5C4JK

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c4jK00
3GTLC 2WB1L 3S1MK 5C4XC 5FJ8K 3GTLK 4AYBL 5C4XK 2NVQK 4X6AC 4A3JC 2O5IA 1HQMA 4BBRC 3GTKC 5C4JC 3M4OK 4X6AK 3GTJK 2VUMC 3I4MK 3GTPC 4BBRK 4XLPA 4A93K 4JK1A 2R92K 2VUMK 1R9TK 3K7AC 3HOXC 5IP9C 3HOZC 3HOVC 4GZYA 5TMCA 3EQLA 3RZDC 3S14K 3S16C 2JA6C 3RZDK 3S16K 2NVYK 4C3JK 1ZYRA 4OIOA 5M5WK 5IYBC 2E2HC 2E2JC 2JA6K 3S1QC 1IW7A 4G7OA 5C3EK 5IP7C 2A69A 2E2JK 2CW0A 3M3YC 3M4OC 4A3KC 1TWAC 2JA8K 3PO3C 4A3FC 3GTOC 2E2IC 2A6HA 3S15C 4QJVB 1YNJA 4BBSK 3HKZD 1TWAK 4A3FK 1WCMK 3GTOK 1TWHC 3GTQK 3S15K 3S2HK 4BY1C 2A68A 3FKIC 1TWHK 1I6HC 4Y52C 4A3DC 4A3LC 4Y52K 4Y7NC 4A3DK 3S17C 2BE5A 4Y7NK 5M5YK 4A3JK 2NVXC 2R7ZC 3GTMC 4YFXA 3GTKK 1SMYA 5C4JK 3HOUC 1K83C 4C3HK 4XSZA 3GTPK 1I3QC 2NVTC 2A6EA 2WB1D 4LK0A 4YG2A 5TMFA 1K83K 2O5JA 2NVTK 3K7AK 3HOXK 5IP9K 4YFKA 4XLNA 2PPBA 3HOVK 3HOZK 5IYDC 4G7HA 4MQ9A 5M3MK 4A3EC 2WAQD 4KN4A 5IYDK 4A3MC 3S1QK 2E2HK 2YU9C 5IYBK 4C2MK 5IYCC 4A3CC 3S1NC 5IP7K 3RZOC 4A3BC 4A3CK 3PO2C 3M3YK 5FLMC 4A3KK 2PMZL 3S1RC 3PO3K 4A3BK 2Y0SD 2E2IK 1Y1WC 4BXXC 4MEYA 1Y1WK 4KMUA 4NOIA 1TWCC 4BY1K 2R93C 3FKIK 1I6HK 4A3GC 4C3IK 4QIWD 1BDFA 3H3VL 1Y1VC 4A3LK 4XSXA 1I50C 4A3IC 1XPPA 2PA8D 4OINA 3S17K 2JA7C 5D4DA 3HKZL 2NVXK 4ZH4A 2JA7K 3GTMK 4LLGA 2R7ZK 3HOUK 3S2DC 1YNNA 4LJZA 4MEXA 3HOWC 1I3QK 4Q5SA 4AYBD 5M3FK 1TWFC 2B63C 4QJVA 4OIRA 4OIPA 3HOYC 3CQZC 4KN7A 4A3EK 3HOYK 3S1MC 4A3MK 2YU9K 5IYCK 3S1NK 2NVQC 3RZOK 3PO2K 3DXJA 5FLMK 3GTJC 3I4MC 3S1RK 5M5XK 3I4NC 4A93C 2R92C 4BXXK 2WAQL 1TWGC 1I6VA 1R9TC 3I4NK 3WODA 5C44C 1TWCK 1SFOC 3GTGC 2R93K 1TWGK 2JA5C 3H0GC 3S14C 4A3GK 5C44K 1SFOK 3GTGK 2PMZD 2JA5K 1Y1VK 3H0GK 4BY7C 1I50K 2NVYC 4A3IK 4BY7K 2Y0SL 5C3EC 4G7ZA 3S2DK 4YFNA 4Q4ZA 3HOWK 4OIQA 3H3VD 2JA8C 4QIWL 4LK1A 4BBSC 1WCMC 1TWFK 2PA8L 2B63K 3GTQC 3S2HC 3CQZK
chains in the Genus database with same CATH superfamily
1WORA 3GTLC 2WB1L 3S1MK 5C4XC 1O27A 3A8JA 1XZQB 1WOPA 4BBRC 4BLAA 5HL8A 3AQPA 4O2DA 4A93K 4KM8A 2R92K 4GTDA 2VUMK 3BP8C 1R9TK 5IP9C 5TMCA 3EQLA 4GTEA 1X31C 3AD9C 3S0XA 3FOEA 1K83A 3S16K 5JVOA 1ZYRA 5M5WK 2E2HC 4FM9A 4C2MC 1ZBSA 2E2JK 2CW0A 1ZVUA 3M4OC 1TWAC 2JA8K 3PO3C 4A3FC 3Q3QA 3S15C 4BBSK 3HKZD 1EK8A 3GTOK 1TWHC 2FQOA 4KC6A 1O2AA 