5C4JK

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c4jK00
2Y0SD 4Y7NK 2WB1D 5D4DA 5TMFA 4A3MK 3HOXC 3M3YC 3RZOK 3S14C 4MEYA 5M5XK 3GTPC 1I6HK 3HOVC 2NVXK 4OINA 4Y7NC 3GTOK 4A3MC 3RZOC 1I6HC 1Y1VK 3DXJA 2VUMC 2R93K 2NVXC 1SFOK 3GTOC 4C2MK 2BE5A 4XSXA 4KMUA 1Y1VC 5C4XK 3GTKK 4OIRA 3S2HK 4Q5SA 2R93C 1SFOC 3I4MC 4MEXA 1IW7A 4MQ9A 2NVYK 2PMZD 4C3IK 3GTKC 5C4XC 3S17K 4Q4ZA 4BXXK 1TWAK 2NVYC 4G7OA 5IYDK 3S15K 4OIPA 4A3LK 3S17C 1I3QK 4YFNA 2PA8D 1TWAC 3PO3C 4BXXC 4KN4A 2A68A 3FKIC 5IYDC 3HOZC 3GTJK 1R9TK 1I3QC 1Y1WK 4BBRK 4BBSK 1SMYA 3K7AK 4QJVA 3GTJC 1R9TC 3S1QK 4A3KK 2CW0A 2E2JK 4ZH4A 4A93K 4BBRC 4BBSC 4OIQA 3K7AC 2A6EA 3S1QC 3HOYK 4C3JK 2E2JC 4A93C 4QJVB 2E2HK 3GTGK 3HOYC 2WAQL 4BY7K 2JA8K 4A3JK 3H0GK 3S2HC 2R92K 4X6AK 2E2HC 1TWHK 2JA7K 4YG2A 4BY7C 2JA8C 5IYCK 3H0GC 2A69A 2R92C 1I50K 4X6AC 4QIWL 3H3VL 3S1RK 1K83K 1TWHC 2JA7C 1TWFK 4YFKA 3S15C 5IYCC 2A6HA 3GTLK 2PMZL 4A3LC 3S1RC 1K83C 1TWFC 3S16K 4LK1A 3GTLC 3S1NK 2JA6K 4AYBL 1Y1WC 1TWGK 5M5WK 3HOUK 3S16C 4A3BK 4A3GK 3S1NC 3HKZL 3S1MK 4A3KC 4A3IK 2Y0SL 5TMCA 2WB1L 1HQMA 1TWGC 4A3BC 4A3GC 3HOWK 4GZYA 2YU9K 1TWCK 3S1MC 1XPPA 4KN7A 4G7ZA 1ZYRA 4A3IC 4YFXA 3GTQK 1YNNA 4JK1A 3GTPK 3HOWC 3GTGC 5FLMK 5C4JK 2YU9C 1TWCC 5C3EK 3HOVK 5C44K 4A3JC 3GTQC 4XLPA 2NVTK 2E2IK 5IP7K 3GTMK 2VUMK 4LK0A 5FLMC 5C4JC 2WAQD 5C3EC 5C44C 4C3HK 2B63K 2E2IC 1WCMK 2NVTC 5IP9K 1I50C 5IP7C 3RZDK 3GTMC 2O5JA 4A3FK 4OIOA 3M4OK 3I4MK 3S2DK 4XLNA 5M3MK 2B63C 1WCMC 3CQZK 5IP9C 3WODA 5M3FK 3RZDC 4QIWD 3H3VD 4A3DK 4A3FC 3M4OC 2PA8L 4NOIA 4A3CK 4LLGA 1BDFA 5IYBK 4G7HA 3S2DC 4A3EK 3CQZC 2R7ZK 2JA6C 2NVQK 1YNJA 4BY1K 3I4NK 3HOUC 4A3DC 5M5YK 2JA5K 4A3CC 5IYBC 1I6VA 5FJ8K 3PO2K 3PO3K 3FKIK 4A3EC 2R7ZC 4Y52K 4AYBD 4BY1C 2NVQC 4LJZA 4XSZA 2O5IA 3HOZK 3M3YK 3HOXK 2JA5C 3S14K 3I4NC 3PO2C 4Y52C 3HKZD 3EQLA 2PPBA
chains in the Genus database with same CATH superfamily
4MEYA 1BJTA 3JSTA 4Y7NC 2GSNA 1I3QA 1Y1VK 3DXJA 2VUMC 1XZQB 4KM9A 1YX2A 4C2MK 4XSXA 5C4XK 3L4JA 4OIRA 3S2HK 3GSIA 1SFOC 4MQ9A 4AH6A 1WQFA 1WOSA 3S17C 1I3QK 4BXXC 3PO3C 4KN4A 2GSOA 2P5MA 4GT9A 2JA7A 3LAJA 2RH6A 4QJVA 4BLAA 3FOFA 2E2JK 1TWFA 4BBRC 3BP3A 3FHZA 4OIQA 3K7AC 2A6EA 1X31C 3HOYC 2GAHC 4A3JK 3A8JA 5CJ9A 2JA7K 3N0CA 4YG2A 5EGHA 