5C4JK

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c4jK00
4OIOA 4KMUA 4Y7NK 3GTGC 4BXXK 1ZYRA 2WAQL 2Y0SL 4A3DK 4LLGA 4A3JK 4A3BK 3GTPC 4A3EC 2JA8C 3PO2K 1I6HC 4GZYA 2NVQC 2Y0SD 3HOUC 4A3CK 3GTPK 2NVYK 2E2IC 3K7AC 2NVXC 3S16K 2PA8D 5IP9K 1TWGC 3K7AK 4Y52C 4G7ZA 4A3MC 2E2JC 3S1MK 3S1NK 4A3FK 5IP7K 1TWFK 2NVTC 2A6HA 1TWGK 4X6AK 5FLMC 3S1RC 2PMZL 4AYBD 4C3JK 4A3GK 4Y52K 2PA8L 3HOZC 5IP7C 3RZDC 4C3IK 5IYDC 5C44C 3HOUK 1WCMC 5M5YK 2R92K 3HOVC 1WCMK 1I3QK 4OIPA 5C3EK 5IYBK 3HOWK 3S2HC 3S1MC 5M5XK 3I4NC 4NOIA 2A69A 5C4XK 5C3EC 4BY1C 3GTJK 4OINA 3S1RK 3H0GC 1SMYA 3GTOK 4LJZA 4A3JC 4A3BC 3GTQC 3M3YK 5C44K 4BBRC 1I6VA 5IYDK 5C4JK 2VUMK 4QIWL 2E2HC 4MEXA 3GTLK 4A3IC 4XSXA 3CQZK 2VUMC 4A93C 4A3DC 2YU9K 3WODA 1IW7A 4XLPA 4OIRA 5M3FK 4QIWD 1R9TC 3CQZC 2JA5K 4A3EK 3S2DC 4BBSK 4A3GC 1R9TK 1SFOC 2NVYC 2E2IK 2JA5C 5TMFA 2A68A 2O5IA 3GTKK 2WAQD 3S16C 3EQLA 2BE5A 3S15K 2E2JK 4KN4A 3GTLC 4A3LC 4BY7K 4MEYA 3GTKC 4A3FC 2JA7C 3HOYK 3S15C 1TWFC 4Q5SA 1XPPA 4YFKA 2YU9C 3S2HK 4X6AC 3HOXC 4C2MK 2JA7K 2WB1D 4G7HA 3GTMC 3HOYC 4BY1K 1HQMA 1I50K 3H0GK 4KN7A 4YFNA 5D4DA 5IYCK 5M3MK 3HOXK 1Y1WK 4XLNA 2JA6C 4OIQA 3M4OC 2WB1L 2R92C 5IYCC 3I4MK 1I3QC 4XSZA 4BY7C 2O5JA 2E2HK 3S1QK 4A3IK 3I4NK 2CW0A 4A93K 5TMCA 4Y7NC 1Y1VC 3FKIC 4LK1A 3GTQK 3GTMK 3S2DK 1YNNA 4BBSC 2R93K 4BBRK 4A3KK 5C4JC 2B63C 1SFOK 2JA8K 1TWAK 4ZH4A 4Q4ZA 3PO2C 1I6HK 4A3KC 1TWAC 1TWCK 3S1QC 4A3LK 3RZOK 4QJVB 2NVXK 3GTGK 3DXJA 5IP9C 4JK1A 3S1NC 3RZOC 2A6EA 4A3MK 4G7OA 2NVTK 1K83K 5M5WK 5FLMK 3S17K 4A3CC 1YNJA 3S14K 4MQ9A 4C3HK 2B63K 2JA6K 3M4OK 2PMZD 1K83C 4AYBL 3RZDK 3S17C 1TWHK 1TWCC 4LK0A 4YG2A 3I4MC 5FJ8K 2R7ZC 1BDFA 3H3VD 4QJVA 2PPBA 4BXXC 5IYBC 3HOWC 1I50C 3PO3C 2R7ZK 1Y1WC 3HOZK 1Y1VK 3FKIK 3HKZD 2R93C 5C4XC 3GTJC 3GTOC 3H3VL 3PO3K 2NVQK 3S14C 3M3YC 4YFXA 1TWHC 3HOVK 3HKZL
chains in the Genus database with same CATH superfamily
4KMUA 4BXXK 1HI9A 3FOEA 3AD9C 3GTLA 2JA8C 1I6HC 2B63A 2Y0SD 3GTPK 1O28A 1XZPB 2NVXC 2PA8D 2E2JC 3MMLB 4RMFA 4AH6A 4A3MC 1F93A 4A3FK 4KM9A 2A6HA 1EK8A 1TWGK 1EH1A 4BKWA 3S1RC 5IP7C 2CFAB 2E2HA 4C3IK 5C44C 2P8TA 2V6UA 3VA7A 2R92K 3HOVC 1I3QK 4OIPA 3S2HC 1TWFA 3G4CA 5M5XK 3I4NC 3A8JA 2A69A 3CAGA 3GTJK 3GTOK 3S1RK 3G4AA 2ZFZA 2P5MA 5C44K 