5C4JK

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c4jK00
2B63C 3GTMK 2E2HC 4BY1K 4C3IK 1K83K 2PPBA 4BBSC 2Y0SL 3GTJC 4QIWL 3S16C 4KN4A 4JK1A 3HOXC 2R7ZK 3RZOK 4X6AC 5IP9C 1BDFA 4C3HK 1Y1WK 2VUMK 3I4NK 4YG2A 2BE5A 3H0GK 5M3FK 4A3LK 3GTPK 4Q5SA 5C4JK 2A6HA 5C4XK 2YU9K 3S1NK 5IYDK 2WB1D 3HOWK 4YFKA 4A3BK 1TWAC 2A6EA 3PO2C 4A3DC 3HOYC 4A3FC 2WAQD 1TWGC 2CW0A 4YFXA 4A3MK 3RZDC 1I50K 3HOUC 4BY7C 4ZH4A 2WB1L 4A93C 5D4DA 2E2JK 4QJVA 3S14K 4QJVB 5FJ8K 1XPPA 2R92C 4NOIA 4Y7NC 2WAQL 4XLNA 2R93C 4XLPA 1Y1VK 5C3EK 1SFOC 1WCMK 4YFNA 3S15K 3S1MK 4A3GC 5M5YK 5C44C 3S1QC 1I6VA 3I4MC 5IP7K 3HOVC 3M3YK 4LLGA 2JA8K 3GTMC 3S17K 3HOZK 4C3JK 4BY1C 4G7ZA 1K83C 4Y52K 3GTOK 4BXXK 2JA6K 3GTKK 2R7ZC 3PO3K 4MEXA 3RZOC 1TWCK 4LJZA 4A3IK 1Y1WC 3CQZK 3GTGK 1R9TC 2VUMC 3GTLK 2PMZD 3HKZD 3H0GC 2JA5K 2NVTK 3S2HK 3GTPC 4A3LC 5C4JC 2PA8D 5IYBK 5C4XC 4OIOA 2YU9C 1ZYRA 4OIPA 4KMUA 1TWHK 3S1NC 4GZYA 2A68A 4A3KK 4OINA 2PMZL 3HKZL 1HQMA 3HOWC 4A3BC 2O5JA 2PA8L 2NVXK 1I6HK 2A69A 4A3MC 3S2DK 1I50C 2E2IK 4XSXA 5FLMC 1TWFK 2NVQK 3S14C 2NVYK 3M4OK 3S1RK 2O5IA 4A3EC 3GTQK 1Y1VC 5C3EC 4BBRK 5IYCK 1WCMC 3S15C 3S1MC 1I3QK 3M3YC 3FKIK 5IP7C 5TMFA 5M5WK 2JA8C 3S17C 1YNJA 4Y52C 3HOZC 1YNNA 4KN7A 4A3CK 3GTOC 4OIRA 3I4NC 4G7OA 3K7AK 4BXXC 2JA6C 4A3JK 3GTKC 3PO3C 4MEYA 2JA7K 1TWCC 2R93K 2B63K 4A3IC 3CQZC 4C2MK 1SFOK 2E2HK 5IYDC 5TMCA 3GTGC 2NVTC 2JA5C 3GTLC 4BBSK 2JA7C 3GTJK 3S16K 3S2HC 5IYBC 5M5XK 3DXJA 4MQ9A 3HOXK 4G7HA 4X6AK 5IP9K 1TWHC 4A3KC 2E2JC 3WODA 2NVXC 1I6HC 1R9TK 3S2DC 2E2IC 1TWFC 2NVQC 1TWAK 3PO2K 4A3DK 2NVYC 3HOYK 4A3FK 4AYBD 3M4OC 1TWGK 3RZDK 3S1RC 3HOUK 4BY7K 1SMYA 3GTQC 3H3VD 4BBRC 4LK0A 5IYCC 5M3MK 4A93K 1I3QC 3EQLA 4Q4ZA 3FKIC 2R92K 4OIQA 4Y7NK 4AYBL 5FLMK 2Y0SD 4A3CC 3H3VL 4QIWD 4A3GK 3K7AC 5C44K 4A3JC 3S1QK 1IW7A 3I4MK 3HOVK 4XSZA 4LK1A 4A3EK
chains in the Genus database with same CATH superfamily
2B63C 3GTMK 4C2MC 4BY1K 1XXAA 4C3IK 2PPBA 4BBSC 2ZFZA 4KN4A 1X31C 3HOXC 1TWAA 3A8IA 3QX3A 1I3QA 1Y1WK 4BKWA 5IOSA 1O2AA 2WB1D 4GT9A 3HOWK 5IORA 4A3BK 2A6EA 3PO2C 3N0BA 1ISEA 1TWGC 4A3MK 4FM9A 3GSIA 1K83A 2P5MA 4A93C 4QJVA 2R93C 5C3EK 1WCMK 4YFNA 2GAGC 3GDZA 3AD9C 3H0GA 1HI9A 3OEPA 5C44C 1EFWA 3S1QC 3M3YK 4P5AA 4LLGA 2JA8K 3GTMC 4BY1C 