5C4WB

Crystal structure of coxsackievirus a16
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
245
Chain Sequence
b'SDRVAQLTIGNSTITTQEAANIVIAYGEWPEYCPDTDATAVDKPTRPDVSVNRFFTLDTKSWAKDSKGWYWKFPDVLTEVGVFGQNAQFHYLYRSGFCVHVQCNASKFHQGALLVAVLPEYVLGTIAGGTGNENSHPPYATTQPGQVGAVLTHPYVLDAGIPLSQLTVCPHQWINLRTNNCATIIVPYMNTVPFDSALNHCNFGLLVIPVVPLDFNTGATSEIPITVTIAPMCAEFAGLRQAVKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
molecule tags Virus
total genus 52
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c4wB00
2HWF1 4JGYA 3VDDB 1AR72 1AYN1 1BBT3 2RR12 1ASJ2 3J8F2 1AR93 3VBOA 1DDLA 4FTSA 5FOJB 1C8M2 1HQNA 4RHV2 1HRI2 1EV11 5J98B 1VBC2 5A33B 1V9U1 4Z92B 1HRV2 1PIV3 1QJY2 1PVC2 2RS13 4Q4W2 1CJDA 4RFT0 1Z7S1 3ZFGC 2RS31 1CD3G 3VBFC 3JBG3 1VBD2 1VBB3 2WS91 4Q4X1 3ZFGA 1COV2 3NAPB 1HXS2 1R092 1AR71 2RR11 1ZBE2 1ASJ1 4JGYB 3J8F1 2ZTNA 1C8M1 1A6CA 1AUYA 2IZWA 4LLFA 4RHV1 4PDWC 1HRI1 4JGZA 4YVSC 1VBC1 3DPRC 2R062 1HRV1 1QJY1 4YVSA 2MEV2 2WZR2 1RUG3 1FOD3 1PVC1 4Q4W1 1D4M2 4Y4YA 2WFF2 1OPOA 1VBD1 1COV1 1R1A3 1H8TC 1HXS1 4CDUC 1R091 1VB2A 3VBHC 1OHFA 2BFUL 3ZFGB 1ZBE1 2HWC3 1NG0A 1PGL2 1QQP2 1H8TA 4RS5C 3JB8A 1ND3C 4CDUA 3VBHA 4RS5A 1TMF3 1RVF2 5BNPC 1RB8G 5BNPA 3HAGA 2R061 4JGZB 1F2NA 2HWD2 2MEV1 2WZR1 1NCRC 4PDWB 2X5IC 4YVSB 1MEC2 1AL23 1D4M1 1NCRA 5C8CC 3JD73 3DPRB 1AR92 2WFF1 2X5IA 1RUD3 4N53C 5C8CA 3VDDC 4RQPC 4N53A 1PGL1 3VBSA 1QQP1 1POV0 1QJU3 4RQPA 5L7OC 1H8TB 1PIV2 1AR63 3LOBA 1NCQC 4CDUB 3VBHB 1RVF1 2Y26A 1TME3 2GH8A 4RS5B 5L7OA 1NCQA 1ND3B 1AR82 1AL0G 1W39A 1VBB2 4AEDC 2HWD1 5BNPB 2RMU3 4AEDA 1MEC1 5GKAC 1AR91 1NCRB 1R083 2X5IB 5C8CB 1VB4A 2HWE3 1FMD3 4N53B 1RUJ3 3VBSB 1PIV1 1B35C 1RUG2 1FOD2 4RQPB 3VBOC 1VAKA 1B35A 2RS11 1AR81 5L7OB 4WM8C 3JBG1 1PO23 1VBB1 5CFDC 1NCQB 1R1A2 2DF7A 1VBE3 4QPGC 4FTEA 4WM8A 5CFDA 2HWC2 4QPGA 4AEDB 5BNOC 1TMF2 5BNOA 1AYM3 2BUKA 4Q4Y3 1K5MC 4NWVA 1RUF1 1RUG1 1FOD1 1K5MA 1AL22 3JD72 1B35B 4GB33 4RR3C 1RUD2 4JGZC 1R1A1 1RUF3 3VBOB 2HWB3 3TN93 1RUI3 4RR3A 2HWC1 3FBMA 4WM8B 5CFDB 1QJU2 1AR62 1F8VA 4QPGB 1TMF1 1TME2 4Q4V3 5BNOB 4QPIC 3ZXAC 1MQTC 3ZFEC 4GH4C 5ABJC 4QPIA 1C8NA 3VBUC 1AL21 1MQTA 3ZFEA 3JD71 1OOPC 1IHMA 4GH4A 1K5MB 1PO13 1Z7S3 5ABJA 5JZGC 1RUD1 3VBUA 5J96B 1OOPA 1R082 2WWSA 1RHI3 5JZGA 2PLV3 2HWE2 1E57A 1ASJ3 1FMD2 2WLPA 4RR3B 1RUJ2 1QJU1 4BCUA 4CEYC 1AR61 1RMU3 5C4WC 1FPN3 1TME1 1BBT2 4CEYA 4N43C 5C4WA 1NA1C 1M06G 1PO22 2XBO3 3ZFFC 4N43A 2RS53 5CFCA 3VBSC 1NA1A 1VBE2 5FMOS 3ZFFA 3CJIC 4QPIB 1BEV3 3CJIA 1MQTB 3ZFEB 4GH4B 1VBD3 1R081 5ABJB 2BPA2 3VBUB 1OOPB 2RS12 2HWE1 1AYM2 1POV3 2R043 1ZBE3 5AC93 5JZGB 1FMD1 1RUJ1 3JBG2 1HX6A 1RUE3 2BBVA 1BBT1 5FMOL 4FTBA 4CEYB 1PO21 4GB32 2TBVA 2RM23 2R063 5D8AC 5C4WB 5K0UC 1VBE1 2HWB2 3TN92 5ACA3 1RUI2 4N43B 5D8AA 1NA1B 5K0UA 3ZFFB 2FZ1A 4CDQC 3CJIB 1PGW2 1GFF2 3S6PA 4CDQA 1AYM1 4Q4V2 1VRH3 1RUH3 4Q4Y1 5DDJ3 1X36A 4FSJA 2QQPA 1QJX3 5LK7B 1PO12 2GSYA 4GB31 1RHI2 1RUC3 2HWB1 3TN91 1RUI1 2XPJA 2PLV2 5A32A 5BNNC 4IV1C 2BFUS 1MEC3 4NWWA 1ZBA3 5BNNA 5D8AB 4CEWC 5C9AC 4IV1A 4Y5Z0 4GMP0 5K0UB 1RMU2 2R073 1PGW1 1FPN2 1NY72 4CEWA 1EAH3 5C9AA 4Q4V1 4YVWC 4GMP3 4CDQB 2XBO2 1VBA3 2RS52 4YVWA 2HWF3 1AYN3 2ZAHA 1PO11 1AR83 1BEV2 3VBRC 1QJZA 1RHI1 2PLV1 3VBFA 3VBRA 2R042 5AC92 5A32B 1EV13 1V9U3 4CDXC 1RMU1 1RUE2 5BNNB 2RMU2 4IV1B 1FPN1 1NY71 4CDXA 4CEWB 5C9AB 2RS33 2XBO1 2RM22 2RS51 4PDWA 1SMVA 1WCDJ 2WS93 4Q4X3 5ACA2 3DPRA 4YVWB 1AR73 2RR13 1BEV1 3J8F3 1C8M3 4RHV3 5CFCC 4CDWC 1POV1 1HRI3 2R041 1VRH2 1RUH2 5AC91 5DDJ2 3VBFB 3VBRB 1VBC3 4CDWA 1RUE1 1HRV3 1QJY3 2RMU1 1ND3A 1PVC3 1QJX2 4Q4W3 4CDXB 4IV3C 1ND2C 2RM21 1BMV2 1COV3 1RUC2 5ACA1 1HXS3 4IV3A 1ND2A 1R093 3JB4C 4Q4Y2 1ZBA2 2VQ0A 3IDEA 2R072 4WM7C 1EAH2 1VRH1 1RUH1 5DDJ1 4WM7A 1VBA2 3VDDA 1RUF2 2MEV3 2WZR3 2FZ2A 5CFCB 2HWF2 4CDWB 1QJX1 1AYN2 1D4M3 1X33A 2WFF3 1NOVA 1BMV1 1RUC1 4SBVA 4EJRA 5A33A 4IV3B 1ND2B 1QQP3 1ZBA1 1EV12 1V9U2 2ZZQA 2R071 1RVF3 1EAH1 3NAPC 4GMP1 1Z7S2 2RS32 1VBA1 3NAPA 4JGYC 3M8LA 2WS92 2HWD3 4Q4X2 4WM7B
chains in the Genus database with same CATH superfamily
5GJ6A 3VUOA 5FBZA 2HWF1 5CISA 3CL1A 3N7LA 5LA9A 4NUBA 2ZX3A 3LF7A 4Q29A 4C91A 5KHKA 1OVPA 1AR93 2Y60A 2XH6A 1GNZA 3HIFA 5CG8A 4EROA 4LEJA 3C8XA 1HQNA 1YIFA 1E5RA 5FZKA 5FYUA 3J7HA 1SLTA 3C3VA 3O1OA 5FBJA 3SCHA 2E9QA 1VALA 4LO5B 2VGDA 4QDSA 4E4SA 1V9U1 4HK8A 4Y1ZA 3NO8A 1QJY2 2J1SA 5FUNA 3POJA 1IG0A 3ACIA 4FFFA 1SBDA 2D40A 3MEPA 4Q4W2 1CJDA 1GLHA 5I8SA 4I30A 4UFKA 1W8TA 4XJUA 1A78A 3D82A 4XPVA 2EIEA 1VBD2 2WS91 2YGMA 5IW0A 5DMYA 1Y9QA 4BB3A 1K3IA 4M0NA 3OSDA 2ZGPA 4ISQA 1NLRA 2GDFA 2UWCA 1W6OA 3FHAA 2WO1A 1UNBA 3OGGA 4ZY9A 4JGYB 4D0QA 1HQWA 1L7QA 4PI2A 4XJZA 5FZ1A 2K9ZA 2ZTNA 1QH7A 2VUJA 2GP5A 1TNFA 2BGCA 1A6CA 2UYBA 4U2AA 2ZGQA 2PAKA 5DZFA 5A6YA 4LLFA 4RHV1 3VD5A 5JMOA 2BBAA 4PDWC 4LT5A 5KHGA 4YW2A 5JVVA 2XG3A 1DGRN 1VBC1 2EXKA 3NV4A 4YVSA 3KLSA 2WZR2 4KWKA 3RMYA 4CXXA 4MVTA 1DQ2A 4MXWA 1DHKB 1PVC1 2FQPA 2YBKA 4QDRA 2OKXA 1TNRA 3HT2A 4PIZA 3WG2A 1WW5A 3VZKA 2V73A 5KHIA 2WFF2 4BH9A 1LCLA 3OD0A 1Q5OA 3VKOA 1AXYA 1W05A 1H8TC 1ZREA 5FZOB 5DN2A 1OHFA 2D93A 