5C4JK

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c4jK00
4Y52K 3DXJA 4BBRK 4A3IC 2NVXC 2B63C 2NVTC 1I3QK 2JA5K 4MEXA 1WCMK 4XSXA 4BBRC 2JA6K 5IP9C 3PO3K 4QJVB 2NVTK 4XLNA 5IYCK 3PO2K 3GTPK 3CQZC 2VUMC 5IP9K 4LK1A 2WB1L 2O5IA 3PO2C 3PO3C 2JA7K 1TWAK 2A6EA 2E2IK 4YFXA 4AYBD 4OIRA 3RZOC 1TWFC 4A3MK 5M3MK 1TWAC 3HOYC 2YU9K 2JA8K 3GTQK 3GTOK 3S2HK 3GTMK 1I6HC 2CW0A 2NVYK 4ZH4A 4BBSC 5M5YK 2JA8C 5IYBC 4G7OA 3S1RK 4LK0A 1TWHK 3HOZK 4Q4ZA 2R92C 3FKIK 1YNNA 3GTLC 1TWHC 1BDFA 3I4MC 4A3EK 4A3CC 2R92K 1WCMC 2JA6C 3WODA 1Y1VK 3EQLA 1IW7A 1TWGC 3I4NC 2PMZL 5FJ8K 4A3IK 2NVXK 4A3JK 3H0GK 2E2JK 2E2IC 3GTKC 3RZOK 2PA8D 4A3KC 1TWFK 4A3MC 2R7ZK 1R9TK 2PMZD 3M3YK 2WAQL 4YFKA 3GTKK 3CQZK 2VUMK 3S2HC 5IYDK 1I6HK 5FLMK 5C3EK 4KMUA 5C4JK 3M4OK 4OINA 4A3LK 4A3BC 2R93C 4A3DC 3GTMC 4YFNA 2NVYC 1Y1WK 4NOIA 1I50K 2A69A 2Y0SD 4A3FK 1SFOK 4BBSK 4C3JK 1I6VA 4QJVA 2NVQK 4Y52C 1Y1WC 5C44K 5M5WK 1SFOC 4A93C 3HOZC 1Y1VC 1I3QC 3S1NC 3HKZD 4X6AK 2Y0SL 3S16C 5C4XK 3S1MC 1ZYRA 4G7ZA 4A3JC 4QIWD 2E2JC 3H3VD 3GTGC 5TMFA 3S1MK 5C4XC 4C3HK 2E2HK 1HQMA 4LJZA 3HKZL 4A3GK 1TWGK 1YNJA 4OIQA 3M3YC 4XLPA 1TWCC 2E2HC 4QIWL 4A3GC 3HOUC 3H3VL 5FLMC 3K7AK 5C4JC 4C3IK 3GTQC 3HOUK 3GTJK 4BY7K 2R7ZC 3K7AC 2WB1D 2A6HA 4MEYA 3HOWC 4BY1C 4Q5SA 3S14K 3S1RC 2BE5A 4AYBL 4KN7A 3HOVC 3FKIC 4Y7NC 3GTLK 5IP7C 1K83K 4G7HA 4BXXC 4C2MK 4JK1A 4A3DK 3S1QC 2PPBA 4X6AC 5IP7K 2A68A 4GZYA 4BXXK 3S17C 2NVQC 3S15C 3S1QK 5C44C 4A93K 3I4MK 3I4NK 3S15K 3S17K 4XSZA 5IYCC 4OIPA 3S16K 1TWCK 2WAQD 2B63K 4MQ9A 4YG2A 4A3KK 5M5XK 2JA5C 2JA7C 3GTGK 1XPPA 3S2DK 4LLGA 3H0GC 5IYDC 5D4DA 3GTJC 3HOYK 5C3EC 3GTPC 2YU9C 4BY7C 3S2DC 3HOXK 3HOWK 4OIOA 3S14C 1R9TC 3M4OC 4A3LC 2PA8L 2R93K 3HOXC 5IYBK 1SMYA 3HOVK 4Y7NK 1I50C 5TMCA 4KN4A 5M3FK 3GTOC 4BY1K 3RZDK 4A3BK 2O5JA 4A3EC 4A3CK 3S1NK 3RZDC 4A3FC 1K83C
chains in the Genus database with same CATH superfamily
4BBRK 1F93A 2NVXC 3GDZA 2P5MA 1I3QK 2YU9A 3PO3K 4QJVB 4LK1A 3T00A 4AH6A 4OIRA 1B4AA 4KMHA 4WJ3M 3GTQK 3GTOK 1I6HC 3Q3QA 3GTPA 1USMA 5HL8A 5IYBC 4KB4A 1EH1A 1O26A 3AQOA 3GTLC 1TWHC 4P9SA 4GFQA 4A3CC 1XXBA 3GTKA 3IPJA 3T02A 2E2HA 3EQLA 1BGWA 4PAAA 5FJ8K 1TWHA 1ZVUA 3H0GK 4LOWA 2E2JK 3GTKC 2PA8D 1I50A 1WOOA 2WAQL 4KM9A 4G0UA 5C3EK 3LPXA 