1WQGA 1I6HC 4Y52C 4A3DC 1WOOA 4KMAA 2GSNA 2R7ZC 1SMYA 4M1XA 3HOUC 4C3HK 4XSZA 3GTPK 1SFOA 2A6EA 4LK0A 1Y1VA 4C45A 1WSVA 3TFHA 5IYCC 3S1NC 4A3BC 2B63A 4A3CK 1XZQA 4FZBA 2PMZL 2Y0SD 4BXXC 4MEYA 4C3IC 4A3GC 3H3VL 3GTJA 4A3LK 3AH5A 1XPPA 2PA8D 3SZZA 1G51A 1BGWA 2XCOA 2XCRB 2JA7K 4Q5SA 1XXCA 4WILA 2NVYA 4GT9A 5M3FK 2JA6A 2W7VA 3HOYC 3CQZC 3S1MC 1O29A 4P5BA 2XCQA 3N0BA 3PO2K 4GTAA 3S1RK 5M5XK 4A93C 2R92C 1DCOA 1R9TC 3GSIA 5C44K 1SFOK 3GTKA 1Y1VK 4A3IK 4DDQA 2V6UA 4KATA 3G4AA 4Q4ZA 3HOWK 4OIQA 2JA8C 4BBSC 3TFJA 2B63K 4PAAA 3GTOA 1XZPB 2NVQK 4X6AC 1Y1WA 2O5IA 1XXAA 3FKIA 3GTJK 4C3HC 3GTPC 3AQOA 4XLPA 1USOA 1VLOA 1EI6A 1F9NA 1VRQC 5CJ9A 2NVXA 2RGRA 1DD5A 3S14K 1KQ4A 2Y3PA 3RZDK 2NVYK 4C3JK 2JA6K 2GAGC 4G7OA 1IW7A 4G0UA 2A6HA 4QJVB 2YU9A 2A68A 4A3LC 4Y7NK 3TTGA 2P5MA 4YFXA 3GTKK 5C4JK 1K83C 1PJ7A 3FHZA 2NVTC 3GTGA 2WB1D 5TMFA 4GTBA 1WIHA 4WJ3M 2PPBA 4YFKA 2GSOA 3L4KA 3HOVK 2JA7A 3ERED 4G7HA 4MQ9A 2WAQD 5IYDK 2V6TA 1UV7A 3A8IA 3S1QK 5IYBK 1C0AA 5IP7K 1XZPA 3PO2C 4A3KK 3S1RC 1Y1WK 4KMUA 4BY1K 3FKIK 4QIWD 1IL2A 1Y1VC 4XSXA 1IQ0A 3NUHA 4A3IC 3S17K 3LPXA 1XXBA 3HKZL 2NVXK 4LJZA 3LAPA 4MEXA 3HOWC 4GTLA 4AYBD 2B63C 4QJVA 4OIRA 5CHPA 3VA7A 4A3MK 2YU9K 1TWAA 2NVQC 3GTQA 1TWHA 3T01A 3GTJC 3I4NC 3A8KA 5EGEA 3WODA 1TWGK 3H0GC 3S14C 3GTGK 2PMZD 3L4JA 2JA5K 2NVYC 4BY7K 2Y0SL 1EH1A 4G7ZA 3S2DK 2ZUEA 3H3VD 4KMDA 4LK1A 1L0WA 4XCHA 5IOQA 3BP3A 2PA8L 1INNA 1ZQ1C 2KWAA 2E2IA 3GTLK 5C4XK 4RMFA 5TJ3A 1HQMA 3HXAA 3GTKC 5C4JC 4LOWA 2VUMC 3I4MK 4BBRK 4JK1A 4GZYA 3HOVC 1GE9A 3IPJA 3S16C 3GTMA 4P9SA 5IOSA 1I3QA 3S1QC 4OIOA 2E2JC 3OEPA 5IYBC 2P8TA 3V4GA 5IP7C 2A69A 1BJTA 1J6VA 3G4CA 5E68A 1IBAA 4A3KC 3AD8C 3M4OK 3GTOC 4LR2A 1TWAK 4A3FK 2V6SA 3S15K 3GTQK 4BY1C 3FKIC 1TWHK 1DCPA 4ILDA 4Y52K 4A3DK 3S17C 2ZUFA 5M5YK 4A3JK 2NVXC 1TWCA 2R93A 3AD7C 4YG2A 4WJ4A 1I50A 2PHCB 3K7AK 4GTCA 3HOXK 4XLNA 3HOZK 3N3YA 3TFIA 1O2FB 1O2BA 5M3MK 4KN4A 4A3MC 2CFAB 2YU9C 3ADAC 4A3CC 1BS2A 1WSRA 1TWFA 5IOTA 3M3YK 1YX2A 4A3BK 3T00A 2E2IK 4KASA 2ZFZA 4C3IK 1BDFA 4BKWA 5IORA 4KMHA 4KB4A 3GEHA 2JA7C 1J98A 1TWGA 5D4DA 3GTMK 3S2DC 3N0CA 2JA5A 4P5AA 1I3QK 1B4AA 4OIPA 1PJ5A 3OPFA 4A3EK 1JOEA 1YCLA 3HOYK 1VJEA 3RZOK 1WCMA 3DXJA 5FLMK 4G0WA 3I4MC 1F7VA 3GTLA 2WAQL 5C44C 