5C4WB

Crystal structure of coxsackievirus a16
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
245
Chain Sequence
SDRVAQLTIGNSTITTQEAANIVIAYGEWPEYCPDTDATAVDKPTRPDVSVNRFFTLDTKSWAKDSKGWYWKFPDVLTEVGVFGQNAQFHYLYRSGFCVHVQCNASKFHQGALLVAVLPEYVLGTIAGGTGNENSHPPYATTQPGQVGAVLTHPYVLDAGIPLSQLTVCPHQWINLRTNNCATIIVPYMNTVPFDSALNHCNFGLLVIPVVPLDFNTGATSEIPITVTIAPMCAEFAGLRQAVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
molecule tags Virus
total genus 52
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c4wB00
1AR71 4AEDB 1VBC2 2XBO3 1SMVA 1VBD2 1ZBA2 2WZR2 4Q4V2 4AEDA 4CEWC 5FMOL 5L7OB 1F8VA 2RS13 1F2NA 4QPGC 5FMOS 1AR81 3ZFGA 2MEV3 4AEDC 1AR62 5DDJ2 4RFT0 1PGL2 1AR93 5ACA2 3CJIA 5L7OC 1POV3 1VB4A 1QJX1 3CJIC 2RM21 4RHV2 4CEYB 1AYM2 3J8F3 4GMP0 1HRV3 3JD73 1Z7S2 4SBVA 1NCRB 1PO22 5D8AA 5BNOA 4NWWA 2HWC3 1NCRA 4N53B 4BCUA 1QJY3 1RUJ1 1NA1B 1NCRC 1NY72 5GKAC 2R062 1DDLA 1HXS3 1RMU2 1E57A 1NA1A 4Q4V1 2HWB2 4N53C 4CDQA 1NA1C 5CFCB 2PLV3 1AR61 1R093 5K0UA 5CFCA 2HWE2 5ACA1 1RUF3 5AC93 5CFCC 1FPN2 1VBA2 2WS93 1C8M3 1QJU3 1BEV3 1EAH3 5BNPB 4PDWB 1Z7S1 4RR3A 2HWD2 1ZBE3 1PO21 2HWF2 3NAPA 1AYN3 1HX6A 1QQP1 1AL21 1B35A 1EV13 1VBE2 2RMU3 4FTBA 5A33B 4PDWC 5BNPC 4Q4W1 5C9AB 1D4M2 1ASJ1 1NCQB 1RUC1 1VRH2 1B35C 1RMU1 2R043 4YVWA 5A33A 2WFF2 2QQPA 1AR72 1V9U3 2ZZQA 2RS12 5C9AC 1NCQC 2RR11 1RHI3 3VDDB 1AR82 1R1A3 2FZ2A 4IV3B 3VDDA 4Y4YA 1FPN1 4RS5B 3VBSA 1RUG1 2RS31 4Z92B 3VDDC 1QJX2 4Q4Y3 3FBMA 3JB4C 3TN91 5LK7B 3DPRA 1FMD2 2GH8A 2HWD1 2RM22 4IV3C 1HRV2 1PGW1 5CFDA 4RS5C 1BBT3 1TME3 3JBG1 1CJDA 4RQPB 5J98B 1VAKA 5CFDC 4CDUB 1QJZA 3ZFEA 2BFUL 4WM7B 1IHMA 2XBO1 4RQPC 1RUD3 1GFF2 4LLFA 4Y5Z0 4CDUC 4WM7A 3VBUA 2RS11 3ZFGB 5JZGA 1OOPB 1X33A 4NWVA 4WM7C 4FSJA 1COV3 3IDEA 2XPJA 1OOPA 4Q4X3 1AR91 3CJIB 1HRI3 1POV1 3ZFGC 1RUE3 1OOPC 1FOD3 1FMD1 1TMF3 3J8F1 1HRV1 4GH4A 5D8AB 3VBOB 1PO13 5BNOB 4GB33 1AYN2 2HWC1 2R073 4CDWB 2BPA2 2X5IB 3VBOA 1RUI3 1QJY1 4CDWA 1QQP2 2X5IA 1AL22 5D8AC 3VBOC 1RVF3 5BNOC 1HXS1 1HQNA 1OPOA 4JGYA 4Q4W2 4CDWC 1ASJ2 2X5IC 1RUC2 1RUH3 4CDQB 1VBB3 2BUKA 2PLV1 2RS52 1R091 5K0UB 1K5MA 4CDQC 2RR12 5AC91 1R083 2WS91 5K0UC 3VBRA 1C8M1 1NOVA 1PIV2 1QJU1 1BEV1 1EAH1 1RUJ3 1AUYA 1RUG2 2RS32 4RR3B 1ZBE1 3NAPB 1VBC3 3TN92 1VBD3 1AYN1 1ZBA3 2WZR3 3M8LA 1RB8G 1PGW2 1B35B 1EV11 2RMU1 4RR3C 3JBG2 3LOBA 3NAPC 4YVWB 5DDJ3 2R041 5ACA3 5C4WA 1V9U1 2XBO2 5J96B 2RS51 1AL0G 4RHV3 4YVWC 1VB2A 5BNNB 1AYM3 1PVC3 1RHI1 3VBFA 1R1A1 1H8TB 2MEV2 5BNNA 1PO23 1POV0 4GMP3 1MEC3 1CD3G 1H8TA 3VBSB 1AR92 5BNNC 1WCDJ 3VBHA 1PIV1 4Q4Y1 1H8TC 3DPRB 1C8NA 2R063 5CFDB 1RMU3 5A32B 1BBT1 1TME1 3VBSC 1ND3A 2ZAHA 3J8F2 2HWB3 3JD72 5FOJB 5A32A 5ABJB 3ZFEB 3DPRC 2HWC2 3JB8A 5ABJA 2HWE3 4FTSA 1ND2A 1QJY2 1RUD1 2WLPA 5ABJC 3VBUB 3ZFEC 4N43A 1FPN3 1HXS2 1RUH2 1VBA3 5JZGB 2VQ0A 1COV1 2PLV2 2MEV1 4Q4X1 2HWD3 3VBUC 5C8CA 1HRI1 1R092 2HWF3 5JZGC 1BMV2 1R082 1W39A 1RUF2 5AC92 1FOD1 1VBE3 1MQTB 2WS92 1D4M3 1MQTA 1VRH3 1C8M2 1QJU2 4CEWA 4GH4B 1BEV2 1EAH2 4QPGA 2WFF3 1PO11 3JD71 1AR73 4CDXA 2IZWA 4GB31 1MQTC 1ZBE2 2R071 2TBVA 1RUI1 2GSYA 4CDXC 4GH4C 5L7OA 1AR83 1EV12 2RMU2 1RVF1 1OHFA 4JGYB 2R042 1RUH1 1VBB1 4QPIB 1QJX3 1V9U2 4QPIA 1K5MB 4JGYC 2BBVA 1PVC2 1FMD3 2RM23 4CEYA 4EJRA 1RHI2 4QPIC 1BMV1 1R081 1M06G 1R1A2 1MEC2 1RUF1 4CEYC 1K5MC 3VBRB 4WM8B 4N53A 4Q4Y2 4WM8A 1VBC1 1VBD1 2ZTNA 1ZBA1 2WZR1 3VBRC 4WM8C 4YVSB 1BBT2 1TME2 4Q4V3 3HAGA 4YVSA 5DDJ1 1X36A 1PGL1 1AR63 4YVSC 5C4WB 4JGZB 1RUD2 3ZFFB 4RHV1 4JGZA 1AYM1 1PVC1 3ZFFA 3VBFB 5C4WC 4JGZC 1COV2 3S6PA 2DF7A 3ZFFC 4GMP1 1Z7S3 1MEC1 4IV1B 4PDWA 4Q4X2 5BNPA 1HRI2 3VBHB 4IV1A 3VBFC 1RUE2 4FTEA 1QQP3 1AL23 1FOD2 1NY71 2FZ1A 2R061 4IV1C 4Q4W3 1ND3B 1TMF2 5C9AA 1ASJ3 3VBHC 1RUC3 2HWB1 1NCQA 1PO12 2RS53 4GB32 2R072 1ND3C 1RUI2 2HWE1 1ND2B 2Y26A 2RR13 4N43B 1RVF2 1VBA1 2WWSA 4IV3A 1PIV3 1ND2C 1VBB2 4RS5A 1RUG3 2RS33 3ZXAC 5C8CB 4N43C 2HWF1 3TN93 1VBE1 1A6CA 1RUE1 3JBG3 5C8CC 4RQPA 1D4M1 1NG0A 1VRH1 4CEWB 2BFUS 4CDUA 4QPGB 1TMF1 1RUJ2 2WFF1 4CDXB
chains in the Genus database with same CATH superfamily