3TFHA 2R92C 3H3VL 3SZZA 1TWHC 1TWFK 1TWCA 4YFKA 5IYCC 1WSVA 5IORA 1K83C 4GTCA 3TTGA 2E2IA 3GTMA 2XCOA 5M5WK 1V5VA 2W7VA 4A3GK 5IOSA 3S1MK 2PHCB 4A3KC 4WJ4A 4ILDA 4G0UA 3G4CA 1TWCK 3L4KA 1XPPA 5C4JK 5C3EK 2V6TA 2E2IK 2JA5A 2V6UA 3GTMK 3FOEA 2WAQD 1O28A 1IL2A 2NVTC 1O27A 5CHPA 2O5JA 4P9SA 1O2AA 3M4OK 3CAGA 1O2BA 2GAGC 4C3HC 2B63C 1WCMC 5M3FK 4A3FC 2PA8L 4NOIA 4LLGA 3GTOA 3S0XA 4A3EK 2JA6C 2JA5K 2V6SA 5IYBC 5IOTA 1VRQC 4FM9A 3S14K 3I4NC 3GTKA 4KMDA 4RMFA 3EQLA 1XZQA 2Y0SD 2WB1D 3M3YC 5TMFA 3RZOK 3GTPC 1I6HK 4KB4A 3ERED 3FKIA 2NVXK 3GTOK 1VH2A 3GTJA 1IS1A 4KMUA 4WJ3M 1Y1VC 3GTKK 3I4MC 4MEXA 1IW7A 1UV7A 4C2MC 3AD9C 2PMZD 5C4XC 1B4AA 4Q4ZA 1KQ4A 3S15K 4A3LK 2A68A 5E68A 4KATA 3LAPA 3HOZC 4KMHA 3GTJK 1I3QC 1Y1WK 3GDZA 4BBSK 1YCLA 3S1QK 4GFQA 2CW0A 2ZUEA 4ZH4A 4A93K 3GTLA 4C3JK 2E2JC 1IE0A 3GTGK 2XCRB 4BY7K 1O25A 2JA8K 4X6AK 4BLBA 5HL8A 4KM8A 2A69A 1I50K 3S1RK 1WIHA 2JA7C 2YU9A 2CFAB 2P8TA 3LPXA 3GTLK 4GTEA 1TWFC 4LK1A 4M1XA 4AYBL 4KMAA 3HOUK 4A3BK 3ADAC 3HKZL 4A3IK 1O24A 1DCPA 1HQMA 1XZPB 4A3GC 3HOWK 3BUEA 1J98A 2YU9K 3S1MC 4KN7A 1DCHA 2KWAA 4YFXA 1DCOA 1TWCC 3AD8C 5C44K 5IP7K 2VUMK 4GTDA 5C4JC 5C3EC 2E2IC 5IP9K 3GTMC 5JFEA 3GEHA 3S2DK 1WSRA 4XLNA 1RU0A 3WODA 4P5BA 3H3VD 4A3DK 3M4OC 4G7HA 3N3YA 2R7ZK 3T02A 2NVQK 2R93A 3PO3K 5FJ8K 3OEPA 4A3EC 4Y52K 1ZBSA 2O5IA 4LJZA 4LOWA 3HOXK 2JA5C 3GIRA 2NVYA 3S14C 4A3MK 5M5XK 1TWAA 3HOVC 4OINA 1AB4A 3RZOC 4PABA 1I6HC 3AD7C 2R93K 2NVXC 3GTOC 1O29A 1R9TA 3T01A 2NVXA 2NVYK 4C3IK 1BGWA 5TJ3A 3GTKC 1HI9A 1TWAK 5IYDK 3MMLB 4OIPA 5L46A 4LQYA 4GTFA 2PA8D 4WILA 2E2HA 3FKIC 5JVOA 4BKWA 1R9TK 1XXCA 2Y3PA 3H0GA 4KAWX 3Q3QA 3AQOA 3GTJC 4O2DA 4DDQA 4A3KK 2D6FC 4BBSC 3S1QC 4P5AA 4A93C 1Y1WA 3G4AA 2E2HK 3NUHA 1USOA 2FQOA 3TFIA 4C3JC 3IPJA 1WOOA 3H0GK 1TWGA 2CFAA 3S2HC 1WQHA 4BY7C 1EQRA 2JA8C 1F9NA 4X6AC 4QIWL 3GTGA 1J6WA 1EK8A 2A6HA 3GTQA 2PMZL 3S1RC 3A8IA 3S16K 1XZPA 3GTLC 3S1NK 2JA6K 1WORA 4LR2A 1I50A 1TWGK 5TMCA 1EH1A 4A3BC 3TFJA 4G0WA 4GZYA 4A3IC 4G7ZA 3GTQK 1F7UA 1JOEA 4JK1A 3GTPK 3HOWC 4G0VA 5FLMK 2YU9C 4A3JC 3GEEA 1ZQ1C 5C44C 1JVIA 1WQGA 5IP7C 3RZDK 3BP8C 3GEIA 1O26A 4FZBA 3I4MK 5M3MK 3QX3A 3CQZK 5IP9C 1IQ0A 2VUMA 1PJ6A 4A3CK 3S2DC 1BDFA 1YNJA 1ZVUA 4BY1K 1JQWA 4A3DC 4KB2A 1O2FB 