1TWCK 1SFOC 2R93K 2D6FC 1I50K 1USMA 2CFAA 1J6XA 1JVIA 4QIWL 2E2HA 1TWFK 3GTQC 3BUEA 4BLBA 5JFEA 1WQFA 3LAJA 5FJ8K 1F7UA 4AYBL 4A3JC 3MMLB 1AB4A 4X6AK 4PABA 4AH6A 3K7AC 3HOXC 3HOZC 1EQRA 4G0VA 2R7ZA 3RZDC 2JA6C 4C3JC 4GTFA 3GEIA 3FOFA 5C3EK 1O28A 3M3YC 5L46A 2FQTA 2E2IC 1YNJA 1RU0A 1HI9A 1WCMK 3S2HK 1J6WA 2RH6A 4Y7NC 4KARA 2BE5A 3OREA 3GTMC 1V5VA 1I3QC 2O5JA 1K83K 3H0GA 2NVTK 5IP9K 4GFQA 1VH2A 5IYDC 4A3EC 4KB2A 1B4BA 2E2HK 4C2MK 3RZOC 3QX3A 3CQZA 5FLMC 1EFWA 3PO3K 1Y1WC 5EGHA 1IS1A 1TWCC 4NOIA 2R93C 1I6HK 3SZYA 1VGXA 1ZXOA 1IE0A 2EBBA 4OINA 1I50C 2GAHC 2R92A 2VUMA 1PJ6A 1R9TA 1JQWA 2R7ZK 4ZH4A 4LLGA 4KDDA 3HOUK 1F93A 1YNNA 4KM9A 1WQHA 3GEEA 1TWFC 3GIRA 3GDZA 1O26A 4KN7A 4KAWX 4LQYA 5IYCK 3S1NK 2GSUA 1ISEA 4BXXK 1TWGC 1I6VA 3I4NK 1WOSA 3GTGC 2JH3A 2JA5C 4A3GK 3T02A 3H0GK 4BY7C 3GTPA 5C3EC 1DCHA 4YFNA 3CAGA 3JSTA 1O24A 1O25A 1WCMC 3S2HC 4J3NA 3CQZK
chains in the Genus database with same CATH topology
3GTLC 2WB1L 3S1MK 5C4XC 5FJ8K 3GTLK 4AYBL 5C4XK 2NVQK 4X6AC 4A3JC 2O5IA 1HQMA 4BBRC 3GTKC 5C4JC 3M4OK 4X6AK 3GTJK 2VUMC 3I4MK 3GTPC 4BBRK 4XLPA 4A93K 4JK1A 2R92K 2VUMK 1R9TK 3K7AC 3HOXC 5IP9C 3HOZC 3HOVC 4GZYA 5TMCA 3EQLA 3RZDC 3S14K 3S16C 2JA6C 3RZDK 3S16K 2NVYK 4C3JK 1ZYRA 4OIOA 5M5WK 5IYBC 2E2HC 2E2JC 2JA6K 3S1QC 1IW7A 4G7OA 5C3EK 5IP7C 2A69A 2E2JK 2CW0A 3M3YC 3M4OC 4A3KC 1TWAC 2JA8K 3PO3C 4A3FC 3GTOC 2E2IC 2A6HA 3S15C 4QJVB 1YNJA 4BBSK 3HKZD 1TWAK 4A3FK 1WCMK 3GTOK 1TWHC 3GTQK 3S15K 3S2HK 4BY1C 2A68A 3FKIC 1TWHK 1I6HC 4Y52C 4A3DC 4A3LC 4Y52K 4Y7NC 4A3DK 3S17C 2BE5A 4Y7NK 5M5YK 4A3JK 2NVXC 2R7ZC 3GTMC 4YFXA 3GTKK 1SMYA 5C4JK 3HOUC 1K83C 4C3HK 4XSZA 3GTPK 1I3QC 2NVTC 2A6EA 2WB1D 4LK0A 4YG2A 5TMFA 1K83K 2O5JA 2NVTK 3K7AK 3HOXK 5IP9K 4YFKA 4XLNA 2PPBA 3HOVK 3HOZK 5IYDC 4G7HA 4MQ9A 5M3MK 4A3EC 2WAQD 4KN4A 5IYDK 4A3MC 3S1QK 2E2HK 2YU9C 5IYBK 4C2MK 5IYCC 4A3CC 3S1NC 5IP7K 3RZOC 4A3BC 4A3CK 3PO2C 3M3YK 5FLMC 4A3KK 2PMZL 3S1RC 3PO3K 4A3BK 2Y0SD 2E2IK 1Y1WC 4BXXC 4MEYA 1Y1WK 4KMUA 4NOIA 1TWCC 4BY1K 2R93C 3FKIK 1I6HK 4A3GC 4C3IK 4QIWD 1BDFA 3H3VL 1Y1VC 4A3LK 4XSXA 1I50C 4A3IC 1XPPA 2PA8D 4OINA 3S17K 2JA7C 5D4DA 3HKZL 2NVXK 4ZH4A 2JA7K 3GTMK 4LLGA 2R7ZK 3HOUK 3S2DC 1YNNA 4LJZA 4MEXA 3HOWC 1I3QK 4Q5SA 4AYBD 5M3FK 1TWFC 