3ZXLA 2HWC3 4J1XA 4FFGA 3CZUA 1ND3C 1OQDA 3VBHA 4CDUA 1MS4A 3WP4A 1LGBA 4FPCA 2ET1A 1XPWA 3I59B 1TMF3 3B9IA 1OVSA 1AXKA 3MIBA 3VZJA 4E2GA 2C6SA 4RSUA 4D6QA 3PNAA 4FP2A 3TEXA 1CAXA 3ZX7A 5GZEA 1W3VA 1V6NA 1MVQA 2ZHLA 1YXWA 1W2OA 3IM0A 4PJYA 3WUCA 5BNPA 2IFRA 1WMFA 4YZ2A 1Y9MA 2BNNA 4PDWB 3OF1A 1KDMA 1XOYA 2BYVE 2JENA 1NCRA 3PHMA 1CAWB 2JECA 4CUBA 2QQKA 3PDQA 4AVTA 5FPUA 1LHWA 1RUD3 2YC2A 4N53C 1WZXA 3POFA 4QGLA 4WVZA 3ZSMA 4AK3A 3TOJA 1V00A 1QF3A 3U14A 3I2OA 1QQP1 1U5YA 4AI8A 4LHSA 1N3PA 3OY8A 2RVAA 1KXGA 4BA6A 1JYTA 4K3UA 1H8TB 3LIGA 4QGMA 2YMZA 2VY0A 2A6WA 1TME3 1RJ7A 3CIHA 4XJWA 1XSQA 1NCQA 1ND3B 5FLIA 4DMIA 1J1TA 4XUPA 1AL0G 3S5QA 1PM7A 3HJRA 5A7WA 3T2OA 2HWD1 4E8CA 5JOWA 3VZMA 1QWRA 4XHXA 2C1FA 2RMU3 3M3CA 4AEDA 2FDIA 1UKGA 1ENRA 3AMQA 5FYBA 5GKAC 4CCMA 5ERLA 1MS5A 1HQLA 2P17A 3PURA 5LBEA 3WUDA 2DVDA 3J26N 1R083 2W3JA 4FT8A 1O3QA 5CZKA 3U37A 3OGVA 2ET7A 5LRRA 5FOBB 1UOGA 4YGCA 5F1RA 2JJ6A 2LS6A 4LK6A 3B3QE 2IXIA 4O9GA 4N53B 2DV9A 2ZGTA 1PIV1 3FE5A 1B35C 1JS9A 5LB6A 1JOPA 4CXWA 3PVNA 5JXHA 3AFGA 5A1LA 3Q8FA 3AP4A 2RS11 1H2MA 1GNHA 1RINA 1VBB1 2A6VA 2AREA 2LM3A 3EO6A 3JBG1 4ZS2A 5GZFA 3V65A 5K9YA 1R1A2 2RE9A 2IXCA 4WM8A 5CEHA 4R52A 5F3EA 5FCCA 2KM2A 5A7NA 3SKVA 1S0GA 2P34A 1UY0A 3HNBM 3ECQA 1ENSA 1KRIA 5EYYA 4RL7A 5F5CA 3H8UA 5FYVA 3SXWA 4EZ4A 4XTPA 4XVHA 1UOJA 4NVPA 3H8XA 1OXCA 1OI6A 3AZVA 3FJSA 4J25A 4Q0PA 4HK9A 1IOAA 4OFGA 5BNOA 2QQJA 2VC9A 1UO9A 1DZRA 4L92A 3HBZA 2XUEA 1KDKA 1IQDC 3GF6A 1JZ7A 4HPKA 4NWVA 5EJZB 2ES3A 2XJTA 1ONAA 1QNYA 3M2MA 3ZSEA 4CCCA 2WN3A 1FOD1 3WF4A 1UL9A 4L9BA 4GJZA 3LA2A 4QPWA 1MS1A 1H4HA 1W8NA 4TWTA 1HJGA 5FV3A 5L9VA 1UAIA 1LGCA 4P00B 4LJHA 2DBNA 1B35B 1DLCA 3OOXA 2DCJA 3T0AA 5C3PA 2B4KA 4LBQB 4HKOA 1W3XA 1RUI3 2F6BA 4N90A 4KMQA 2VMDA 1W6PB 2WIIB 4H7MA 1W8FA 3FFZA 3MICA 1OBNA 3NWKA 1Y7BA 3I97A 4M3CF 5CFDB 1PX4A 4P5YA 4W6WA 4XAEA 2Q0AA 1WKYA 2JDPA 4LA3A 4DPNA 3I8TA 4JDMA 5JSPA 2O1QA 5IK5A 2DUOA 4F8AA 1SLCA 1AZDA 2YYOA 5A70A 2PHRA 1GP6A 2V4VA 4C1WA 1O4YA 1TVGA 3M3EA 2A75A 1XNBA 2KR2A 3E5QA 2ZEXA 4MLOA 2D5HA 4GWMA 1GMMA 3POGA 3KV4A 5JIAA 1YLLA 1OA2A 4K7JA 4YW5A 4CP0A 2D43A 3H1MA 1UF2C 5T5LA 3ZFEA 3GXUA 3JD71 1OOPC 3WEZA 3M1HA 5ABJA 3NNJA 3OBTA 2JE7A 3VBUA 1SEFA 3THCA 5EV7A 2FDJA 2OZJA 1OMIA 3LGRA 4LE4A 4O7XA 3T3YA 1RHI3 3DEMA 5J96B 2CGPA 5JZGA 3IIIA 3D0JA 2WLPA 2I2SA 2XMLA 5F3IA 1DU3D 1O3RA 1J3RA 4BCUA 2WA3A 1AR61 2VR4A 4L11A 4LHNA 3POEA 2VZVA 1HKDA 3I2DA 3VDBA 4ZHNA 1QU0A 1DQ4A 3AM2A 4H3WA 1FPN3 3MV11 1BBT2 3WNPA 3O1UA 1BYHA 2JIGA 4CVUA 2XVLA 1LR5A 5FPZA 1M06G 2VOVA 3ZFFC 2ZGNA 1PNFA 3ZN4A 1FATA 4A6OA 4BMEA 4XFAA 2Y6HA 4BDVB 3C7OA 2WC2A 4B4QA 2BNMA 4QX5A 3CDZB 3CJIC 4JHZA 4NMIA 4DUWA 1RUOA 4JAAA 5FZMA 2E7AA 1LAJA 1RTVA 3AZWA 4L8QA 1LEMA 4CCLA 4LORA 2DCZA 1WMEA 2VCMA 1O3SA 1OD3A 4IGPA 3O0WA 4NRQA 2BPA2 4W8JA 1UXXX 4RYDA 3ZYJB 5FZIA 1OOPB 2RS12 3E5UA 4IETA 2HWE1 3WNNA 1TEIA 5AVAA 3E97A 5AC93 1PNGA 1LOAA 1VAMA 4ORFA 4BQ5A 1RUJ1 3JBG2 5FUIA 2OX0A 2ZGMA 2TNFA 2VQAA 5T5PA 1BHGA 3BKZA 1XNCA 3CNAA 4A6SA 1F4AA 3ZN6B 3X29B 5IVVA 2FMDA 4L97A 1Q8PA 4DO0A 2FHRA 2Q1MA 1YRZA 4KG8A 1WCKA 4BIFA 4WV8A 2I07B 1X82A 2DURA 2BOJA 3E1F1 5I0TA 2XXZA 3ACFA 3H7JA 3T4VA 1W6MA 5FZ3A 1QXRA 1QEXA 1W8HA 5H9PA 1STMA 3ZFFB 5T5OA 1ALYA 2YG0A 4BQYA 4Q0QA 4CDQC 1BJQA 5B2GB 4BISA 4KWJA 3A0NA 3CJIB 1PGW2 4B4PA 3RYRA 5FP3A 1G8WA 4AGVA 4OHXA 2Y38A 1KEXA 1AYM1 2AENA 2WO3A 2Y33A 3AKTA 1VRH3 2XVGA 3F2ZA 3LOIA 4INDA 4Q4Y1 4Y20B 4M00A 2LALA 3NJVA 1UWWA 3WDVA 2A1XA 1XNDA 4EN8B 4Q1RA 1IGOA 3QACA 2RJLA 1CIWA 2GC2A 2QDNA 5DZEA 5FREA 4XBQA 1OH4A 1GBGA 2XL9A 2ZHNA 4FXKB 5LK7B 2FDFA 1UCXA 2PHLA 2WINB 5FP9A 2VW1A 4HT1T 1UY4A 2HWB1 5DAVA 3NL1A 2PLV2 5BNNC 1UD1A 4IV1C 4I0BA 3RYKA 2WZEA 3EYPA 3A21A 4NWWA 3PTYA 4XMIA 1ZBA3 1CZVA 1W99A 4CEWC 3SQOA 3T0DA 1YFYA 3BTZA 1LRHA 2BW8A 4GJYA 5AFBA 5CBLA 1UY1A 4YVWC 1G7YA 4UW5A 3N35A 3S7IA 3U4SA 4B29A 4XTMA 4CDQB 3W58A 2GN3A 3VKMA 2BGPA 2VTXJ 4JDOA 4ISRA 1QHDA 1XSRA 4S2FA 1HB2A 2WYSA 1W6QB 1WD4A 1UU6A 2ZKNA 1T6GC 2QZ2A 4GKYA 2WT0A 4CUAA 3IB3A 4CU8A 1PO11 4G9SB 1BEV2 1FNYA 2VTFA 4QXCA 2RDQA 3FHQA 1LOCA 1JYWA 1DQ1A 3AMNA 2W08A 3HD8B 3URFA 5A32B 4E8DA 2LTNA 1ZZBA 4YM1A 3WD5A 4AHZA 1RMU1 1RUE2 1VMJA 2WLQA 4XJAA 4A4AA 2OQ6A 3O1VA 5BNNB 4IV1B 1I6XA 2GC3A 3B00A 5J1XA 4FPFA 1UX6A 2ORZA 3N7JA 4CEWB 1OUXA 2BRTA 2XBO1 2ZHMA 1UIKA 2RM22 2RS51 3ZDSA 1EPZA 5A3OA 4AF9A 4YGEA 3WP5A 3VKNA 1SLLA 3KVBA 1E5HA 4YVWB 3RJRA 2B46X 4AWDA 1IPJA 1VPHA 2WBKA 5HBAA 4BWOA 3SEEA 3N3HA 3V0BB 2LUWA 2E7TA 3O12A 4UBGA 1PHMA 1C8M3 2DBIA 3WY6A 3U1XA 1H1IA 1UQXA 5C33A 3ZLIA 1HRI3 1N3QA 2R041 4NIGA 1JHNA 3SCFA 2A7AA 4A44A 1JN2P 2BWCA 3KF5A 4BJ0A 3H9AA 4ITCA 1HRV3 2CDPA 5EJ1B 5A1AA 5IATA 2R49A 2EXJA 1C57A 2VE1A 3ZKUA 3GCXA 1US3A 1LHNA 3ZSKA 1JHJA 4MXVA 1O59A 4IEXA 1ND2C 2K0GA 2VMEA 4NRPA 3TWIA 1CX1A 5F3CA 4IE5A 1BMV2 1COV3 5FFOC 4IV3A 5FIXA 3J7LA 2E32A 2XJSA 3I49A 1LENA 3KV6A 1OQEA 2ZKLA 1YO8A 3JB4C 4Q4Y2 2DVBA 3USUA 2VQ0A 3OEBA 5FTTC 3MPPG 2R072 1JYCA 3KQ4B 5F3GA 2CAUA 3EQEA 3KCXA 4P9JA 4Y26A 1RUH1 4XUNA 3BTAA 3RJ2X 1X9TA 1VBA2 3SMHA 1W8OA 2XJQA 2WNEA 3OUIA 1UZZA 