4BBRC 2VUMK 2E2HC 5CJ9A 1IE0A 1O29A 1WORA 2JA5K 3CQZC 3S2DC 4BBSK 1J98A 4C3JC 1WSVA 4A3GC 2E2IA 1JOEA 3N3YA 2BE5A 4GTDA 2CFAA 4GTLA 1BJTA 1F7VA 4X6AC 1WOOA 3GEEA 1XZQA 4C2MK 3V4GA 3HOYC 4G7HA 1I50K 3H0GK 4KN7A 3HOXK 2FQOA 1WSRA 3GEHA 5IYCC 4C45A 4XSZA 4G0UA 2FQTA 3S1QK 4KB4A 4A3IK 2XCOA 1VLOA 4KDDA 4A93K 5TMCA 3FKIC 3T02A 3GTMK 2NVXA 1YNNA 5C4JC 3RZOK 3N0BA 3GTGA 1ISEA 3DXJA 1O27A 1IQ0A 4G7OA 4JK1A 5M5WK 5FLMK 2ZUFA 3M4OK 2GAHC 2R93A 1K83C 3S17C 4YG2A 2R7ZC 3BUEA 5IYBC 1O2AA 1DD5A 1Y1WC 1Y1VK 1EFWA 4P5BA 1F7UA 3PO3K 3ERED 3S14C 3JSTA 3S0XA 1XZQB 4LR2A 3HKZL 3HOVK 2PHCB 4OIOA 5E68A 4Y7NK 3GTGC 1ZVUA 2Y0SL 2YU9A 1VGXA 2GSOA 4A3JK 1XXBA 4A3EC 3PO2K 4A3CK 3NUHA 1DCHA 2NVYK 2W7VA 3K7AC 5EGHA 1GE9A 3S16K 5IP9K 4Y52C 3SZZA 4G7ZA 3S1NK 5CHPA 2NVTC 1F9NA 4C3JK 4A3GK 3RZDC 4WJ3M 5IYDC 1WCMC 1AB4A 3GTMA 3HOWK 5C3EK 4KASA 2JA7A 5C4XK 1YCLA 4LJZA 4A3BC 3M3YK 3FOFA 2GSNA 5IYDK 4A3IC 1R9TA 4A93C 4QIWD 1B4BA 5IOTA 1O25A 1J6WA 1J6XA 3A8IA 1X31C 1R9TK 1SFOC 2E2IK 5TMFA 2WAQD 4M1XA 3EQLA 2E2JK 4KN4A 4MEYA 3GTKC 1WOSA 1TWFC 1XPPA 4YFKA 2JA7K 5JFEA 4BY1K 3GDZA 3HXAA 1TWHA 4YFNA 5D4DA 1DCOA 3M4OC 4XLNA 4G0WA 3TFHA 1WOPA 4FZBA 3GTJA 3GTOA 2O5JA 3I4NK 2CW0A 4KMDA 1Y1VC 1O26A 4O2DA 2R93K 1TWCA 4BBRK 2B63C 1BGWA 1PJ6A 4ZH4A 4A3KC 1TWAC 1EI6A 1TWCK 3S1QC 4A3LK 4QJVB 1WQGA 3GTGK 4PABA 1ZQ1C 2KWAA 4GTBA 1IL2A 4MQ9A 2B63K 2PMZD 4AYBL 1TWHK 1O2FB 3Q3QA 1VRQC 1Y1VA 1INNA 4KMAA 1I50C 1YX2A 3HKZD 2Y3PA 1BS2A 3FHZA 1JVIA 1ZYRA 4A3DK 4LLGA 1PJ7A 2V6TA 1IBAA 1B4AA 1XXCA 4P9SA 3AH5A 4ILDA 4GZYA 4GT9A 3HOUC 4C3HC 3IPJA 4BLBA 2JA5A 3K7AK 1L0WA 3N0CA 4X6AK 3ADAC 2VUMA 4Y52K 2PMZL 4AYBD 3HOZC 5M5YK 3GTQA 3L4JA 3H0GA 5IYBK 3H0GC 4PAAA 4WJ4A 3GTQC 3OREA 2NVYA 5TJ3A 5C4JK 4QIWL 4XSXA 2VUMC 2YU9K 3WODA 4G0VA 1XZPA 1RU0A 1IW7A 3T00A 1O2BA 2ZUEA 2JA5C 5EGEA 4C3IC 3S15K 4BY7K 3LAJA 2XCQA 4A3FC 3HOYK 2XCRB 4Q5SA 2GSUA 3S2HK 1IS1A 1DCPA 5M3MK 4OIQA 3BP3A 5JVOA 1UV7A 2WB1L 2R92C 1I3QC 2E2HK 5IOSA 1TWGA 4LK1A 1O24A 3AD8C 1KQ4A 2EBBA 4GTAA 1K83A 2JA8K 1ZBSA 4Q4ZA 3GTPA 1I6HK 1WIHA 3LPXA 4LOWA 2NVXK 1G51A 5IP9C 3S1NC 3RZOC 2A6EA 4A3MK 1EQRA 1TWAA 4A3CC 4C3HK 2JA6K 4KB2A 1J6VA 1TWCC 4LK0A 1I50A 3I4MC 2RH6A 4KC6A 1BDFA 3FKIA 4BXXC 2R7ZK 3HOZK 4KM8A 5C4XC 