1K83A 2NVYC 4A3FK 2CFAB 5C44K 5M5WK 4XCHA 1EI6A 1I3QC 4A3JC 4GTAA 4GTDA 4C3HK 4PABA 1O2BA 1TWCC 1YX2A 3LAPA 1EQRA 3GEIA 3HOUC 2FQTA 1F9NA 3K7AK 5FLMC 5C4JC 2ZUEA 3QX3A 2R7ZC 2WB1D 3ADAC 2A6HA 4Q5SA 3AH5A 3OEPA 3HOWC 2BE5A 4AYBL 2Y3PA 3FKIC 4BXXC 1KQ4A 4A3DK 3GTGA 3S1QK 4A93K 1O29A 4DDQA 4FZBA 1TWCK 1VRQC 3GTGK 3CAGA 1WOPA 3GTJC 4WILA 3GTPC 2YU9C 2D6FC 2CFAA 1J6VA 4OIOA 2ZUFA 3S14C 2ZFZA 3HOXC 5IYBK 3GTJA 5TMCA 3N3YA 3RZDK 1WORA 4A3FC 1JQWA 4A3IC 3L4JA 2B63C 1WCMK 4XSXA 4BBRC 3FHZA 2JA6K 3VA7A 4XLNA 1R9TA 1WQHA 4C3IC 3PO3C 2O5IA 3PO2C 2JA7K 5JFEA 5JVOA 4YFXA 3AD8C 3RZOC 4A3MK 1VGXA 3HOYC 1TWAC 1USOA 2YU9K 3GTMK 3A8IA 3BP3A 5M5YK 3V4GA 4LK0A 3S1RK 1TWHK 3L4KA 1IBAA 1YNNA 3GTOA 4KM8A 2NVYA 3CQZA 2JA6C 2GSNA 3WODA 2VUMA 1DD5A 2XCOA 1TWGC 4A3IK 4GTFA 1O27A 3A8KA 1I3QA 3M3YK 3FOFA 1XZPB 5C4JK 3T01A 2V6UA 3M4OK 4OINA 1Y1WK 1TWFA 2GSOA 4NOIA 3LAJA 1JOEA 2R7ZA 3TFIA 4QJVA 1L0WA 4Y52C 2NVQK 2P8TA 3TFHA 1Y1VC 1DCOA 4GTCA 1WSVA 2Y0SL 4X6AK 1ZYRA 4C3HC 4G7ZA 2R92A 1WQGA 5E68A 5TMFA 3GTGC 1BJTA 3S1MK 2E2HK 4A3GK 3HKZL 1YNJA 4OIQA 3M3YC 4XLPA 4QIWL 3AD9C 3H3VL 2R93A 4C3IK 3GTQC 2GAGC 4BY7K 1O2AA 1F7VA 3ERED 1B4BA 4KATA 3HOVC 1UV7A 4C45A 2B63A 5CHPA 3A8JA 3G4AA 2EBBA 5L46A 2PPBA 5IP7K 3S15C 2NVQC 2XCQA 3I4NK 2W7VA 3S17K 5IYCC 1VLOA 4MQ9A 4YG2A 1G51A 3AD7C 1TWAA 3AQPA 3S0XA 4LLGA 1J98A 3HOYK 3S2DC 1WSRA 4KMAA 4GT9A 1R9TC 3M4OC 2PA8L 3SZYA 3HOVK 3GTOC 1EFWA 3OPFA 1ISEA 2JA6A 1PJ6A 4A3BK 4A3EC 3S1NK 4G0WA 4ILDA 2JA7A 1RU0A 1ZBSA 1INNA 1ZXOA 3GIRA 5EGEA 3GSIA 2JA5K 4MEXA 3OREA 2NVTK 3GTPK 5TJ3A 3CQZC 2VUMC 5IP9K 4KC6A 2A6EA 4KASA 3FKIA 1TWFC 5M3MK 2JA5A 4P5AA 4BLAA 3S2HK 2NVYK 1DCHA 1O2FB 1Y1VA 4G7OA 1BS2A 3HOZK 4Q4ZA 2R92C 1IL2A 3I4MC 1BDFA 4A3EK 2R92K 1WCMC 1IW7A 2NVXK 2E2IC 1WCMA 3GEHA 5IOTA 4WJ4A 4A3KC 1IQ0A 1TWFK 2R7ZK 1R9TK 2PMZD 5IOQA 3GTKK 3CQZK 2VUMK 3S2HC 4P5BA 5FLMK 4M1XA 2E2IA 4GTLA 1EK8A 3H0GA 3TFJA 2R93C 3GTQA 2V6SA 4FM9A 3GTMC 1DCPA 2Y0SD 3MMLB 4C3JK 1Y1WC 1JVIA 1WQFA 4LR2A 3S1NC 3HKZD 4KARA 5C4XK 5IOSA 4QIWD 3H3VD 5C4XC 1HQMA 2XCRB 3HOUK 4MEYA 3S14K 3S1RC 4C3JC 4Y7NC 3GTLK 4G7HA 1VJEA 4C2MK 1O25A 4X6AC 3TTGA 4C2MC 3S17C 4BKWA 3S15K 1ZQ1C 4OIPA 1J6WA 2RH6A 2WAQD 3GTLA 4A3KK 2JA5C 2JA7C 2V6TA 1XPPA 3G4CA 5D4DA 