2K2SA 3CJXA 3CF6E 2Z69A 5E8AA 3T09A 3GBFA 4XZUG 2XJVA 2WDBA 4YLZA 3N9PA 1AYN2 3BPSA 4CRQA 2GAUA 1D4M3 2IVJA 4UT5A 1HB4A 4ZZ5A 2BDRA 3KHCA 3PVEA 4XDPA 4HVQA 1OFSA 3K75B 4QAWA 1D2SA 1YIPA 2JG9B 3NJXA 4QM9A 1RUC1 5HXVA 4GAZA 4UBHA 2JB4A 1JYIA 4OHYA 5IFPA 3OBRA 1ND2B 2Y6JA 2XDVA 1EV12 3ME2A 3GM8A 4NE9A 4SLIA 5DABA 3RI8A 3MLKA 3SISA 2BWAA 4QX1A 4IEOA 4AYUA 1CGPA 2P1BA 4I0WB 1J84A 4KG0A 2FBEA 4BQ3A 2ZZJA 1RVF3 4MV2A 5DPNA 1NKGA 2DU0A 4GMP1 3J9SA 4U36A 2RS32 4OQ9A 3LPFA 3OGRA 1U0AA 1AX2A 2EAKA 1RUF1 1LJ7A 4Q5OA 2EIGA 3CMGA 3R0RA 4LQRA 1WA6X 3VDDB 1W6NA 1AR72 4F3JA 4FVVA 4Y22B 2RR12 2VZ1A 4DB5A 3DYOA 5GZDA 4F7ZA 4J6GA 4DS0A 3IBMA 3NJYA 3J8F2 4CYDA 4PF1A 5FZGA 5FYZA 2EXHA 2WAAA 3IN9A 2OPKA 3T08A 4LO6B 3BI3A 2CYFA 3AL5A 3E6BA 2H6CA 3BGAA 3O0VA 3RVHA 3VHOA 4NIHA 3WINE 1WBLA 5D2AA 3WNKA 3WQ0A 1OKQA 2EIBA 3RDIA 1PX3A 3WHUA 2CL2A 1LKNA 1V6KA 4EZHA 5J98B 2ORXA 3KT7A 1DIWA 2ARCA 4HONA 3AMHA 3W20A 4HL0A 1MPXA 3I3BA 3UETA 2F4PA 4OI1A 5FYMA 2ZS6B 5JR7B 4W4ZA 2D6MA 1YQ6A 4RFT0 4JTOA 2ERFA 4M01A 1CD3G 3VBFC 3WNOA 4CTEA 1NLSA 4Q4X1 3HOBA 2GNDA 1BXHA 3LB9A 1HXS2 3LDRA 4M0HA 4ZXKA 1F5FA 1R092 1BZWA 5FAXA 4Z1VA 3PU8A 3BB6A 1WLWA 3HPNA 3NRUA 5CG9A 2ADEA 4YM3A 4QM8A 3JZVA 3NV3A 4G3YC 3VLBB 2P3YA 3I3MA 4M4PA 2B5HA 4FPJA 4KH9A 4JGZA 4S2DA 2DCTA 2GNTA 4YVSC 4OI0A 1QOSA 2ZGUA 1WCQA 2JB8A 4XJ9A 2P37A 2R062 4B8EA 1QJY1 3DKQA 2MEV2 1RJ8A 1RUG3 2VD7A 3FHIB 3W59A 4ZZ8A 4ZKTB 1LHUA 3O1TA 3FC0A 4MZUA 5IVEA 4NO4A 4FFIA 2R1DA 4OCTA 4CU9A 4K21A 4Q4W1 2IXJA 4WZCA 3S0MA 3KF3A 5LATA 4C1XA 4TLGA 4OUEA 4BM8A 5C3SA 1UZ0A 2AC1A 1VBD1 3LEKA 3VL8A 4BHPA 4MG2A 1EUUA 2N7GA 3I7DA 3PVBB 5IFTA 1O5UA 4CDUC 3VBHC 4MGYE 5FPVA 2QNKA 1PGL2 2ILMA 3FLRA 1L7LA 3HBKA 1W6OB 1HV1A 5FZEA 4QXBA 1XNKA 1YJLA 2C9AA 4QB6A 4RS5A 1NQDA 2WL1A 5BNPC 4XFIA 4DOUA 4DY5A 5KR7A 4Z07A 4YRDA 3WT3A 4M4RA 4W50A 1J83A 1GZWA 2MNGA 3CHXA 3HAGA 1J58A 3APBA 1ZA7A 1W0PA 5CADA 2WZR1 1NCRC 4Q2FA 1QXPA 1LOFA 3LSDA 4XABA 3ILRA 2ZJCA 4QWNA 4YVSB 3IIAA 2GZWA 4MYEA 1AL23 2ZACA 4NPRA 2NLRA 2W1QA 4MXWB 3HWJA 1AR92 2NM1A 2WFF1 2X5IA 5I0UA 1XJAA 5JOXA 4QX2A 5C8CA 2JG8C 3TNPB 2CGNA 4MHUA 3L2YA 2QQLA 4XBLA 3ZN5A 3R05A 5F6KA 3VBSA 3NNMA 3H3ZA 3CBNA 5JIUA 1SCRA 2E6VA 1VMFA 1POV0 1QJU3 2KD7A 3J7NA 2KXLA 4RQPA 3A7QA 1NCQC 4CDUB 2ZX2A 3VBHB 2O0OA 4AOCA 2G19A 3AL6A 3KV5A 4E4HA 1NT0A 3FFQA 4QQ2A 3A22A 1Q8VA 2GH8A 5CA6A 5GZCA 1BLZA 1K12A 3IMNA 4O61A 3WSOA 5EJ3A 2OXBA 2NN8A 4OUSA 1W39A 4YG0A 3BPZA 4QU2A 4AEDC 1W9FA 4XHBA 1CAXB 3FL7A 5BNPB 3MBWA 1JH5A 2UURA 1JI6A 2G9GA 1W8WA 2YC0A 2CU5A 2WO7A 3UJQA 4D7TA 1RXGA 2VVDA 1WBFA 5IVCA 4PCRA 1W03A 5F2WA 5LBBA 1NCRB 2YU2A 5J36A 1W2NA 1OA3A 4EQVA 2G4IA 1WWYA 3Q8CA 4CP1A 2IC1A 2R7EB 1BCXA 1YQ8A 1ULPA 1NYWA 3EXUA 5DUXA 1FMD3 5BXXA 4EN9B 3ACHA 2JG8B 3OY8B 1YI7A 1IKPA 4XFGA 4K8RB 2HYKA 3VBOC 1OF4A 3B7MA 4D3WA 1XU1A 1DZQA 4WM8C 4COUA 1PO23 5BUVA 1W04A 1NCQB 1REEA 2YU1A 3HQUA 1VRBA 3VZNA 2DF7A 2JDZA 3O0XA 4XUTA 2CNAA 1VBE3 5A7WB 4FTEA 1IS5A 5FXWA 3UT0A 2XVKA 2P3KA 2HWC2 2JDUA 4LO7A 1ZNPA 3AP7A 4QPGA 4AEDB 5BNOC 5A3WA 4XMAA 5GLZA 2Z4FA 4QKNA 1F4HA 1PZ7A 3VN4A 1TMF2 4ASLA 4EN6B 5BNQA 1DYPA 4UFIA 5ISLA 4LULA 4KWUA 2JWPA 3PMSA 3AKPA 3LKJA 1HIXA 3B69A 5FYYA 1SPPA 3I2IA 4LO8A 5A6ZA 2VNOA 2GN7A 3RSJA 3D6EA 2ENRA 1RXFA 4V2VA 1X7NA 3FWEA 1KJLA 1MVEA 1YHFA 2VBDA 4K9SA 4B3NA 4COVA 5IYYA 5HV0A 5KHJA 3PUQA 1FV2A 2VZTA 1OD5A 5DAPA 4AI2A 3RZGA 5CKMA 2UWAA 2V5YA 2QKDA 4GB33 1G9CA 1RUD2 2PHTA 4D6SA 5C5UA 1R1A1 1RUF3 3S5AA 3UK9A 3VBOB 1XRUA 3TN93 3ZXFA 1FT9A 1ODNA 1I9RA 2GMPA 4PIXA 3UKTA 4ATFA 3UL2A 5BPXA 1YQ5A 3N9MA 3RPQA 2UY8A 1KD7A 2XQRA 4WM8B 3T30A 5F39A 1D4VB 5E88A 4Q8KA 1OFNA 4MX3A 3U11A 2E53A 5A80A 2NP0A 4HSJA 4XURA 3BTXA 2P4EA 3HN1A 5F5IA 1GWMA 3ZYBA 5FQ0A 1TME2 4QMAA 3K3NA 3AP9A 3PIJA 2VZOA 3SH5A 4CU7A 4QX7A 3CZJA 2R32A 5BNOB 5KXBA 4NR1A 1O8SA 1DQ0A 2Z79A 5KBFA 2JD9A 3B01A 3ZFEC 5E16A 1TG7A 4HPKB 4X8PA 5ABJC 4QPIA 3ZR5A 2VUCA 3BIEA 1AHSA 3VBUC 3KCCA 4QB2A 3ZXGA 3TEZA 4GH4A 1IHMA 3RGBA 2ETEA 1A3KA 4UFLA 1MS3A 4AEJA 5JZGC 3AJZA 1JU3A 1R082 2RJ2A 2WWSA 5JXIA 3AKRA 1V0AA 5ANQA 4XE9A 5L36A 1QNWA 3WF1A 4HN1A 2EVXA 4YNIA 3VZOA 4YARA 1W9SA 3AKSA 4KI5M 1BK0A 1V70A 4X6RB 5CIRA 3OCPA 3AP5A 3D8CA 1CVNA 1EPWA 5FZ9A 2J42A 1O6UA 2WNVA 5CVRA 4CEYA 4S2GA 3WZ1A 4GULA 2Q30A 4NAOA 3W9AA 1N1SA 4K1ZA 3AC0A 2VOKA 4FFHA 2DUPA 4LO4B 3WX5A 3WQ7A 1P8JA 1ZZ9A 4R4ZA 5CFCA 1DFQA 2WQZC 3MIEA 4QKFA 2W1WA 5JSRA 3RG0A 1GICA 5FY8A 3SHRA 4JX0A 4I2OA 5JPNB 3ZFEB 4I3PA 2AZ5A 2IUWA 1H2LA 1VBD3 2PA7A 5ABJB 4YGDA 1C5HA 3VBUB 3LQCA 1ODMA 2UWBA 2JKXA 1POV3 1CWPA 5JZGB 3RMXA 2DCYA 4LBKA 4S2HA 2DCKA 5JI9A 4M3CA 5H9RA 4ASMB 4N7UA 5LEJA 4E4DX 1CPNA 5KHHA 1BBT1 1IQAA 3TEYA 5F7UA 3OBZA 2QQUA 2UY9A 2PXJA 4KQ7A 1CONA 4AVBA 1XE8A 3NSTA 4UXAA 5ACA3 3O14A 1RUI2 1UPSA 4MOAA 2A73B 4OZXA 5D8AA 5CKNA 4LIVA 2VCCA 1PK6A 1D2QA 3NKTA 4LHLA 1CQ9A 1WW6A 3LPGA 2FZ1A 4W6XA 1HV0A 3SEPA 2W92A 1RL3A 3W5NA 2VQUA 2ZPXA 2WAOA 2Q8CA 4Y5SA 4P9YA 1GFF2 1DCSA 2E33A 4HFSA 3USSA 5LZ6A 5DG1A 5DDJ3 3OPTA 1NUKA 5IJRA 4PLMA 3GZEA 3WCRA 3FN9A 5FXZA 1QY4A 2QQPA 1QJX3 4NN0A 2VOTA 4QHZA 1FNZA 4OHWA 5JXGA 