1I6VA 1SFOA 1L0WA 3PO2K 3A8KA 2R7ZC 4AYBD 2NVQC 3HOZK 2FQTA 4XSZA 1J6XA 1WOPA 1VGXA 2EBBA 1ZXOA 4Y52C 4C45A 3HKZD 2R7ZA 4Y7NK 5D4DA 3HOXC 3AQPA 2XCQA 4A3MC 3OREA 4GTLA 5IOQA 1SFOK 2BE5A 4Q5SA 1C0AA 2R93C 1VJEA 5EGEA 3S17K 4BXXK 2NVYC 4C3IC 4G7OA 1DD5A 4KDDA 4YFNA 1TWAC 4GTBA 5IYDC 1F7VA 1ISEA 1EI6A 2R92A 1INNA 4KASA 1TWHA 4BBRK 1SMYA 3K7AK 1R9TC 1K83A 1PJ7A 3HOYK 4QJVB 1XXBA 2WAQL 1EFWA 2R92K 2E2HC 1TWHK 3AH5A 5IYCK 3H0GC 2GSUA 1K83K 3S15C 4GTAA 4A3LC 1USMA 4KC6A 1PJ5A 4KARA 1BS2A 2RGRA 1IBAA 1Y1WC 3SZYA 3S16C 3S1NC 2B63A 1WCMA 2Y0SL 2WB1L 1TWGC 3T00A 2JA6A 1ZYRA 1XXAA 1YNNA 3HXAA 3GTGC 3HOVK 3GTQC 4XLPA 2NVTK 4LK0A 5FLMC 2JH3A 4C3HK 2B63K 1WCMK 4PAAA 1I50C 3GTPA 2ZUFA 4A3FK 1J6VA 4OIOA 4XCHA 3V4GA 3RZDC 4QIWD 1GE9A 5IYBK 3N0BA 4J3NA 1B4BA 3CQZC 1Y1VA 3I4NK 3HOUC 1G51A 1VLOA 5M5YK 4A3CC 3VA7A 3FKIK 3CQZA 4BY1C 3M3YK 2ZFZA 3OPFA 1F93A 3PO2C 2PPBA
chains in the Genus database with same CATH topology
2Y0SD 4Y7NK 2WB1D 5D4DA 5TMFA 4A3MK 3HOXC 3M3YC 3RZOK 3S14C 4MEYA 5M5XK 3GTPC 1I6HK 3HOVC 2NVXK 4OINA 4Y7NC 3GTOK 4A3MC 3RZOC 1I6HC 1Y1VK 3DXJA 2VUMC 2R93K 2NVXC 1SFOK 3GTOC 4C2MK 2BE5A 4XSXA 4KMUA 1Y1VC 5C4XK 3GTKK 4OIRA 3S2HK 4Q5SA 2R93C 1SFOC 3I4MC 4MEXA 1IW7A 4MQ9A 2NVYK 2PMZD 4C3IK 3GTKC 5C4XC 3S17K 4Q4ZA 4BXXK 1TWAK 2NVYC 4G7OA 5IYDK 3S15K 4OIPA 4A3LK 3S17C 1I3QK 4YFNA 2PA8D 1TWAC 3PO3C 4BXXC 4KN4A 2A68A 3FKIC 5IYDC 3HOZC 3GTJK 1R9TK 1I3QC 1Y1WK 4BBRK 4BBSK 1SMYA 3K7AK 4QJVA 3GTJC 1R9TC 3S1QK 4A3KK 2CW0A 2E2JK 4ZH4A 4A93K 4BBRC 4BBSC 4OIQA 3K7AC 2A6EA 3S1QC 3HOYK 4C3JK 2E2JC 4A93C 4QJVB 2E2HK 3GTGK 3HOYC 2WAQL 4BY7K 2JA8K 4A3JK 3H0GK 3S2HC 2R92K 4X6AK 2E2HC 1TWHK 2JA7K 4YG2A 4BY7C 2JA8C 5IYCK 3H0GC 2A69A 2R92C 1I50K 4X6AC 4QIWL 3H3VL 3S1RK 1K83K 1TWHC 2JA7C 1TWFK 4YFKA 3S15C 5IYCC 2A6HA 3GTLK 2PMZL 4A3LC 3S1RC 1K83C 1TWFC 3S16K 4LK1A 3GTLC 3S1NK 2JA6K 4AYBL 1Y1WC 1TWGK 5M5WK 3HOUK 3S16C 4A3BK 4A3GK 3S1NC 3HKZL 3S1MK 4A3KC 4A3IK 2Y0SL 5TMCA 2WB1L 1HQMA 1TWGC 4A3BC 4A3GC 3HOWK 4GZYA 2YU9K 1TWCK 3S1MC 1XPPA 4KN7A 4G7ZA 1ZYRA 4A3IC 4YFXA 3GTQK 1YNNA 4JK1A 3GTPK 3HOWC 3GTGC 5FLMK 5C4JK 2YU9C 1TWCC 5C3EK 3HOVK 5C44K 4A3JC 3GTQC 4XLPA 2NVTK 2E2IK 5IP7K 3GTMK 2VUMK 4LK0A 5FLMC 5C4JC 2WAQD 5C3EC 5C44C 4C3HK 2B63K 