4RMFA 4BY7C 3JSTA 4A3LC 1SMYA 1XXCA 1I50C 4KN4A 3FOEA 1X31C 3RZDC 4O2DA 1V5VA 1K83C 4Y52K 3DXJA 4KAWX 2NVTC 5IP9C 3PO2K 5IYCK 2WB1L 3NUHA 4BLBA 1TWAK 1WIHA 2E2IK 2PHCB 4AYBD 1PJ7A 2JA8K 1Y1WA 2CW0A 4ZH4A 4BBSC 2JA8C 4KMDA 2NVXA 1XZPA 3FKIK 2FQOA 4GTBA 1F7UA 2KWAA 3BUEA 1GE9A 1Y1VK 3I4NC 2PMZL 4LQYA 4A3JK 5EGHA 3RZOK 4G0VA 4A3MC 4YFKA 2JH3A 5IYDK 1I6HK 4KMUA 3SZZA 4A3LK 4A3BC 4A3DC 4YFNA 4BBSK 1SFOK 1I50K 2A69A 5IORA 1I6VA 4A93C 4KDDA 1SFOC 2GAHC 3HOZC 1XZQB 3S16C 3S1MC 1IE0A 1XZQA 2E2JC 1SFOA 1O28A 4LJZA 1TWGK 1O24A 2E2HC 1VH2A 4A3GC 1J6XA 2RGRA 3N0BA 4J3NA 1C0AA 3GTJK 1PJ5A 3GEEA 3K7AC 5CJ9A 1YCLA 1XXAA 4BY1C 4KN7A 5IP7C 1K83K 4JK1A 3S1QC 1HI9A 2A68A 4BXXK 4GZYA 3BP8C 3HXAA 5C44C 3I4MK 1WOSA 4KB2A 4XSZA 3S16K 2B63K 5M5XK 3N0CA 3S2DK 3H0GC 5IYDC 1TWGA 5C3EC 3HOXK 3GTMA 3HOWK 1AB4A 2GSUA 2R93K 1TWCA 4Y7NK 5M3FK 1IS1A 4BY1K 2O5JA 4A3CK 4GTEA
chains in the Genus database with same CATH topology
4Y52K 3DXJA 4BBRK 4A3IC 2NVXC 2B63C 2NVTC 1I3QK 2JA5K 4MEXA 1WCMK 4XSXA 4BBRC 2JA6K 5IP9C 3PO3K 4QJVB 2NVTK 4XLNA 5IYCK 3PO2K 3GTPK 3CQZC 2VUMC 5IP9K 4LK1A 2WB1L 2O5IA 3PO2C 3PO3C 2JA7K 1TWAK 2A6EA 2E2IK 4YFXA 4AYBD 4OIRA 3RZOC 1TWFC 4A3MK 5M3MK 1TWAC 3HOYC 2YU9K 2JA8K 3GTQK 3GTOK 3S2HK 3GTMK 1I6HC 2CW0A 2NVYK 4ZH4A 4BBSC 5M5YK 2JA8C 5IYBC 4G7OA 3S1RK 4LK0A 1TWHK 3HOZK 4Q4ZA 2R92C 3FKIK 1YNNA 3GTLC 1TWHC 1BDFA 3I4MC 4A3EK 4A3CC 2R92K 1WCMC 2JA6C 3WODA 1Y1VK 3EQLA 1IW7A 1TWGC 3I4NC 2PMZL 5FJ8K 4A3IK 2NVXK 4A3JK 3H0GK 2E2JK 2E2IC 3GTKC 3RZOK 2PA8D 4A3KC 1TWFK 4A3MC 2R7ZK 1R9TK 2PMZD 3M3YK 2WAQL 4YFKA 3GTKK 3CQZK 2VUMK 3S2HC 5IYDK 1I6HK 5FLMK 5C3EK 4KMUA 5C4JK 3M4OK 4OINA 4A3LK 4A3BC 2R93C 4A3DC 3GTMC 4YFNA 2NVYC 1Y1WK 4NOIA 1I50K 2A69A 2Y0SD 4A3FK 1SFOK 4BBSK 4C3JK 1I6VA 4QJVA 2NVQK 4Y52C 1Y1WC 5C44K 5M5WK 1SFOC 4A93C 3HOZC 1Y1VC 1I3QC 3S1NC 3HKZD 4X6AK 2Y0SL 3S16C 5C4XK 3S1MC 1ZYRA 4G7ZA 4A3JC 4QIWD 2E2JC 3H3VD 3GTGC 5TMFA 3S1MK 5C4XC 4C3HK 2E2HK 1HQMA 4LJZA 3HKZL 4A3GK 1TWGK 1YNJA 4OIQA 3M3YC 4XLPA 1TWCC 2E2HC 4QIWL 4A3GC 3HOUC 3H3VL 5FLMC 3K7AK 5C4JC 4C3IK 3GTQC 3HOUK 3GTJK 4BY7K 2R7ZC 3K7AC 2WB1D 2A6HA 4MEYA 3HOWC 4BY1C 4Q5SA 3S14K 3S1RC 2BE5A 4AYBL 4KN7A 3HOVC 3FKIC 4Y7NC 3GTLK 5IP7C 1K83K 4G7HA 4BXXC 4C2MK 