3B94A 5C7GA 5JXJA 4LUMA 2Q1FA 1WW4A 4XETA 2A70A 2D97A 5IWFA 1RHI2 4AR2A 4FAGA 2BNOA 2BVBA 3UESA 2GH2A 5J3UA 1LOEA 2BFUS 4GXLA 1K45A 4NHLA 1XB9A 1X8EA 3M3OA 4JRLA 3U75A 4I02A 2HBTA 1W6MB 4XACA 4BE3A 4XUQA 1Q8OA 5T3NA 4AVCA 3AYEA 1W28A 1PGW1 2YPJA 3DCQA 3Q9OA 4GA9A 1FPN2 1EAH3 5C9AA 5FDBA 3ILFA 4Q4V1 5GALA 1GOFA 1I1EA 3VD7A 5FWJA 1JBCA 3TAYA 1OLME 4GD4A 1FXZA 4NHYA 4W65A 5FZBA 4C0BA 1H6YA 5LY2A 5JMCA 3WHTA 2CY6A 4IE6A 1IS4A 3MIDA 1PMIA 2HWF3 4CZSA 4ET7A 2B9UA 2VU9A 1VAVA 4BLJA 2V5DA 2D3SA 3ETPA 5FY4A 2JDYA 2FDKA 1UOFA 1WLDA 2VNVA 2XKOA 5FZOA 1GZTA 2J1AA 3DGTA 3VD4A 2GP3A 2PLV1 2JDKA 3VBRA 3Q8BA 3ZSJA 5AC92 3WDXA 4MGZE 5F2SA 1K42A 1OT5A 4HETA 1S0JA 3P3NA 1V9U3 2W47A 3JQXA 4AG4A 4MSVA 1UZYA 5FP4A 5FZ4A 5HCHA 4OUMA 2BP6A 2OW4A 4B7EA 3DL3A 5EFUA 3WP3A 3GZAA 1NZCA 3ES4A 4HN0A 3GHNA 4TSVA 4PDWA 2IVIB 4AW7A 1SMVA 3OPZA 2WS93 3MF6A 1FI2A 3V56A 1W8ZA 2VXRA 3BU0A 2VM9A 2IXHA 5DAXA 3WXPA 4C8DA 2RHPA 3AVRA 5K7PA 1HDKA 4NIDA 1YEWA 1PVXA 3ELNA 3FUOA 3LDKA 2WT2A 1BEV1 2DDUA 4QGNA 4D69A 3OEAA 1VIWB 2WFPA 4JCKA 3MFCA 1ZZCA 2VECA 3BUCA 2Y64A 5CAZA 3ATGA 1CESA 4RHV3 4DINB 4XC9A 3ZVXA 1OH3A 3GDBA 4XQDA 4AL9A 1VRH2 3IKWA 1VBC3 4CDWA 1RUE1 2XHKA 3PJQA 1MZ6A 5IUQA 2OS2A 5CKQA 3WCSA 1ND3A 2TUNA 4YW4A 1CX4A 3KT1A 1PVC3 3ORJA 1SQ4A 2AR6A 4DEQA 5F6LB 2YC4A 4IV3C 5CB7A 2RM21 2ATFA 1GQGA 1O91A 3IMMA 4XDOA 4E2SA 4EE2A 5A6XA 3R4DB 3AFKA 4LOSA 4LPLA 2RDRA 2R0FA 4AFBA 3TBDA 4YZ5A 1WMXA 1ZBA2 3H1YA 3NNFA 1NE4A 1UKRA 4XXAA 3IDEA 3K3OA 4KL1A 1LHVA 1Z78A 4GWIA 4UF0A 3LSEA 3ZOIA 2BERA 1ZRCA 2B7YA 5CNAA 5I91A 3ZDVA 3FLPA 3LA7A 4IQPA 1XC6A 3BN6A 4I01A 3PLQA 4EWAA 3IWZA 3IZOA 1MS8A 3WG4A 3KHBA 1LB2A 5TSWA 1SZBA 3ACGA 1X33A 4QD2A 3QH6A 1YFXA 5E1RA 1BMV1 5J7MA 4OMDA 4XILA 5C3QA 5A33A 4DIQA 4IV3B 1Q8QA 1QQP3 2P6CA 2QFEA 3AK0A 2WSVA 1WD3A 2WT1A 3CQOA 2ZZQA 2R071 1FAYA 3FBYA 3USUB 3SNMA 3QH7A 1RIRA 4Q1PA 4Q4X2 3IDAA 2AEZA 1Z7S2 3NVCA 4LLOA 2CTVA 3UKNA 5DUUA 1VBA1 3NAPA 5H9QA 4MH0E 3DECA 2HWD3 1IKQA 3H0OA 5LBCA 2ZGOA 3MGUA 2E51A 2YGLA 3M3IA 5K8SA 2ARAA 3AX4A 1AYN1 1BBT3 4ZU5A 2VW0A 4QHBA 1ASJ2 5E89A 3U4XA 1DDLA 2LW8A 4HSLA 2ZGRA 4FTSA 5B4NA 1C8M2 2HH9A 4URAA 1ULCA 3AMPA 5EWSA 2HLEA 1HRI2 3MIFA 1EP0A 4FXGB 1EV11 3HNYM 4Q0SA 4Z92B 3LCPA 3K2OA 1HRV2 1PIV3 5GLWA 2PHXA 5LW9A 2A5ZA 1W9YA 3ZYGA 3OTFA 4HBNA 3P1IA 2FCTA 3PUSA 3GZTB 2RS13 4CXYA 2XLGA 2RS31 4XFBA 2OYZA 3JBG3 1VBB3 3LEMA 3ZFGA 1COV2 2H6BA 3VKFC 1A34A 1CZSA 2XL7A 1AR71 2DVFA 1VR3A 4XZPA 3MYXA 2RR11 1ZBE2 3AJYA 2D6OX 4YW7A 5IK4A 4LUKA 2EF6A 1W6NB 3J8F1 4LIUA 5FLHA 3BU7A 1T6BX 4G4FA 1A8DA 2AH2A 5APAA 4MGIE 1AUYA 2IZWA 3D0SA 1GU3A 2FDHA 3WVJA 2EIDA 4R4XA 3U07A 4UFJA 2ARBA 3O1SA 3HVDA 3Q8EA 3DPRC 3MI8A 4Z2WA 1N1YA 2VOXA 2PQQA 3NW4A 5DZGA 1FOD3 4KGQA 2A6XA 2DFBA 1I3HA 4B7KA 5C5TA 1CZTA 5DUVA 5FXVA 1D4M2 1GZ9A 1SCSA 4Y4YA 1QXJA 1OPOA 2QVSB 4XDQA 3AYAA 1XYNA 4HG6B 4AAPA 4E27A 4UW4A 4ZU4A 4L99A 1CAVA 4FPEA 4GZ9A 1AJOA 1HXS1 1YQ2A 2ZGSA 1R091 4XEZA 2BFUL 5LEKA 1UY2A 1TZOA 4RS5C 4EN7B 1VMHA 4QQPA 2NPIA 2NYYA 4H2AA 4R9BA 4YWAA 5T54A 3N9NA 2QUOA 2JG9C 1RVF2 3ZPYA 1O7FA 3KB5A 5JAXA 4DZGA 5F37A 3GGLA 1LOFC 4K6BA 4MUVA 3WNXA 2R061 4JGZB 3R4SA 1LEDA 1LNSA 1XNTA 2L9LA 4FQZA 2MEV1 4FQ4A 2AGSA 4H7LA 4NIIA 2VOWA 2X5IC 4BOWA 1MEC2 2CSGA 2XLFA 3O7OA 5FLJA 1KFUL 5C8CC 3ES1A 3JD73 1W2TA 3DPRB 3D5OA 2J1TA 4KNCA 3I3DA 5C8WA 2BZDA 1UY3A 1UW8A 2JDMA 2WUHA 2PAMA 3RFRA 5I8TA 5LWBA 2YROA 3S57A 4K40A 3KGLA 3VDDC 3I3QA 4RQPC 5A3TA 4FOVA 5A1FA 1PGL1 1CN1A 2QJVA 5I0DA 2D6KA 2WA4A 1B09A 2CHHA 2W94A 2YFUA 5C70A 4OVEA 1AR63 2A3WA 1IPKA 1K5JA 3WQ1A 2Y26A 3KD4A 1G9BA 5L7OA 4RS5B 2R1BA 1TE1B 3POYA 4PI0A 1AR82 4LOTA 3RWNA 4OI4A 4AEKA 3MUY1 2PN5A 4XF1A 1HB1A 3N9OA 1GZWB 3AB0A 2OPWA 4IEZA 3S30A 3AYDA 5EIYB 2F4LA 5DXDA 5FJKA 5IVFA 5EPAA 3ENRA 1SHWB 3RI9A 3ZMNA 1QH6A 1AR91 2VTXA 4CE8A 5HPOA 4UFHA 2VCBA 3QD6A 1H30A 4XQ4A 2X5IB 2E31A 2JIJA 5I8YA 4LXLA 3NJZA 4I0AA 4UFMA 1IS3A 2Q4SA 5C8CB 4FPHA 2QQOA 1VB4A 2HWE3 1QDOA 5DAQA 1JOJA 2F17A 4CCNA 1GV9A 1RUJ3 4QX8A 3VBSB 4LE3A 1MR5A 3D3AA 1RUG2 5C3OA 5KC5A 4RQPB 2PHDA 3KMHA 1VAKA 2C26A 3MW4A 4BXSV 4XFCA 4P9IA 5I93A 1I5PA 2G9FA 4LMFA 3ST7A 2VO5A 2WABA 2FMYA 4XAAA 3T2TA 4UAPA 1F31A 4IEPA 4QPGC 4NROA 5FWEA 1Q8SA 4CPBA 2HEWF 3SH3A 2PELA 5T52A 3RS6A 3KV9A 3WW2A 1DLLA 4LKDA 4V2WA 2JDAA 4IL7A 3D4KA 2WQ8A 4DXTA 1V6OA 1AYM3 4AI0A 2BUKA 4Q4Y3 2XOMA 1RC6A 2JDHA 4AEMA 5J48A 1SFPA 3FZ3A 1ENXA 5I0SA 3I3EA 4FPOB 1K5MA 1X9PA 4EWEA 1AL22 5F32A 2VNRA 1G6NA 2J1EA 5LASA 3IPVA 2JDNA 5A7PA 4P08A 1OLRA 4JKMA 2Z42A 4FI9A 4MGQA 2HWB3 4PLNA 3POBA 4JHTA 2MPFA 3BIWE 4RR3A 5FO7B 2HWC1 3IDCB 3VV1A 2CV6A 1US2A 4LBLA 1T2XA 4Z8BA 4COYA 4DEVA 1QJU2 1LU2A 1F8VA 4R9DA 2EA7A 4QPGB 1TMF1 1YJKA 4YW6A 2GU9A 5HCAA 1JZ3A 1H8VA 2WQ4A 2ZA9A 3WG3A 4Z2AA 2R30A 3ASIA 3OB8A 1DYKA 1SBEA 4K1YA 3TB0A 4QPIC 1SDWA 2ZABA 1SPPB 3CEWA 3ZXAC 3K4DA 1HLCA 5F5AA 4GH4C 1N47A 4TN7A 3MPBA 4PQ9A 1H1AA 4N9IA 1C8NA 2ZX4A 1MQTA 1XYOA 4RGAA 1PO13 3NMBA 4AQ6A 1JXNA 5G05L 3ITQA 5EZWA 3H1WA 1RUD1 2XHNA 2H0VA 5IAXA 1J59A 5SV8A 4HMZA 3WDWA 5FYCA 3I2KA 1Y9GA 2WN2A 4A7YA 3VD9A 2ZMNA 1RGSA 1E57A 2QBXA 1YFWA 