2ZGNA 1DP0A 4NAOA 5E6HA 4AEDB 4OMDA 2E63A 3TYJA 4X6QB 1LHNA 5A7QA 4QM9A 4CEWC 4M0NA 1Q8VA 2VUAA 4CCNA 1L3JA 3E5XA 1UOBA 3ZFGA 2CTVA 3ZXDA 4AEJA 1W2OA 3CZJA 4XYXA 1GNZA 1SZBA 5IVJA 3FFZA 2B4KA 3G6JB 1YJLA 4G4FA 4R9AA 1UY0A 2C9KA 3AC0A 5DABA 1ODNA 1QJX1 2Y0OA 5G05L 1FAYA 5F5CA 2FMDA 1OLQA 1UOFA 1DZRA 4FPLA 1ALYA 5CEHA 2DCKA 3AK0A 2V5DA 3GYDA 2FDFA 4HLTA 1W6OB 1UZYA 5E8AA 5LRRA 4GMP0 2R1BA 4BXSV 1LENA 4SBVA 5FO8B 2ZGKA 2DDUA 2E26A 5FRAA 5FXXA 1ZA4A 1NCRA 3SC7X 3RFRA 4S2GA 5JMOA 2ARCA 3TEXA 3Q8AA 1RUJ1 3POFA 4AI9A 1NCRC 3ZMNA 2W5FA 3PLQA 5B2GB 1GANA 2H0BA 1CONA 4K8RB 3THDA 1HXS3 1RMU2 1XSQA 1NA1A 2OUHA 2DBNA 4DEVA 1RINA 4UFHA 5C7GA 3SLIA 5ISLA 1W0NA 3AP4A 3F2ZA 2J1AA 4EWAA 4ET7A 3WW2A 1NA1C 2V4VA 5CFCB 4ASMB 1G7YA 2YYOA 4PJYA 5FYBA 4QQPA 5K0UA 4UFKA 2HWE2 5DAVA 3KHBA 3CQOA 4JDMA 5CYYA 4A3XA 5FO9B 5LBBA 1IS4A 3WEZA 2YUEA 4HK9A 5FY5A 5H9SA 5KR7A 1FPN2 3MBWA 4UF0B 4CCCA 1JOJA 4M4PA 4IGQA 3SEPA 5JOXA 3USUA 1KQRA 1QY4A 1I6XA 3W5MA 2P3JA 4A3ZA 3WCSA 4AHZA 1OC1A 1HB4A 4RGKA 1BEV3 1EAH3 2W1QA 2ZHNA 1DQ5A 5BNPB 4PDWB 2QE3A 1L7QA 5L73A 2HWD2 3C7GA 1VIWB 2VOWA 2WQ4A 4ZONA 3SISA 1UXZA 1IG0A 2WAAA 3N7KA 3OCPA 1LOCA 2W08A 2ZPXA 5J3UA 2PHDA 1QQP1 3VL9A 3N9PA 3RI8A 2W0XA 1AL21 2E51A 2RMU3 5A33B 4NHKA 4Q4W1 1U5XA 3NNGA 3IIIA 2HEWF 1D4M2 3WP6A 1RUC1 4XUPA 2GMEA 2R043 1RMU1 2WT2A 2XHNA 3O7OA 4YVWA 5FZBA 3VZJA 2E32A 2AC1A 2GMPA 4W8JA 4BXFA 3BYWA 1AR72 4DMIA 5JPMB 1W6PB 2DVFA 3LZZA 2FHRA 4Q26A 4ATEA 4S2DA 2P17A 3SH4A 4BPZA 1DG6A 5DAWA 3SMHA 2ORZA 4PF5A 1KFUL 1NXD1 1WW6A 3E97A 4GXLA 2EXKA 1I5ZA 1U12A 4P9GA 4IV3B 2O8OA 1FPN1 4Y4YA 5FYTA 2VZTA 2WL1A 1AJOA 2E53A 3JZVA 4RS5B 5IK7A 5FWJA 3VBSA 4P9YA 3O1MA 4Q4Y3 4FOWA 2DU0A 4RYDA 5H9PA 2LUWA 3JB4C 5BPXA 3TN91 1JHNA 4DUXA 3DPRA 4A44A 1BVVA 1S2KA 2HWD1 2QQJA 2O0OA 2XJPA 2VW1A 3DEMA 4XFAA 3IKWA 2Q8EA 3T2OA 4MZUA 3TEWA 4WVMB 3IPVB 5FMBA 3P6BA 4M0HA 1UN1A 3DGTA 3HEIA 4LOTA 3OEBA 3VLBB 1LECA 3WV6A 2Y6FA 5FZGA 4AHXA 4MGZE 1UU4A 5FYVA 2DUQA 4CDUB 3K4AA 3NJZA 2WZEA 4Y5SA 3LA2A 3H50A 1UYYA 2MPFA 4P9IA 5KWRA 3LF7A 1CPMA 3QACA 1CX4A 2ZBJA 3WT3A 3J7NA 3NNMA 1MS3A 4Y4RA 3D4KA 4Q5OA 3VBUA 3ZDSA 2J22A 5DG1A 2W1SA 4XPVA 5A3UA 3U4SA 5JZGA 3ABZA 1X33A 1RL3A 4NWVA 3FFQA 3FHAA 5DAQA 4XF3A 5I8SA 3TAYA 2OZ6A 1CZVA 1GWMA 4Q4X3 1PGSA 1U5ZA 1E5HA 3NV2A 3CJIB 1HRI3 4AK3A 4LUKA 3M1HA 3K2OA 3OG2A 1GUIA 3HT2A 1RUE3 4XAEA 3UV9A 4YFZA 1FOD3 4UYBA 1JHJA 1LJ7A 5C71A 4LO7A 1CVNA 5FUNA 3URFA 2ET1A 3ZYHA 2ARAA 4NIDA 4L8QA 4Y22B 2OPKA 3LGRA 3IBMA 1CAUB 4YZ4A 3WHTA 4AFDA 2ENRA 1GNYA 1H8VA 1OBNA 1ULGA 4GB33 2R073 4CP0A 4MGYE 1W05A 2BEOA 1A3KA 1JTZX 2X5IB 1QMJA 1V6IA 4XEZA 2F17A 5CA6A 3ZN6B 3GBWA 1MS1A 5FZ4A 5A6YA 3T09A 4UW3A 4BIFA 3I2DA 4QAWA 5D8AC 1ZRFA 1RVF3 2PHWA 2YROA 3HNYM 1G6NA 1HXS1 4KNCA 4ZPIA 2VMHA 4JGYA 5FPVA 5BV6A 1ENQA 1ASJ2 4YM0A 4CDQB 1TNFA 4AE2A 1YUDA 5DAPA 3VDCA 1YCIA 3WNXA 1HV0A 1CIWA 2YBKA 1L7RA 5IVYA 1K5MA 2DCZA 4GZ9A 4YARA 3KHCA 2Q1MA 3NKGA 3GZTB 3UGHA 1XXNA 2IFWA 2RR12 2R16A 3NQHA 4Q0SA 4OHVA 1YYNA 3QH6A 5JCTA 2Q5TA 3WNKA 3IDAA 1A8DA 4OULA 5GLVA 3WX5A 5HCAA 4XACA 3VBRA 1NOVA 1PIV2 3C7HA 1CAVA 1BEV1 1EAH1 5IAVA 3IDBB 3WDXA 2RS32 2B5HA 3B7MA 2JDMA 5FYZA 3W58A 1VBC3 3OJBA 4E27A 4ISRA 1VBD3 1LRHA 4FP2A 3E6BA 1AX0A 5CIRA 5CU1A 1A8MA 1XQNA 2J1UA 4LTAA 1LU2A 3I3DA 4BU2A 3VUOA 2WYFA 5DG2A 2RMU1 1V6MA 4M01A 3GZUC 4RR3C 1JU4A 3HOBA 3P1IA 2PHXA 2R041 4O7XA 2QUOA 2Y6LA 3S0MA 5ACA3 5LA0A 2YFZA 5A80A 5IYYA 1XU1A 1XC6A 4YZ2A 5C33A 2XBO2 5FUIA 5FXVA 1J1LA 3AKPA 1DYOA 1ULPA 4H2AA 1AL0G 4I01A 4RHV3 5FZFA 5BNNB 1WD4A 3H9AA 4XFCA 5GZCA 1UKGA 4BK4A 1H2LA 2Y6HA 3FWEA 5IWFA 3ZIWA 1O5UA 4MHRA 3RPQA 3V65A 3KLSA 4NPMA 1POV0 3ITQA 1CD3G 1H8TA 2DTYA 5FYSA 2D44A 3I59A 1SLIA 1DQ1A 3A21A 1PIV1 3VBHA 1W6MA 4UBHA 4BISA 4Q4Y1 1GOGA 1QIQA 3T2TA 3FHQA 1H8TC 1TEIA 1GZTA 2JDZA 1LEMA 1C8NA 2WT1A 5D2AA 4YW5A 2QDNA 5K4LA 5A32B 1YFYA 2XG3A 2K9ZA 1OF3A 1ND3A 3C7EA 3N9LA 5I0RA 2VTXJ 5T5PA 2Q8CA 2CAVA 5FOJB 4DXSA 5ABJB 2J42A 1BLZA 2PELA 3CU7A 5JIUA 1Q5OA 3THPA 1LHUA 4A2UA 4FTSA 2D5HA 2ATFA 3AMQA 1CAXA 3NNLA 3NJYA 3I2OA 2VMIA 2B45X 2ZX3A 4LR4A 5A3TA 3HQRA 5FQ0A 1OFNA 1OKQA 4YG0A 3RS6A 1G9DA 3H8RA 2VQ0A 4CXXA 2DYCA 3QOPA 4XXAA 2A5ZA 4NO4A 4Q4X1 1VLNA 2GH2A 5FYCA 5FZ6A 1HRI1 4K40A 2CSGA 1UQXA 4DUWA 1HN1A 2VAUA 3K77A 5A1FA 1BQPA 2WN3A 1HQLA 1UIJA 1H6XA 1FOD1 1X50A 4F3JA 1IPKA 4AVBA 3FJSA 1ZVFA 3EHKA 2DVGA 4LHNA 4YLZA 1MQTA 1DQ4A 1C8M2 4GH4B 4LMFA 3WF4A 1JH5A 4FVVA 4QPGA 4QXHA 2WKKA 3LA7A 3IMNA 3BI3A 2V72A 2W9XA 1MQTC 2R071 2LW8A 4GB31 2P6HA 3HNBM 4KQ7A 2YC4A 2VG9A 2QNKA 3O0VA 4AI3A 1C57A 2TEPA 4K7JA 5F5AA 4XUOA 1AR83 4YZ5A 3TRSB 1RVF1 1UOJA 2X10A 5F1RA 2ILMA 1WMXA 4O65A 1EP0A 1OURA 2VMFA 3DKQA 4HT1T 4YWAA 5FMCA 4H7LA 3RMYA 1FV2A 3MLKA 4FQZA 5E88A 3RDIA 1OI6A 4JKKA 3M3IA 4KWUA 4QPIA 1JOBA 2EALA 2FCTA 1FMD3 3NSTA 3LAGA 