4JK1A 4A3DK 3S1QC 2PPBA 4X6AC 5IP7K 2A68A 4GZYA 4BXXK 3S17C 2NVQC 3S15C 3S1QK 5C44C 4A93K 3I4MK 3I4NK 3S15K 3S17K 4XSZA 5IYCC 4OIPA 3S16K 1TWCK 2WAQD 2B63K 4MQ9A 4YG2A 4A3KK 5M5XK 2JA5C 2JA7C 3GTGK 1XPPA 3S2DK 4LLGA 3H0GC 5IYDC 5D4DA 3GTJC 3HOYK 5C3EC 3GTPC 2YU9C 4BY7C 3S2DC 3HOXK 3HOWK 4OIOA 3S14C 1R9TC 3M4OC 4A3LC 2PA8L 2R93K 3HOXC 5IYBK 1SMYA 3HOVK 4Y7NK 1I50C 5TMCA 4KN4A 5M3FK 3GTOC 4BY1K 3RZDK 4A3BK 2O5JA 4A3EC 4A3CK 3S1NK 3RZDC 4A3FC 1K83C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y52 K;  3DXJ A;  4BBR K;  4A3I C;  2NVX C;  2B63 C;  2NVT C;  1I3Q K;  2JA5 K;  4MEX A;  1WCM K;  4XSX A;  4BBR C;  2JA6 K;  5IP9 C;  3PO3 K;  4QJV B;  2NVT K;  4XLN A;  5IYC K;  3PO2 K;  3GTP K;  3CQZ C;  2VUM C;  5IP9 K;  4LK1 A;  2WB1 L;  2O5I A;  3PO2 C;  3PO3 C;  2JA7 K;  1TWA K;  2A6E A;  2E2I K;  4YFX A;  4AYB D;  4OIR A;  3RZO C;  1TWF C;  4A3M K;  5M3M K;  1TWA C;  3HOY C;  2YU9 K;  2JA8 K;  3GTQ K;  3GTO K;  3S2H K;  3GTM K;  1I6H C;  2CW0 A;  2NVY K;  4ZH4 A;  4BBS C;  5M5Y K;  2JA8 C;  5IYB C;  4G7O A;  3S1R K;  4LK0 A;  1TWH K;  3HOZ K;  4Q4Z A;  2R92 C;  3FKI K;  1YNN A;  3GTL C;  1TWH C;  1BDF A;  3I4M C;  4A3E K;  4A3C C;  2R92 K;  1WCM C;  2JA6 C;  3WOD A;  1Y1V K;  3EQL A;  1IW7 A;  1TWG C;  3I4N C;  2PMZ L;  5FJ8 K;  4A3I K;  2NVX K;  4A3J K;  3H0G K;  2E2J K;  2E2I C;  3GTK C;  3RZO K;  2PA8 D;  4A3K C;  1TWF K;  4A3M C;  2R7Z K;  1R9T K;  2PMZ D;  3M3Y K;  2WAQ L;  4YFK A;  3GTK K;  3CQZ K;  2VUM K;  3S2H C;  5IYD K;  1I6H K;  5FLM K;  5C3E K;  4KMU A;  5C4J K;  3M4O K;  4OIN A;  4A3L K;  4A3B C;  2R93 C;  4A3D C;  3GTM C;  4YFN A;  2NVY C;  1Y1W K;  4NOI A;  1I50 K;  2A69 A;  2Y0S D;  4A3F K;  1SFO K;  4BBS K;  4C3J K;  1I6V A;  4QJV A;  2NVQ K;  4Y52 C;  1Y1W C;  5C44 K;  5M5W K;  1SFO C;  4A93 C;  3HOZ C;  1Y1V C;  1I3Q C;  3S1N C;  3HKZ D;  4X6A K;  2Y0S L;  3S16 C;  5C4X K;  3S1M C;  1ZYR A;  4G7Z A;  4A3J C;  4QIW D;  2E2J C;  3H3V D;  3GTG C;  5TMF A;  3S1M K;  5C4X C;  4C3H K;  2E2H K;  1HQM A;  4LJZ A;  3HKZ L;  4A3G K;  1TWG K;  1YNJ A;  4OIQ A;  3M3Y C;  4XLP A;  1TWC C;  2E2H C;  4QIW L;  4A3G C;  3HOU C;  3H3V L;  5FLM C;  3K7A K;  5C4J C;  4C3I K;  3GTQ C;  3HOU K;  3GTJ K;  