2E2IC 1WCMK 2NVTC 5IP9K 1I50C 5IP7C 3RZDK 3GTMC 2O5JA 4A3FK 4OIOA 3M4OK 3I4MK 3S2DK 4XLNA 5M3MK 2B63C 1WCMC 3CQZK 5IP9C 3WODA 5M3FK 3RZDC 4QIWD 3H3VD 4A3DK 4A3FC 3M4OC 2PA8L 4NOIA 4A3CK 4LLGA 1BDFA 5IYBK 4G7HA 3S2DC 4A3EK 3CQZC 2R7ZK 2JA6C 2NVQK 1YNJA 4BY1K 3I4NK 3HOUC 4A3DC 5M5YK 2JA5K 4A3CC 5IYBC 1I6VA 5FJ8K 3PO2K 3PO3K 3FKIK 4A3EC 2R7ZC 4Y52K 4AYBD 4BY1C 2NVQC 4LJZA 4XSZA 2O5IA 3HOZK 3M3YK 3HOXK 2JA5C 3S14K 3I4NC 3PO2C 4Y52C 3HKZD 3EQLA 2PPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S D;  4Y7N K;  2WB1 D;  5D4D A;  5TMF A;  4A3M K;  3HOX C;  3M3Y C;  3RZO K;  3S14 C;  4MEY A;  5M5X K;  3GTP C;  1I6H K;  3HOV C;  2NVX K;  4OIN A;  4Y7N C;  3GTO K;  4A3M C;  3RZO C;  1I6H C;  1Y1V K;  3DXJ A;  2VUM C;  2R93 K;  2NVX C;  1SFO K;  3GTO C;  4C2M K;  2BE5 A;  4XSX A;  4KMU A;  1Y1V C;  5C4X K;  3GTK K;  4OIR A;  3S2H K;  4Q5S A;  2R93 C;  1SFO C;  3I4M C;  4MEX A;  1IW7 A;  4MQ9 A;  2NVY K;  2PMZ D;  4C3I K;  3GTK C;  5C4X C;  3S17 K;  4Q4Z A;  4BXX K;  1TWA K;  2NVY C;  4G7O A;  5IYD K;  3S15 K;  4OIP A;  4A3L K;  3S17 C;  1I3Q K;  4YFN A;  2PA8 D;  1TWA C;  3PO3 C;  4BXX C;  4KN4 A;  2A68 A;  3FKI C;  5IYD C;  3HOZ C;  3GTJ K;  1R9T K;  1I3Q C;  1Y1W K;  4BBR K;  4BBS K;  1SMY A;  3K7A K;  4QJV A;  3GTJ C;  1R9T C;  3S1Q K;  4A3K K;  2CW0 A;  2E2J K;  4ZH4 A;  4A93 K;  4BBR C;  4BBS C;  4OIQ A;  3K7A C;  2A6E A;  3S1Q C;  3HOY K;  4C3J K;  2E2J C;  4A93 C;  4QJV B;  2E2H K;  3GTG K;  3HOY C;  2WAQ L;  4BY7 K;  2JA8 K;  4A3J K;  3H0G K;  3S2H C;  2R92 K;  4X6A K;  2E2H C;  1TWH K;  2JA7 K;  4YG2 A;  4BY7 C;  2JA8 C;  5IYC K;  3H0G C;  2A69 A;  2R92 C;  1I50 K;  4X6A C;  4QIW L;  3H3V L;  3S1R K;  1K83 K;  1TWH C;  2JA7 C;  1TWF K;  4YFK A;  3S15 C;  5IYC C;  2A6H A;  3GTL K;  2PMZ L;  4A3L C;  3S1R C;  1K83 C;  1TWF C;  3S16 K;  4LK1 A;  3GTL C;  3S1N K;  2JA6 K;  4AYB L;  1Y1W C;  1TWG K;  5M5W K;  3HOU K;  3S16 C;  4A3B K;  4A3G K;  3S1N C;  3HKZ L;  3S1M K;  4A3K C;  4A3I K;  2Y0S L;  5TMC A;  2WB1 L;  1HQM A;  1TWG C;  4A3B C;  4A3G C;  3HOW K;  4GZY A;  2YU9 K;  1TWC K;  3S1M C;  1XPP A;  4KN7 A;  4G7Z A;  1ZYR A;  4A3I C;  4YFX A;  3GTQ K;  1YNN A;  4JK1 A;  3GTP K;  3HOW C;  3GTG C;  5FLM