4C3IC 1J6VA 2P8TA 4KM9A 2RGRA 4BLAA 1XZQA 3GTKK 4MEXA 4A3IK 1Y1WC 3CQZK 3T01A 3GTLK 3ERED 2JA5K 3S2HK 4OIOA 3HXAA 1BGWA 4OINA 3HOWC 1IL2A 4KAWX 4A3BC 1J98A 1F9NA 4A3MC 3AH5A 3S1RK 1AB4A 3NUHA 5C3EC 4BBRK 1WCMC 1O2FB 2YU9A 3M3YC 3FKIK 1WQFA 5TMFA 2JA8C 4KB2A 4A3CK 4OIRA 3K7AK 1EI6A 4ILDA 2CFAB 4A3JK 3GTKC 3T02A 2NVXA 4A3IC 3CQZC 1SFOK 1O28A 3GTLC 2E2IA 2JA5C 2ZUEA 3S2HC 3GTJK 5M5XK 4MQ9A 3N0CA 2NVYA 4GTAA 3G4CA 5EGHA 5IOQA 1R9TK 4RMFA 4DDQA 3SZYA 4A3FK 2JA7A 3MMLB 3S1RC 3HOUK 2B63A 1SMYA 1O26A 4BBRC 1GE9A 1EH1A 4AH6A 2Y3PA 1F93A 3EQLA 4Q4ZA 3FKIC 4A3CC 3H3VL 4A3GK 3K7AC 4A3JC 3HOVK 4XSZA 4LK1A 2Y0SL 3GTJC 3GTQA 4JK1A 1IBAA 1DCPA 3RZOK 3ADAC 4KMAA 4YG2A 2BE5A 1PJ5A 1XXBA 3GTPK 2A6HA 2V6UA 3S1NK 1XZPA 2ZUFA 2R93A 4YFKA 5JFEA 3TFHA 4A3FC 2WAQD 4YFXA 1BS2A 3HOUC 1I50K 3GTMA 4KMDA 2WB1L 5D4DA 2E2JK 2V6SA 1IQ0A 1Y1WA 4A3GC 5IP7K 3HOVC 3HOZK 3GTOK 4BXXK 5L46A 3RZOC 4LJZA 1VGXA 2PMZD 2NVTK 4FZBA 3GTPC 4KASA 3S1NC 4J3NA 1YX2A 1USMA 1WCMA 1I6HK 3S2DK 1I50C 2VUMA 1JVIA 4KATA 4G0UA 1IE0A 2O5IA 3VA7A 4A3EC 1O27A 3GTLA 2JA5A 1I3QK 4KB4A 5IP7C 5M5WK 1YNJA 3HOZC 1O29A 3GTOC 4G7OA 4BXXC 3N3YA 4KC6A 5E68A 2NVTC 1WQGA 1ZQ1C 4G7HA 4X6AK 3GEIA 3T00A 2JA6A 1I6HC 3S2DC 2JH3A 3G4AA 4A3DK 5IOTA 5TJ3A 4G0VA 4BY7K 3BP8C 1TWHA 4LQYA 1I3QC 2RH6A 2R92K 4Y7NK 4M1XA 5FLMK 4QIWD 1WOSA 3V4GA 3JSTA 1YCLA 2XCRB 1G51A 1XXCA 5JVOA 2R7ZK 4X6AC 4C3HK 3I4NK 1B4BA 5M3FK 4A3LK 4GTBA 4Q5SA 1O25A 5C4JK 5EGEA 1BJTA 5C4XK 2YU9K 2W7VA 5IYDK 2FQOA 4GTLA 4WILA 4A3DC 2CW0A 4BY7C 4ZH4A 1VJEA 4QJVB 1XPPA 2R92C 4NOIA 4Y7NC 2WAQL 4XLPA 1Y1VK 5CJ9A 1SFOC 3S15K 4LR2A 3GTPA 1I6VA 2GSUA 1V5VA 1VH2A 1JOEA 4C3JK 1TWGA 4GTDA 4GTCA 1ZBSA 2R7ZC 1XZQB 1TWCK 3A8JA 3GTGK 4C3HC 1R9TC 1I50A 3HKZD 4A3LC 1WORA 4P5BA 5C4JC 2PA8D 4WJ4A 3FOEA 5C4XC 2YU9C 4GZYA 2A68A 1EK8A 4A3KK 2PMZL 1HQMA 3TFJA 2O5JA 2A69A 3FHZA 4XSXA 3GTOA 1TWFK 2NVQK 1J6WA 2KWAA 3LAPA 3M4OK 1EQRA 1WSVA 1Y1VC 3GTQK 3AD8C 5IYCK 2V6TA 3S15C 2GAHC 3GEEA 4C3JC 3IPJA 4KN7A 2D6FC 2CFAA 3Q3QA 4KMHA 1TWCC 2R93K 4KDDA 2E2HK 3GTGC 2XCQA 3S16K 3BUEA 3LPXA 5IP9K 1WQHA 4A3KC 4XCHA 2E2JC 3WODA 1O24A 3GTKA 3CQZA 4BLBA 1TWFC 2NVQC 1TWAK 3AQOA 3HOYK 4AYBD 3M4OC 3RZDK 3GTQC 5IYCC 4P9SA 5M3MK 4OIQA 2EBBA 1J6XA 1RU0A 4PABA 