3GTJC 3GTOC 3H3VL 2NVQK 2D6FC 3M3YC 1TWHC 2RGRA 1WQHA 2WAQL 1USMA 3GSIA 3L4KA 4A3BK 3TFIA 3GTKA 3GTPC 2NVQC 3OPFA 2E2IC 1SFOA 5L46A 3AD7C 1TWGC 3CQZA 3S1MK 5IP7K 1TWFK 3GIRA 1I3QA 5FLMC 2R92A 2PA8L 5IOQA 3TFJA 3HOUK 4GFQA 1WCMK 3S1MC 3T01A 4NOIA 5IORA 5C3EC 4BY1C 4OINA 1SMYA 4GTEA 4A3JC 3SZYA 1I6VA 1VJEA 1VH2A 4MEXA 3GTLK 4FM9A 1PJ5A 3CQZK 1ZXOA 4WILA 4A3DC 4GTFA 4XLPA 4OIRA 5M3FK 4GTCA 1R9TC 4A3EK 4KARA 3OEPA 2NVYC 2A68A 2O5IA 4LQYA 3GTKK 1WQFA 3S16C 3GTLC 4A3LC 2GAGC 4C2MC 2JA7C 3S15C 2YU9C 2JH3A 3HOXC 2WB1D 3GTMC 1HQMA 1WCMA 1Y1WK 5IYCK 4KMHA 2JA6C 4XCHA 1XXAA 3I4MK 4BY7C 3A8KA 4KAWX 1JQWA 3LAPA 4Y7NC 1USOA 3GTQK 3S2DK 4BBSC 4A3KK 1C0AA 1SFOK 4DDQA 3AQPA 3PO2C 3TTGA 4P5AA 4BLAA 2V6SA 2NVTK 1K83K 3S17K 1YNJA 3S14K 3QX3A 3AQOA 3RZDK 1Y1WA 5FJ8K 3BP8C 3GEIA 3H3VD 1V5VA 4QJVA 4J3NA 2R7ZA 2PPBA 3HOWC 3PO3C 3FKIK 2R93C 5HL8A 4KATA 4YFXA 2JA6A 1TWAK
chains in the Genus database with same CATH topology
4OIOA 4KMUA 4Y7NK 3GTGC 4BXXK 1ZYRA 2WAQL 2Y0SL 4A3DK 4LLGA 4A3JK 4A3BK 3GTPC 4A3EC 2JA8C 3PO2K 1I6HC 4GZYA 2NVQC 2Y0SD 3HOUC 4A3CK 3GTPK 2NVYK 2E2IC 3K7AC 2NVXC 3S16K 2PA8D 5IP9K 1TWGC 3K7AK 4Y52C 4G7ZA 4A3MC 2E2JC 3S1MK 3S1NK 4A3FK 5IP7K 1TWFK 2NVTC 2A6HA 1TWGK 4X6AK 5FLMC 3S1RC 2PMZL 4AYBD 4C3JK 4A3GK 4Y52K 2PA8L 3HOZC 5IP7C 3RZDC 4C3IK 5IYDC 5C44C 3HOUK 1WCMC 5M5YK 2R92K 3HOVC 1WCMK 1I3QK 4OIPA 5C3EK 5IYBK 3HOWK 3S2HC 3S1MC 5M5XK 3I4NC 4NOIA 2A69A 5C4XK 5C3EC 4BY1C 3GTJK 4OINA 3S1RK 3H0GC 1SMYA 3GTOK 4LJZA 4A3JC 4A3BC 3GTQC 3M3YK 5C44K 4BBRC 1I6VA 5IYDK 5C4JK 2VUMK 4QIWL 2E2HC 4MEXA 3GTLK 4A3IC 4XSXA 3CQZK 2VUMC 4A93C 4A3DC 2YU9K 3WODA 1IW7A 4XLPA 4OIRA 5M3FK 4QIWD 1R9TC 3CQZC 2JA5K 4A3EK 3S2DC 4BBSK 4A3GC 1R9TK 1SFOC 2NVYC 2E2IK 2JA5C 5TMFA 2A68A 2O5IA 3GTKK 2WAQD 3S16C 3EQLA 2BE5A 3S15K 2E2JK 4KN4A 3GTLC 4A3LC 4BY7K 4MEYA 3GTKC 4A3FC 2JA7C 3HOYK 3S15C 1TWFC 4Q5SA 1XPPA 4YFKA 2YU9C 3S2HK 4X6AC 3HOXC 4C2MK 2JA7K 2WB1D 4G7HA 3GTMC 3HOYC 4BY1K 1HQMA 1I50K 3H0GK 4KN7A 4YFNA 5D4DA 5IYCK 5M3MK 3HOXK 1Y1WK 4XLNA 2JA6C 4OIQA 3M4OC 2WB1L 2R92C 5IYCC 3I4MK 1I3QC 4XSZA 4BY7C 2O5JA 2E2HK 3S1QK 4A3IK 3I4NK 2CW0A 4A93K 5TMCA 4Y7NC 1Y1VC 3FKIC 4LK1A 3GTQK 3GTMK 3S2DK 1YNNA 4BBSC 2R93K 4BBRK 4A3KK 5C4JC 2B63C 1SFOK 2JA8K 