K;  5C4J K;  2YU9 C;  1TWC C;  5C3E K;  3HOV K;  5C44 K;  4A3J C;  3GTQ C;  4XLP A;  2NVT K;  2E2I K;  5IP7 K;  3GTM K;  2VUM K;  4LK0 A;  5FLM C;  5C4J C;  2WAQ D;  5C3E C;  5C44 C;  4C3H K;  2B63 K;  2E2I C;  1WCM K;  2NVT C;  5IP9 K;  1I50 C;  5IP7 C;  3RZD K;  3GTM C;  2O5J A;  4A3F K;  4OIO A;  3M4O K;  3I4M K;  3S2D K;  4XLN A;  5M3M K;  2B63 C;  1WCM C;  3CQZ K;  5IP9 C;  3WOD A;  5M3F K;  3RZD C;  4QIW D;  3H3V D;  4A3D K;  4A3F C;  3M4O C;  2PA8 L;  4NOI A;  4A3C K;  4LLG A;  1BDF A;  5IYB K;  4G7H A;  3S2D C;  4A3E K;  3CQZ C;  2R7Z K;  2JA6 C;  2NVQ K;  1YNJ A;  4BY1 K;  3I4N K;  3HOU C;  4A3D C;  5M5Y K;  2JA5 K;  4A3C C;  5IYB C;  1I6V A;  5FJ8 K;  3PO2 K;  3PO3 K;  3FKI K;  4A3E C;  2R7Z C;  4Y52 K;  4AYB D;  4BY1 C;  2NVQ C;  4LJZ A;  4XSZ A;  2O5I A;  3HOZ K;  3M3Y K;  3HOX K;  2JA5 C;  3S14 K;  3I4N C;  3PO2 C;  4Y52 C;  3HKZ D;  3EQL A;  2PPB A; 
#chains in the Genus database with same CATH topology
 4MEY A;  1BJT A;  3JST A;  4Y7N C;  2GSN A;  1I3Q A;  1Y1V K;  3DXJ A;  2VUM C;  1XZQ B;  4KM9 A;  1YX2 A;  4C2M K;  4XSX A;  5C4X K;  3L4J A;  4OIR A;  3S2H K;  3GSI A;  1SFO C;  4MQ9 A;  4AH6 A;  1WQF A;  1WOS A;  3S17 C;  1I3Q K;  4BXX C;  3PO3 C;  4KN4 A;  2GSO A;  2P5M A;  4GT9 A;  2JA7 A;  3LAJ A;  2RH6 A;  4QJV A;  4BLA A;  3FOF A;  2E2J K;  1TWF A;  4BBR C;  3BP3 A;  3FHZ A;  4OIQ A;  3K7A C;  2A6E A;  1X31 C;  3HOY C;  2GAH C;  4A3J K;  3A8J A;  5CJ9 A;  2JA7 K;  3N0C A;  4YG2 A;  5EGH A;  3TFH A;  2R92 C;  3H3V L;  3SZZ A;  1TWH C;  1TWF K;  1TWC A;  4YFK A;  5IYC C;  1WSV A;  5IOR A;  1K83 C;  4GTC A;  3TTG A;  2E2I A;  3GTM A;  2XCO A;  5M5W K;  1V5V A;  2W7V A;  4A3G K;  5IOS A;  3S1M K;  2PHC B;  4A3K C;  4WJ4 A;  4ILD A;  4G0U A;  3G4C A;  1TWC K;  3L4K A;  1XPP A;  5C4J K;  5C3E K;  2V6T A;  2E2I K;  2JA5 A;  2V6U A;  3GTM K;  3FOE A;  2WAQ D;  1O28 A;  1IL2 A;  2NVT C;  1O27 A;  5CHP A;  2O5J A;  4P9S A;  1O2A A;  3M4O K;  3CAG A;  1O2B A;  2GAG C;  4C3H C;  2B63 C;  1WCM C;  5M3F K;  4A3F C;  2PA8 L;  4NOI A;  4LLG A;  3GTO A;  3S0X A;  4A3E K;  2JA6 C;  2JA5 K;  2V6S A;  5IYB C;  5IOT A;  1VRQ C;  4FM9 A;  3S14 K;  3I4N C;  3GTK A;  4KMD A;  4RMF A;  3EQL A;  1XZQ A;  