4BY7 K;  2R7Z C;  3K7A C;  2WB1 D;  2A6H A;  4MEY A;  3HOW C;  4BY1 C;  4Q5S A;  3S14 K;  3S1R C;  2BE5 A;  4AYB L;  4KN7 A;  3HOV C;  3FKI C;  4Y7N C;  3GTL K;  5IP7 C;  1K83 K;  4G7H A;  4BXX C;  4C2M K;  4JK1 A;  4A3D K;  3S1Q C;  2PPB A;  4X6A C;  5IP7 K;  2A68 A;  4GZY A;  4BXX K;  3S17 C;  2NVQ C;  3S15 C;  3S1Q K;  5C44 C;  4A93 K;  3I4M K;  3I4N K;  3S15 K;  3S17 K;  4XSZ A;  5IYC C;  4OIP A;  3S16 K;  1TWC K;  2WAQ D;  2B63 K;  4MQ9 A;  4YG2 A;  4A3K K;  5M5X K;  2JA5 C;  2JA7 C;  3GTG K;  1XPP A;  3S2D K;  4LLG A;  3H0G C;  5IYD C;  5D4D A;  3GTJ C;  3HOY K;  5C3E C;  3GTP C;  2YU9 C;  4BY7 C;  3S2D C;  3HOX K;  3HOW K;  4OIO A;  3S14 C;  1R9T C;  3M4O C;  4A3L C;  2PA8 L;  2R93 K;  3HOX C;  5IYB K;  1SMY A;  3HOV K;  4Y7N K;  1I50 C;  5TMC A;  4KN4 A;  5M3F K;  3GTO C;  4BY1 K;  3RZD K;  4A3B K;  2O5J A;  4A3E C;  4A3C K;  3S1N K;  3RZD C;  4A3F C;  1K83 C; 
#chains in the Genus database with same CATH topology
 4BBR K;  1F93 A;  2NVX C;  3GDZ A;  2P5M A;  1I3Q K;  2YU9 A;  3PO3 K;  4QJV B;  4LK1 A;  3T00 A;  4AH6 A;  4OIR A;  1B4A A;  4KMH A;  4WJ3 M;  3GTQ K;  3GTO K;  1I6H C;  3Q3Q A;  3GTP A;  1USM A;  5HL8 A;  5IYB C;  4KB4 A;  1EH1 A;  1O26 A;  3AQO A;  3GTL C;  1TWH C;  4P9S A;  4GFQ A;  4A3C C;  1XXB A;  3GTK A;  3IPJ A;  3T02 A;  2E2H A;  3EQL A;  1BGW A;  4PAA A;  5FJ8 K;  1TWH A;  1ZVU A;  3H0G K;  4LOW A;  2E2J K;  3GTK C;  2PA8 D;  1I50 A;  1WOO A;  2WAQ L;  4KM9 A;  4G0U A;  5C3E K;  3LPX A;  1K83 A;  2NVY C;  4A3F K;  2CFA B;  5C44 K;  5M5W K;  4XCH A;  1EI6 A;  1I3Q C;  4A3J C;  4GTA A;  4GTD A;  4C3H K;  4PAB A;  1O2B A;  1TWC C;  1YX2 A;  3LAP A;  1EQR A;  3GEI A;  3HOU C;  2FQT A;  1F9N A;  3K7A K;  5FLM C;  5C4J C;  2ZUE A;  3QX3 A;  2R7Z C;  2WB1 D;  3ADA C;  2A6H A;  4Q5S A;  3AH5 A;  3OEP A;  3HOW C;  2BE5 A;  4AYB L;  2Y3P A;  3FKI C;  4BXX C;  1KQ4 A;  4A3D K;  3GTG A;  3S1Q K;  4A93 K;  1O29 A;  4DDQ A;  4FZB A;  1TWC K;  1VRQ C;  3GTG K;  3CAG A;  1WOP A;  3GTJ C;  4WIL A;  3GTP C;  2YU9 C;  2D6F C;  2CFA A;  1J6V A;  4OIO A;  2ZUF A;  3S14 C;  2ZFZ A;  3HOX C;  5IYB K;  3GTJ A;  5TMC A;  3N3Y A;  3RZD K;  1WOR A;  4A3F C;  1JQW A;  4A3I C;  3L4J A;  2B63 C;  1WCM K;  