1L0WA 1DCHA 1IW7A 3TTGA 3I4MK 1BDFA 1WOPA 2E2HC 1K83K 4GTFA 3S16C 4QIWL 5IP9C 3FKIA 2VUMK 3OPFA 3H0GK 1KQ4A 3AQPA 1VLOA 4G0WA 1PJ7A 2R92A 1XZPB 2GSOA 4O2DA 1SFOA 1F7UA 1TWAC 3HOYC 3GTJA 3RZDC 1F7VA 3L4KA 3S14K 3A8KA 5FJ8K 2R7ZA 1O2BA 4XLNA 1INNA 1R9TA 3S1MK 3GEHA 5M5YK 4LOWA 3I4MC 3S17K 4Y52K 4G7ZA 1K83C 3S0XA 2JA6K 3PO3K 2VUMC 1DD5A 3H0GC 5IYBK 1ZYRA 4OIPA 4KMUA 1TWHK 3LAJA 1Y1VA 3HKZL 4C45A 3TFIA 2PA8L 2NVXK 4GFQA 3GIRA 2E2IK 1JQWA 5FLMC 3OREA 3S14C 2NVYK 1B4AA 1TWCA 3GTGA 3S1MC 3CAGA 4WJ3M 4KARA 3S17C 4Y52C 1YNNA 2XCOA 4PAAA 3SZZA 3I4NC 2GSNA 2FQTA 2JA6C 3PO3C 4MEYA 1PJ6A 2JA7K 2B63K 1IS1A 3AD7C 4C2MK 5IYDC 5TMCA 1UV7A 4BBSK 5CHPA 1WOOA 1TWFA 5IYBC 3DXJA 3HOXK 1TWHC 2NVXC 1USOA 5HL8A 2E2IC 1ZXOA 1VRQC 3PO2K 2NVYC 1C0AA 1WSRA 1TWGK 1ZVUA 3H3VD 2E2HA 4LK0A 4A93K 1WIHA 2PHCB 1DCOA 4AYBL 4KM8A 3FOFA 3L4JA 2Y0SD 4GTEA 5C44K 3S1QK 2JA7C 3BP3A 4A3EK
chains in the Genus database with same CATH topology
2B63C 3GTMK 2E2HC 4BY1K 4C3IK 1K83K 2PPBA 4BBSC 2Y0SL 3GTJC 4QIWL 3S16C 4KN4A 4JK1A 3HOXC 2R7ZK 3RZOK 4X6AC 5IP9C 1BDFA 4C3HK 1Y1WK 2VUMK 3I4NK 4YG2A 2BE5A 3H0GK 5M3FK 4A3LK 3GTPK 4Q5SA 5C4JK 2A6HA 5C4XK 2YU9K 3S1NK 5IYDK 2WB1D 3HOWK 4YFKA 4A3BK 1TWAC 2A6EA 3PO2C 4A3DC 3HOYC 4A3FC 2WAQD 1TWGC 2CW0A 4YFXA 4A3MK 3RZDC 1I50K 3HOUC 4BY7C 4ZH4A 2WB1L 4A93C 5D4DA 2E2JK 4QJVA 3S14K 4QJVB 5FJ8K 1XPPA 2R92C 4NOIA 4Y7NC 2WAQL 4XLNA 2R93C 4XLPA 1Y1VK 5C3EK 1SFOC 1WCMK 4YFNA 3S15K 3S1MK 4A3GC 5M5YK 5C44C 3S1QC 1I6VA 3I4MC 5IP7K 3HOVC 3M3YK 4LLGA 2JA8K 3GTMC 3S17K 3HOZK 4C3JK 4BY1C 4G7ZA 1K83C 4Y52K 3GTOK 4BXXK 2JA6K 3GTKK 2R7ZC 3PO3K 4MEXA 3RZOC 1TWCK 4LJZA 4A3IK 1Y1WC 3CQZK 3GTGK 1R9TC 2VUMC 3GTLK 2PMZD 3HKZD 3H0GC 2JA5K 2NVTK 3S2HK 3GTPC 4A3LC 5C4JC 2PA8D 5IYBK 5C4XC 4OIOA 2YU9C 1ZYRA 4OIPA 4KMUA 1TWHK 3S1NC 4GZYA 2A68A 4A3KK 4OINA 2PMZL 3HKZL 1HQMA 3HOWC 4A3BC 2O5JA 2PA8L 2NVXK 1I6HK 2A69A 4A3MC 3S2DK 1I50C 2E2IK 4XSXA 5FLMC 1TWFK 2NVQK 3S14C 2NVYK 3M4OK 3S1RK 2O5IA 4A3EC 3GTQK 1Y1VC 5C3EC 4BBRK 5IYCK 1WCMC 3S15C 3S1MC 1I3QK 3M3YC 3FKIK 5IP7C 5TMFA 5M5WK 2JA8C 3S17C 1YNJA 4Y52C 3HOZC 1YNNA 4KN7A 4A3CK 3GTOC 4OIRA 3I4NC 4G7OA 3K7AK 4BXXC 2JA6C 4A3JK 3GTKC 3PO3C 4MEYA 2JA7K 1TWCC 2R93K 2B63K 4A3IC 3CQZC 4C2MK 1SFOK 2E2HK 