1XPWA 5EXOA 3BIEA 1GOHA 2XXZA 4OUEA 3D3AA 1W6OA 3AMHA 4QPIC 1M06G 4DS0A 2A6XA 1ZZCA 2D6NA 1VMJA 3J26N 3RYPA 4DXZA 4HVRA 3FMGA 1O91A 2O8QA 4DEQA 2ORXA 4P08A 5JOZA 1ZRIA 2EICA 4KU8A 4WM8A 1AX2A 1VBC1 4XBQA 1N1YA 1VBD1 3U10A 3CKHA 1UCXA 4WBBA 2WQZC 3VKNA 4WM8C 1JMUB 3T1MA 1TME2 1XYNA 2CGNA 2R0HA 3M3QA 3HAGA 1QXPA 4KGQA 4EROA 3TEYA 2VVEA 1PZ9A 4CCLA 4HFSA 4OHWA 4CPBA 5C3SA 3T3YA 2HBUA 3KQ4B 2IFRA 2EVXA 1LR5A 1F15A 2JXAA 2LROA 2VMGA 2Z2SB 2XQRA 2OUJA 2ADDA 1PNGA 5HCFA 3U14A 4JVAA 2P34A 5EYXA 5F32A 2W68A 4P5YA 5LA2A 3POIA 1RUD2 1HJFA 2C4XA 4RHV1 3AKQA 1DU3D 3PJQA 4UF0A 4D7YA 1DQ6A 4BQ5A 1AF9A 1LTEA 3ETPA 3RRDA 3VBFB 2LM3A 3ZFFA 3M3CA 5C4WC 4LNVA 5LA1A 2VZSA 4IEQA 2KA3A 1UY3A 4L99A 2DF7A 2ZHKA 2Q0AA 3ZFFC 4PDWA 5BNPA 1UKRA 1F5FA 4FXGB 1UX6A 1QJEA 2W3JA 3QCWA 1CN1A 5D1IA 2XJTA 3ZYJB 1QOSA 1Z0HA 4Y24A 3IZOA 1Q43A 1LGCA 3AMPA 1NY71 5C8WA 1NAEA 2J1VA 2GNBA 2NN8A 3UNPA 4IETA 4NOTA 4AI2A 3V0BB 1B09A 4L2NA 1H6YA 2V5YA 2BERA 1DIWA 1ULCA 1UMZA 2A7AA 1J58A 1V0AA 3O0XA 4PF1A 3M4FA 2FCVA 1W6PA 4OI4A 4XF0A 1JW6A 4F8AA 4U36A 1YFXA 1VMFA 4QX3A 2ZMLA 2E9QA 2Z4FA 1KD7A 2BYVE 1JYCA 1S0EA 1IOAA 2PHFA 2J1TA 1W3XA 4EWEA 2VOKA 5HXVA 2D6LX 2VMEA 5FKCA 2WWSA 3WUCA 4CTEA 1GZCA 4IV3A 1ND2C 2VCCA 5KHKA 4RS5A 4NRPA 4HOOA 2K46A 4YG6A 4IW3A 4E2SA 5A7SA 4N43C 3KS7A 2VNVA 1SEFA 2GN3A 2YC0A 3H42B 3ASIA 2CDPA 4XJAA 3KVAA 5HBAA 5AFBA 3OD4A 4LBLA 4WVMA 3IPVA 4COYA 3A22A 2EF6A 4OQ8A 1EPZA 3PVNA 1RJ7A 2QQWA 5FDBA 3AXDA 2J1RA 2LRPA 1PK6C 1NG0A 2WNOA 4N9IA 1CESA 3SHRA 4CDUA 2XL7A 1K42A 5DUUA 3BKZA 1DCSA 1WLDA 5LY2A 5EIYB 3BODA 2WAOA 3RVHA 1W8NA 1XOYA 4GWIA 4XMAA 5I8YA 3LE0A 3POGA 2WABA 2WZR2 1LGBA 1GICA 2A75A 5FMOL 1W99A 1F8VA 3WDYA 2ADEA 4FAHA 2D43A 1AR81 4MG2A 1W2AX 4AVAA 2SBAA 3M3EA 2MEV3 3FN9A 3OBZA 5FMDA 4UFLA 5DDJ2 2XJSA 5FFOC 4B4PA 1LOBA 2N7GA 5FZOB 1PGL2 1MS0A 3CJIA 3OBAA 3ACLA 1VB4A 2Q8OA 3SCHA 3OPWA 4D0QA 5L7OC 1KJRA 4FOQA 4LQRA 4MO3M 4COVA 1YQCA 5CZKA 3H3ZA 1UAIA 2UY8A 1L7LA 3OEAA 3B02A 3CJIC 4MXWB 4RD7A 4CEYB 4K21A 1A78A 1GMMA 4CPBD 1HRV3 3JD73 1UY1A 1UMIA 1WLCA 1WMFA 4IGPA 4LKFA 3BPSA 1DYPA 1PO22 3DF0A 4AWDA 1CAUA 3WQ1A 3CO2A 1SLAA 1XE0A 5F39A 5FAXA 4NWWA 4FPJA 2DFCA 4R52A 1W6NB 1ZX5A 3DYMA 3N36A 2BGPA 4IXLA 4N53B 4JX0A 5F3GA 3ZYGA 4YGBA 3B01A 3AFGA 1O4ZA 4LKDA 4XE9A 3ZN6A 2VZVA 3JUUA 2WWJA 3IMMA 2DCYA 3UL2A 1E57A 1CZSA 4C0BA 3KCYA 4JAAA 1UXXX 3UK9A 4IUGA 2P2KA 2FDJA 1BHGA 3BIWE 3SKVA 4S2HA 3ZMOA 4ZU7A 4CDQA 4BQXA 3VV1A 3OOXA 4P00B 1QU0A 2P37A 1R093 3DKWA 4L11A 3CEWA 3V56A 5IVEA 2RDNA 1D2SA 1JYIA 5HPOA 2XJQA 1RUF3 5AC93 4PT6A 4YZ1A 3SXWA 5B4XA 1MS4A 3WDVA 4IE4A 5JWPA 3MFCA 2D98A 4Y5TA 3A23A 2VZOA 2YY1A 4JTNA 5F3IA 1QJU3 3H7JA 1R1ZA 2X05A 5FLHA 4D6SA 3ATGA 3MLLA 1S0GA 2ETEA 2DURA 2UYBA 1WCSA 2BGCA 5CISA 1ZBE3 3OGVA 1PO21 4B4RA 3AL6A 1W8FA 2HWF2 1ZZBA 2JDHA 2VPVA 2WC2A 3LSDA 5A3MA 4XQDA 1LEDA 3GF6A 1PX4A 4KH9A 1EV13 2D5FA 3FLTA 3PJYA 4FTBA 5KHJA 2VMDA 2E7TA 1OKOA 3WW1A 3VZNA 1O3QA 3PU8A 3RI9A 5C9AB 4LHLA 4W50A 3O1TA 4WVVA 1VRH2 2FDKA 4KMQA 3C7FA 2JG8C 4J25A 5FZ7A 2WFF2 4FPKA 2QQPA 1OVSA 4HKWA 3LKJA 4HN1A 3WY6A 1V9U3 3LPGA 4L9BA 2B42B 1NCQC 1OVPA 1ULOA 1YXWA 2ID4A 1RHI3 2Z42A 1POQA 3WW4A 1JZ8A 2DV9A 2X8KA 3OGSA 1WW4A 1GQHA 3AYAA 3VDDA 2XLFA 4BE3A 3W59A 2ZMKA 4OI1A 1ODMA 2YU1A 1S0BA 4Z92B 4XFHA 3VDDC 1QJX2 4D69A 4XBLA 1GZWB 2X29A 2GDFA 2VBBA 5FJHA 2BDRA 2W46A 3K4DA 5FZ0A 3MIDA 4NHYA 1BYHA 2GH8A 4BQYA 1HRV2 3NWKA 1PGW1 4IESA 4MX3A 3KT7A 5C3PA 2JDUA 1LOFC 1OLRA 3LA3A 4XQ4A 3ZSJA 1CJDA 1W9WA 2VZUA 3D82A 3M7AA 2NZ9A 1VAKA 4Z2AA 3SITA 5LY1A 2BBAA 1XSRA 5LRSA 3IIAA 4WM7B 5BNQA 5A6QA 1W06A 2VOVA 3AFKA 4Y1ZA 3OY8B 3O12A 4QDRA 4RQPC 3VHOA 3W20A 4Y5Z0 1F9KA 4FPCA 4IEXA 3PUAA 3VDBA 5L19A 5FPUA 2B39A 2Y38A 3FL7A 5JXGA 1IS6A 1XJAA 3BU0A 1NLQA 1OOPB 3AP9A 1S55A 1COV3 5L9BA 1J3RA 5F7UA 2QQVA 1RC6A 3QLQA 2UURA 4FT8A 4QQ2A 1G8WA 1V6OA 2Q1FA 1MR5A 3BU7A 4BIOA 5HI0A 2BVVA 1OUXA 3ZFGC 3IWZA 4BQWA 1X7NA 4LIVA 2VW2A 4AVVA 3O1UA 1ULFA 1JOPA 1TQ5A 4XVHA 3WDTA 1OH3A 1W9YA 4I2OA 4PCRA 1SLBA 1TMF3 5GLZA 2ZGLA 1HRV1 3OSDA 2SLIA 5FYIA 4J6GA 4GH4A 2I45A 3ES4A 4XUNA 1W03A 1YFWA 3VBOB 4ES8A 1PO13 4M3CA 1WCQA 5BNOB 1DGRA 2PN5A 2ZEYA 3ZO0B 4I09A 4CDWB 2IVJA 3GCXA 2XL9A 5A3PA 3SEEA 4NIGA 4YNIA 4RN5A 3VZKA 3MUY1 2ZS6B 5FY0A 4L97A 5JI9A 1SPPB 1S0JA 2WLQA 1QNWA 5FKBA 1QQP2 1SLCA 4M3CF 1AL22 4P9XA 5LASA 4AVSA 4P14A 1OPOA 4Q4W2 4QDQA 2F4LA 3RZKA 5L9VA 1RUC2 1SBFA 4NMIA 1RUH3 3OBTA 1WGPA 2P3KA 2WZ8A 3ZM8A 4ZZ8A 