1TWAK 4ZH4A 4Q4ZA 3PO2C 1I6HK 4A3KC 1TWAC 1TWCK 3S1QC 4A3LK 3RZOK 4QJVB 2NVXK 3GTGK 3DXJA 5IP9C 4JK1A 3S1NC 3RZOC 2A6EA 4A3MK 4G7OA 2NVTK 1K83K 5M5WK 5FLMK 3S17K 4A3CC 1YNJA 3S14K 4MQ9A 4C3HK 2B63K 2JA6K 3M4OK 2PMZD 1K83C 4AYBL 3RZDK 3S17C 1TWHK 1TWCC 4LK0A 4YG2A 3I4MC 5FJ8K 2R7ZC 1BDFA 3H3VD 4QJVA 2PPBA 4BXXC 5IYBC 3HOWC 1I50C 3PO3C 2R7ZK 1Y1WC 3HOZK 1Y1VK 3FKIK 3HKZD 2R93C 5C4XC 3GTJC 3GTOC 3H3VL 3PO3K 2NVQK 3S14C 3M3YC 4YFXA 1TWHC 3HOVK 3HKZL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIO A;  4KMU A;  4Y7N K;  3GTG C;  4BXX K;  1ZYR A;  2WAQ L;  2Y0S L;  4A3D K;  4LLG A;  4A3J K;  4A3B K;  3GTP C;  4A3E C;  2JA8 C;  3PO2 K;  1I6H C;  4GZY A;  2NVQ C;  2Y0S D;  3HOU C;  4A3C K;  3GTP K;  2NVY K;  2E2I C;  3K7A C;  2NVX C;  3S16 K;  2PA8 D;  5IP9 K;  1TWG C;  3K7A K;  4Y52 C;  4G7Z A;  4A3M C;  2E2J C;  3S1M K;  3S1N K;  4A3F K;  5IP7 K;  1TWF K;  2NVT C;  2A6H A;  1TWG K;  4X6A K;  5FLM C;  3S1R C;  2PMZ L;  4AYB D;  4C3J K;  4A3G K;  4Y52 K;  2PA8 L;  3HOZ C;  5IP7 C;  3RZD C;  4C3I K;  5IYD C;  5C44 C;  3HOU K;  1WCM C;  5M5Y K;  2R92 K;  3HOV C;  1WCM K;  1I3Q K;  4OIP A;  5C3E K;  5IYB K;  3HOW K;  3S2H C;  3S1M C;  5M5X K;  3I4N C;  4NOI A;  2A69 A;  5C4X K;  5C3E C;  4BY1 C;  3GTJ K;  4OIN A;  3S1R K;  3H0G C;  1SMY A;  3GTO K;  4LJZ A;  4A3J C;  4A3B C;  3GTQ C;  3M3Y K;  5C44 K;  4BBR C;  1I6V A;  5IYD K;  5C4J K;  2VUM K;  4QIW L;  2E2H C;  4MEX A;  3GTL K;  4A3I C;  4XSX A;  3CQZ K;  2VUM C;  4A93 C;  4A3D C;  2YU9 K;  3WOD A;  1IW7 A;  4XLP A;  4OIR A;  5M3F K;  4QIW D;  1R9T C;  3CQZ C;  2JA5 K;  4A3E K;  3S2D C;  4BBS K;  4A3G C;  1R9T K;  1SFO C;  2NVY C;  2E2I K;  2JA5 C;  5TMF A;  2A68 A;  2O5I A;  3GTK K;  2WAQ D;  3S16 C;  3EQL A;  2BE5 A;  3S15 K;  2E2J K;  4KN4 A;  3GTL C;  4A3L C;  4BY7 K;  4MEY A;  3GTK C;  4A3F C;  2JA7 C;  3HOY K;  3S15 C;  1TWF C;  4Q5S A;  1XPP A;  4YFK A;  2YU9 C;  3S2H K;  4X6A C;  3HOX C;  4C2M K;  2JA7 K;  2WB1 D;  4G7H A;  3GTM C;  3HOY C;  4BY1 K;  1HQM A;  1I50 K;  3H0G K;  4KN7 A;  4YFN A;  5D4D A;  5IYC K;  5M3M K;  3HOX K;  1Y1W K;  4XLN A;  2JA6 C;  4OIQ A;  3M4O C;  2WB1 L;  2R92 C;  5IYC C;  3I4M K;  1I3Q C;  4XSZ A;  4BY7 C;  2O5J A;  