2Y0S D;  2WB1 D;  3M3Y C;  5TMF A;  3RZO K;  3GTP C;  1I6H K;  4KB4 A;  3ERE D;  3FKI A;  2NVX K;  3GTO K;  1VH2 A;  3GTJ A;  1IS1 A;  4KMU A;  4WJ3 M;  1Y1V C;  3GTK K;  3I4M C;  4MEX A;  1IW7 A;  1UV7 A;  4C2M C;  3AD9 C;  2PMZ D;  5C4X C;  1B4A A;  4Q4Z A;  1KQ4 A;  3S15 K;  4A3L K;  2A68 A;  5E68 A;  4KAT A;  3LAP A;  3HOZ C;  4KMH A;  3GTJ K;  1I3Q C;  1Y1W K;  3GDZ A;  4BBS K;  1YCL A;  3S1Q K;  4GFQ A;  2CW0 A;  2ZUE A;  4ZH4 A;  4A93 K;  3GTL A;  4C3J K;  2E2J C;  1IE0 A;  3GTG K;  2XCR B;  4BY7 K;  1O25 A;  2JA8 K;  4X6A K;  4BLB A;  5HL8 A;  4KM8 A;  2A69 A;  1I50 K;  3S1R K;  1WIH A;  2JA7 C;  2YU9 A;  2CFA B;  2P8T A;  3LPX A;  3GTL K;  4GTE A;  1TWF C;  4LK1 A;  4M1X A;  4AYB L;  4KMA A;  3HOU K;  4A3B K;  3ADA C;  3HKZ L;  4A3I K;  1O24 A;  1DCP A;  1HQM A;  1XZP B;  4A3G C;  3HOW K;  3BUE A;  1J98 A;  2YU9 K;  3S1M C;  4KN7 A;  1DCH A;  2KWA A;  4YFX A;  1DCO A;  1TWC C;  3AD8 C;  5C44 K;  5IP7 K;  2VUM K;  4GTD A;  5C4J C;  5C3E C;  2E2I C;  5IP9 K;  3GTM C;  5JFE A;  3GEH A;  3S2D K;  1WSR A;  4XLN A;  1RU0 A;  3WOD A;  4P5B A;  3H3V D;  4A3D K;  3M4O C;  4G7H A;  3N3Y A;  2R7Z K;  3T02 A;  2NVQ K;  2R93 A;  3PO3 K;  5FJ8 K;  3OEP A;  4A3E C;  4Y52 K;  1ZBS A;  2O5I A;  4LJZ A;  4LOW A;  3HOX K;  2JA5 C;  3GIR A;  2NVY A;  3S14 C;  4A3M K;  5M5X K;  1TWA A;  3HOV C;  4OIN A;  1AB4 A;  3RZO C;  4PAB A;  1I6H C;  3AD7 C;  2R93 K;  2NVX C;  3GTO C;  1O29 A;  1R9T A;  3T01 A;  2NVX A;  2NVY K;  4C3I K;  1BGW A;  5TJ3 A;  3GTK C;  1HI9 A;  1TWA K;  5IYD K;  3MML B;  4OIP A;  5L46 A;  4LQY A;  4GTF A;  2PA8 D;  4WIL A;  2E2H A;  3FKI C;  5JVO A;  4BKW A;  1R9T K;  1XXC A;  2Y3P A;  3H0G A;  4KAW X;  3Q3Q A;  3AQO A;  3GTJ C;  4O2D A;  4DDQ A;  4A3K K;  2D6F C;  4BBS C;  3S1Q C;  4P5A A;  4A93 C;  1Y1W A;  3G4A A;  2E2H K;  3NUH A;  1USO A;  2FQO A;  3TFI A;  4C3J C;  3IPJ A;  1WOO A;  3H0G K;  1TWG A;  2CFA A;  3S2H C;  1WQH A;  4BY7 C;  1EQR A;  2JA8 C;  1F9N A;  4X6A C;  4QIW L;  3GTG A;  1J6W A;  1EK8 A;  2A6H A;  3GTQ A;  2PMZ L;  3S1R C;  3A8I A;  3S16 K;  1XZP A;  3GTL C;  3S1N K;  2JA6 K;  1WOR A;  4LR2 A;  1I50 A;  1TWG K;  5TMC A;  1EH1 A;  4A3B C;  3TFJ A;  4G0W A;  4GZY A;  4A3I