4IEVA 5FYUA 2KR2A 3H8UA 5FPAA 4DFSA 2RS52 2FD8A 1JBCA 1KXGA 2ES3A 1R091 1UYXA 2UWBA 1C1FA 4YSFA 5ERLA 4BMEA 1W8WA 2JG9A 3ACFA 1U0AA 3APBA 1XE7A 3VD3A 1ZRCA 1UPSA 2BNMA 2MNGA 3ZLIA 5AC91 2WFPA 4RSUA 1F5JA 1X8EA 5JI7A 2E7AA 2JG9C 3FBYA 1QDOA 3RMXA 5K0UC 2BU9A 2QTWB 5FZ1A 1QJU1 5T52A 2VZRA 3ZYRA 4JV4A 3UGGA 2A3YA 2ZKNA 1AUYA 4JCKA 5I0DA 1CX1A 2ERFA 3M70A 1G86A 1N1TA 1ZBE1 3ES1A 2DUPA 3NAPB 4QX5A 4DINB 2WWUA 1N3OA 3TN92 1ZBA3 2ZGMA 3M8LA 1JZ3A 4HSJA 4NVPA 1RB8G 4CU8A 2VTXA 5FY1A 4N7IA 1EV11 4OI2A 1W8ZA 3WCRA 4FCAA 3ZXLA 3LOBA 2A73B 3KM5A 3N3HA 3C3VA 2Y0IA 1NE4A 3R4DB 3DCQA 2CGPA 4R8HA 3UJOA 1OQEA 1V9U1 5KHGA 2VR4A 2WNUB 3I2KA 5EWSA 2JX9A 4LBKA 1YO8A 5J96B 2RS51 4BQ4A 3DUIA 4YVWC 5FR3A 2ZX2A 1AYM3 5GLTA 1DQ0A 1RHI1 5F6LB 2AACA 3VBFA 4RL7A 3M3OA 3QBQA 5D21A 4LHKA 3I3MA 3P3NA 4Y1UA 4PBPA 4XIOA 2PAEA 4GMP3 5FZEA 3KZ4C 3VKFC 3KV6A 1IS3A 3K48A 3ILFA 3POYA 2NMNA 1WCKA 5FCCA 4L92A 5F8PA 3CL1A 3DV8A 2QQMA 1T6GC 2A1XA 5FREA 1O59A 1UZ0A 5EPAA 2R063 3HQUA 4B8EA 2ZGSA 3VBSC 1QKQA 1XNKA 2Y60A 2ZAHA 3BALA 4Q0VA 2HWB3 3V0BA 4XJ9A 2RG4A 1BCXA 1VAMA 4FFIA 3ZFEB 1VR3A 3DPRC 4PQ9A 4I3PA 4KG0A 3JB8A 4YGDA 1LULA 2GC3A 3LFIA 4RA0A 3ZKYA 5LEKA 3RJ2X 4D7SA 5IK8A 2R32A 4YYOA 4XDQA 1K45A 2WLPA 3D0SA 4LO4B 5IATA 4UFIA 3U37A 1HXS2 1RUH2 1VBA3 3ORJA 3OYWA 3O5SA 4LLOA 1WMDA 3E5UA 4EE2A 5T5OA 4AR2A 5FZ9A 1COV1 1Y43B 3ZXFA 4PLMA 4BMBA 2Z69A 4C1WA 3T4HB 3S5AA 4O61A 1O4TA 5A7OA 1YJKA 3F95A 3VBUC 2EIEA 2WA4A 3P5BA 3Q8CA 4PBOA 3WQ0A 3K4ZA 2W87A 5JZGC 5JPNB 5JDBA 3I3QA 1W39A 3ZSLA 1JUIA 3DECA 4GQ7A 3CDZB 5JOYA 3GGLA 1VBE3 4HZFA 4PLNA 1CPNA 1NYWA 1URXA 1H30A 1SFNA 1W8OA 3UYJA 1EY2A 4NAMA 4KG8A 3POSA 5F37A 2EIDA 4QD2A 5BY5A 2OVUA 2VMCA 3G7DA 3I97A 2DU1A 3VD5A 1BEV2 1EAH2 4FAGA 1PO11 3L9JT 2IZWA 3ENRA 4QT6A 4ZS3A 3WG4A 4TXWA 2RDSA 1QOOA 2RE9A 2GZWA 3PU3A 3RJRA 2KXLA 2GSYA 2WUHA 3ZVXA 1S0DA 3MYXA 2DBIA 4F83A 2RV9A 2RMU2 1IS5A 3KGLA 1JYXA 4XILA 2D7FA 3PTRB 4HVOA 2R042 2UWCA 1RUH1 4Q29A 1D4VB 5FZOA 3D5OA 3KF3A 2QZ3A 5BYNA 5B4NA 5FP8A 4XDOA 3VHRA 5KBFA 4JGYC 2GC2A 4MSVA 2BBVA 2BQPA 4MGKE 4XHXA 5KHHA 5IVFA 2RM23 1J3QA 4BQ1A 4MXWA 2Y6JA 4CEYA 4EJRA 1MS8A 5LBCA 4MHUA 4D3WA 5FY8A 1SG3A 4C91A 1MZ5A 3ACIA 3B94A 4YGEA 5DUVA 4BWOA 2OZJA 4CEYC 4E4ZA 5FXZA 5LZ6A 1W8UA 1K5MC 3RG0A 1GQGA 4WZFA 1KRIA 5C5UA 3WXPA 1U5YA 5FY7A 4LBJA 1OMIA 2VZ1A 1CAWB 4TYSA 4AI0A 3U0ZA 1W6NA 2AUYA 3HQXA 4AI1A 2FBEA 4N53A 4Q4Y2 5T5JA 3R6SA 3S57A 2ZTNA 1ZBA1 3VBRC 3HBZA 3H0OA 1HW5A 1IKQA 4V2VA 1W2UA 2YGMA 4YVSB 1S2EA 1NE6A 2I74A 2ZX1A 5HCHA 4CCEA 1VALA 3FLPA 3VD9A 1HJGA 3MPBA 3LDBA 2Y8KA 3DN7A 4LBMA 4MADA 3WZ1A 4ARYA 5FY9A 5HXMA 1X36A 4CA9A 1OH4A 3S30A 4ZKTB 2OQ7A 1LOEA 5GLUA 4UFJA 3QH7A 2ZXQA 1GOFA 4YW1A 4Y26A 1FNZA 2OYZA 3ILNA 4JGZB 3WOGA 3RGBA 1V00A 1FT9A 3N9QA 2K2SA 4QQLA 1VJ2A 4BYYA 4S2FA 1K3IA 1Q8QA 4Q8KA 1LHOA 2V73A 1AYM1 2D40A 2QZ2A 4GD4A 1GP5A 1VRBA 2VXRA 3TB0A 1MZFA 5C3OA 4UFMA 3MIHA 3EXUA 3HMYA 4CXYA 1S0CA 1PMJX 1LODA 4GMP1 4Q4X2 1SACA 4AI8A 1HRI2 1XNAA 1Q56A 5FPZA 3CZUA 1C4RA 4IV1A 3ZYFA 3ZDVA 1RUE2 4Y20B 1FV3A 4W6WA 1FOD2 4OCTA 3HR9A 2R061 4IV1C 3LEMA 3ZOIA 5C9AA 3VBHC 1T2XA 2HWB1 2JDYA 2WNVA 3PDQA 5I8TA 1ZA7A 3LWCA 3A4UA 2NQYA 4GB32 5E89A 2R072 3THTA 2WNVC 4CP2A 1YQ5A 3AYCA 3IAQA 3AZZA 1ND3C 1JN2P 1W6QA 4FP3A 2DCTA 1FYUA 4C8DA 2ZA9A 5IHRA 2BOIA 1JU3A 2DFBA 4ISQA 4UI9L 5ANNA 4BM8A 1RVF2 3RZHA 3IN9A 2CV6A 4IEOA 3WF0A 4AQ6A 2V4AA 1VBA1 1UZWA 4GWNA 1J3PA 3GM8A 4IEPA 2YBSA 4COZA 1WLWA 2EIBA 3IM0A 3PVOA 5LBFA 4CU9A 5FBZA 1W2NA 3DXUA 1RUG3 3FUOA 1UW8A 2R1DA 4AQ2A 5C8CB 5FZHA 1J59A 4TSVA 3LEKA 2IC1A 1JZ4A 1E5SA 1PNFA 2WQ8A 3MIBA 2IVIB 4K6BA 5CKMA 1VBE1 3TNQA 1RUE1 3R4UA 3JBG3 4DQAA 3MPPG 1GKBA 3MFAA 3H1MA 4CUCA 4Q8LA 4CEWB 1HLCA 1BK1A 1HQWA 3BTXA 1NKGA 4EN9B 3H8OA 5KXDA 2QVSB 4ZZ5A 3I2JA 4CDXB 4A7ZA 1RGSA 1UO9A 2VUDA 3WDUA 2NPIA 4DXRA 1VBC2 2QCSB 1VPHA 1W8HA 4JRLA 1VBD2 3OY8A 4XAAA 1EPWA 3FHIB 3ZYIB 2TNFA 2ZGQA 4AEDA 1EUTA 4BA6A 2G1MA 4FFGA 5A3NA 2RS13 1F2NA 2JD9A 4QPGC 4XUQA 4LBNA 3ECQA 5FZMA 1NQJA 4PI0A 4AEDC 1WMEA 5I91A 3IT8A 1XNTA 1AR93 3AKSA 3ACGA 5ACA2 3FUQA 1POV3 4LJHA 1HN0A 4NIAA 3FLRA 3T2QA 3UT0A 1OQDA 1KFXL 3ETQA 5IW0A 2RM21 4RHV2 4YM3A 2OW4A 1HV1A 5F5IA 3HVDA 2YDEA 3J8F3 1REFA 3WNMA 5GJ6A 4NIIA 2JKBA 4BLJA 4OHXA 1QWRA 2RHPA 5H9QA 1NCRB 3WG2A 2JE8A 3J4UH 4MGIE 1EYBA 3JQWA 4XURA 4LE3A 4N9HA 5BNOA 2HWC3 4ZY9A 1WW5A 2ZEZA 4LXLA 2O14A 2Y6KA 4BCUA 2GC0A 1QJY3 1RTVA 5APAA 1NA1B 3MHZA 1SPPA 1TNRA 4META 