1FMD2 2YUEA 1KGYA 1MZFA 4CEYC 1RMU3 2P6HA 2UU8A 2YPDA 5F8PA 1TME1 5FZCA 4E2QA 1APNA 3B9CA 2XJRA 5C4WA 5FQ0B 1ZYBA 2I74A 1S0BA 1PO22 2XBO3 3HQXA 4N43A 2W46A 2RS53 5FRAA 3KZ4C 2P2KA 1FV3A 1NA1A 1VBE2 3MHZA 3OYWA 4JZRA 4LR4A 5FMOS 1G9DA 2HKXA 2FDGA 1L3JA 4BQXA 1G86A 1C3HA 2YXSA 4QPIB 2D98A 1O3TA 4GH4B 1Q3EA 1R081 1Y4WA 4HKWA 4NPMA 1ULDA 3T1LA 1XQNA 4V1PA 3K51A 4FO9A 2NQYA 2D6NA 4CCJA 2R043 1WMDA 4J1WA 3O1MA 4A7ZA 4D7YA 2XB6C 5HCFA 5FKCA 1U5ZA 1N1TA 1D7PM 1GYKA 3DXTA 2IWGB 4R9CA 5IK7A 3DKWA 1AX1A 2ZXQA 4LITA 4DUVA 1OKOA 3ABZA 2QDRA 4QX3A 4CEYB 4GB32 4KU8A 2R063 5D8AC 4YFZA 3IDBB 3GALA 1IZ3A 2G9ZA 2W52A 1PK6C 4YZ1A 3TN92 3ZPOA 3ZYFA 4AFDA 5JUVA 3LZZA 5K0UA 2IXLA 4BXFA 1BK1A 4UWDA 2WNUA 3AZYA 1CAUA 1ULGA 1UX7A 3IAQA 4YM2A 4PBPA 2J1RA 3V0AA 2QZ3A 2XWBB 4OLLA 4QB1A 1DGLA 5FP8A 1ACCA 3O1RA 2DVGA 1NE6A 1RUH3 2A6YA 3L9JT 4DXSA 5C3RA 5IVBA 1ST8A 1DF0A 4Y1UA 5EP9A 3PL0A 4H55A 2OIIA 3AKQA 1EY2A 4IE4A 4CP9A 2VZPA 5FY9A 3VDCA 4E4ZA 4M3CB 3U0ZA 2RDNA 3H8OA 4RGKA 5IT6A 2GSYA 1A8MA 4ZXEA 3WNLA 5JPMB 4YYOA 5FMBA 4JDNA 1RUC3 2XPJA 1RUI1 3WW4A 2VZRA 2Z5WA 3BYWA 3TYJA 1PM4A 3H3UA 5A3LA 4XCBA 3KVAA 1PZ8A 4NJ4A 4XJ8A 5D8AB 5C9AC 3OUJA 3POSA 1PK6B 2ZGLA 1GKBA 4B1MA 1NY72 1G9AA 2EAAA 2W68A 3WG1A 5LCWL 1OUSA 4XQWA 4FPLA 4GMP3 3M70A 5F9TA 1KS5A 1YC61 4Y1VA 3N4MA 4HVRA 1BVP1 2WJSA 1H9PA 2RDSA 1DZTA 1GWLA 1DP0A 2FCUA 2ZAHA 2ZCWA 1WLTA 1XE7A 4DUXA 2E63A 2ZGKA 2O8OA 5GLUA 4AFCA 3GHMA 2JD4A 3VBRC 1LODA 5T55A 1SBFA 1RHI1 3QCWA 2B8MA 4GIQA 4MO3M 4AFAA 3MZHA 3VBFA 3I54A 5JWPA 1H1MA 1LULA 4URTA 2DYCA 4IESA 3I2JA 1MACA 2QCSB 2NZ9A 1POQA 4HOOA 2HYXA 1QOOA 2JE9A 3RZLA 2JEMA 1W90A 4QQOA 1JZ8A 2RMU2 4DXRA 1FPN1 4IE7A 2WKKA 4OI2A 4CDXA 5JR2A 4BQ2A 4NRMA 2BJSA 3UJOA 1L7RA 1NXD1 2P3IA 3AYCA 2Q8DA 5C9AB 2A71A 3GBGA 2R6QA 3EMRA 1WCDJ 4Y3OA 4Q4X3 3OBAA 2Z2SB 3WP6A 5ACA2 4JKLA 3WDYA 4IERA 1REFA 2PHFA 2PFWA 1JW6A 3KQRA 5IVJA 1AX0A 4KGGA 4QKDA 4Y5TA 1HN1A 4WVVA 2RV9A 4A2UA 1Z0HA 3ALQA 2ZOEB 5JCTA 4R9AA 2GC1A 2J7MA 4FOQA 2B45X 4YM0A 4XIOA 1S0IA 4MADA 2W1UA 3B5LB 4XFFA 1O4ZA 2C4XA 4QDQA 4CDWC 2DVAA 4CUCA 5AC91 5I0RA 5DDJ2 3AZXA 4AVAA 4WVMA 3QBQA 3VBRB 3VKLA 3GCWA 3WV6A 2W9XA 5FZDA 1WLCA 4XF3A 1QJY3 2MHFA 2VBBA 5LBFA 1X8MA 4UOJA 2GNMA 2O8QA 2QQWA 2DUQA 5CU1A 4BYYA 5A3PA 5LA0A 1QJX2 5L73A 4Q4W3 2XLAA 4Y33A 4F83A 2D3PA 3HR9A 4UW6A 1GOGA 4WVWA 4DRVA 1H4GA 4ASKA 5J37A 3NV1A 5IVYA 2NMNA 1S2EA 2IXKA 2JKBA 3AMMA 3P6BA 3PUAA 4IXLA 4P02B 3WOGA 3FUQA 1BQPA 1XXNA 2VNGA 4OHZA 1R64A 1UYXA 4L0PA 5FYHA 4BQ1A 3PUHA 2V72A 4A45A 4DXZA 2CWMA 5FXXA 3OG2A 1VE0A 4JRAA 2OUJA 4Y4RA 4N7IA 1EAH2 1Q56A 4PT6A 4LKFA 1ZRIA 1NZIA 1VRH1 2ADDA 2Y6LA 5JSOA 4IEYA 2JG8A 1C1LA 5GLTA 4WM7A 3WR0A 3EJKA 5FZHA 2PHWA 3CLPA 1CPMA 2WZR3 5DUWA 5FPLA 5SV5A 4COZA 3W5MA 2HWF2 2GALA 4CDWB 2K46A 2Y0OA 3G6JB 2OUHA 1W0NA 3AXEA 4FOWA 3N7KA 4NOTA 5FZFA 4MGTA 4CU6A 2GMEA 4P5HA 4AVVA 1UYPA 2PAEA 2WFF3 1MS0A 4QHOA 4LTAA 2RG4A 3ZIXA 5FK7A 1C5IA 2EICA 2WSUA 1YCIA 5EQUA 5FR3A 3LEGA 4SBVA 3TEWA 4C90A 1WCUA 5BYNA 1JTZX 4COWA 3SCGA 1ZBA1 3MLLA 2Q1ZB 2PMWB 5A3MA 1UMIA 1V9U2 2BGOA 5GM0A 1JZ4A 4AAXA 5HI0A 5A6QA 4NIAA 4XBNA 3WDUA 1NAEA 1V6MA 3NAPC 2Y6GA 5EXOA 5D21A 3QOPA 2VZ3A 4UF0B 4Q4V2 3M8LA 1UYYA 3F95A 2WS92 2D7FA 1LTEA 5FMOL 4JGYA 4UW3A 1Y43B 5C6CA 1UU4A 1YYNA 2PHUA 4BU2A 2VH9A 1V6JA 2X8KA 4FCAA 3AVSA 4QT6A 3VBOA 2D6PA 4LBJA 5FOJB 3PMEA 3OJBA 4TTGA 3VHNA 4YPJA 5HXMA 4RHV2 1LU1A 4AQSA 4K8FA 3PUIA 1DGWX 4CA9A 1VBC2 5A33B 1GANA 5FMDA 2J22A 4LBNA 4PHZA 5JI7A 5FPXA 2D3RA 2VMGA 1PVC2 3K46A 3ZFGC 1Z7S1 4LA2A 1U12A 4RFRB 5B4XA 1WUVA 1V6IA 2OQ7A 1C4RA 4IEUA 4O9EA 2WO2A 3JU9A 1SLIA 2OVUA 2VW2A 3ACLA 3C7EA 3LIHA 3NAPB 3P5BA 4YG6A 3THDA 1VLNA 3P3PA 2CGOA 4PF5A 3C7GA 5FMCA 2WR9A 1UMHA 2PYTA 1ASJ1 5FO9B 4IEQA 3I59A 4AE2A 4K20A 3RQ0A 5CYYA 2ZEYA 2OZ6A 1C8M1 1QJEA 1S55A 5KXEA 2FCVA 3KSCA 3T1MA 3ZM8A 5A3UA 5LA1A 2SLIA 1HRI1 1H2KA 2CDOA 3K4ZA 3ON7A 3C7HA 1ZVFA 3RZKA 4AQTA 5FZAA 4GQ7A 1HRV1 1NX9A 2QQIA 4LNVA 1CJPA 5FZ0A 3VD3A 1CAWA 5KC6A 5T5JA 1S2KA 2VUAA 1W2UA 2X10A 3UGFA 4ONUA 2XGXA 3N36A 4CSWA 1COV1 1GQPA 1R1A3 3BCWA 4XW3A 4DFSA 2X05A 1VB2A 3DXUA 1V6LA 4R8HA 5ANNA 3ZFGB 1ZBE1 3ZIWA 1NG0A 2VMIA 2ZMKA 1QQP2 1H8TA 3JB8A 1UMZA 1TQ5A 4LBQD 1OSGA 3T0BA 4QQLA 3N9QA 4JQTA 3WW3A 5KXCA 2XQXA 3ZSLA 1S0EA 1YFUA 1NLQA 2VG9A 3EB7A 5BV6A 5CFDC 1URXA 1RB8G 4DY3A 2DWRA 1QIQA 1F2NA 1MZ5A 4NAMA 2HWD2 4XF4A 4AI1A 4JC1A 4BMBA 1W2AX 2D6LX 5LA2A 1WA4A 2A6ZA 4PQQA 1HB3A 1D4M1 2RJKA 1LECA 5FZ7A 1RUNA 5HV4A 2W91A 4YW1A 3RZZA 2UYAA 3M4FA 1HW5A 3HMYA 1SFYA 1GR3A 1QOTA 1MS9A 2Q5TA 2ZX1A 1CAVB 4N53A 4IE0A 1BKZA 3A23A 1WW7A 4XFHA 1GOHA 1NXMA 4AVSA 1UU5A 4ES8A 5L7OC 1PIV2 4L2NA 4OZOA 3R6SA 5C71A 3UNPA 3LOBA 1ZZ6A 2I45A 1RVF1 2W5FA 5DAWA 2A3YA 4WBBA 5LK5A 2PTMA 3GNEA 2C0ZA 4P9WA 4ZU7A 4FPKA 1YNAA 3N7MA 5LY1A 2G1MA 1VBB2 1GUIA 1S0DA 1X50A 3UKVA 3ZXDA 4FPGA 1OPMA 1ULFA 2BU9A 1KJRA 3DYMA 1JMUB 2QQVA 2W95A 1J3PA 2VZUA 1MEC1 1QGLA 3RRDA 4YFWA 4B1LA 1KFXL 5G04L 1SDDB 2CAVA 3WF2A 2WRAA 3FX3A 4ATEA 1C1FA 4OYUA 3DF0A 3N9LA 4AHWA 2JICA 2VXJA 3ZYRA 3T2QA 4AGGA 2V4AA 3MDPA 3MIHA 1HN0A 3KWVA 4BK5A 5FP7A 3GJBA 