2B63C 4QJVA 4OIRA 4OIPA 3HOYC 3CQZC 4KN7A 4A3EK 3HOYK 3S1MC 4A3MK 2YU9K 5IYCK 3S1NK 2NVQC 3RZOK 3PO2K 3DXJA 5FLMK 3GTJC 3I4MC 3S1RK 5M5XK 3I4NC 4A93C 2R92C 4BXXK 2WAQL 1TWGC 1I6VA 1R9TC 3I4NK 3WODA 5C44C 1TWCK 1SFOC 3GTGC 2R93K 1TWGK 2JA5C 3H0GC 3S14C 4A3GK 5C44K 1SFOK 3GTGK 2PMZD 2JA5K 1Y1VK 3H0GK 4BY7C 1I50K 2NVYC 4A3IK 4BY7K 2Y0SL 5C3EC 4G7ZA 3S2DK 4YFNA 4Q4ZA 3HOWK 4OIQA 3H3VD 2JA8C 4QIWL 4LK1A 4BBSC 1WCMC 1TWFK 2PA8L 2B63K 3GTQC 3S2HC 3CQZK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL C;  2WB1 L;  3S1M K;  5C4X C;  5FJ8 K;  3GTL K;  4AYB L;  5C4X K;  2NVQ K;  4X6A C;  4A3J C;  2O5I A;  1HQM A;  4BBR C;  3GTK C;  5C4J C;  3M4O K;  4X6A K;  3GTJ K;  2VUM C;  3I4M K;  3GTP C;  4BBR K;  4XLP A;  4A93 K;  4JK1 A;  2R92 K;  2VUM K;  1R9T K;  3K7A C;  3HOX C;  5IP9 C;  3HOZ C;  3HOV C;  4GZY A;  5TMC A;  3EQL A;  3RZD C;  3S14 K;  3S16 C;  2JA6 C;  3RZD K;  3S16 K;  2NVY K;  4C3J K;  1ZYR A;  4OIO A;  5M5W K;  5IYB C;  2E2H C;  2E2J C;  2JA6 K;  3S1Q C;  1IW7 A;  4G7O A;  5C3E K;  5IP7 C;  2A69 A;  2E2J K;  2CW0 A;  3M3Y C;  3M4O C;  4A3K C;  1TWA C;  2JA8 K;  3PO3 C;  4A3F C;  3GTO C;  2E2I C;  2A6H A;  3S15 C;  4QJV B;  1YNJ A;  4BBS K;  3HKZ D;  1TWA K;  4A3F K;  1WCM K;  3GTO K;  1TWH C;  3GTQ K;  3S15 K;  3S2H K;  4BY1 C;  2A68 A;  3FKI C;  1TWH K;  1I6H C;  4Y52 C;  4A3D C;  4A3L C;  4Y52 K;  4Y7N C;  4A3D K;  3S17 C;  2BE5 A;  4Y7N K;  5M5Y K;  4A3J K;  2NVX C;  2R7Z C;  3GTM C;  4YFX A;  3GTK K;  1SMY A;  5C4J K;  3HOU C;  1K83 C;  4C3H K;  4XSZ A;  3GTP K;  1I3Q C;  2NVT C;  2A6E A;  2WB1 D;  4LK0 A;  4YG2 A;  5TMF A;  1K83 K;  2O5J A;  2NVT K;  3K7A K;  3HOX K;  5IP9 K;  4YFK A;  4XLN A;  2PPB A;  3HOV K;  3HOZ K;  5IYD C;  4G7H A;  4MQ9 A;  5M3M K;  4A3E C;  2WAQ D;  4KN4 A;  5IYD K;  4A3M C;  3S1Q K;  2E2H K;  2YU9 C;  5IYB K;  4C2M K;  5IYC C;  4A3C C;  3S1N C;  5IP7 K;  3RZO C;  4A3B C;  4A3C K;  3PO2 C;  3M3Y K;  5FLM C;  4A3K K;  2PMZ L;  3S1R C;  3PO3 K;  4A3B K;  2Y0S D;  2E2I K;  1Y1W C;  4BXX C;  4MEY A;  1Y1W K;  4KMU A;  4NOI A;  1TWC C;  4BY1 K;  2R93 C;  3FKI K;  1I6H K;  4A3G C;  4C3I K;  4QIW D;  1BDF A;  3H3V L;  1Y1V C;  4A3L K;  4XSX A;  1I50 C;  4A3I C;  1XPP A;  