3WQ7A 3K51A 1NY72 4QU2A 2XVLA 5C5TA 1DDLA 4K8FA 2B46X 5LATA 3JCIA 4QGLA 5FZ3A 4R9DA 3PTYA 5EYYA 5JR2A 1I1EA 5DUWA 2NYYA 4FQ4A 1HIXA 3RYKA 2JD4A 3SCGA 2PLV3 4E2QA 1W28A 1LHWA 2QFEA 3HNMA 5DAXA 1YRZA 5KXCA 3KSCA 1SFPA 2XJRA 4AHWA 5CFCA 3C2UA 1PM4A 4GJZA 1X82A 4FPOB 3KT4A 5ACA1 4UW5A 3B5LB 1M4WA 3CNAA 3AZYA 1JZ5A 1WA4A 5CFCC 1CIYA 2WS93 3NNFA 1OLMA 3UJQA 2OS2A 5LA9A 5K7PA 3U1XA 3WNOA 4TZDA 4NRMA 4J1XA 4LPLA 1W9SA 2VCMA 3IDCB 2VNOA 3RYRA 2VXJA 3HPNA 1W0OA 1GP4A 2IXJA 3NAPA 3MW2A 5BXXA 3WQBA 1HX6A 4JDNA 4FFFA 4JTOA 3B93A 4BQ2A 2QDRA 3FZ3A 4N8MA 2JECA 2ZHMA 2FQPA 5BNPC 4PDWC 1UOGA 4IE5A 2BW8A 4URTA 3GCWA 5A33A 1JZ7A 4KL1A 5DPNA 1IZ3A 4O9EA 1RYYA 5FZKA 3BVCA 4HKOA 2GC1A 2ZZQA 1APNA 4AFCA 1IPJA 2WNUA 2RS12 4EYUA 4I3GA 4XFIA 3IAPA 5EFUA 2XONA 1AR82 1C5HA 3SKJE 1R1A3 1UYZA 2EA7A 2AEYA 4CCJA 1XRUA 3POJA 4INDA 2VVFA 1IGOA 4LBQB 4UW6A 2PHTA 4IL7A 2CWMA 1AHSA 2C26A 1GLHA 1ENRA 2XKOA 1RUG1 1GWKA 3AL5A 3RWKX 2PAKA 2VZQA 3VHNA 2CYFA 1GQPA 3PURA 3MI8A 3T0BA 2D3SA 3ZX7A 4D8MA 1FMD2 2D97A 4IV3C 3AVRA 2BWCA 4UW4A 5LBEA 4DB5A 4RS5C 1EUUA 1BBT3 4XMIA 3RZMA 3DXTA 1OPMA 2AZ5A 2PHLA 3JBG1 4YPJA 3AVSA 4OUSA 5J98B 5T50A 1DLLA 1Q8PA 2YB7A 1GYKA 1UY2A 3WF1A 3ZFEA 5M0TA 2A3XA 5F2WA 1LB2A 1CJPA 1W0PA 2OIIA 3MF9A 2WZPP 4OI0A 4AL9A 4QQHA 2BFUL 1YI7A 4TN7A 2ZX0A 1JI6A 2V09A 1SDDB 5IK5A 3BCWA 1GFF2 3ZR5A 3ZPOA 5EZWA 5AVPA 3SQOA 4YW2A 2KD7A 4CDUC 2AREA 1CGPA 2RS11 3KQRA 3RNSA 1UYPA 2VU9A 3AYEA 2NM1A 4M3CE 2LTNA 4JC1A 4Y1VA 3EJKA 2RJKA 2YU2A 1UMHA 1PMHX 3IDEA 3J7LA 5KXEA 1LU1A 2XPJA 3PMEA 5IFTA 2XWBB 1F35A 1AR91 3AMNA 4E2GA 4W65A 1DGWX 1POV1 1E5IA 1QF3A 4AGRA 3T08A 3NNJA 4HXCA 4EWDA 3HIFA 5GLWA 1JZ2A 3RSJA 4KGGA 4NUBA 5A3LA 1H4GA 5HCBA 1ZRRA 3EMRA 5A7WB 5DN2A 4CXWA 1S1AA 1ZYBA 4TWTA 2WO3A 5J36A 1JUHA 3DYPA 2K0GA 1FMD1 3ALQA 1VAVA 3J8F1 4PLOA 1JYWA 5CG9A 4KWLA 1D2QA 3SH5A 3KV4A 3UESA 2Q4SA 4AEMA 3SCFA 5D8AB 2XQXA 2HEYF 1UY4A 1YWKA 2Y34A 2CL2A 3O0WA 4Y22A 2HWC1 4AOCA 3AZVA 2BPA2 4MVTA 3PNAA 3GZEA 1RUI3 2A70A 4DPNA 1SDWA 1QJY1 2E31A 3NW4A 4XHBA 2X5IA 3T0DA 4ONUA 2Y64A 4QGNA 2YXSA 1UL9A 5FYHA 2R49A 1O3SA 4BHPA 2YPJA 2WIIB 1HQNA 4NHMA 4XJ8A 5FOBB 1PHMA 2QQKA 1AZDA 2X5IC 1NQDA 5IFPA 1VBB3 3EO6A 5E16A 1GNHA 1WWYA 4HPKB 1OT5A 2XVKA 2B9UA 2PLV1 2KM2A 2VULA 3OB8A 5T3NA 1LESA 1SLTA 2DTWA 4XJWA 1BXHA 4P5HA 3T0AA 2RDRA 1I5PA 2WNEA 4ZU4A 4CDQC 1VE0A 1JYNA 3NMBA 2EXJA 1CAVB 3L2YA 4B1MA 1MZEA 3PL0A 2WS91 3N35A 2ZEWA 4HETA 3VHPA 1NLRA 1WZXA 4GAZA 4Z8BA 5J09A 3ST7A 3I3BA 1RUJ3 2VUCA 2WO2A 1CAWA 4RR3B 2JE7A 4QXBA 3CHXA 4MGSA 4V2WA 2VL4A 3P3PA 5FLIA 1BKZA 4ORFA 3AX4A 4MYEA 2YBPA 1WW7A 1CQ9A 1IG3A 4P9WA 4PQQA 1PGW2 1W9FA 1MZ6A 2I07B 2ZCWA 2HYKA 1B35B 4D6QA 2P1BA 4GKXA 1XNDA 4TLFA 4F7ZA 4Z07A 4FPHA 1V6LA 4JRAA 1D0HA 3WG3A 5GZEA 5BUVA 2VM9A 4IEZA 1SCSA 4C0HA 1U5IA 3HBKA 3CMGA 4WV8A 1ZREA 1W2TA 2P4EA 1TVGA 1S0IA 2ZHLA 4Q1PA 1UU6A 1PVC3 5J7MA 3AZXA 2EAAA 1QH6A 3UKTA 5CBLA 4UWDA 5KC5A 1R1A1 1H8TB 2MEV2 5BNNA 3I59B 4KBBA 3LEGA 1JZ6A 1MEC3 2JEMA 3H3LA 4HMZA 2A6ZA 5BNNC 4K1YA 2J1SA 5CKQA 4ASKA 4QPYA 4X8NA 1MACA 1G9FA 4JZRA 3W5NA 1OQ1A 4Y20A 2W1WA 4QGMA 4Z2WA 4Y33A 5FLJA 5CFDB 1RMU3 1REEA 4XJUA 5A1LA 1BBT1 4E4HA 3OUJA 2BRTA 1W90A 2PHUA 3JD72 2RJ2A 4GA9A 3N7MA 3WP3A 5A32A 5JSPA 2LS6A 2WDBA 2G19A 1QXRA 1UZZA 3VKOA 2P6CA 5KXBA 4J1WA 5J48A 4LA3A 5ABJA 5T55A 5JSOA 5L9RA 1UWWA 2HWE3 5EJ3A 4EQVA 3GNEA 5FQ0B 4QXCA 5IT6A 1UF2C 4LA2A 4XUTA 5ABJC 4CRQA 4K9SA 2IWGB 1FPN3 5I0SA 1YEWA 2QJVA 4CUBA 4ZS2A 4AF9A 4IEUA 4A7KA 1LGNA 1LOGA 5KC6A 1O6UA 1H1MA 4CP9B 1PVXA 4QHZA 1NZIA 2MEV1 2HWD3 1AVBA 2ZZJA 4PIYA 5C8CA 1P8JA 2WSVA 1R092 1PMIA 1WUVA 2HYXA 3OGRA 5AFEA 1BMV2 3T2PA 2QQNA 1N3PA 2HBTA 1RUF2 1CZTA 2GNMA 4H3WA 5AC92 1MQTB 2ARXA 3ZYBA 4BB3A 4BDVB 4BK5A 1ONAA 2QQLA 4QMAA 4DUVA 2H6CA 1D4M3 3MW4A 1ZM1A 4XW3A 3VZLA 3WVJA 1QJU2 4CEWA 5FUPA 3GBFA 5A6XA 1WCUA 1XU2A 1QNYA 3HN1A 3CJXA 5LB6A 3BOPA 5C70A 3JD71 1AR73 4CDXA 2A71A 1PM7A 5JR7B 1ZBE2 1RITA 2TBVA 4HL0A 1RUI1 1DLCA 4AW7A 4KWKA 5EJ1B 2OT7A 3MF6A 2IXIA 4CDXC 5IJRA 2VQTA 4GH4C 2Z5WA 3A0KA 3WNLA 2AENA 3VD4A 1EV12 3ON7A 3ZYPA 5A3OA 3CBNA 2RJLA 4B4QA 3KB5A 2JKXA 3ZN5A 4CSWA 2JDKA 4DZGA 1F4AA 5JXIA 1VBB1 4R4XA 4QPIB 3C8XA 3MIGA 2CGOA 3O1OA 1LOAA 3AM2A 5FZAA 1V9U2 3O1SA 1YQ2A 1AXKA 3WG1A 3KT1A 1PVC2 2W94A 1AXYA 3PHMA 3OUIA 4GULA 1RHI2 4HG6B 1BMV1 3MW3A 4HN0A 4IGOA 5FBJA 5FPBA 1MEC2 1RUF1 4H14A 1ZZ8A 5F3EA 3VL8A 2HEVF 1XNCA 2W92A 3K3NA 3KWVA 4EN0A 4QKNA 4WM8B 4E4DX 4YG3A 