B;  2PMZ E;  3KDF B;  3HKZ E;  3BJU A;  4LF7 L;  4TQU S;  1WCM H;  2CFM A;  1VQO A;  4R4C A;  2IY5 B;  1Z9F A;  3NBH B;  4JI2 Q;  5JEA G;  3PV0 A;  4A3L G;  5HY6 A;  1CKO A;  1UWV A;  4LFC L;  1PH8 A;  5IYD H;  1CSP A;  3E9I A;  2F4V Q;  4P73 A;  1NY4 A;  1HNW Q;  3S1Q H;  2JA8 H;  5IE8 A;  2C35 B;  4X6A H;  1X54 A;  4L5Q A;  2JA8 G;  3M7N A;  3SGI A;  4X66 Q;  1TWC H;  4JBW A;  2B63 G;  3CP0 A;  4AQY L;  4YCU A;  4Y52 H;  1PFS A;  2UUA Q;  3J81 j;  4X64 L;  2K50 A;  2CCZ A;  1HNW L;  1X9N A;  4A93 G;  1Q1E A;  4DR2 L;  1VQ9 A;  3HOU H;  1KC8 C;  2UU9 Q;  3A5Z B;  1HH2 P;  4JOI C;  4IJL A;  2Q2U A;  1O7I A;  3A5U A;  1HR0 W;  1FJG L;  2MO1 A;  4TVA B;  2R92 H;  1K8A C;  2YTY A;  3HKZ G;  1NMF A;  2LXJ A;  4P74 A;  1N34 Q;  1VQ8 A;  4JI8 Q;  1EWI A;  4YHH Q;  2ZJQ A;  2IX1 A;  4LF6 Q;  2JA6 H;  3M3Y H;  3PUV A;  5FLX c;  1HNZ L;  5C4J H;  3PO3 G;  1C9O A;  1PA6 A;  1I5F A;  3F8T A;  5M3M H;  4GKK L;  2K4K A;  4C3H H;  5M3F H;  4BXX G;  3GD7 A;  4JC0 A;  2N3S A;  2WB1 G;  4JI3 L;  1QZH A;  4JBK A;  2MO0 A;  3M85 A;  3S15 H;  4HJ5 A;  1VQC A;  5FJ8 G;  1QVF A;  1VQA A;  4DV1 Q;  2NZH A;  3OTO Q;  2ZTD A;  5GQO A;  4ALP A;  3K7U C;  1VQJ A;  4A76 A;  2K5H A;  3RZD H;  4H02 A;  1KQS A;  2DGY A;  2KHJ A;  4LFA Q;  3CCM A;  1JJ2 A;  2UUB L;  2OWO A;  4DR5 L;  1LYL A;  2UXD L;  5M3M G;  4AYB E;  3PCO B;  4IPH A;  1SLJ A;  3W1B A;  5C4X H;  1XMQ Q;  3FHW A;  1BBU A;  2R6G A;  3KDF A;  2AKW B;  4B3T L;  4IPD A;  4DAY B;  1IL2 A;  4A3G G;  5IWA L;  3W5O A;  2VQF L;  5M5X H;  3ULP A;  2YTV A;  1N32 Q;  3CCR A;  2Q2H A;  2K75 A;  1P8L A;  3HOY H;  1VQK A;  1PH6 A;  1X6O A;  4GN4 B;  2B63 H;  3KFU A;  2VY3 A;  1Y1W G;  3CW2 C;  1K8G A;  2I5H A;  3K8A A;  1BVS A;  1JJC B;  1QZG A;  2ATW A;  1YJ9 A;  2ZTC A;  4JI6 Q;  3S16 H;  4DV5 L;  1X55 A;  3HOU G;  1U5K A;  3MEF A;  1XPO A;  2KCT A;  4JI3 Q;  1ASZ A;  3CMA A;  3JC6 6;  1CKN B;  1PH2 A;  4LF6 L;  1L2F A;  4YHH L;  1FVI A;  3PIP A;  2WAQ G;  1W3S A;  2ZM6 Q;  4A3C G;  2JK8 A;  1RIP A;  2KEN A;  1NBW A;  1EOV A;  3S14 H;  4WJ3 M;  4HID A;  1FL0 A;  4GNX A;  1P16 A;  1PH3 A;  1N34 L;  2CKZ B;  1K3R A;  4KI0 A;  4BXX H;  3KJO A;  1YIT A;  5FJ8 H;  4DR2 Q;  2E2H H;  3TS2 A;  3KLW A;  4IFD J;  1K0R A;  2OQ0 A;  4LUZ A;  1QVC A;  4YCW A;  3ERS X;  1VQP A;  3F2D A;  4AQY Q;  2R7Z G;  5K36 G;  1HZB A;  3STB D;  3BU2 A;  2VS1 A;  5E7N A;  4A3J G;  1KHI A;  3U50 C;  5AJ3 Q;  1RL2 A;  5IP7 G;  2QGQ A;  1HR0 L;  2WP8 J;  1I6H H;  5IT9 c;  1AE2 A;  3G71 A;  2R7D A;  4FDB A;  2F4V L;  4IOA A;  4JI5 Q;  3CCS A;  4UP9 A;  1VQG A;  4YY3 L;  1Y1V G;  1V43 A;  1PHJ A;  1N36 L;  1YIJ A;  1WJJ A;  1EQQ A;  1GKH A;  4LUV A;  4IPG A;  4O2D A;  3ER0 A;  1XMO L;  2JEA I;  4JYA L;  3H0G G;  3TEH B;  4LF7 Q;  1N33 Q;  1SRO A;  3I2Z A;  4BBS G;  4A3J H;  1AH9 A;  4JI6 L;  3D0F A;  2B3G A;  4MTN A;  4R4T A;  3TRE A;  3W1G A;  4JI7 L;  3AFP A;  4BY1 H;  1R9T H;  1I94 L;  3NEN A;  3AYH B;  3U58 A;  1IZ6 A;  2A19 A;  2WFW A;  3PUY A;  2DUD A;  1YHB A;  2YYZ A;  5LMN L;  1X65 A;  4DUY L;  3PF4 A;  4DR7 Q;  5FLM H;  3CCJ A;  2NZO A;  2UUC Q;  4PMW A;  3CC4 A;  3M9B A;  5DLQ E;  4HJ8 A;  4JI0 L;  4DR6 Q;  3G4S A;  1YHA A;  3OW2 A;  4BBS H;  4UPA A;  2VQE Q;  3B6Y A;  3I4O A;  4A3F G;  1E24 A;  2AHO B;  3G48 A;  4BY1 G;  2VQE L;  2ZJR A;  2UUB Q;  3UDX A;  4B3M L;  4LF8 L;  3ICE A;  3K7A H;  4DR6 L;  3HFZ B;  4JI2 L;  3PO2 G;  1IYJ B;  1E1O A;  4PZ7 A;  1X56 A;  3PUZ A;  4HJ7 A;  4DR7 L;  2KHI A;  1VQI A;  4QIW E;  4X62 Q;  3VDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...