2E2H K;  3S1Q K;  4A3I K;  3I4N K;  2CW0 A;  4A93 K;  5TMC A;  4Y7N C;  1Y1V C;  3FKI C;  4LK1 A;  3GTQ K;  3GTM K;  3S2D K;  1YNN A;  4BBS C;  2R93 K;  4BBR K;  4A3K K;  5C4J C;  2B63 C;  1SFO K;  2JA8 K;  1TWA K;  4ZH4 A;  4Q4Z A;  3PO2 C;  1I6H K;  4A3K C;  1TWA C;  1TWC K;  3S1Q C;  4A3L K;  3RZO K;  4QJV B;  2NVX K;  3GTG K;  3DXJ A;  5IP9 C;  4JK1 A;  3S1N C;  3RZO C;  2A6E A;  4A3M K;  4G7O A;  2NVT K;  1K83 K;  5M5W K;  5FLM K;  3S17 K;  4A3C C;  1YNJ A;  3S14 K;  4MQ9 A;  4C3H K;  2B63 K;  2JA6 K;  3M4O K;  2PMZ D;  1K83 C;  4AYB L;  3RZD K;  3S17 C;  1TWH K;  1TWC C;  4LK0 A;  4YG2 A;  3I4M C;  5FJ8 K;  2R7Z C;  1BDF A;  3H3V D;  4QJV A;  2PPB A;  4BXX C;  5IYB C;  3HOW C;  1I50 C;  3PO3 C;  2R7Z K;  1Y1W C;  3HOZ K;  1Y1V K;  3FKI K;  3HKZ D;  2R93 C;  5C4X C;  3GTJ C;  3GTO C;  3H3V L;  3PO3 K;  2NVQ K;  3S14 C;  3M3Y C;  4YFX A;  1TWH C;  3HOV K;  3HKZ L; 
#chains in the Genus database with same CATH topology
 4KMU A;  4BXX K;  1HI9 A;  3FOE A;  3AD9 C;  3GTL A;  2JA8 C;  1I6H C;  2B63 A;  2Y0S D;  3GTP K;  1O28 A;  1XZP B;  2NVX C;  2PA8 D;  2E2J C;  3MML B;  4RMF A;  4AH6 A;  4A3M C;  1F93 A;  4A3F K;  4KM9 A;  2A6H A;  1EK8 A;  1TWG K;  1EH1 A;  4BKW A;  3S1R C;  5IP7 C;  2CFA B;  2E2H A;  4C3I K;  5C44 C;  2P8T A;  2V6U A;  3VA7 A;  2R92 K;  3HOV C;  1I3Q K;  4OIP A;  3S2H C;  1TWF A;  3G4C A;  5M5X K;  3I4N C;  3A8J A;  2A69 A;  3CAG A;  3GTJ K;  3GTO K;  3S1R K;  3G4A A;  2ZFZ A;  2P5M A;  5C44 K;  4BBR C;  2VUM K;  2E2H C;  5CJ9 A;  1IE0 A;  1O29 A;  1WOR A;  2JA5 K;  3CQZ C;  3S2D C;  4BBS K;  1J98 A;  4C3J C;  1WSV A;  4A3G C;  2E2I A;  1JOE A;  3N3Y A;  2BE5 A;  4GTD A;  2CFA A;  4GTL A;  1BJT A;  1F7V A;  4X6A C;  1WOO A;  3GEE A;  1XZQ A;  4C2M K;  3V4G A;  3HOY C;  4G7H A;  1I50 K;  3H0G K;  4KN7 A;  3HOX K;  2FQO A;  1WSR A;  3GEH A;  5IYC C;  4C45 A;  4XSZ A;  4G0U A;  2FQT A;  3S1Q K;  4KB4 A;  4A3I K;  2XCO A;  1VLO A;  4KDD A;  4A93 K;  5TMC A;  3FKI C;  3T02 A;  3GTM K;  2NVX A;  1YNN A;  5C4J C;  3RZO K;  3N0B A;  3GTG A;  1ISE A;  3DXJ A;  1O27 A;  1IQ0 A;  4G7O A;  4JK1 A;  5M5W K;  5FLM K;  2ZUF A;  3M4O K;  2GAH C;  2R93 A;  1K83 C;  3S17 C;  4YG2 A;  2R7Z C;  3BUE