2BOJA 1CR7A 2IXKA 3GJBA 4DIQA 3ME2A 4B7EA 3BPZA 4OLLA 4COUA 4QX2A 3GXUA 4XQWA 4Z82A 2B7YA 4HVQA 4GJYA 1VMHA 4AGGA 3PIJA 1OA3A 3U78A 2B9VA 3M2MA 4Q4V3 4I0BA 3UKVA 1BK0A 3U4XA 1US3A 3MICA 3NKTA 5C6CA 2BWAA 5JVVA 4QDSA 4P02B 5CADA 2C9AA 2D6KA 3OGGA 1AJKA 5IVVA 1O3RA 1AR63 2ZKLA 3WD5A 2DUOA 1FXZA 5C4WB 2ZGOA 1QDCA 3B9CA 1TG7A 2RDQA 3O1RA 3ZFFB 2EXIA 2L9LA 5K8SA 4QHOA 3AP7A 3I2HA 4CCDA 1XYPA 3Q8FA 1PVC1 1RXFA 3BTAA 3I2IA 2CU5A 5I0TA 1KGYA 5CAZA 1N1SA 2WINB 4UAPA 1COV2 2JDPA 4QPWA 3WR0A 5LCWL 1TE1B 2PYTA 1GV9A 3LSEA 4LOSA 1Z7S3 1MEC1 1YIPA 4LORA 4R4ZA 2YFUA 5K9YA 1KDMA 5DUXA 3MUZ1 4AHYA 4DXTA 3VBFC 4YRDA 1JYVA 4DO0A 1XYOA 4N90A 2JENA 3WF3A 1NT0A 2XJVA 3K3OA 4RGAA 5FP7A 1DGRN 3O14A 2XGXA 3BB6A 1TMF2 1ZNPA 2HJIA 1ASJ3 1FI2A 4LK7A 2E7QA 1N1VA 1IQAA 3B9IA 2D6MA 2OX0A 5FK7A 3I4IA 2FDGA 1PO12 1DBNA 1ULEA 1UZVA 3N9MA 4OUMA 4AAPA 3RQ0A 4OZOA 5FY4A 2CAUA 3H3UA 3I2GA 2HWE1 1ND2B 1ENXA 2G4IA 5E1RA 1Y9MA 2ZACA 1ZZ9A 1S0FA 2XWJB 2RR13 4QKDA 5FZLA 3ZSEA 4N43B 2FDIA 3L2HA 2D3PA 2JWPA 5I0UA 4OHZA 3VGIA 2AGSA 3KD4A 1PIV3 2WT0A 4LBQA 4MH0E 4ARXA 2C1FA 2RS33 4Y1YA 5LEJA 3AMMA 3VKLA 5JOWA 3MV01 1XB9A 1PK6B 3K46A 4P9LA 4Z1VA 1KS4A 1SCRA 3Q9OA 4QX0A 5FZIA 3POWA 2WO7A 2VUJA 4QWNA 4CZSA 5CB7A 4A4AA 2CWSA 5IUQA 3H1WA 1D4M1 2BFUS 4B1LA 4IE6A 4XJZA 1TMF1 4QXKA 5FP3A 5LK5A 3GDBA 4LO8A 1NXMA 1AR71 4FPGA 2XOMA 3I2FA 2EAKA 2XBO3 1G9BA 1SMVA 5JXHA 3KCXA 1ZBA2 2OQ6A 1J84A 4Q4V2 2J7MA 5L7OB 4LT5A 4CP1A 2GMMA 2VO5A 2VQUA 5FMOS 2YZ4A 1X9PA 4GIQA 3B69A 4BZ4A 1TZOA 3B00A 1AR62 3MV11 1K5JA 2XLGA 4QM8A 4RFT0 1O7FA 4AFAA 2UWAA 2YMZA 1W3VA 3OBRA 3O1VA 4YM1A 1N3QA 3I3EA 5CG8A 5A7WA 1AYM2 4XBNA 5FP9A 4LBOA 3J7MA 3WHUA 3PMSA 3PUIA 4DOUA 3UKNA 1Z7S2 3N9OA 3N7JA 3NV1A 3PIGA 5D8AA 4AVCA 3LIHA 4ITCA 5GALA 3T30A 4UXAA 4TTGA 4PHZA 4NHLA 4E4SA 1CWPA 2E33A 1QJFA 1C1LA 3ZXJA 3NJXA 4AQTA 4W6XA 1J83A 3NV4A 2XR4A 5FJKA 3IB3A 5GKAC 3A7QA 1OLME 3VDAA 2R062 2AR6A 1ZRDA 2Q8DA 4UBGA 3PVEA 2WYSA 3S7EA 4QB1A 4Q4V1 1BJQA 2HKXA 2HWB2 1ZZ7A 4N53C 2F4PA 2IUWA 4CE8A 4BJ0A 3BTZA 1JXNA 4HPKA 4A6SA 5A70A 2W52A 5JLVA 1AR61 1OA2A 2QQIA 2WA3A 4LITA 2VNGA 3ROUA 2C24A 2Q1ZB 1G9CA 3KGZA 2PMWB 4NHXA 3WF2A 1G9AA 3TBDA 4YZ3A 3PUHA 1VBA2 4H55A 4XOGA 1A34A 4XF4A 4JQRA 3TNPB 4G3YC 2XUEA 1C8M3 2H0VA 2BP6A 2Z79A 4LIUA 1LCLA 2XDVA 1KEXA 1O8PA 3T1LA 1DFQA 1Z7S1 4O9GA 1DYKA 4RR3A 3PUSA 4XCBA 3AKRA 1HB2A 2VH9A 4EN6B 5JIAA 1AYN3 3LDKA 2JG8B 3JU9A 1GBGA 1K12A 3V0AB 2VCBA 1C5IA 2GNDA 1VBE2 1B35A 2AYHA 1YQ8A 4IQPA 2A3WA 1OD5A 5F3CA 5GZDA 1ST8A 1I9RA 4LBQD 4AFMA 1V6KA 1KDKA 1ASJ1 1NCQB 3ZSMA 2YV8A 1B35C 4XABA 2VZPA 2W1UA 4CCOA 1S4CA 2HLEA 3HD8B 4E8DA 5DZEA 3LCPA 4B3NA 1RUOA 3SH3A 5EP9A 2GN7A 2WJSA 4A42A 1XE8A 4AAXA 3HJRA 5HV4A 4B29A 5C9AC 4OMCA 1Y9GA 2ZOEB 2RR11 3VDDB 1GP6A 3KV9A 2NMOA 1GU3A 2DWRA 2JJ6A 2EXHA 5FZCA 3USSA 3W21A 4LK6A 4C90A 2FZ2A 1SFYA 4HBNA 4LO6B 2UYAA 1RJ8A 1DGLA 2W95A 5TSWA 2RS31 2F6BA 2R30A 3FBMA 3KVBA 5KHIA 4MOAA 1OSGA 3CLPA 4K20A 4KWJA 4V1PA 4AFBA 5LK7B 1KS5A 2RM22 3LQCA 1GZWA 5DZGA 5CFDA 1GWLA 1MPXA 1TME3 2YGLA 4K1ZA 4Q1RA 4CU6A 2GNTA 4I0WB 2DCJA 1R64A 2OKXA 3U75A 4RQPB 2W39A 1RIRA 1HB3A 3LIGA 5CFDC 2EIGA 1QJZA 2PXJA 4FPFA 1MVEA 3AZWA 4XIKA 3VZMA 1WLTA 4A6OA 1QGLA 3EBRA 4MLOA 1T6BX 1Y3TA 3LB9A 3WINE 1NZCA 4W6YA 4DY5A 2BVBA 5C3RA 1IHMA 3CF6E 4QU1A 4GWJA 4JQTA 2XBO1 4XZPA 2AH2A 1RUD3 3WNPA 3WUDA 4LLFA 2YHJA 1YC61 4WM7A 4OVEA 2G9FA 2YG0A 4QKFA 2VBDA 1QHDA 4PIZA 1LKNA 3ZFGB 3ZR6A 1Y9QA 2PAMA 2GALA 3WDWA 4FSJA 4WM7C 2Y6GA 5L36A 4QHBA 3ELNA 4BQ3A 1H1AA 4CP9A 3H7YA 4GKYA 1OOPA 1KJLA 2ZMNA 4LO5B 4YFWA 2JB8A 5H9RA 3T4VA 2C5DA 5FWEA 3X29B 1V6JA 1RUNA 1OOPC 1UPIA 1YLLA 1DHKB 2VC9A 3INAA 3NL1A 1C3HA 2JICA 3E5QA 2I2SA 4OFGA 4BOWA 3MIFA 4XF9A 3LOIA 4KI5M 2RVAA 4LEJA 4ZU5A 3LEIA 5A3WA 5FIXA 4M3CB 1YHFA 3D8CA 1QXJA 2JDAA 1LNSA 1Q8OA 3AJZA 4YW7A 4FXKB 3I49A 3SNMA 4MGQA 4HKLA 3WW3A 1AYN2 5FK8A 4Q0UA 1YQ6A 1GR3A 4FOYA 3J9SA 5T5LA 3VBOA 1DZTA 4XF1A 5F2SA 1D0GA 4CDWA 3QD6A 1DF0A 3MLJA 3KF5A 3AYDA 1WA6X 3LD8A 3MGUA 3VBOC 5BNOC 4KU7A 4X6RB 4CDWC 3AJYA 5A7NA 5A7PA 4YGCA 3ZN4A 2R6QA 2X53S 4XTMA 1XBFA 2Y33A 1STMA 2BUKA 1V70A 3OTFA 4XC9A 1BVP1 2JG9B 3MDPA 1H0BA 2UY9A 3OUHA 1VP6A 5K0UB 4I02A 2VE1A 1AX1A 2PQQA 4FOVA 4BLIA 4Q27A 1SBDA 1IQDC 3AP5A 1R083 1LHVA 4FBFA 1ULDA 3K75B 4LUMA 2DVDA 3EYPA 5FP4A 3USUB 4HONA 2JB4A 2IXCA 2X09A 2ZJCA 4XTPA 1C8M1 5IK4A 1FX5A 1RUG2 1IPSA 1SBEA 4NPRA 4CVUA 4WZCA 1W8TA 4LKSA 2VOXA 2A6YA 3VZOA 4AXOA 1AYN1 