C;  4G7Z A;  3GTQ K;  1F7U A;  1JOE A;  4JK1 A;  3GTP K;  3HOW C;  4G0V A;  5FLM K;  2YU9 C;  4A3J C;  3GEE A;  1ZQ1 C;  5C44 C;  1JVI A;  1WQG A;  5IP7 C;  3RZD K;  3BP8 C;  3GEI A;  1O26 A;  4FZB A;  3I4M K;  5M3M K;  3QX3 A;  3CQZ K;  5IP9 C;  1IQ0 A;  2VUM A;  1PJ6 A;  4A3C K;  3S2D C;  1BDF A;  1YNJ A;  1ZVU A;  4BY1 K;  1JQW A;  4A3D C;  4KB2 A;  1O2F B;  1I6V A;  1SFO A;  1L0W A;  3PO2 K;  3A8K A;  2R7Z C;  4AYB D;  2NVQ C;  3HOZ K;  2FQT A;  4XSZ A;  1J6X A;  1WOP A;  1VGX A;  2EBB A;  1ZXO A;  4Y52 C;  4C45 A;  3HKZ D;  2R7Z A;  4Y7N K;  5D4D A;  3HOX C;  3AQP A;  2XCQ A;  4A3M C;  3ORE A;  4GTL A;  5IOQ A;  1SFO K;  2BE5 A;  4Q5S A;  1C0A A;  2R93 C;  1VJE A;  5EGE A;  3S17 K;  4BXX K;  2NVY C;  4C3I C;  4G7O A;  1DD5 A;  4KDD A;  4YFN A;  1TWA C;  4GTB A;  5IYD C;  1F7V A;  1ISE A;  1EI6 A;  2R92 A;  1INN A;  4KAS A;  1TWH A;  4BBR K;  1SMY A;  3K7A K;  1R9T C;  1K83 A;  1PJ7 A;  3HOY K;  4QJV B;  1XXB A;  2WAQ L;  1EFW A;  2R92 K;  2E2H C;  1TWH K;  3AH5 A;  5IYC K;  3H0G C;  2GSU A;  1K83 K;  3S15 C;  4GTA A;  4A3L C;  1USM A;  4KC6 A;  1PJ5 A;  4KAR A;  1BS2 A;  2RGR A;  1IBA A;  1Y1W C;  3SZY A;  3S16 C;  3S1N C;  2B63 A;  1WCM A;  2Y0S L;  2WB1 L;  1TWG C;  3T00 A;  2JA6 A;  1ZYR A;  1XXA A;  1YNN A;  3HXA A;  3GTG C;  3HOV K;  3GTQ C;  4XLP A;  2NVT K;  4LK0 A;  5FLM C;  2JH3 A;  4C3H K;  2B63 K;  1WCM K;  4PAA A;  1I50 C;  3GTP A;  2ZUF A;  4A3F K;  1J6V A;  4OIO A;  4XCH A;  3V4G A;  3RZD C;  4QIW D;  1GE9 A;  5IYB K;  3N0B A;  4J3N A;  1B4B A;  3CQZ C;  1Y1V A;  3I4N K;  3HOU C;  1G51 A;  1VLO A;  5M5Y K;  4A3C C;  3VA7 A;  3FKI K;  3CQZ A;  4BY1 C;  3M3Y K;  2ZFZ A;  3OPF A;  1F93 A;  3PO2 C;  2PPB A; 
#chains in the Genus database with same CATH homology
 2Y0S D;  4Y7N K;  2WB1 D;  5D4D A;  5TMF A;  4A3M K;  3HOX C;  3M3Y C;  3RZO K;  3S14 C;  4MEY A;  5M5X K;  3GTP C;  1I6H K;  3HOV C;  2NVX K;  4OIN A;  4Y7N C;  3GTO K;  4A3M C;  3RZO C;  1I6H C;  1Y1V K;  3DXJ A;  2VUM C;  2R93 K;  2NVX C;  1SFO K;  3GTO C;  4C2M K;  2BE5 A;  4XSX A;  4KMU A;  1Y1V C;  5C4X K;  3GTK K;  4OIR A;  3S2H K;  4Q5S A;  2R93 C;  1SFO C;  3I4M C;  4MEX A;  1IW7 A;  4MQ9 A;  2NVY K;  2PMZ D;  4C3I K;  