2PA8 D;  4OIN A;  3S17 K;  2JA7 C;  5D4D A;  3HKZ L;  2NVX K;  4ZH4 A;  2JA7 K;  3GTM K;  4LLG A;  2R7Z K;  3HOU K;  3S2D C;  1YNN A;  4LJZ A;  4MEX A;  3HOW C;  1I3Q K;  4Q5S A;  4AYB D;  5M3F K;  1TWF C;  2B63 C;  4QJV A;  4OIR A;  4OIP A;  3HOY C;  3CQZ C;  4KN7 A;  4A3E K;  3HOY K;  3S1M C;  4A3M K;  2YU9 K;  5IYC K;  3S1N K;  2NVQ C;  3RZO K;  3PO2 K;  3DXJ A;  5FLM K;  3GTJ C;  3I4M C;  3S1R K;  5M5X K;  3I4N C;  4A93 C;  2R92 C;  4BXX K;  2WAQ L;  1TWG C;  1I6V A;  1R9T C;  3I4N K;  3WOD A;  5C44 C;  1TWC K;  1SFO C;  3GTG C;  2R93 K;  1TWG K;  2JA5 C;  3H0G C;  3S14 C;  4A3G K;  5C44 K;  1SFO K;  3GTG K;  2PMZ D;  2JA5 K;  1Y1V K;  3H0G K;  4BY7 C;  1I50 K;  2NVY C;  4A3I K;  4BY7 K;  2Y0S L;  5C3E C;  4G7Z A;  3S2D K;  4YFN A;  4Q4Z A;  3HOW K;  4OIQ A;  3H3V D;  2JA8 C;  4QIW L;  4LK1 A;  4BBS C;  1WCM C;  1TWF K;  2PA8 L;  2B63 K;  3GTQ C;  3S2H C;  3CQZ K; 
#chains in the Genus database with same CATH topology
 1WOR A;  3GTL C;  2WB1 L;  3S1M K;  5C4X C;  1O27 A;  3A8J A;  1XZQ B;  1WOP A;  4BBR C;  4BLA A;  5HL8 A;  3AQP A;  4O2D A;  4A93 K;  4KM8 A;  2R92 K;  4GTD A;  2VUM K;  3BP8 C;  1R9T K;  5IP9 C;  5TMC A;  3EQL A;  4GTE A;  1X31 C;  3AD9 C;  3S0X A;  3FOE A;  1K83 A;  3S16 K;  5JVO A;  1ZYR A;  5M5W K;  2E2H C;  4FM9 A;  4C2M C;  1ZBS A;  2E2J K;  2CW0 A;  1ZVU A;  3M4O C;  1TWA C;  2JA8 K;  3PO3 C;  4A3F C;  3Q3Q A;  3S15 C;  4BBS K;  3HKZ D;  1EK8 A;  3GTO K;  1TWH C;  2FQO A;  4KC6 A;  1O2A A;  1WQG A;  1I6H C;  4Y52 C;  4A3D C;  1WOO A;  4KMA A;  2GSN A;  2R7Z C;  1SMY A;  4M1X A;  3HOU C;  4C3H K;  4XSZ A;  3GTP K;  1SFO A;  2A6E A;  4LK0 A;  1Y1V A;  4C45 A;  1WSV A;  3TFH A;  5IYC C;  3S1N C;  4A3B C;  2B63 A;  4A3C K;  1XZQ A;  4FZB A;  2PMZ L;  2Y0S D;  4BXX C;  4MEY A;  4C3I C;  4A3G C;  3H3V L;  3GTJ A;  4A3L K;  3AH5 A;  1XPP A;  2PA8 D;  3SZZ A;  1G51 A;  1BGW A;  2XCO A;  2XCR B;  2JA7 K;  4Q5S A;  1XXC A;  4WIL A;  2NVY A;  4GT9 A;  5M3F K;  2JA6 A;  2W7V A;  3HOY C;  3CQZ C;  3S1M C;  1O29 A;  4P5B A;  2XCQ A;  3N0B A;  3PO2 K;  4GTA A;  3S1R K;  5M5X K;  4A93 C;  2R92 C;  1DCO A;  1R9T C;  3GSI A;  5C44 K;  1SFO K;  3GTK A;  1Y1V K;  4A3I K;  4DDQ A;  2V6U A;  4KAT A;  