4M3CE 5E6HA 5FO8B 2VVFA 3NKGA 3HQRA 3I2GA 2EALA 2QE3A 1CR7A 3GZUC 1JYXA 4CCDA 1YUDA 4IGQA 5FPAA 1FOD2 2OA2A 3LAGA 1LESA 2BV4A 4KU7A 3K77A 4RGGA 5AVPA 1B35A 4XCAA 3HEIA 4Z82A 1AR81 2V09A 1JODA 4LBQA 3WF3A 1LOGA 3MIGA 4YG3A 4YZ3A 4JVAA 3ZYHA 5L7OB 5FYSA 2W87A 1ZRRA 1W6PA 3HT1A 5M0TA 1VJ2A 5CFDA 3WLUA 2VZSA 1W06A 2ZMLA 1O8PA 3J4UH 2DU1A 4Y24A 5L19A 4QQHA 1EYBA 5KXDA 1LOBA 3MV01 3MLJA 4AFMA 5JOZA 1ZRFA 2VAUA 2XUMA 4A3ZA 2YDEA 4P9GA 4AQ2A 4IUGA 4AI3A 1OF3A 3BTYA 2TEPA 1JUIA 1JU4A 5A7OA 3ZXEA 4D6RA 1PMHX 4DNYA 2HBUA 2AEYA 1GQHA 1KS4A 3MW3A 4BLIA 5LRSA 4XOGA 2X29A 1W9TA 1REDA 1K5MC 2B42B 2YBSA 3LWCA 4LK7A 2Q8EA 3ZXJA 1ZRDA 1RUG1 1IG3A 3OD4A 3KM5A 3RNSA 1SFNA 1DQ5A 1DYOA 3JD72 4HXCA 1QDCA 3WQBA 4RR3C 3VGIA 4JGZC 3PTRB 3GJAA 1F35A 3POWA 4IEVA 2XWJB 1R1ZA 3ZR6A 3RZMA 5FKBA 3V64A 4QPYA 3AP6A 3UGHA 4GKXA 3A4UA 3FBMA 2O14A 5FJHA 1VP6A 2WZ8A 4RA0A 4Q8LA 3G7DA 1XBFA 2CWSA 4N8MA 1AR62 3CO2A 4AHXA 4YW3A 2XJPA 1ZX5A 1UN1A 2J1VA 2ARXA 1JOBA 3SLIA 2Y8KA 4Q4V3 3LFMA 2BOIA 4ARYA 3CU7A 3MFAA 1MZEA 4TLFA 3Q8AA 5D1IA 1GP5A 5BY5A 1JZ2A 1HJFA 1F15A 1MQTC 2W39A 1DBNA 2Y6FA 2OT7A 4FPYA 1D0HA 2J1UA 1D0GA 1Y3TA 4QXKA 2DTYA 3AXDA 3PIGA 2VMHA 1AL21 3EBRA 4XF9A 5A7SA 1K5MB 5DG2A 1Z7S3 1LGNA 3E6CC 2VULA 3MF9A 3WF0A 3UGGA 1JZ5A 3K4AA 1OOPA 3ZMOA 4OMCA 3IPVB 2PLV3 4I09A 4BQ4A 1RYYA 2W1SA 1F5JA 2HWE2 3LFIA 4P9LA 4PLOA 1ASJ3 4RR3B 3WNMA 3ZN6A 1RUJ2 3UV9A 1QJU1 4A42A 4CPBD 1SLBA 3EHKA 3DN7A 1UIJA 2VCAA 4EYUA 1W9WA 1UYZA 5C4WC 5DQ0A 2VVEA 3ZXKA 5FK8A 1H2NA 4D7SA 1OURA 3ETQA 4N43C 1G9FA 4HLTA 3SITA 4TYSA 3NQHA 1NA1C 1CIYA 3C7FA 4FOYA 4DQAA 1I5ZA 2NMOA 4A3XA 3VBSC 1AVBA 3OUHA 2E7QA 4HKLA 2GC0A 2HEVF 1OQ1A 3ZFFA 3HNMA 1S4CA 2WWUA 3SKJE 4Q26A 1IPSA 2ZEWA 3QLQA 2WZPP 4EN0A 1BEV3 1JUHA 3CJIA 1MQTB 3BOPA 3H50A 3LDBA 1F9KA 1E5SA 4TXWA 4FP3A 4CCEA 1WCSA 4Y20A 1S0FA 3THTA 3OGSA 4CUGA 2C24A 1AYM2 1S1AA 3DUIA 1ZBE3 3GYDA 1XYPA 3M3QA 2WYFA 4IDZA 1FMD1 4W6YA 1KITA 4YZ4A 5EHDA 4A7KA 4C0HA 4BZ4A 3B02A 3VZLA 1ULEA 2ZX0A 1HX6A 1RUE3 2VZQA 1OC1A 2BBVA 2ID4A 3IAPA 1ENQA 4AI9A 4BIOA 5JLVA 2VMFA 3T2PA 2YY1A 4FTBA 2BTVC 2Y0IA 4KBBA 4Q27A 1PO21 1GSLA 2TBVA 2BVVA 2RM23 4LBMA 4RD7A 5C4WB 3LEIA 3BVCA 2B39A 4ZS3A 5K0UC 1XU2A 1VBE1 2HWB2 2XR4A 2WNUC 1S2BA 3KT4A 4N43B 4DRRA 1N3OA 1C28A 2DFCA 2R16A 1DGRA 1NA1B 2C5DA 3OYWB 1O5LA 1OLQA 1UPIA 1UZVA 2W0XA 3NNGA 5GLVA 5IHRA 1JYNA 5AFEA 2QTWB 2JE8A 4QX0A 1SLAA 3E5XA 3S6PA 4CDQA 1GP4A 2GNBA 3VHPA 3JXSA 4O65A 4CCOA 2QQMA 2HEYF 4NHXA 4CCKA 1W6QA 2AUYA 3O1PA 4MGKE 2A3XA 2WNOA 1X36A 3HN3A 2AYHA 3AZZA 1W0OA 4Q0UA 3KCYA 2D44A 4FSJA 5FZ6A 1DQ6A 1YWKA 4CP2A 2ZHKA 3FMGA 4Y1XA 1JZ6A 3WDTA 3B93A 1PO12 5KWRA 4D94A 4GB31 2KA3A 3DV8A 3VDAA 1UXZA 4RN5A 5FYTA 3TN91 2HJIA 4AGRA 5A32A 1XE0A 3ZYPA 3NV2A 1NQJA 3IT8A 1MEC3 3JUUA 2VQTA 4LKEA 4BQWA 2SBAA 4X6QB 2ZAAA 4ZONA 5BNNA 4BPZA 2VBPA 4IV1A 4Y5Z0 4GMP0 3W21A 5K0UB 1RMU2 2JXAA 4QKBA 2WNUB 2R073 1CAUB 4UYBA 3VHRA 4E9KA 4CEWA 3UYJA 3JCIA 4N9HA 3V0AB 3FLTA 4OQ8A 1PGSA 3POIA 4ZPIA 1H6XA 2XBO2 1VBA3 2WWJA 3H3LA 3OGJA 2RS52 5JOYA 3ROUA 3TRSB 4YVWA 3ZKYA 5A7QA 4KWLA 5H9SA 1U5IA 3CKHA 4LKSA 1BVVA 4OULA 3PU3A 1O4TA 1AYN3 4IGOA 3L2HA 3LD8A 3TNQA 3V0BA 1AJKA 4CP9B 3RWKX 1AR83 4JV4A 1SACA 1LHOA 5FZLA 2D5FA 2YB7A 5F5QA 3ZYIB 1QJZA 5T50A 1DGWA 5FY5A 3E6DA 3I4IA 2R0HA 1H9WA 2B9VA 3MUZ1 2FD8A 2R042 1S0CA 2LROA 1EV13 1AXZA 5JDBA 1QJFA 4CDXC 2DTWA 3GBWA 3ZO0B 1J1LA 2VJXA 5K4LA 3U10A 1NY71 5FY7A 1GWKA 4IEWA 3OPWA 3RYPA 2XKPA 4Y1YA 3MO4A 4MGSA 3M7AA 4IW3A 4JTNA 2C9KA 2QQNA 4LHKA 4PBOA 2RS33 2JX9A 4HANA 2XJUA 3I2HA 5HCBA 4YGBA 5A3NA 1UOBA 5FZ8A 3DPRA 1AR73 2X53S 3NNLA 3LA3A 2RR13 2P3JA 4A41A 1KQRA 1E5IA 3BALA 3J8F3 1ZZ8A 2WNVC 2X09A 2Y34A 4I3GA 4HVOA 5FY1A 4PIYA 4AXOA 1Q43A 2LRPA 4NPLA 3I2FA 3O5SA 3VL9A 5CFCC 2E26A 1M4WA 3K48A 1POV1 2P5BA 4Q0VA 4GWJA 4X8NA 1RUH2 2H0BA 5FY0A 5IAVA 3J7MA 5FUPA 3R4UA 2IFWA 1U5XA 4WZFA 3SC7X 3U78A 4QXHA 3VBFB 3BOWA 5L9RA 1RITA 4QU1A 2EXIA 3SH4A 2W2IA 4P14A 1FX5A 2RMU1 3A0KA 5GZGA 1N1VA 2VMCA 1GZCA 1H0BA 4GWNA 2JG9A 4XYXA 4CDXB 1UZWA 3RZJA 3THPA 1QMJA 3WW1A 4ARXA 2YFZA 1ULOA 1RUC2 5ACA1 4D8MA 1HXS3 4KBZA 1ND2A 3VB9A 1R093 3MW2A 5FPBA 3H8RA 4XXPA 1IS6A 1ZM1A 4AHYA 5FYIA 4FAHA 2BQPA 3LE0A 5IK8A 1EUTA 1GNYA 3C2UA 4FBFA 1J3QA 4UI9L 4JKKA 4WM7C 2YHJA 1W8UA 3ILNA 5EYXA 4XF0A 4GALA 2ZEZA 1YQCA 2WNVB 1OA4A 4LBOA 5DDJ1 2YZ4A 3BODA 4XUOA 1DG6A 4BK4A 4META 3VDDA 3H42B 1RUF2 4XIKA 3PJYA 4EWDA 3KS7A 2MEV3 4WVMB 3JQWA 4Y22A 2FZ2A 5CFCB 1PZ9A 2BEOA 4P9XA 1QJX1 2AACA 3T4HB 4YSFA 1ZA4A 2GMMA 4B4RA 3DYPA 1NOVA 4NHMA 3PVOA 1PMJX 1WGPA 3RZHA 4ES9A 1FYUA 3S7EA 2PQSA 1SG3A 2VPVA 4OHVA 4EJRA 2ZBJA 4TZDA 2Q8OA 4H14A 5J09A 2YV8A 4HZFA 1ZZ7A 4MHRA 1XNAA 1YI9A 1QKQA 1EAH1 2YBPA 2VUDA 5L9BA 4NHKA 4EV0A 2XONA 1JYVA 3INAA 1AF9A 4AZZA 3H7YA 2VL4A 4JGYC 4JQRA 2Y6KA 3KGZA 1OLMA 4WM7B
chains in the Genus database with same CATH topology