A;  5IYB C;  1O2A A;  1DD5 A;  1Y1W C;  1Y1V K;  1EFW A;  4P5B A;  1F7U A;  3PO3 K;  3ERE D;  3S14 C;  3JST A;  3S0X A;  1XZQ B;  4LR2 A;  3HKZ L;  3HOV K;  2PHC B;  4OIO A;  5E68 A;  4Y7N K;  3GTG C;  1ZVU A;  2Y0S L;  2YU9 A;  1VGX A;  2GSO A;  4A3J K;  1XXB A;  4A3E C;  3PO2 K;  4A3C K;  3NUH A;  1DCH A;  2NVY K;  2W7V A;  3K7A C;  5EGH A;  1GE9 A;  3S16 K;  5IP9 K;  4Y52 C;  3SZZ A;  4G7Z A;  3S1N K;  5CHP A;  2NVT C;  1F9N A;  4C3J K;  4A3G K;  3RZD C;  4WJ3 M;  5IYD C;  1WCM C;  1AB4 A;  3GTM A;  3HOW K;  5C3E K;  4KAS A;  2JA7 A;  5C4X K;  1YCL A;  4LJZ A;  4A3B C;  3M3Y K;  3FOF A;  2GSN A;  5IYD K;  4A3I C;  1R9T A;  4A93 C;  4QIW D;  1B4B A;  5IOT A;  1O25 A;  1J6W A;  1J6X A;  3A8I A;  1X31 C;  1R9T K;  1SFO C;  2E2I K;  5TMF A;  2WAQ D;  4M1X A;  3EQL A;  2E2J K;  4KN4 A;  4MEY A;  3GTK C;  1WOS A;  1TWF C;  1XPP A;  4YFK A;  2JA7 K;  5JFE A;  4BY1 K;  3GDZ A;  3HXA A;  1TWH A;  4YFN A;  5D4D A;  1DCO A;  3M4O C;  4XLN A;  4G0W A;  3TFH A;  1WOP A;  4FZB A;  3GTJ A;  3GTO A;  2O5J A;  3I4N K;  2CW0 A;  4KMD A;  1Y1V C;  1O26 A;  4O2D A;  2R93 K;  1TWC A;  4BBR K;  2B63 C;  1BGW A;  1PJ6 A;  4ZH4 A;  4A3K C;  1TWA C;  1EI6 A;  1TWC K;  3S1Q C;  4A3L K;  4QJV B;  1WQG A;  3GTG K;  4PAB A;  1ZQ1 C;  2KWA A;  4GTB A;  1IL2 A;  4MQ9 A;  2B63 K;  2PMZ D;  4AYB L;  1TWH K;  1O2F B;  3Q3Q A;  1VRQ C;  1Y1V A;  1INN A;  4KMA A;  1I50 C;  1YX2 A;  3HKZ D;  2Y3P A;  1BS2 A;  3FHZ A;  1JVI A;  1ZYR A;  4A3D K;  4LLG A;  1PJ7 A;  2V6T A;  1IBA A;  1B4A A;  1XXC A;  4P9S A;  3AH5 A;  4ILD A;  4GZY A;  4GT9 A;  3HOU C;  4C3H C;  3IPJ A;  4BLB A;  2JA5 A;  3K7A K;  1L0W A;  3N0C A;  4X6A K;  3ADA C;  2VUM A;  4Y52 K;  2PMZ L;  4AYB D;  3HOZ C;  5M5Y K;  3GTQ A;  3L4J A;  3H0G A;  5IYB K;  3H0G C;  4PAA A;  4WJ4 A;  3GTQ C;  3ORE A;  2NVY A;  5TJ3 A;  5C4J K;  4QIW L;  4XSX A;  2VUM C;  2YU9 K;  3WOD A;  4G0V A;  1XZP A;  1RU0 A;  1IW7 A;  3T00 A;  1O2B A;  2ZUE A;  2JA5 C;  5EGE A;  4C3I C;  3S15 K;  4BY7 K;  3LAJ A;  2XCQ A;  4A3F C;  3HOY K;  2XCR B;  4Q5S A;  2GSU A;  3S2H K;  1IS1 A;  1DCP A;  5M3M K;  4OIQ A;  3BP3 A;  5JVO A;  1UV7 A;  2WB1 L;  2R92 C;  1I3Q C;  2E2H K;  5IOS A;  1TWG A;  4LK1 A;  1O24 