3G4A A;  4Q4Z A;  3HOW K;  4OIQ A;  2JA8 C;  4BBS C;  3TFJ A;  2B63 K;  4PAA A;  3GTO A;  1XZP B;  2NVQ K;  4X6A C;  1Y1W A;  2O5I A;  1XXA A;  3FKI A;  3GTJ K;  4C3H C;  3GTP C;  3AQO A;  4XLP A;  1USO A;  1VLO A;  1EI6 A;  1F9N A;  1VRQ C;  5CJ9 A;  2NVX A;  2RGR A;  1DD5 A;  3S14 K;  1KQ4 A;  2Y3P A;  3RZD K;  2NVY K;  4C3J K;  2JA6 K;  2GAG C;  4G7O A;  1IW7 A;  4G0U A;  2A6H A;  4QJV B;  2YU9 A;  2A68 A;  4A3L C;  4Y7N K;  3TTG A;  2P5M A;  4YFX A;  3GTK K;  5C4J K;  1K83 C;  1PJ7 A;  3FHZ A;  2NVT C;  3GTG A;  2WB1 D;  5TMF A;  4GTB A;  1WIH A;  4WJ3 M;  2PPB A;  4YFK A;  2GSO A;  3L4K A;  3HOV K;  2JA7 A;  3ERE D;  4G7H A;  4MQ9 A;  2WAQ D;  5IYD K;  2V6T A;  1UV7 A;  3A8I A;  3S1Q K;  5IYB K;  1C0A A;  5IP7 K;  1XZP A;  3PO2 C;  4A3K K;  3S1R C;  1Y1W K;  4KMU A;  4BY1 K;  3FKI K;  4QIW D;  1IL2 A;  1Y1V C;  4XSX A;  1IQ0 A;  3NUH A;  4A3I C;  3S17 K;  3LPX A;  1XXB A;  3HKZ L;  2NVX K;  4LJZ A;  3LAP A;  4MEX A;  3HOW C;  4GTL A;  4AYB D;  2B63 C;  4QJV A;  4OIR A;  5CHP A;  3VA7 A;  4A3M K;  2YU9 K;  1TWA A;  2NVQ C;  3GTQ A;  1TWH A;  3T01 A;  3GTJ C;  3I4N C;  3A8K A;  5EGE A;  3WOD A;  1TWG K;  3H0G C;  3S14 C;  3GTG K;  2PMZ D;  3L4J A;  2JA5 K;  2NVY C;  4BY7 K;  2Y0S L;  1EH1 A;  4G7Z A;  3S2D K;  2ZUE A;  3H3V D;  4KMD A;  4LK1 A;  1L0W A;  4XCH A;  5IOQ A;  3BP3 A;  2PA8 L;  1INN A;  1ZQ1 C;  2KWA A;  2E2I A;  3GTL K;  5C4X K;  4RMF A;  5TJ3 A;  1HQM A;  3HXA A;  3GTK C;  5C4J C;  4LOW A;  2VUM C;  3I4M K;  4BBR K;  4JK1 A;  4GZY A;  3HOV C;  1GE9 A;  3IPJ A;  3S16 C;  3GTM A;  4P9S A;  5IOS A;  1I3Q A;  3S1Q C;  4OIO A;  2E2J C;  3OEP A;  5IYB C;  2P8T A;  3V4G A;  5IP7 C;  2A69 A;  1BJT A;  1J6V A;  3G4C A;  5E68 A;  1IBA A;  4A3K C;  3AD8 C;  3M4O K;  3GTO C;  4LR2 A;  1TWA K;  4A3F K;  2V6S A;  3S15 K;  3GTQ K;  4BY1 C;  3FKI C;  1TWH K;  1DCP A;  4ILD A;  4Y52 K;  4A3D K;  3S17 C;  2ZUF A;  5M5Y K;  4A3J K;  2NVX C;  1TWC A;  2R93 A;  3AD7 C;  4YG2 A;  4WJ4 A;  1I50 A;  2PHC B;  3K7A K;  4GTC A;  3HOX K;  4XLN A;  3HOZ K;  3N3Y A;  3TFI A;  1O2F B;  1O2B A;  5M3M K;  4KN4 A;  4A3M C;  2CFA B;  2YU9 C;  3ADA C;  4A3C C;  1BS2 A;  1WSR A;  1TWF A;  5IOT A;  3M3Y K;  1YX2 A;  4A3B