5GJ6A 3VUOA 5FBZA 2HWF1 3CL1A 3N7LA 2ZX3A 4Q29A 4C91A 5KHKA 1AR93 2XH6A 1GNZA 3HIFA 5CG8A 4EROA 4LEJA 1HQNA 1YIFA 1SLTA 3C3VA 3SCHA 2E9QA 1VALA 4LO5B 2VGDA 4E4SA 1V9U1 4HK8A 4Y1ZA 3NO8A 1QJY2 1SBDA 2D40A 3MEPA 4Q4W2 1CJDA 1GLHA 5I8SA 4I30A 4XJUA 1A78A 3D82A 4XPVA 1VBD2 2YGMA 2WS91 1Y9QA 4M0NA 2ZGPA 4ISQA 1NLRA 2GDFA 2UWCA 1W6OA 3OGGA 4JGYB 1HQWA 4XJZA 2K9ZA 2ZTNA 1QH7A 2VUJA 4U2AA 1TNFA 2BGCA 1A6CA 2UYBA 5DZFA 2ZGQA 2PAKA 4LLFA 4RHV1 4LT5A 4PDWC 4YW2A 5JVVA 2XG3A 1DGRN 1VBC1 2EXKA 3NV4A 4YVSA 3KLSA 2WZR2 4KWKA 3RMYA 4MVTA 1DQ2A 4MXWA 1DHKB 1PVC1 2FQPA 1TNRA 3HT2A 4PIZA 3WG2A 1WW5A 3VZKA 2V73A 5KHIA 2WFF2 4BH9A 1LCLA 3OD0A 1Q5OA 3VKOA 1AXYA 1H8TC 1ZREA 1OHFA 2D93A 3ZXLA 2HWC3 4J1XA 1ND3C 1OQDA 3VBHA 4CDUA 1MS4A 3WP4A 1LGBA 4FPCA 2ET1A 3I59B 1TMF3 3B9IA 1AXKA 3MIBA 3VZJA 4E2GA 4RSUA 3PNAA 4FP2A 1CAXA 3ZX7A 5GZEA 2ZHLA 1V6NA 1MVQA 3WUCA 1YXWA 3IM0A 4PJYA 5BNPA 2IFRA 1WMFA 4YZ2A 2BNNA 4PDWB 3OF1A 1KDMA 2BYVE 2JENA 1NCRA 3PHMA 1CAWB 2JECA 4AVTA 1LHWA 1RUD3 4N53C 4QGLA 3ZSMA 4WVZA 4AK3A 3TOJA 1V00A 1QF3A 1QQP1 1U5YA 4AI8A 1N3PA 3OY8A 4BA6A 1KXGA 4K3UA 1H8TB 4QGMA 2YMZA 2VY0A 2A6WA 1TME3 1RJ7A 4XJWA 1NCQA 1ND3B 5FLIA 4DMIA 1J1TA 1AL0G 1PM7A 2HWD1 5JOWA 3VZMA 1QWRA 4XHXA 2C1FA 2RMU3 3M3CA 4AEDA 1UKGA 1ENRA 3AMQA 5GKAC 1MS5A 1HQLA 2P17A 3WUDA 2DVDA 3J26N 1R083 4FT8A 1O3QA 2ET7A 5LRRA 5FOBB 4YGCA 5F1RA 2JJ6A 3B3QE 2IXIA 4O9GA 4N53B 2DV9A 2ZGTA 1PIV1 3FE5A 1B35C 3PVNA 3AFGA 3AP4A 2RS11 1H2MA 1GNHA 1RINA 1VBB1 2A6VA 2AREA 2LM3A 3EO6A 3JBG1 5GZFA 5CFDC 3V65A 5K9YA 1R1A2 2RE9A 2IXCA 4WM8A 4R52A 5FCCA 2KM2A 1S0GA 2P34A 1KRIA 3ECQA 1ENSA 5EYYA 4RL7A 3H8UA 3SXWA 4XTPA 4NVPA 1OI6A 3AZVA 3FJSA 4Q0PA 5BNOA 4HK9A 1IOAA 4OFGA 1DZRA 4L92A 3HBZA 1KDKA 3GF6A 4HPKA 4NWVA 2ES3A 2XJTA 1ONAA 1QNYA 3M2MA 3ZSEA 1FOD1 1UL9A 4L9BA 3LA2A 1MS1A 1H4HA 4TWTA 1UAIA 1LGCA 1B35B 2DCJA 4LBQB 4HKOA 1RUI3 2F6BA 4N90A 1W6PB 2WIIB 4H7MA 3NWKA 3FFZA 3MICA 4M3CF 1Y7BA 5CFDB 4W6WA 2Q0AA 4LA3A 4DPNA 3I8TA 4JDMA 5JSPA 2O1QA 5IK5A 2DUOA 4F8AA 1SLCA 1AZDA 2YYOA 2PHRA 4C1WA 1O4YA 3M3EA 2A75A 1XNBA 3E5QA 4MLOA 2D5HA 4GWMA 5JIAA 1YLLA 1OA2A 4K7JA 4YW5A 4CP0A 2D43A 3H1MA 1UF2C 5T5LA 3ZFEA 3JD71 1OOPC 3M1HA 5ABJA 3OBTA 2JE7A 3VBUA 1SEFA 5EV7A 2OZJA 3LGRA 1OMIA 4LE4A 5J96B 2CGPA 1RHI3 5JZGA 3D0JA 2WLPA 2I2SA 1DU3D 1O3RA 1J3RA 4BCUA 2WA3A 1AR61 4L11A 4LHNA 1HKDA 3I2DA 1QU0A 1DQ4A 3AM2A 4H3WA 1FPN3 1BBT2 1BYHA 2XVLA 1LR5A 5FPZA 1M06G 2VOVA 3ZFFC 2ZGNA 1PNFA 3ZN4A 1FATA 4BMEA 4XFAA 4B4QA 2WC2A 2BNMA 4QX5A 3CJIC 1RUOA 4JAAA 2E7AA 1RTVA 3AZWA 4L8QA 1LEMA 2DCZA 1WMEA 1O3SA 3O0WA 2BPA2 3ZYJB 1OOPB 2RS12 3E5UA 4IETA 2HWE1 1TEIA 5AVAA 3E97A 5AC93 1PNGA 1LOAA 1VAMA 4ORFA 1RUJ1 3JBG2 2ZGMA 2TNFA 2VQAA 5T5PA 1XNCA 3CNAA 3ZN6B 3X29B 2FMDA 4L97A 1Q8PA 2FHRA 2Q1MA 1YRZA 4KG8A 1WCKA 4BIFA 4WV8A 2I07B 1X82A 2DURA 5I0TA 3H7JA 1W6MA 5H9PA 1QXRA 3ZFFB 5T5OA 1ALYA 4Q0QA 4CDQC 1BJQA 5B2GB 4KWJA 3A0NA 3CJIB 1PGW2 4B4PA 3RYRA 1G8WA 4AGVA 4OHXA 2Y38A 3SH3A 1AYM1 2AENA 3AKTA 4Q4V2 4INDA 1VRH3 2XVGA 3LOIA 4Q4Y1 4Y20B 4M00A 2LALA 3WDVA 4EN8B 1XNDA 4Q1RA 1IGOA 3QACA 2RJLA 1CIWA 2GC2A 2QDNA 5DZEA 5FREA 4XBQA 2XL9A 1GBGA 2ZHNA 4FXKB 5LK7B 1UCXA 2PHLA 2WINB 2VW1A 4HT1T 2HWB1 3NL1A 2PLV2 5BNNC 1UD1A 4IV1C 4I0BA 3RYKA 4XMIA 4NWWA 3PTYA 1ZBA3 4CEWC 1YFYA 1LRHA 2BW8A 5AFBA 5CBLA 4YVWC 1G7YA 4UW5A 3N35A 3S7IA 4B29A 4XTMA 4CDQB 3W58A 2GN3A 3VKMA 4JDOA 4ISRA 1QHDA 4S2FA 1W6QB 1WD4A 1UU6A 2ZKNA 1T6GC 2QZ2A 4GKYA 2WT0A 1PO11 4G9SB 1BEV2 1FNYA 1LOCA 1DQ1A 3AMNA 2W08A 3HD8B 3URFA 5A32B 2LTNA 1ZZBA 4YM1A 3WD5A 4AHZA 1RMU1 1RUE2 4XJAA 2WLQA 5BNNB 4IV1B 1I6XA 2GC3A 3B00A 4FPFA 1UX6A 3N7JA 4CEWB 2XBO1 2ZHMA 1UIKA 2RM22 2RS51 3ZDSA 1EPZA 4AF9A 4YGEA 3WP5A 3VKNA 1SLLA 4YVWB 3RJRA 4AWDA 2B46X 1IPJA 5HBAA 4BWOA 3V0BB 3N3HA 2LUWA 2E7TA 3O12A 4UBGA 1PHMA 1C8M3 3WY6A 1H1IA 5C33A 1HRI3 1N3QA 2R041 1JHNA 3SCFA 2A7AA 1JN2P 2BWCA 3H9AA 4ITCA 1HRV3 2R49A 2EXJA 1C57A 1LHNA 3ZSKA 4MXVA 4IEXA 1ND2C 2K0GA 3TWIA 1BMV2 1COV3 5FFOC 4IV3A 2XJSA 1LENA 1OQEA 2ZKLA 1YO8A 3JB4C 4Q4Y2 2DVBA 3USUA 2VQ0A 5FTTC 3MPPG 2R072 1JYCA 2CAUA 3EQEA 3KCXA 4P9JA 4Y26A 1RUH1 3BTAA 3RJ2X 1VBA2 3SMHA 2XJQA 2WNEA 1UZZA 2K2SA 3CJXA 3CF6E 2Z69A 5E8AA 3GBFA 2XJVA 4YLZA 1AYN2 4CRQA 2GAUA 1D4M3 3PVEA 4HVQA 1OFSA 1D2SA 1YIPA 2JG9B 4QM9A 1RUC1 5HXVA 4UBHA 1JYIA 4OHYA 3OBRA 1ND2B 4SLIA 1EV12 3ME2A 3RI8A 4AYUA 1CGPA 3MLKA 3SISA 2BWAA 4IEOA 4I0WB 4KG0A 2FBEA 2ZZJA 1RVF3 4MV2A 2DU0A 4GMP1 3J9SA 4U36A 2RS32 1U0AA 1AX2A 2EAKA 1RUF1 1LJ7A 2EIGA 3R0RA 3VDDB 1W6NA 1AR72 4F3JA 4FVVA 4Y22B 2RR12 4DB5A 4F7ZA 5GZDA 4J6GA 4DS0A 3IBMA 3J8F2 4CYDA 2EXHA 3IN9A 2OPKA 4LO6B 2CYFA 3E6BA 3O0VA 2H6CA 3VHOA 3WINE 1WBLA 3WQ0A 1OKQA 3RDIA 3WHUA 2CL2A 1LKNA 1V6KA 5J98B 3KT7A 1DIWA 3AMHA 4HL0A 2F4PA 4OI1A 2ZS6B 5JR7B 2D6MA 4RFT0 4JTOA 2ERFA 4M01A 1CD3G 3VBFC 4CTEA 1NLSA 4Q4X1 2GNDA 1BXHA 3LB9A 1HXS2 4M0HA 4ZXKA 1F5FA 1R092 1BZWA 5FAXA 4Z1VA 3BB6A 1WLWA 5CG9A 4YM3A 4QM8A 3JZVA 3NV3A 4G3YC 3VLBB 2B5HA 4FPJA 4KH9A 4JGZA 4S2DA 2DCTA 2GNTA 4YVSC 4OI0A 1QOSA 2ZGUA 4XJ9A 2P37A 2R062 4B8EA 1QJY1 2MEV2 1RJ8A 1RUG3 3FHIB 3W59A 4ZKTB 1LHUA 3FC0A 4MZUA 4NO4A 2R1DA 4K21A 4Q4W1 2IXJA 4WZCA 3S0MA 4C1XA 4BM8A 1VBD1 3VL8A 4BHPA 2N7GA 3I7DA 3PVBB 1O5UA 4CDUC 3VBHC 4MGYE 2QNKA 1PGL2 2ILMA 3FLRA 1W6OB 1HV1A 1XNKA 1YJLA 2C9AA 4RS5A 1NQDA 2WL1A 5BNPC 