A;  3AD8 C;  1KQ4 A;  2EBB A;  4GTA A;  1K83 A;  2JA8 K;  1ZBS A;  4Q4Z A;  3GTP A;  1I6H K;  1WIH A;  3LPX A;  4LOW A;  2NVX K;  1G51 A;  5IP9 C;  3S1N C;  3RZO C;  2A6E A;  4A3M K;  1EQR A;  1TWA A;  4A3C C;  4C3H K;  2JA6 K;  4KB2 A;  1J6V A;  1TWC C;  4LK0 A;  1I50 A;  3I4M C;  2RH6 A;  4KC6 A;  1BDF A;  3FKI A;  4BXX C;  2R7Z K;  3HOZ K;  4KM8 A;  5C4X C;  3GTJ C;  3GTO C;  3H3V L;  2NVQ K;  2D6F C;  3M3Y C;  1TWH C;  2RGR A;  1WQH A;  2WAQ L;  1USM A;  3GSI A;  3L4K A;  4A3B K;  3TFI A;  3GTK A;  3GTP C;  2NVQ C;  3OPF A;  2E2I C;  1SFO A;  5L46 A;  3AD7 C;  1TWG C;  3CQZ A;  3S1M K;  5IP7 K;  1TWF K;  3GIR A;  1I3Q A;  5FLM C;  2R92 A;  2PA8 L;  5IOQ A;  3TFJ A;  3HOU K;  4GFQ A;  1WCM K;  3S1M C;  3T01 A;  4NOI A;  5IOR A;  5C3E C;  4BY1 C;  4OIN A;  1SMY A;  4GTE A;  4A3J C;  3SZY A;  1I6V A;  1VJE A;  1VH2 A;  4MEX A;  3GTL K;  4FM9 A;  1PJ5 A;  3CQZ K;  1ZXO A;  4WIL A;  4A3D C;  4GTF A;  4XLP A;  4OIR A;  5M3F K;  4GTC A;  1R9T C;  4A3E K;  4KAR A;  3OEP A;  2NVY C;  2A68 A;  2O5I A;  4LQY A;  3GTK K;  1WQF A;  3S16 C;  3GTL C;  4A3L C;  2GAG C;  4C2M C;  2JA7 C;  3S15 C;  2YU9 C;  2JH3 A;  3HOX C;  2WB1 D;  3GTM C;  1HQM A;  1WCM A;  1Y1W K;  5IYC K;  4KMH A;  2JA6 C;  4XCH A;  1XXA A;  3I4M K;  4BY7 C;  3A8K A;  4KAW X;  1JQW A;  3LAP A;  4Y7N C;  1USO A;  3GTQ K;  3S2D K;  4BBS C;  4A3K K;  1C0A A;  1SFO K;  4DDQ A;  3AQP A;  3PO2 C;  3TTG A;  4P5A A;  4BLA A;  2V6S A;  2NVT K;  1K83 K;  3S17 K;  1YNJ A;  3S14 K;  3QX3 A;  3AQO A;  3RZD K;  1Y1W A;  5FJ8 K;  3BP8 C;  3GEI A;  3H3V D;  1V5V A;  4QJV A;  4J3N A;  2R7Z A;  2PPB A;  3HOW C;  3PO3 C;  3FKI K;  2R93 C;  5HL8 A;  4KAT A;  4YFX A;  2JA6 A;  1TWA K; 
#chains in the Genus database with same CATH homology
 4OIO A;  4KMU A;  4Y7N K;  3GTG C;  4BXX K;  1ZYR A;  2WAQ L;  2Y0S L;  4A3D K;  4LLG A;  4A3J K;  4A3B K;  3GTP C;  4A3E C;  2JA8 C;  3PO2 K;  1I6H C;  4GZY A;  2NVQ C;  2Y0S D;  3HOU C;  4A3C K;  3GTP K;  2NVY K;  2E2I C;  3K7A C;  2NVX C;  3S16 K;  2PA8 D;  5IP9 K;  1TWG C;  3K7A K;  4Y52 C;  4G7Z A;  4A3M C;  2E2J C;  3S1M K;  3S1N K;  4A3F K;  5IP7 K;  1TWF K;  2NVT C;  2A6H A;  1TWG K;  4X6A K;  5FLM C;  3S1R C;  2PMZ L;  