K;  3T00 A;  2E2I K;  4KAS A;  2ZFZ A;  4C3I K;  1BDF A;  4BKW A;  5IOR A;  4KMH A;  4KB4 A;  3GEH A;  2JA7 C;  1J98 A;  1TWG A;  5D4D A;  3GTM K;  3S2D C;  3N0C A;  2JA5 A;  4P5A A;  1I3Q K;  1B4A A;  4OIP A;  1PJ5 A;  3OPF A;  4A3E K;  1JOE A;  1YCL A;  3HOY K;  1VJE A;  3RZO K;  1WCM A;  3DXJ A;  5FLM K;  4G0W A;  3I4M C;  1F7V A;  3GTL A;  2WAQ L;  5C44 C;  1TWC K;  1SFO C;  2R93 K;  2D6F C;  1I50 K;  1USM A;  2CFA A;  1J6X A;  1JVI A;  4QIW L;  2E2H A;  1TWF K;  3GTQ C;  3BUE A;  4BLB A;  5JFE A;  1WQF A;  3LAJ A;  5FJ8 K;  1F7U A;  4AYB L;  4A3J C;  3MML B;  1AB4 A;  4X6A K;  4PAB A;  4AH6 A;  3K7A C;  3HOX C;  3HOZ C;  1EQR A;  4G0V A;  2R7Z A;  3RZD C;  2JA6 C;  4C3J C;  4GTF A;  3GEI A;  3FOF A;  5C3E K;  1O28 A;  3M3Y C;  5L46 A;  2FQT A;  2E2I C;  1YNJ A;  1RU0 A;  1HI9 A;  1WCM K;  3S2H K;  1J6W A;  2RH6 A;  4Y7N C;  4KAR A;  2BE5 A;  3ORE A;  3GTM C;  1V5V A;  1I3Q C;  2O5J A;  1K83 K;  3H0G A;  2NVT K;  5IP9 K;  4GFQ A;  1VH2 A;  5IYD C;  4A3E C;  4KB2 A;  1B4B A;  2E2H K;  4C2M K;  3RZO C;  3QX3 A;  3CQZ A;  5FLM C;  1EFW A;  3PO3 K;  1Y1W C;  5EGH A;  1IS1 A;  1TWC C;  4NOI A;  2R93 C;  1I6H K;  3SZY A;  1VGX A;  1ZXO A;  1IE0 A;  2EBB A;  4OIN A;  1I50 C;  2GAH C;  2R92 A;  2VUM A;  1PJ6 A;  1R9T A;  1JQW A;  2R7Z K;  4ZH4 A;  4LLG A;  4KDD A;  3HOU K;  1F93 A;  1YNN A;  4KM9 A;  1WQH A;  3GEE A;  1TWF C;  3GIR A;  3GDZ A;  1O26 A;  4KN7 A;  4KAW X;  4LQY A;  5IYC K;  3S1N K;  2GSU A;  1ISE A;  4BXX K;  1TWG C;  1I6V A;  3I4N K;  1WOS A;  3GTG C;  2JH3 A;  2JA5 C;  4A3G K;  3T02 A;  3H0G K;  4BY7 C;  3GTP A;  5C3E C;  1DCH A;  4YFN A;  3CAG A;  3JST A;  1O24 A;  1O25 A;  1WCM C;  3S2H C;  4J3N A;  3CQZ K; 
#chains in the Genus database with same CATH homology
 3GTL C;  2WB1 L;  3S1M K;  5C4X C;  5FJ8 K;  3GTL K;  4AYB L;  5C4X K;  2NVQ K;  4X6A C;  4A3J C;  2O5I A;  1HQM A;  4BBR C;  3GTK C;  5C4J C;  3M4O K;  4X6A K;  3GTJ K;  2VUM C;  3I4M K;  3GTP C;  4BBR K;  4XLP A;  4A93 K;  4JK1 A;  2R92 K;  2VUM K;  1R9T K;  3K7A C;  3HOX C;  5IP9 C;  3HOZ C;  3HOV C;  4GZY A;  5TMC A;  3EQL A;  3RZD C;  3S14 K;  3S16 C;  2JA6 C;  3RZD K;  3S16 K;  2NVY K;  4C3J K;  1ZYR A;  4OIO A;  5M5W K;  