4XSX A;  4BBR C;  3FHZ A;  2JA6 K;  3VA7 A;  4XLN A;  1R9T A;  1WQH A;  4C3I C;  3PO3 C;  2O5I A;  3PO2 C;  2JA7 K;  5JFE A;  5JVO A;  4YFX A;  3AD8 C;  3RZO C;  4A3M K;  1VGX A;  3HOY C;  1TWA C;  1USO A;  2YU9 K;  3GTM K;  3A8I A;  3BP3 A;  5M5Y K;  3V4G A;  4LK0 A;  3S1R K;  1TWH K;  3L4K A;  1IBA A;  1YNN A;  3GTO A;  4KM8 A;  2NVY A;  3CQZ A;  2JA6 C;  2GSN A;  3WOD A;  2VUM A;  1DD5 A;  2XCO A;  1TWG C;  4A3I K;  4GTF A;  1O27 A;  3A8K A;  1I3Q A;  3M3Y K;  3FOF A;  1XZP B;  5C4J K;  3T01 A;  2V6U A;  3M4O K;  4OIN A;  1Y1W K;  1TWF A;  2GSO A;  4NOI A;  3LAJ A;  1JOE A;  2R7Z A;  3TFI A;  4QJV A;  1L0W A;  4Y52 C;  2NVQ K;  2P8T A;  3TFH A;  1Y1V C;  1DCO A;  4GTC A;  1WSV A;  2Y0S L;  4X6A K;  1ZYR A;  4C3H C;  4G7Z A;  2R92 A;  1WQG A;  5E68 A;  5TMF A;  3GTG C;  1BJT A;  3S1M K;  2E2H K;  4A3G K;  3HKZ L;  1YNJ A;  4OIQ A;  3M3Y C;  4XLP A;  4QIW L;  3AD9 C;  3H3V L;  2R93 A;  4C3I K;  3GTQ C;  2GAG C;  4BY7 K;  1O2A A;  1F7V A;  3ERE D;  1B4B A;  4KAT A;  3HOV C;  1UV7 A;  4C45 A;  2B63 A;  5CHP A;  3A8J A;  3G4A A;  2EBB A;  5L46 A;  2PPB A;  5IP7 K;  3S15 C;  2NVQ C;  2XCQ A;  3I4N K;  2W7V A;  3S17 K;  5IYC C;  1VLO A;  4MQ9 A;  4YG2 A;  1G51 A;  3AD7 C;  1TWA A;  3AQP A;  3S0X A;  4LLG A;  1J98 A;  3HOY K;  3S2D C;  1WSR A;  4KMA A;  4GT9 A;  1R9T C;  3M4O C;  2PA8 L;  3SZY A;  3HOV K;  3GTO C;  1EFW A;  3OPF A;  1ISE A;  2JA6 A;  1PJ6 A;  4A3B K;  4A3E C;  3S1N K;  4G0W A;  4ILD A;  2JA7 A;  1RU0 A;  1ZBS A;  1INN A;  1ZXO A;  3GIR A;  5EGE A;  3GSI A;  2JA5 K;  4MEX A;  3ORE A;  2NVT K;  3GTP K;  5TJ3 A;  3CQZ C;  2VUM C;  5IP9 K;  4KC6 A;  2A6E A;  4KAS A;  3FKI A;  1TWF C;  5M3M K;  2JA5 A;  4P5A A;  4BLA A;  3S2H K;  2NVY K;  1DCH A;  1O2F B;  1Y1V A;  4G7O A;  1BS2 A;  3HOZ K;  4Q4Z A;  2R92 C;  1IL2 A;  3I4M C;  1BDF A;  4A3E K;  2R92 K;  1WCM C;  1IW7 A;  2NVX K;  2E2I C;  1WCM A;  3GEH A;  5IOT A;  4WJ4 A;  4A3K C;  1IQ0 A;  1TWF K;  2R7Z K;  1R9T K;  2PMZ D;  5IOQ A;  3GTK K;  3CQZ K;  2VUM K;  3S2H C;  4P5B A;  5FLM K;  4M1X A;  2E2I A;  4GTL A;  1EK8 A;  3H0G A;  3TFJ A;  2R93 C;  3GTQ A;  2V6S A;  4FM9 A;  3GTM C;  1DCP A;  2Y0S D;  3MML B;  4C3J K;  1Y1W C;  1JVI A;  1WQF