5IYDC 5TMCA 3GTGC 2NVTC 2JA5C 3GTLC 4BBSK 2JA7C 3GTJK 3S16K 3S2HC 5IYBC 5M5XK 3DXJA 4MQ9A 3HOXK 4G7HA 4X6AK 5IP9K 1TWHC 4A3KC 2E2JC 3WODA 2NVXC 1I6HC 1R9TK 3S2DC 2E2IC 1TWFC 2NVQC 1TWAK 3PO2K 4A3DK 2NVYC 3HOYK 4A3FK 4AYBD 3M4OC 1TWGK 3RZDK 3S1RC 3HOUK 4BY7K 1SMYA 3GTQC 3H3VD 4BBRC 4LK0A 5IYCC 5M3MK 4A93K 1I3QC 3EQLA 4Q4ZA 3FKIC 2R92K 4OIQA 4Y7NK 4AYBL 5FLMK 2Y0SD 4A3CC 3H3VL 4QIWD 4A3GK 3K7AC 5C44K 4A3JC 3S1QK 1IW7A 3I4MK 3HOVK 4XSZA 4LK1A 4A3EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B63 C;  3GTM K;  2E2H C;  4BY1 K;  4C3I K;  1K83 K;  2PPB A;  4BBS C;  2Y0S L;  3GTJ C;  4QIW L;  3S16 C;  4KN4 A;  4JK1 A;  3HOX C;  2R7Z K;  3RZO K;  4X6A C;  5IP9 C;  1BDF A;  4C3H K;  1Y1W K;  2VUM K;  3I4N K;  4YG2 A;  2BE5 A;  3H0G K;  5M3F K;  4A3L K;  3GTP K;  4Q5S A;  5C4J K;  2A6H A;  5C4X K;  2YU9 K;  3S1N K;  5IYD K;  2WB1 D;  3HOW K;  4YFK A;  4A3B K;  1TWA C;  2A6E A;  3PO2 C;  4A3D C;  3HOY C;  4A3F C;  2WAQ D;  1TWG C;  2CW0 A;  4YFX A;  4A3M K;  3RZD C;  1I50 K;  3HOU C;  4BY7 C;  4ZH4 A;  2WB1 L;  4A93 C;  5D4D A;  2E2J K;  4QJV A;  3S14 K;  4QJV B;  5FJ8 K;  1XPP A;  2R92 C;  4NOI A;  4Y7N C;  2WAQ L;  4XLN A;  2R93 C;  4XLP A;  1Y1V K;  5C3E K;  1SFO C;  1WCM K;  4YFN A;  3S15 K;  3S1M K;  4A3G C;  5M5Y K;  5C44 C;  3S1Q C;  1I6V A;  3I4M C;  5IP7 K;  3HOV C;  3M3Y K;  4LLG A;  2JA8 K;  3GTM C;  3S17 K;  3HOZ K;  4C3J K;  4BY1 C;  4G7Z A;  1K83 C;  4Y52 K;  3GTO K;  4BXX K;  2JA6 K;  3GTK K;  2R7Z C;  3PO3 K;  4MEX A;  3RZO C;  1TWC K;  4LJZ A;  4A3I K;  1Y1W C;  3CQZ K;  3GTG K;  1R9T C;  2VUM C;  3GTL K;  2PMZ D;  3HKZ D;  3H0G C;  2JA5 K;  2NVT K;  3S2H K;  3GTP C;  4A3L C;  5C4J C;  2PA8 D;  5IYB K;  5C4X C;  4OIO A;  2YU9 C;  1ZYR A;  4OIP A;  4KMU A;  1TWH K;  3S1N C;  4GZY A;  2A68 A;  4A3K K;  4OIN A;  2PMZ L;  3HKZ L;  1HQM A;  3HOW C;  4A3B C;  2O5J A;  2PA8 L;  2NVX K;  1I6H K;  2A69 A;  4A3M C;  3S2D K;  1I50 C;  2E2I K;  4XSX A;  5FLM C;  1TWF K;  2NVQ K;  3S14 C;  2NVY K;  3M4O K;  3S1R K;  2O5I A;  4A3E C;  3GTQ K;  1Y1V C;  5C3E C;  4BBR K;  5IYC K;  1WCM C;  3S15 C;  3S1M C;  1I3Q K;  3M3Y C;  3FKI K;  5IP7 C;  5TMF A;  5M5W K;  2JA8 C;  3S17 C;  1YNJ A;  4Y52 C;  3HOZ C;  