2WZR3 3RZZA 5I93A 2UU8A 2OXBA 2C0ZA 4JKMA 2VCAA 2VOTA 1KITA 5GZFA 1H2KA 2P3IA 1H4HA 1HB1A 3ZXKA 3JBG2 5CVRA 3E1F1 4YW4A 4CCMA 3NAPC 4JDOA 3H1YA 4YVWB 2LALA 5DDJ3 4Q0PA 1PZ7A 3J7HA 4IE0A 3NO8A 3UGFA 2ZEXA 4QX1A 2A6WA 1AXZA 3S7IA 5C4WA 5DXDA 5FV3A 5FZDA 5IVCA 1OF4A 1H9WA 5SV5A 4XZUG 3MIEA 4NPLA 2FDHA 3I7DA 4UT5A 1VB2A 4IERA 4WVZA 4DY3A 1UNBA 3DYOA 4HSLA 1UX7A 2JE9A 1MS9A 3U11A 2BGOA 3A0NA 2XJUA 2VY0A 5CNAA 5EV7A 4AZZA 5CKNA 1PO23 1FATA 4LE4A 2WNUC 1C28A 5C3QA 2DVBA 2VECA 4R9CA 3VBSB 1AR92 3BTYA 1WCDJ 4ATFA 4D7TA 4Y1XA 5IVBA 3VN4A 3WP4A 2WR9A 2XLAA 1QH7A 3HN3A 4AYUA 3DPRB 4IDZA 5T54A 3UETA 4YM2A 5FYMA 5A1AA 3BUCA 2CHHA 5G04L 2WSUA 3B3QE 3VB9A 1TME1 3OD0A 3POEA 2PA7A 3J8F2 2E6VA 4D94A 3MZHA 2WN2A 3KCCA 1PX3A 2YC2A 2VTFA 3ACHA 3VKMA 1W9TA 1OD3A 1WBLA 2VVDA 4P9JA 4XFBA 5AVAA 1Z78A 2HWC2 3ZIXA 1V6NA 2BNOA 2OPWA 4NIHA 1QOTA 2Q30A 3WP5A 1ND2A 1QJY2 3VD7A 4CYDA 3OYWB 4B7KA 1RUD1 4M4RA 3AP6A 3VBUB 3ZFEC 2PHRA 4LHSA 4N43A 5JZGB 3ZPYA 3LPFA 3W9AA 4FI9A 4Q0QA 2PQSA 2XKPA 3WNNA 2BTVC 4URAA 2VBPA 4JKLA 1YFUA 2PLV2 1Y4WA 2J1EA 2H6BA 3NV3A 1QEXA 3TOJA 5GZGA 2WRAA 5F9TA 2HWF3 3GHMA 1S2BA 4AG4A 4QX8A 1PK6A 1OUSA 3C7OA 3LFMA 3R4SA 3ILRA 3FC0A 1R082 4MUVA 3I54A 5FZ8A 4EZ4A 4CU7A 4AVTA 3DL3A 1DZQA 4UOJA 4EZHA 2VD7A 3OF1A 1Q8SA 5A6ZA 2W2IA 1JYTA 1YNAA 3ZXEA 4N7UA 2WS92 1MS5A 4AQSA 1VRH3 2D3RA 4E8CA 1WBFA 1N47A 2WFF3 2O1QA 2NP0A 3JXSA 4R9BA 4Q2FA 1SLLA 5J37A 1X9TA 5FYYA 1XNBA 1W04A 2D6OX 4OQ9A 5JSRA 3PUQA 4EV0A 2DVAA 1H2MA 4ASLA 1D7PM 1JODA 2QKDA 4YW6A 5HV0A 2YPDA 5L7OA 1RXGA 2VW0A 5DQ0A 2HH9A 1OHFA 4JGYB 4XETA 4YW3A 4GALA 3ZKUA 2P5BA 4DNYA 4DRRA 1SQ4A 2W91A 3OGJA 1NLSA 1O8SA 5FPLA 3WSOA 2P3YA 2ZGPA 4AGVA 4EN8B 5LW9A 2QQOA 3MEPA 1QJX3 4U2AA 1UIKA 5F5QA 4FPYA 4HANA 5JUVA 1BZWA 1K5MB 4NN0A 1F4HA 3FX3A 5SV8A 3BN6A 4QX7A 3HWJA 4A7YA 4NROA 1GSLA 3MO4A 2JDNA 1Q3EA 2D6PA 1HDKA 1NUKA 1UU5A 4XDPA 1R081 4RFRB 4QB6A 2JIJA 1R1A2 2VQAA 3GHNA 3V64A 4WVWA 2ARBA 1GZ9A 1OFSA 1SHWB 4XFFA 3VBRB 4MV2A 5J1XA 3RZGA 2PTMA 3TEZA 3TWIA 1O5LA 1WKYA 1H1IA 1F31A 2IXLA 4OHYA 2VGDA 5DZFA 2TUNA 4K3UA 3OPTA 5EJZB 3N4MA 2WZR1 3BGAA 3E6DA 1BBT2 3O1PA 4KBZA 5FPXA 4C1XA 2B8MA 1J1TA 4YVSA 1Y7BA 3KMHA 5DDJ1 5IAXA 4HK8A 3I8TA 1PGL1 3Q8BA 2WO1A 2IXHA 4IEWA 2XVGA 2G9GA 3HT1A 4YVSC 2GAUA 2MHFA 4SLIA 3THCA 3RZJA 4QB2A 1E5RA 2BV4A 2ZGRA 3EQEA 3ZSKA 4JGZA 2QQUA 3R0RA 4I0AA 1OA4A 1US2A 2GU9A 2R7EB 3GBGA 4PIXA 4ZXKA 4BH9A 2VNRA 4JGZC 3S6PA 2FMYA 4COWA 3GALA 3AB0A 2CNAA 4JHTA 2FCUA 2VJXA 2XUMA 4CCKA 4IV1B 2BZDA 3OPZA 1UD1A 2ZGUA 2ZX4A 4PI2A 2D93A 4A45A 2ZAAA 3VBHB 1W6MB 4XFGA 3GZAA 2OA2A 2XHKA 5FXWA 4RGGA 4XXPA 4OZXA 3AXEA 1REDA 4FTEA 2JG8A 5ANQA 1QQP3 5FTTC 4G9SB 3V0AA 3NJVA 1AL23 2FZ1A 2BNNA 4NE9A 2AEZA 5JMCA 2JIGA 2WNVB 1YI9A 3EB7A 4MGTA 4GWMA 4Q4W3 1ND3B 3R05A 1FNYA 4NRQA 4CUAA 2C6SA 1ENSA 1DQ2A 3D6EA 3JQXA 1RUC3 4Y3OA 4A41A 4QKBA 1NCQA 4AEKA 3LDRA 4X8PA 3POBA 1OXCA 1DGWA 1I3HA 2W47A 4DRVA 2BJSA 3RZLA 1W6QB 3E6CC 4EN7B 4E9KA 3S5QA 2RS53 1O3TA 1WD3A 3N9NA 4QQOA 1RUI2 4XCAA 2ZGTA 5DMYA 1CAXB 3NVCA 2Y26A 4ZHNA 2GP5A 1NX9A 2VZ3A 4H7MA 1YIFA 4IEYA 4ES9A 2CY6A 3AKTA 2CDOA 1H9PA 3CIHA 2G9ZA 2ZABA 3WLUA 3NRUA 5LWBA 1VBB2 5EQUA 4W4ZA 2XMLA 1O4YA 4CUGA 5JXJA 2QBXA 3BOWA 1LOFA 1HKDA 1MVQA 2NLRA 4I30A 5F6KA 4M00A 4ZXEA 3ZXAC 4LKEA 4TLGA 3H8XA 2WBKA 2HWF1 3PVBB 3TN93 1ACCA 2PFWA 3N7LA 1ZZ6A 4JHZA 4MXVA 4NR1A 5GM0A 4LULA 4FFHA 3ZXGA 2XB6C 2A6VA 5EHDA 4FPEA 3FE5A 1A6CA 3D0JA 3KV5A 2R0FA 1JS9A 5C8CC 1IKPA 3GJAA 3Q8EA 4OYUA 4RQPA 4L0PA 1PZ8A 2GP3A 4IE7A 3RWNA 4D6RA 1VRH1 2XH6A 5FO7B 4FO9A 3U07A 4QPGB 1LAJA 1X8MA 1RUJ2 5JAXA 2WFF1 4NJ4A 2ET7A 1H2NA
chains in the Genus database with same CATH topology
2ZGNA 4AEDB 2E63A 3TYJA 4X6QB 1LHNA 4QM9A 4CEWC 4M0NA 1Q8VA 2VUAA 1L3JA 3E5XA 3ZFGA 2CTVA 3ZXDA 4AEJA 1GNZA 3FFZA 3G6JB 1YJLA 4G4FA 4R9AA 1QJX1 2Y0OA 1FAYA 2FMDA 1OLQA 1DZRA 4FPLA 1ALYA 2DCKA 3AK0A 3GYDA 4HLTA 1W6OB 1UZYA 5E8AA 5LRRA 4GMP0 2R1BA 1LENA 4SBVA 5FO8B 2ZGKA 5FRAA 1ZA4A 1NCRA 4S2GA 1RUJ1 1NCRC 3ZMNA 3PLQA 5B2GB 1GANA 2H0BA 1CONA 1HXS3 1RMU2 1NA1A 2OUHA 1RINA 3SLIA 3AP4A 4EWAA 3WW2A 1NA1C 5CFCB 4ASMB 1G7YA 2YYOA 4PJYA 5K0UA 4QQPA 2HWE2 4JDMA 5FO9B 4A3XA 1IS4A 2YUEA 4HK9A 5H9SA 1FPN2 1JOJA 5JOXA 3USUA 1KQRA 1QY4A 1I6XA 2P3JA 3WCSA 4AHZA 1BEV3 1EAH3 2ZHNA 1DQ5A 5BNPB 4PDWB 2QE3A 5L73A 2HWD2 1VIWB 2VOWA 2WQ4A 3SISA 3N7KA 3OCPA 1LOCA 2W08A 2ZPXA 5J3UA 2PHDA 1QQP1 3VL9A 3RI8A 2W0XA 1AL21 2E51A 2RMU3 5A33B 4NHKA 