A;  4LR2 A;  3S1N C;  3HKZ D;  4KAR A;  5C4X K;  5IOS A;  4QIW D;  3H3V D;  5C4X C;  1HQM A;  2XCR B;  3HOU K;  4MEY A;  3S14 K;  3S1R C;  4C3J C;  4Y7N C;  3GTL K;  4G7H A;  1VJE A;  4C2M K;  1O25 A;  4X6A C;  3TTG A;  4C2M C;  3S17 C;  4BKW A;  3S15 K;  1ZQ1 C;  4OIP A;  1J6W A;  2RH6 A;  2WAQ D;  3GTL A;  4A3K K;  2JA5 C;  2JA7 C;  2V6T A;  1XPP A;  3G4C A;  5D4D A;  4RMF A;  4BY7 C;  3JST A;  4A3L C;  1SMY A;  1XXC A;  1I50 C;  4KN4 A;  3FOE A;  1X31 C;  3RZD C;  4O2D A;  1V5V A;  1K83 C;  4Y52 K;  3DXJ A;  4KAW X;  2NVT C;  5IP9 C;  3PO2 K;  5IYC K;  2WB1 L;  3NUH A;  4BLB A;  1TWA K;  1WIH A;  2E2I K;  2PHC B;  4AYB D;  1PJ7 A;  2JA8 K;  1Y1W A;  2CW0 A;  4ZH4 A;  4BBS C;  2JA8 C;  4KMD A;  2NVX A;  1XZP A;  3FKI K;  2FQO A;  4GTB A;  1F7U A;  2KWA A;  3BUE A;  1GE9 A;  1Y1V K;  3I4N C;  2PMZ L;  4LQY A;  4A3J K;  5EGH A;  3RZO K;  4G0V A;  4A3M C;  4YFK A;  2JH3 A;  5IYD K;  1I6H K;  4KMU A;  3SZZ A;  4A3L K;  4A3B C;  4A3D C;  4YFN A;  4BBS K;  1SFO K;  1I50 K;  2A69 A;  5IOR A;  1I6V A;  4A93 C;  4KDD A;  1SFO C;  2GAH C;  3HOZ C;  1XZQ B;  3S16 C;  3S1M C;  1IE0 A;  1XZQ A;  2E2J C;  1SFO A;  1O28 A;  4LJZ A;  1TWG K;  1O24 A;  2E2H C;  1VH2 A;  4A3G C;  1J6X A;  2RGR A;  3N0B A;  4J3N A;  1C0A A;  3GTJ K;  1PJ5 A;  3GEE A;  3K7A C;  5CJ9 A;  1YCL A;  1XXA A;  4BY1 C;  4KN7 A;  5IP7 C;  1K83 K;  4JK1 A;  3S1Q C;  1HI9 A;  2A68 A;  4BXX K;  4GZY A;  3BP8 C;  3HXA A;  5C44 C;  3I4M K;  1WOS A;  4KB2 A;  4XSZ A;  3S16 K;  2B63 K;  5M5X K;  3N0C A;  3S2D K;  3H0G C;  5IYD C;  1TWG A;  5C3E C;  3HOX K;  3GTM A;  3HOW K;  1AB4 A;  2GSU A;  2R93 K;  1TWC A;  4Y7N K;  5M3F K;  1IS1 A;  4BY1 K;  2O5J A;  4A3C K;  4GTE A; 
#chains in the Genus database with same CATH homology
 4Y52 K;  3DXJ A;  4BBR K;  4A3I C;  2NVX C;  2B63 C;  2NVT C;  1I3Q K;  2JA5 K;  4MEX A;  1WCM K;  4XSX A;  4BBR C;  2JA6 K;  5IP9 C;  3PO3 K;  4QJV B;  2NVT K;  4XLN A;  5IYC K;  3PO2 K;  3GTP K;  3CQZ C;  2VUM C;  5IP9 K;  4LK1 A;  2WB1 L;  2O5I A;  3PO2 C;  3PO3 C;  2JA7 K;  1TWA K;  2A6E A;  2E2I K;  4YFX A;  4AYB D;  4OIR A;  3RZO C;  1TWF C;  4A3M K;  5M3M K;  1TWA C;  3HOY C;  2YU9 K;  2JA8 K;  3GTQ K;  3GTO K;  3S2H K;  