1YNN A;  4KN7 A;  4A3C K;  3GTO C;  4OIR A;  3I4N C;  4G7O A;  3K7A K;  4BXX C;  2JA6 C;  4A3J K;  3GTK C;  3PO3 C;  4MEY A;  2JA7 K;  1TWC C;  2R93 K;  2B63 K;  4A3I C;  3CQZ C;  4C2M K;  1SFO K;  2E2H K;  5IYD C;  5TMC A;  3GTG C;  2NVT C;  2JA5 C;  3GTL C;  4BBS K;  2JA7 C;  3GTJ K;  3S16 K;  3S2H C;  5IYB C;  5M5X K;  3DXJ A;  4MQ9 A;  3HOX K;  4G7H A;  4X6A K;  5IP9 K;  1TWH C;  4A3K C;  2E2J C;  3WOD A;  2NVX C;  1I6H C;  1R9T K;  3S2D C;  2E2I C;  1TWF C;  2NVQ C;  1TWA K;  3PO2 K;  4A3D K;  2NVY C;  3HOY K;  4A3F K;  4AYB D;  3M4O C;  1TWG K;  3RZD K;  3S1R C;  3HOU K;  4BY7 K;  1SMY A;  3GTQ C;  3H3V D;  4BBR C;  4LK0 A;  5IYC C;  5M3M K;  4A93 K;  1I3Q C;  3EQL A;  4Q4Z A;  3FKI C;  2R92 K;  4OIQ A;  4Y7N K;  4AYB L;  5FLM K;  2Y0S D;  4A3C C;  3H3V L;  4QIW D;  4A3G K;  3K7A C;  5C44 K;  4A3J C;  3S1Q K;  1IW7 A;  3I4M K;  3HOV K;  4XSZ A;  4LK1 A;  4A3E K; 
#chains in the Genus database with same CATH topology
 2B63 C;  3GTM K;  4C2M C;  4BY1 K;  1XXA A;  4C3I K;  2PPB A;  4BBS C;  2ZFZ A;  4KN4 A;  1X31 C;  3HOX C;  1TWA A;  3A8I A;  3QX3 A;  1I3Q A;  1Y1W K;  4BKW A;  5IOS A;  1O2A A;  2WB1 D;  4GT9 A;  3HOW K;  5IOR A;  4A3B K;  2A6E A;  3PO2 C;  3N0B A;  1ISE A;  1TWG C;  4A3M K;  4FM9 A;  3GSI A;  1K83 A;  2P5M A;  4A93 C;  4QJV A;  2R93 C;  5C3E K;  1WCM K;  4YFN A;  2GAG C;  3GDZ A;  3AD9 C;  3H0G A;  1HI9 A;  3OEP A;  5C44 C;  1EFW A;  3S1Q C;  3M3Y K;  4P5A A;  4LLG A;  2JA8 K;  3GTM C;  4BY1 C;  4C3I C;  1J6V A;  2P8T A;  4KM9 A;  2RGR A;  4BLA A;  1XZQ A;  3GTK K;  4MEX A;  4A3I K;  1Y1W C;  3CQZ K;  3T01 A;  3GTL K;  3ERE D;  2JA5 K;  3S2H K;  4OIO A;  3HXA A;  1BGW A;  4OIN A;  3HOW C;  1IL2 A;  4KAW X;  4A3B C;  1J98 A;  1F9N A;  4A3M C;  3AH5 A;  3S1R K;  1AB4 A;  3NUH A;  5C3E C;  4BBR K;  1WCM C;  1O2F B;  2YU9 A;  3M3Y C;  3FKI K;  1WQF A;  5TMF A;  2JA8 C;  4KB2 A;  4A3C K;  4OIR A;  3K7A K;  1EI6 A;  4ILD A;  2CFA B;  4A3J K;  3GTK C;  3T02 A;  2NVX A;  4A3I C;  3CQZ C;  1SFO K;  1O28 A;  3GTL C;  2E2I A;  2JA5 C;  2ZUE A;  3S2H C;  3GTJ K;  5M5X K;  4MQ9 A;  3N0C A;  2NVY A;  4GTA A;  3G4C A;  5EGH A;  5IOQ A;  1R9T K;  4RMF A;  4DDQ A;  3SZY A;  4A3F K;  2JA7 A;  3MML