4AYB D;  4C3J K;  4A3G K;  4Y52 K;  2PA8 L;  3HOZ C;  5IP7 C;  3RZD C;  4C3I K;  5IYD C;  5C44 C;  3HOU K;  1WCM C;  5M5Y K;  2R92 K;  3HOV C;  1WCM K;  1I3Q K;  4OIP A;  5C3E K;  5IYB K;  3HOW K;  3S2H C;  3S1M C;  5M5X K;  3I4N C;  4NOI A;  2A69 A;  5C4X K;  5C3E C;  4BY1 C;  3GTJ K;  4OIN A;  3S1R K;  3H0G C;  1SMY A;  3GTO K;  4LJZ A;  4A3J C;  4A3B C;  3GTQ C;  3M3Y K;  5C44 K;  4BBR C;  1I6V A;  5IYD K;  5C4J K;  2VUM K;  4QIW L;  2E2H C;  4MEX A;  3GTL K;  4A3I C;  4XSX A;  3CQZ K;  2VUM C;  4A93 C;  4A3D C;  2YU9 K;  3WOD A;  1IW7 A;  4XLP A;  4OIR A;  5M3F K;  4QIW D;  1R9T C;  3CQZ C;  2JA5 K;  4A3E K;  3S2D C;  4BBS K;  4A3G C;  1R9T K;  1SFO C;  2NVY C;  2E2I K;  2JA5 C;  5TMF A;  2A68 A;  2O5I A;  3GTK K;  2WAQ D;  3S16 C;  3EQL A;  2BE5 A;  3S15 K;  2E2J K;  4KN4 A;  3GTL C;  4A3L C;  4BY7 K;  4MEY A;  3GTK C;  4A3F C;  2JA7 C;  3HOY K;  3S15 C;  1TWF C;  4Q5S A;  1XPP A;  4YFK A;  2YU9 C;  3S2H K;  4X6A C;  3HOX C;  4C2M K;  2JA7 K;  2WB1 D;  4G7H A;  3GTM C;  3HOY C;  4BY1 K;  1HQM A;  1I50 K;  3H0G K;  4KN7 A;  4YFN A;  5D4D A;  5IYC K;  5M3M K;  3HOX K;  1Y1W K;  4XLN A;  2JA6 C;  4OIQ A;  3M4O C;  2WB1 L;  2R92 C;  5IYC C;  3I4M K;  1I3Q C;  4XSZ A;  4BY7 C;  2O5J A;  2E2H K;  3S1Q K;  4A3I K;  3I4N K;  2CW0 A;  4A93 K;  5TMC A;  4Y7N C;  1Y1V C;  3FKI C;  4LK1 A;  3GTQ K;  3GTM K;  3S2D K;  1YNN A;  4BBS C;  2R93 K;  4BBR K;  4A3K K;  5C4J C;  2B63 C;  1SFO K;  2JA8 K;  1TWA K;  4ZH4 A;  4Q4Z A;  3PO2 C;  1I6H K;  4A3K C;  1TWA C;  1TWC K;  3S1Q C;  4A3L K;  3RZO K;  4QJV B;  2NVX K;  3GTG K;  3DXJ A;  5IP9 C;  4JK1 A;  3S1N C;  3RZO C;  2A6E A;  4A3M K;  4G7O A;  2NVT K;  1K83 K;  5M5W K;  5FLM K;  3S17 K;  4A3C C;  1YNJ A;  3S14 K;  4MQ9 A;  4C3H K;  2B63 K;  2JA6 K;  3M4O K;  2PMZ D;  1K83 C;  4AYB L;  3RZD K;  3S17 C;  1TWH K;  1TWC C;  4LK0 A;  4YG2 A;  3I4M C;  5FJ8 K;  2R7Z C;  1BDF A;  3H3V D;  4QJV A;  2PPB A;  4BXX C;  5IYB C;  3HOW C;  1I50 C;  3PO3 C;  2R7Z K;  1Y1W C;  3HOZ K;  1Y1V K;  3FKI K;  3HKZ D;  2R93 C;  5C4X C;  3GTJ C;  3GTO C;  3H3V L;  3PO3 K;  2NVQ K;  3S14 C;  3M3Y C;  4YFX A;  1TWH C;  3HOV K;  3HKZ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...