3GTK C;  5C4X C;  3S17 K;  4Q4Z A;  4BXX K;  1TWA K;  2NVY C;  4G7O A;  5IYD K;  3S15 K;  4OIP A;  4A3L K;  3S17 C;  1I3Q K;  4YFN A;  2PA8 D;  1TWA C;  3PO3 C;  4BXX C;  4KN4 A;  2A68 A;  3FKI C;  5IYD C;  3HOZ C;  3GTJ K;  1R9T K;  1I3Q C;  1Y1W K;  4BBR K;  4BBS K;  1SMY A;  3K7A K;  4QJV A;  3GTJ C;  1R9T C;  3S1Q K;  4A3K K;  2CW0 A;  2E2J K;  4ZH4 A;  4A93 K;  4BBR C;  4BBS C;  4OIQ A;  3K7A C;  2A6E A;  3S1Q C;  3HOY K;  4C3J K;  2E2J C;  4A93 C;  4QJV B;  2E2H K;  3GTG K;  3HOY C;  2WAQ L;  4BY7 K;  2JA8 K;  4A3J K;  3H0G K;  3S2H C;  2R92 K;  4X6A K;  2E2H C;  1TWH K;  2JA7 K;  4YG2 A;  4BY7 C;  2JA8 C;  5IYC K;  3H0G C;  2A69 A;  2R92 C;  1I50 K;  4X6A C;  4QIW L;  3H3V L;  3S1R K;  1K83 K;  1TWH C;  2JA7 C;  1TWF K;  4YFK A;  3S15 C;  5IYC C;  2A6H A;  3GTL K;  2PMZ L;  4A3L C;  3S1R C;  1K83 C;  1TWF C;  3S16 K;  4LK1 A;  3GTL C;  3S1N K;  2JA6 K;  4AYB L;  1Y1W C;  1TWG K;  5M5W K;  3HOU K;  3S16 C;  4A3B K;  4A3G K;  3S1N C;  3HKZ L;  3S1M K;  4A3K C;  4A3I K;  2Y0S L;  5TMC A;  2WB1 L;  1HQM A;  1TWG C;  4A3B C;  4A3G C;  3HOW K;  4GZY A;  2YU9 K;  1TWC K;  3S1M C;  1XPP A;  4KN7 A;  4G7Z A;  1ZYR A;  4A3I C;  4YFX A;  3GTQ K;  1YNN A;  4JK1 A;  3GTP K;  3HOW C;  3GTG C;  5FLM K;  5C4J K;  2YU9 C;  1TWC C;  5C3E K;  3HOV K;  5C44 K;  4A3J C;  3GTQ C;  4XLP A;  2NVT K;  2E2I K;  5IP7 K;  3GTM K;  2VUM K;  4LK0 A;  5FLM C;  5C4J C;  2WAQ D;  5C3E C;  5C44 C;  4C3H K;  2B63 K;  2E2I C;  1WCM K;  2NVT C;  5IP9 K;  1I50 C;  5IP7 C;  3RZD K;  3GTM C;  2O5J A;  4A3F K;  4OIO A;  3M4O K;  3I4M K;  3S2D K;  4XLN A;  5M3M K;  2B63 C;  1WCM C;  3CQZ K;  5IP9 C;  3WOD A;  5M3F K;  3RZD C;  4QIW D;  3H3V D;  4A3D K;  4A3F C;  3M4O C;  2PA8 L;  4NOI A;  4A3C K;  4LLG A;  1BDF A;  5IYB K;  4G7H A;  3S2D C;  4A3E K;  3CQZ C;  2R7Z K;  2JA6 C;  2NVQ K;  1YNJ A;  4BY1 K;  3I4N K;  3HOU C;  4A3D C;  5M5Y K;  2JA5 K;  4A3C C;  5IYB C;  1I6V A;  5FJ8 K;  3PO2 K;  3PO3 K;  3FKI K;  4A3E C;  2R7Z C;  4Y52 K;  4AYB D;  4BY1 C;  2NVQ C;  4LJZ A;  4XSZ A;  2O5I A;  3HOZ K;  3M3Y K;  3HOX K;  2JA5 C;  3S14 K;  3I4N C;  3PO2 C;  4Y52 C;  3HKZ D;  3EQL A;  2PPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...