B;  3S1R C;  3HOU K;  2B63 A;  1SMY A;  1O26 A;  4BBR C;  1GE9 A;  1EH1 A;  4AH6 A;  2Y3P A;  1F93 A;  3EQL A;  4Q4Z A;  3FKI C;  4A3C C;  3H3V L;  4A3G K;  3K7A C;  4A3J C;  3HOV K;  4XSZ A;  4LK1 A;  2Y0S L;  3GTJ C;  3GTQ A;  4JK1 A;  1IBA A;  1DCP A;  3RZO K;  3ADA C;  4KMA A;  4YG2 A;  2BE5 A;  1PJ5 A;  1XXB A;  3GTP K;  2A6H A;  2V6U A;  3S1N K;  1XZP A;  2ZUF A;  2R93 A;  4YFK A;  5JFE A;  3TFH A;  4A3F C;  2WAQ D;  4YFX A;  1BS2 A;  3HOU C;  1I50 K;  3GTM A;  4KMD A;  2WB1 L;  5D4D A;  2E2J K;  2V6S A;  1IQ0 A;  1Y1W A;  4A3G C;  5IP7 K;  3HOV C;  3HOZ K;  3GTO K;  4BXX K;  5L46 A;  3RZO C;  4LJZ A;  1VGX A;  2PMZ D;  2NVT K;  4FZB A;  3GTP C;  4KAS A;  3S1N C;  4J3N A;  1YX2 A;  1USM A;  1WCM A;  1I6H K;  3S2D K;  1I50 C;  2VUM A;  1JVI A;  4KAT A;  4G0U A;  1IE0 A;  2O5I A;  3VA7 A;  4A3E C;  1O27 A;  3GTL A;  2JA5 A;  1I3Q K;  4KB4 A;  5IP7 C;  5M5W K;  1YNJ A;  3HOZ C;  1O29 A;  3GTO C;  4G7O A;  4BXX C;  3N3Y A;  4KC6 A;  5E68 A;  2NVT C;  1WQG A;  1ZQ1 C;  4G7H A;  4X6A K;  3GEI A;  3T00 A;  2JA6 A;  1I6H C;  3S2D C;  2JH3 A;  3G4A A;  4A3D K;  5IOT A;  5TJ3 A;  4G0V A;  4BY7 K;  3BP8 C;  1TWH A;  4LQY A;  1I3Q C;  2RH6 A;  2R92 K;  4Y7N K;  4M1X A;  5FLM K;  4QIW D;  1WOS A;  3V4G A;  3JST A;  1YCL A;  2XCR B;  1G51 A;  1XXC A;  5JVO A;  2R7Z K;  4X6A C;  4C3H K;  3I4N K;  1B4B A;  5M3F K;  4A3L K;  4GTB A;  4Q5S A;  1O25 A;  5C4J K;  5EGE A;  1BJT A;  5C4X K;  2YU9 K;  2W7V A;  5IYD K;  2FQO A;  4GTL A;  4WIL A;  4A3D C;  2CW0 A;  4BY7 C;  4ZH4 A;  1VJE A;  4QJV B;  1XPP A;  2R92 C;  4NOI A;  4Y7N C;  2WAQ L;  4XLP A;  1Y1V K;  5CJ9 A;  1SFO C;  3S15 K;  4LR2 A;  3GTP A;  1I6V A;  2GSU A;  1V5V A;  1VH2 A;  1JOE A;  4C3J K;  1TWG A;  4GTD A;  4GTC A;  1ZBS A;  2R7Z C;  1XZQ B;  1TWC K;  3A8J A;  3GTG K;  4C3H C;  1R9T C;  1I50 A;  3HKZ D;  4A3L C;  1WOR A;  4P5B A;  5C4J C;  2PA8 D;  4WJ4 A;  3FOE A;  5C4X C;  2YU9 C;  4GZY A;  2A68 A;  1EK8 A;  4A3K K;  2PMZ L;  1HQM A;  3TFJ A;  2O5J A;  2A69 A;  3FHZ A;  4XSX A;  3GTO A;  1TWF K;  2NVQ K;  1J6W A;  2KWA A;  3LAP A;  3M4O K;  1EQR A;  1WSV A;  1Y1V C;  3GTQ K;  3AD8 C;  5IYC K;  2V6T A;  3S15 C;  2GAH C;  3GEE A;  4C3J C;  3IPJ A;  4KN7 