3GTM K;  1I6H C;  2CW0 A;  2NVY K;  4ZH4 A;  4BBS C;  5M5Y K;  2JA8 C;  5IYB C;  4G7O A;  3S1R K;  4LK0 A;  1TWH K;  3HOZ K;  4Q4Z A;  2R92 C;  3FKI K;  1YNN A;  3GTL C;  1TWH C;  1BDF A;  3I4M C;  4A3E K;  4A3C C;  2R92 K;  1WCM C;  2JA6 C;  3WOD A;  1Y1V K;  3EQL A;  1IW7 A;  1TWG C;  3I4N C;  2PMZ L;  5FJ8 K;  4A3I K;  2NVX K;  4A3J K;  3H0G K;  2E2J K;  2E2I C;  3GTK C;  3RZO K;  2PA8 D;  4A3K C;  1TWF K;  4A3M C;  2R7Z K;  1R9T K;  2PMZ D;  3M3Y K;  2WAQ L;  4YFK A;  3GTK K;  3CQZ K;  2VUM K;  3S2H C;  5IYD K;  1I6H K;  5FLM K;  5C3E K;  4KMU A;  5C4J K;  3M4O K;  4OIN A;  4A3L K;  4A3B C;  2R93 C;  4A3D C;  3GTM C;  4YFN A;  2NVY C;  1Y1W K;  4NOI A;  1I50 K;  2A69 A;  2Y0S D;  4A3F K;  1SFO K;  4BBS K;  4C3J K;  1I6V A;  4QJV A;  2NVQ K;  4Y52 C;  1Y1W C;  5C44 K;  5M5W K;  1SFO C;  4A93 C;  3HOZ C;  1Y1V C;  1I3Q C;  3S1N C;  3HKZ D;  4X6A K;  2Y0S L;  3S16 C;  5C4X K;  3S1M C;  1ZYR A;  4G7Z A;  4A3J C;  4QIW D;  2E2J C;  3H3V D;  3GTG C;  5TMF A;  3S1M K;  5C4X C;  4C3H K;  2E2H K;  1HQM A;  4LJZ A;  3HKZ L;  4A3G K;  1TWG K;  1YNJ A;  4OIQ A;  3M3Y C;  4XLP A;  1TWC C;  2E2H C;  4QIW L;  4A3G C;  3HOU C;  3H3V L;  5FLM C;  3K7A K;  5C4J C;  4C3I K;  3GTQ C;  3HOU K;  3GTJ K;  4BY7 K;  2R7Z C;  3K7A C;  2WB1 D;  2A6H A;  4MEY A;  3HOW C;  4BY1 C;  4Q5S A;  3S14 K;  3S1R C;  2BE5 A;  4AYB L;  4KN7 A;  3HOV C;  3FKI C;  4Y7N C;  3GTL K;  5IP7 C;  1K83 K;  4G7H A;  4BXX C;  4C2M K;  4JK1 A;  4A3D K;  3S1Q C;  2PPB A;  4X6A C;  5IP7 K;  2A68 A;  4GZY A;  4BXX K;  3S17 C;  2NVQ C;  3S15 C;  3S1Q K;  5C44 C;  4A93 K;  3I4M K;  3I4N K;  3S15 K;  3S17 K;  4XSZ A;  5IYC C;  4OIP A;  3S16 K;  1TWC K;  2WAQ D;  2B63 K;  4MQ9 A;  4YG2 A;  4A3K K;  5M5X K;  2JA5 C;  2JA7 C;  3GTG K;  1XPP A;  3S2D K;  4LLG A;  3H0G C;  5IYD C;  5D4D A;  3GTJ C;  3HOY K;  5C3E C;  3GTP C;  2YU9 C;  4BY7 C;  3S2D C;  3HOX K;  3HOW K;  4OIO A;  3S14 C;  1R9T C;  3M4O C;  4A3L C;  2PA8 L;  2R93 K;  3HOX C;  5IYB K;  1SMY A;  3HOV K;  4Y7N K;  1I50 C;  5TMC A;  4KN4 A;  5M3F K;  3GTO C;  4BY1 K;  3RZD K;  4A3B K;  2O5J A;  4A3E C;  4A3C K;  3S1N K;  3RZD C;  4A3F C;  1K83 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...