4XFIA 4DOUA 4DY5A 4Z07A 4YRDA 3WT3A 1GZWA 2MNGA 3HAGA 1J58A 3APBA 5CADA 1W0PA 2WZR1 1NCRC 4Q2FA 1QXPA 1LOFA 3LSDA 3ILRA 2ZJCA 4YVSB 3IIAA 2GZWA 4MYEA 1AL23 2ZACA 4NPRA 2NLRA 4MXWB 3HWJA 1AR92 2NM1A 2WFF1 2X5IA 5I0UA 5JOXA 5C8CA 2JG8C 3TNPB 2CGNA 3L2YA 4XBLA 3ZN5A 3R05A 5F6KA 3VBSA 3H3ZA 5JIUA 1SCRA 2E6VA 1POV0 1QJU3 4RQPA 2KXLA 1NCQC 4CDUB 2ZX2A 3VBHB 2O0OA 5GZCA 3FFQA 4QQ2A 1Q8VA 2GH8A 5CA6A 3IMNA 5EJ3A 4OUSA 2NN8A 1W39A 4YG0A 3BPZA 4QU2A 4AEDC 4XHBA 1CAXB 5BNPB 1JH5A 2UURA 4D7TA 2G9GA 2YC0A 3UJQA 2VVDA 1WBFA 4PCRA 1NCRB 5J36A 1OA3A 2G4IA 4CP1A 2IC1A 1BCXA 1NYWA 3EXUA 5DUXA 1FMD3 5BXXA 4EN9B 2JG8B 3OY8B 1YI7A 1IKPA 4XFGA 2HYKA 3VBOC 3B7MA 4D3WA 1XU1A 1DZQA 4WM8C 4COUA 1PO23 5BUVA 1NCQB 1REEA 3VZNA 2DF7A 2JDZA 3O0XA 2CNAA 1VBE3 4FTEA 1IS5A 2XVKA 2P3KA 2HWC2 4LO7A 1ZNPA 3AP7A 4QPGA 4AEDB 5BNOC 4XMAA 5GLZA 1PZ7A 3VN4A 1TMF2 4ASLA 4EN6B 5BNQA 1DYPA 4LULA 3PMSA 3AKPA 3LKJA 1HIXA 3B69A 4LO8A 2VNOA 2GN7A 3RSJA 3D6EA 2ENRA 1X7NA 3FWEA 1KJLA 1MVEA 1YHFA 4K9SA 4B3NA 4COVA 5KHJA 1FV2A 4AI2A 1OD5A 2UWAA 2V5YA 2QKDA 4GB33 1G9CA 1RUD2 2PHTA 1R1A1 1RUF3 3UK9A 3VBOB 1XRUA 3TN93 3ZXFA 1FT9A 2GMPA 1I9RA 4PIXA 3UKTA 4ATFA 3UL2A 5BPXA 3RPQA 2UY8A 1KD7A 4WM8B 1D4VB 5E88A 4Q8KA 1OFNA 4MX3A 3U11A 2E53A 2NP0A 4HSJA 3HN1A 5FQ0A 1TME2 4QMAA 3AP9A 3SH5A 2R32A 5BNOB 5KXBA 4NR1A 1DQ0A 2Z79A 5KBFA 3B01A 3ZFEC 5E16A 4HPKB 4X8PA 5ABJC 4QPIA 1AHSA 3VBUC 3KCCA 3ZXGA 4GH4A 1IHMA 2ETEA 1A3KA 1MS3A 4AEJA 5JZGC 3AJZA 1R082 2WWSA 3AKRA 4XE9A 5L36A 1QNWA 4HN1A 2EVXA 4YNIA 3VZOA 4YARA 3AKSA 1V70A 4X6RB 5CIRA 3OCPA 3AP5A 3D8CA 1CVNA 1EPWA 2WNVA 5CVRA 4CEYA 4S2GA 3WZ1A 4GULA 2Q30A 3W9AA 1N1SA 4K1ZA 2VOKA 4LO4B 2DUPA 3WX5A 3WQ7A 1ZZ9A 4R4ZA 5CFCA 1DFQA 2WQZC 3MIEA 5JSRA 3RG0A 1GICA 3SHRA 4I2OA 5JPNB 3ZFEB 4I3PA 2AZ5A 1H2LA 1VBD3 2PA7A 5ABJB 4YGDA 1C5HA 3VBUB 2UWBA 1POV3 5JZGB 3RMXA 2DCYA 4LBKA 4S2HA 2DCKA 5JI9A 4M3CA 5H9RA 4ASMB 4N7UA 5LEJA 4E4DX 1CPNA 5KHHA 1BBT1 1IQAA 2UY9A 4KQ7A 1CONA 4AVBA 1XE8A 3NSTA 4UXAA 5ACA3 3O14A 1RUI2 1UPSA 2A73B 4OZXA 5D8AA 1PK6A 1D2QA 3NKTA 4LHLA 1CQ9A 1WW6A 2FZ1A 4W6XA 1HV0A 1RL3A 2ZPXA 4P9YA 1GFF2 4HFSA 3USSA 5DG1A 5DDJ3 4PLMA 3WCRA 1QY4A 2QQPA 1QJX3 4NN0A 1FNZA 4OHWA 3B94A 4LUMA 1WW4A 4XETA 2A70A 2D97A 1RHI2 4FAGA 2BNOA 2BVBA 2GH2A 5J3UA 1LOEA 2BFUS 4GXLA 4NHLA 3M3OA 1X8EA 4JRLA 4I02A 4BE3A 1W6MB 1Q8OA 5T3NA 4AVCA 3AYEA 1PGW1 2YPJA 3Q9OA 4GA9A 1FPN2 1EAH3 5C9AA 5FDBA 3ILFA 4Q4V1 5GALA 1I1EA 1JBCA 3TAYA 4C0BA 1FXZA 4W65A 5JMCA 3WHTA 2CY6A 1IS4A 3MIDA 1PMIA 2HWF3 4CZSA 2B9UA 2VU9A 1VAVA 4BLJA 2D3SA 1WLDA 2XKOA 3DGTA 2PLV1 3VBRA 3ZSJA 5AC92 3WDXA 4MGZE 4HETA 1S0JA 3P3NA 1V9U3 3JQXA 4AG4A 4MSVA 1UZYA 4OUMA 2OW4A 4B7EA 3DL3A 5EFUA 3WP3A 3GZAA 1NZCA 3ES4A 4HN0A 3GHNA 4TSVA 4PDWA 4AW7A 1SMVA 3OPZA 2WS93 3MF6A 1FI2A 3V56A 2VXRA 2IXHA 3WXPA 2RHPA 5K7PA 1HDKA 1PVXA 3ELNA 3FUOA 2WT2A 1BEV1 4QGNA 4D69A 1VIWB 2WFPA 4JCKA 3MFCA 1ZZCA 2VECA 5CAZA 3ATGA 1CESA 4RHV3 4DINB 3ZVXA 4XQDA 1VRH2 3IKWA 1VBC3 4CDWA 1RUE1 2XHKA 3PJQA 1MZ6A 5IUQA 3WCSA 1ND3A 2TUNA 4YW4A 1CX4A 3KT1A 1PVC3 1SQ4A 2AR6A 5F6LB 4IV3C 5CB7A 2RM21 2ATFA 1GQGA 1O91A 4E2SA 3R4DB 3AFKA 2R0FA 4AFBA 3TBDA 4YZ5A 1ZBA2 3H1YA 1NE4A 1UKRA 4XXAA 3IDEA 4KL1A 1LHVA 1Z78A 3LSEA 1ZRCA 2B7YA 5CNAA 5I91A 3FLPA 3LA7A 4IQPA 4I01A 3PLQA 4EWAA 3IWZA 1MS8A 3WG4A 1LB2A 5TSWA 1X33A 4QD2A 3QH6A 1YFXA 5E1RA 1BMV1 5J7MA 4XILA 5A33A 4IV3B 1Q8QA 1QQP3 2QFEA 3AK0A 2WSVA 1WD3A 2WT1A 2ZZQA 2R071 1FAYA 3FBYA 3USUB 3SNMA 3QH7A 1RIRA 4Q1PA 4Q4X2 1Z7S2 3NVCA 4LLOA 2CTVA 3UKNA 5DUUA 1VBA1 3NAPA 5H9QA 4MH0E 2HWD3 1IKQA 3H0OA 2ZGOA 3MGUA 2E51A 2YGLA 3M3IA 5K8SA 4ZU5A 3AX4A 1AYN1 1BBT3 2VW0A 4QHBA 1ASJ2 5E89A 3U4XA 1DDLA 4HSLA 2ZGRA 4FTSA 1C8M2 1ULCA 3AMPA 5EWSA 1HRI2 3MIFA 1EP0A 4FXGB 1EV11 4Q0SA 4Z92B 3LCPA 1HRV2 1PIV3 5GLWA 2PHXA 2A5ZA 3ZYGA 3OTFA 4HBNA 3GZTB 2RS13 2XLGA 2RS31 4XFBA 2OYZA 3JBG3 1VBB3 3ZFGA 1COV2 2H6BA 3VKFC 2XL7A 1AR71 2DVFA 1VR3A 4XZPA 3MYXA 2RR11 1ZBE2 3AJYA 2D6OX 5IK4A 4LUKA 2EF6A 1W6NB 3J8F1 5FLHA 3BU7A 4G4FA 1A8DA 2AH2A 4MGIE 1AUYA 2IZWA 3D0SA 3WVJA 4R4XA 3U07A 2ARBA 3DPRC 3MI8A 4Z2WA 1N1YA 2VOXA 2PQQA 3NW4A 5DZGA 1FOD3 4KGQA 2A6XA 2DFBA 1I3HA 4B7KA 5DUVA 1D4M2 1GZ9A 1SCSA 4Y4YA 1QXJA 1OPOA 2QVSB 4XDQA 3AYAA 1XYNA 4E27A 4UW4A 4ZU4A 4L99A 1CAVA 4FPEA 1AJOA 1HXS1 2ZGSA 1R091 4XEZA 2BFUL 5LEKA 4RS5C 4EN7B 4QQPA 2NPIA 2NYYA 4R9BA 5T54A 2QUOA 2JG9C 1RVF2 3ZPYA 1O7FA 3KB5A 5JAXA 4DZGA 4MUVA 1LOFC 4K6BA 3WNXA 2R061 4JGZB 3R4SA 1LEDA 4FQZA 4FQ4A 2MEV1 4H7LA 2AGSA 2VOWA 2X5IC 4BOWA 1MEC2 2XLFA 3O7OA 5FLJA 1KFUL 5C8CC 3ES1A 3JD73 3DPRB 3D5OA 4KNCA 5C8WA 5I8TA 1UW8A 2PAMA 2YROA 4K40A 3KGLA 3VDDC 4RQPC 4FOVA 1PGL1 1CN1A 2QJVA 2D6KA 2WA4A 1B09A 4OVEA 1AR63 2A3WA 1IPKA 3WQ1A 2Y26A 3KD4A 1G9BA 5L7OA 4RS5B 2R1BA 1TE1B 3POYA 1AR82 3RWNA 4OI4A 4AEKA 2PN5A 4XF1A 1GZWB 3AB0A 4IEZA 3S30A 3AYDA 5DXDA 3ENRA 3RI9A 3ZMNA 1QH6A 1AR91 3QD6A 1H30A 4XQ4A 2X5IB 5I8YA 3NJZA 4I0AA 1IS3A 2Q4SA 5C8CB 4FPHA 1VB4A 2HWE3 1QDOA 1JOJA 1GV9A 1RUJ3 3VBSB 4LE3A 1MR5A 1RUG2 5KC5A 4RQPB 2PHDA 3KMHA 1VAKA 3MW4A 4XFCA 4P9IA 5I93A 2G9FA 3ST7A 2FMYA 3T2TA