A;  2D6F C;  2CFA A;  3Q3Q A;  4KMH A;  1TWC C;  2R93 K;  4KDD A;  2E2H K;  3GTG C;  2XCQ A;  3S16 K;  3BUE A;  3LPX A;  5IP9 K;  1WQH A;  4A3K C;  4XCH A;  2E2J C;  3WOD A;  1O24 A;  3GTK A;  3CQZ A;  4BLB A;  1TWF C;  2NVQ C;  1TWA K;  3AQO A;  3HOY K;  4AYB D;  3M4O C;  3RZD K;  3GTQ C;  5IYC C;  4P9S A;  5M3M K;  4OIQ A;  2EBB A;  1J6X A;  1RU0 A;  4PAB A;  1L0W A;  1DCH A;  1IW7 A;  3TTG A;  3I4M K;  1BDF A;  1WOP A;  2E2H C;  1K83 K;  4GTF A;  3S16 C;  4QIW L;  5IP9 C;  3FKI A;  2VUM K;  3OPF A;  3H0G K;  1KQ4 A;  3AQP A;  1VLO A;  4G0W A;  1PJ7 A;  2R92 A;  1XZP B;  2GSO A;  4O2D A;  1SFO A;  1F7U A;  1TWA C;  3HOY C;  3GTJ A;  3RZD C;  1F7V A;  3L4K A;  3S14 K;  3A8K A;  5FJ8 K;  2R7Z A;  1O2B A;  4XLN A;  1INN A;  1R9T A;  3S1M K;  3GEH A;  5M5Y K;  4LOW A;  3I4M C;  3S17 K;  4Y52 K;  4G7Z A;  1K83 C;  3S0X A;  2JA6 K;  3PO3 K;  2VUM C;  1DD5 A;  3H0G C;  5IYB K;  1ZYR A;  4OIP A;  4KMU A;  1TWH K;  3LAJ A;  1Y1V A;  3HKZ L;  4C45 A;  3TFI A;  2PA8 L;  2NVX K;  4GFQ A;  3GIR A;  2E2I K;  1JQW A;  5FLM C;  3ORE A;  3S14 C;  2NVY K;  1B4A A;  1TWC A;  3GTG A;  3S1M C;  3CAG A;  4WJ3 M;  4KAR A;  3S17 C;  4Y52 C;  1YNN A;  2XCO A;  4PAA A;  3SZZ A;  3I4N C;  2GSN A;  2FQT A;  2JA6 C;  3PO3 C;  4MEY A;  1PJ6 A;  2JA7 K;  2B63 K;  1IS1 A;  3AD7 C;  4C2M K;  5IYD C;  5TMC A;  1UV7 A;  4BBS K;  5CHP A;  1WOO A;  1TWF A;  5IYB C;  3DXJ A;  3HOX K;  1TWH C;  2NVX C;  1USO A;  5HL8 A;  2E2I C;  1ZXO A;  1VRQ C;  3PO2 K;  2NVY C;  1C0A A;  1WSR A;  1TWG K;  1ZVU A;  3H3V D;  2E2H A;  4LK0 A;  4A93 K;  1WIH A;  2PHC B;  1DCO A;  4AYB L;  4KM8 A;  3FOF A;  3L4J A;  2Y0S D;  4GTE A;  5C44 K;  3S1Q K;  2JA7 C;  3BP3 A;  4A3E K; 
#chains in the Genus database with same CATH homology
 2B63 C;  3GTM K;  2E2H C;  4BY1 K;  4C3I K;  1K83 K;  2PPB A;  4BBS C;  2Y0S L;  3GTJ C;  4QIW L;  3S16 C;  4KN4 A;  4JK1 A;  3HOX C;  2R7Z K;  3RZO K;  4X6A C;  5IP9 C;  1BDF A;  4C3H K;  1Y1W K;  2VUM K;  3I4N K;  4YG2 A;  2BE5 A;  3H0G K;  5M3F K;  4A3L K;  3GTP K;  4Q5S A;  5C4J K;  2A6H A;  5C4X K;  2YU9 K;  3S1N K;  5IYD K;  2WB1 D;  3HOW K;  4YFK A;  4A3B K;  1TWA C;  2A6E A;  3PO2 C;  4A3D C;  3HOY C;  4A3F C;  2WAQ D;  