5IYB C;  2E2H C;  2E2J C;  2JA6 K;  3S1Q C;  1IW7 A;  4G7O A;  5C3E K;  5IP7 C;  2A69 A;  2E2J K;  2CW0 A;  3M3Y C;  3M4O C;  4A3K C;  1TWA C;  2JA8 K;  3PO3 C;  4A3F C;  3GTO C;  2E2I C;  2A6H A;  3S15 C;  4QJV B;  1YNJ A;  4BBS K;  3HKZ D;  1TWA K;  4A3F K;  1WCM K;  3GTO K;  1TWH C;  3GTQ K;  3S15 K;  3S2H K;  4BY1 C;  2A68 A;  3FKI C;  1TWH K;  1I6H C;  4Y52 C;  4A3D C;  4A3L C;  4Y52 K;  4Y7N C;  4A3D K;  3S17 C;  2BE5 A;  4Y7N K;  5M5Y K;  4A3J K;  2NVX C;  2R7Z C;  3GTM C;  4YFX A;  3GTK K;  1SMY A;  5C4J K;  3HOU C;  1K83 C;  4C3H K;  4XSZ A;  3GTP K;  1I3Q C;  2NVT C;  2A6E A;  2WB1 D;  4LK0 A;  4YG2 A;  5TMF A;  1K83 K;  2O5J A;  2NVT K;  3K7A K;  3HOX K;  5IP9 K;  4YFK A;  4XLN A;  2PPB A;  3HOV K;  3HOZ K;  5IYD C;  4G7H A;  4MQ9 A;  5M3M K;  4A3E C;  2WAQ D;  4KN4 A;  5IYD K;  4A3M C;  3S1Q K;  2E2H K;  2YU9 C;  5IYB K;  4C2M K;  5IYC C;  4A3C C;  3S1N C;  5IP7 K;  3RZO C;  4A3B C;  4A3C K;  3PO2 C;  3M3Y K;  5FLM C;  4A3K K;  2PMZ L;  3S1R C;  3PO3 K;  4A3B K;  2Y0S D;  2E2I K;  1Y1W C;  4BXX C;  4MEY A;  1Y1W K;  4KMU A;  4NOI A;  1TWC C;  4BY1 K;  2R93 C;  3FKI K;  1I6H K;  4A3G C;  4C3I K;  4QIW D;  1BDF A;  3H3V L;  1Y1V C;  4A3L K;  4XSX A;  1I50 C;  4A3I C;  1XPP A;  2PA8 D;  4OIN A;  3S17 K;  2JA7 C;  5D4D A;  3HKZ L;  2NVX K;  4ZH4 A;  2JA7 K;  3GTM K;  4LLG A;  2R7Z K;  3HOU K;  3S2D C;  1YNN A;  4LJZ A;  4MEX A;  3HOW C;  1I3Q K;  4Q5S A;  4AYB D;  5M3F K;  1TWF C;  2B63 C;  4QJV A;  4OIR A;  4OIP A;  3HOY C;  3CQZ C;  4KN7 A;  4A3E K;  3HOY K;  3S1M C;  4A3M K;  2YU9 K;  5IYC K;  3S1N K;  2NVQ C;  3RZO K;  3PO2 K;  3DXJ A;  5FLM K;  3GTJ C;  3I4M C;  3S1R K;  5M5X K;  3I4N C;  4A93 C;  2R92 C;  4BXX K;  2WAQ L;  1TWG C;  1I6V A;  1R9T C;  3I4N K;  3WOD A;  5C44 C;  1TWC K;  1SFO C;  3GTG C;  2R93 K;  1TWG K;  2JA5 C;  3H0G C;  3S14 C;  4A3G K;  5C44 K;  1SFO K;  3GTG K;  2PMZ D;  2JA5 K;  1Y1V K;  3H0G K;  4BY7 C;  1I50 K;  2NVY C;  4A3I K;  4BY7 K;  2Y0S L;  5C3E C;  4G7Z A;  3S2D K;  4YFN A;  4Q4Z A;  3HOW K;  4OIQ A;  3H3V D;  2JA8 C;  4QIW L;  4LK1 A;  4BBS C;  1WCM C;  1TWF K;  2PA8 L;  2B63 K;  3GTQ C;  3S2H C;  3CQZ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...