1TWG C;  2CW0 A;  4YFX A;  4A3M K;  3RZD C;  1I50 K;  3HOU C;  4BY7 C;  4ZH4 A;  2WB1 L;  4A93 C;  5D4D A;  2E2J K;  4QJV A;  3S14 K;  4QJV B;  5FJ8 K;  1XPP A;  2R92 C;  4NOI A;  4Y7N C;  2WAQ L;  4XLN A;  2R93 C;  4XLP A;  1Y1V K;  5C3E K;  1SFO C;  1WCM K;  4YFN A;  3S15 K;  3S1M K;  4A3G C;  5M5Y K;  5C44 C;  3S1Q C;  1I6V A;  3I4M C;  5IP7 K;  3HOV C;  3M3Y K;  4LLG A;  2JA8 K;  3GTM C;  3S17 K;  3HOZ K;  4C3J K;  4BY1 C;  4G7Z A;  1K83 C;  4Y52 K;  3GTO K;  4BXX K;  2JA6 K;  3GTK K;  2R7Z C;  3PO3 K;  4MEX A;  3RZO C;  1TWC K;  4LJZ A;  4A3I K;  1Y1W C;  3CQZ K;  3GTG K;  1R9T C;  2VUM C;  3GTL K;  2PMZ D;  3HKZ D;  3H0G C;  2JA5 K;  2NVT K;  3S2H K;  3GTP C;  4A3L C;  5C4J C;  2PA8 D;  5IYB K;  5C4X C;  4OIO A;  2YU9 C;  1ZYR A;  4OIP A;  4KMU A;  1TWH K;  3S1N C;  4GZY A;  2A68 A;  4A3K K;  4OIN A;  2PMZ L;  3HKZ L;  1HQM A;  3HOW C;  4A3B C;  2O5J A;  2PA8 L;  2NVX K;  1I6H K;  2A69 A;  4A3M C;  3S2D K;  1I50 C;  2E2I K;  4XSX A;  5FLM C;  1TWF K;  2NVQ K;  3S14 C;  2NVY K;  3M4O K;  3S1R K;  2O5I A;  4A3E C;  3GTQ K;  1Y1V C;  5C3E C;  4BBR K;  5IYC K;  1WCM C;  3S15 C;  3S1M C;  1I3Q K;  3M3Y C;  3FKI K;  5IP7 C;  5TMF A;  5M5W K;  2JA8 C;  3S17 C;  1YNJ A;  4Y52 C;  3HOZ C;  1YNN A;  4KN7 A;  4A3C K;  3GTO C;  4OIR A;  3I4N C;  4G7O A;  3K7A K;  4BXX C;  2JA6 C;  4A3J K;  3GTK C;  3PO3 C;  4MEY A;  2JA7 K;  1TWC C;  2R93 K;  2B63 K;  4A3I C;  3CQZ C;  4C2M K;  1SFO K;  2E2H K;  5IYD C;  5TMC A;  3GTG C;  2NVT C;  2JA5 C;  3GTL C;  4BBS K;  2JA7 C;  3GTJ K;  3S16 K;  3S2H C;  5IYB C;  5M5X K;  3DXJ A;  4MQ9 A;  3HOX K;  4G7H A;  4X6A K;  5IP9 K;  1TWH C;  4A3K C;  2E2J C;  3WOD A;  2NVX C;  1I6H C;  1R9T K;  3S2D C;  2E2I C;  1TWF C;  2NVQ C;  1TWA K;  3PO2 K;  4A3D K;  2NVY C;  3HOY K;  4A3F K;  4AYB D;  3M4O C;  1TWG K;  3RZD K;  3S1R C;  3HOU K;  4BY7 K;  1SMY A;  3GTQ C;  3H3V D;  4BBR C;  4LK0 A;  5IYC C;  5M3M K;  4A93 K;  1I3Q C;  3EQL A;  4Q4Z A;  3FKI C;  2R92 K;  4OIQ A;  4Y7N K;  4AYB L;  5FLM K;  2Y0S D;  4A3C C;  3H3V L;  4QIW D;  4A3G K;  3K7A C;  5C44 K;  4A3J C;  3S1Q K;  1IW7 A;  3I4M K;  3HOV K;  4XSZ A;  4LK1 A;  4A3E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...