4Q4W1 1U5XA 2HEWF 1D4M2 3WP6A 1RUC1 2GMEA 2R043 1RMU1 2WT2A 3O7OA 4YVWA 3VZJA 2GMPA 1AR72 4DMIA 5JPMB 1W6PB 2DVFA 3LZZA 2FHRA 4Q26A 4ATEA 4S2DA 2P17A 3SH4A 4BPZA 1DG6A 3SMHA 4PF5A 1KFUL 1NXD1 1WW6A 3E97A 4GXLA 2EXKA 1I5ZA 1U12A 4P9GA 4IV3B 2O8OA 1FPN1 4Y4YA 5IK7A 2WL1A 1AJOA 2E53A 3JZVA 4RS5B 3VBSA 4P9YA 4Q4Y3 4FOWA 2DU0A 5H9PA 2LUWA 3JB4C 5BPXA 3TN91 1JHNA 3DPRA 1BVVA 1S2KA 2HWD1 2XJPA 2O0OA 2VW1A 4XFAA 3IKWA 4MZUA 4WVMB 3IPVB 4M0HA 1UN1A 3DGTA 3VLBB 1LECA 3WV6A 4AHXA 4MGZE 1UU4A 2DUQA 4CDUB 3NJZA 3LA2A 3H50A 2MPFA 4P9IA 5KWRA 3WT3A 1CPMA 3QACA 1CX4A 2ZBJA 1MS3A 3D4KA 3VBUA 3ZDSA 5DG1A 4XPVA 5JZGA 1X33A 1RL3A 4NWVA 3FFQA 4XF3A 5I8SA 3TAYA 2OZ6A 4Q4X3 1PGSA 1U5ZA 3NV2A 3CJIB 1HRI3 4AK3A 4LUKA 3M1HA 3HT2A 1RUE3 3UV9A 4YFZA 1FOD3 1LJ7A 4LO7A 1CVNA 3URFA 2ET1A 4L8QA 4Y22B 2OPKA 3LGRA 3IBMA 1CAUB 4YZ4A 3WHTA 4AFDA 2ENRA 1H8VA 1ULGA 4GB33 2R073 4CP0A 4MGYE 2BEOA 1A3KA 1JTZX 2X5IB 1QMJA 1V6IA 4XEZA 5CA6A 3ZN6B 3GBWA 1MS1A 4BIFA 4UW3A 3I2DA 5D8AC 1ZRFA 1RVF3 2PHWA 2YROA 1G6NA 1HXS1 4KNCA 2VMHA 4JGYA 5BV6A 1ENQA 1ASJ2 4YM0A 4CDQB 1TNFA 4AE2A 1YUDA 1YCIA 3WNXA 1HV0A 1CIWA 1K5MA 2DCZA 4YARA 2Q1MA 3NKGA 3GZTB 1XXNA 2IFWA 2RR12 2R16A 4Q0SA 4OHVA 1YYNA 3QH6A 5JCTA 2Q5TA 1A8DA 4OULA 5GLVA 3WX5A 5HCAA 3VBRA 1NOVA 1PIV2 1CAVA 1BEV1 1EAH1 3WDXA 3IDBB 2RS32 2B5HA 3B7MA 3W58A 1VBC3 3OJBA 4E27A 4ISRA 1VBD3 1LRHA 4FP2A 3E6BA 1AX0A 5CIRA 5CU1A 1A8MA 1XQNA 4LTAA 1LU2A 3VUOA 5DG2A 2RMU1 1V6MA 4M01A 3GZUC 4RR3C 2PHXA 2R041 2QUOA 3S0MA 5ACA3 1XU1A 4YZ2A 5C33A 2XBO2 1J1LA 3AKPA 4I01A 1AL0G 4RHV3 5BNNB 1WD4A 3H9AA 4XFCA 5GZCA 1UKGA 1H2LA 3FWEA 3ZIWA 1O5UA 3RPQA 3V65A 3KLSA 1POV0 1CD3G 1H8TA 2DTYA 2D44A 3I59A 1SLIA 1DQ1A 3VBHA 1PIV1 1W6MA 4UBHA 4Q4Y1 3T2TA 1H8TC 1TEIA 2JDZA 1LEMA 1C8NA 2WT1A 4YW5A 2QDNA 5A32B 1YFYA 2XG3A 2K9ZA 1ND3A 5I0RA 5T5PA 2CAVA 5FOJB 5ABJB 2PELA 3CU7A 5JIUA 1Q5OA 3THPA 1LHUA 4A2UA 4FTSA 2D5HA 2ATFA 3AMQA 1CAXA 2VMIA 2B45X 2ZX3A 4LR4A 5FQ0A 1OFNA 1OKQA 4YG0A 3RS6A 1G9DA 2VQ0A 2DYCA 3QOPA 4XXAA 2A5ZA 4NO4A 4Q4X1 1VLNA 2GH2A 1HRI1 4K40A 1BQPA 1HQLA 1UIJA 1FOD1 1X50A 4F3JA 1IPKA 4AVBA 3FJSA 1ZVFA 3EHKA 2DVGA 4LHNA 4YLZA 1MQTA 1DQ4A 1C8M2 4GH4B 1JH5A 4FVVA 4QPGA 2WKKA 3LA7A 3IMNA 4GB31 1MQTC 2R071 4KQ7A 4AI3A 2VG9A 2QNKA 3O0VA 1C57A 2TEPA 4K7JA 4YZ5A 5F1RA 1AR83 3TRSB 1RVF1 2ILMA 1EP0A 4HT1T 4H7LA 3RMYA 1FV2A 3MLKA 4FQZA 5E88A 3RDIA 1OI6A 3M3IA 4QPIA 2EALA 3NSTA 1FMD3 3LAGA 5EXOA 4QPIC 1W6OA 3AMHA 1M06G 4DS0A 2A6XA 1ZZCA 2D6NA 3J26N 3RYPA 4DXZA 4HVRA 3FMGA 1O91A 2O8QA 5JOZA 4KU8A 4WM8A 1AX2A 1VBC1 4XBQA 1N1YA 1VBD1 3U10A 1UCXA 4WBBA 2WQZC 3VKNA 4WM8C 3T1MA 1TME2 1XYNA 2CGNA 2R0HA 3M3QA 3HAGA 1QXPA 4KGQA 4EROA 2VVEA 1PZ9A 4HFSA 4OHWA 2IFRA 2EVXA 1LR5A 2JXAA 2VMGA 2Z2SB 2OUJA 5HCFA 1PNGA 4JVAA 2P34A 5EYXA 3UKNA 2W68A 1RUD2 4RHV1 3AKQA 1DU3D 3PJQA 4D7YA 1DQ6A 1AF9A 1LTEA 3RRDA 3ZFFA 3VBFB 2LM3A 3M3CA 5C4WC 4LNVA 4IEQA 2KA3A 4L99A 2DF7A 2ZHKA 2Q0AA 3ZFFC 4PDWA 5BNPA 1UKRA 1F5FA 4FXGB 1UX6A 3QCWA 1CN1A 5D1IA 2XJTA 3ZYJB 1QOSA 1Z0HA 4Y24A 1Q43A 1LGCA 3AMPA 1NY71 5C8WA 2GNBA 2NN8A 4IETA 4NOTA 4AI2A 3V0BB 1B09A 4L2NA 2V5YA 1DIWA 1ULCA 1UMZA 2A7AA 1J58A 3O0XA 3M4FA 1W6PA 4OI4A 4XF0A 1JW6A 4F8AA 4U36A 1YFXA 2ZMLA 2E9QA 1KD7A 2BYVE 1JYCA 1S0EA 1IOAA 2PHFA 4EWEA 2VOKA 5HXVA 2D6LX 3WUCA 2WWSA 4CTEA 1GZCA 4IV3A 1ND2C 5KHKA 4RS5A 4YG6A 4E2SA 4N43C 3KS7A 1SEFA 2GN3A 2YC0A 3ASIA 4XJAA 5HBAA 5AFBA 3OD4A 4LBLA 4WVMA 3IPVA 4COYA 2EF6A 1EPZA 3PVNA 1RJ7A 5FDBA 3AXDA 1PK6C 1NG0A 4N9IA 4CDUA 1CESA 3SHRA 2XL7A 5DUUA 1WLDA 3BODA 4XMAA 5I8YA 2WZR2 1LGBA 1GICA 2A75A 5FMOL 1F8VA 3WDYA 4FAHA 2D43A 1AR81 4AVAA 2SBAA 3M3EA 2MEV3 5DDJ2 2XJSA 5FFOC 4B4PA 1LOBA 2N7GA 1PGL2 1MS0A 3CJIA 2Q8OA 3ACLA 1VB4A 3SCHA 5L7OC 1KJRA 4FOQA 4COVA 3H3ZA 1UAIA 2UY8A 3B02A 3CJIC 4MXWB 4RD7A 4CEYB 4K21A 1A78A 1HRV3 3JD73 1WMFA 1WLCA 1DYPA 1PO22 3DF0A 4AWDA 1CAUA 3WQ1A 3CO2A 1SLAA 5FAXA 4NWWA 4FPJA 2DFCA 4R52A 1W6NB 1ZX5A 3N36A 4IXLA 4N53B 3ZYGA 4YGBA 3B01A 3AFGA 1O4ZA 4XE9A 3ZN6A 3JUUA 2DCYA 3UL2A 1E57A 4C0BA 3KCYA 4JAAA 3UK9A 2P2KA 3BIWE 4S2HA 3ZMOA 4ZU7A 4CDQA 3VV1A 1QU0A 2P37A 1R093 3DKWA 4L11A 3CEWA 3V56A 1D2SA 1JYIA 2XJQA 1RUF3 5AC93 4YZ1A 3SXWA 1MS4A 3WDVA 5JWPA 3MFCA 2D98A 2YY1A 4JTNA 1QJU3 3H7JA 1R1ZA 5FLHA 3ATGA 3MLLA 1S0GA 2ETEA 2DURA 2UYBA 1WCSA 2BGCA 1ZBE3 4B4RA 1PO21 2HWF2 1ZZBA 2VPVA 2WC2A 3LSDA 5A3MA 4XQDA 1LEDA 3GF6A 4KH9A 1EV13 2D5FA 3FLTA 3PJYA 4FTBA 5KHJA 2E7TA 3WW1A 1O3QA 3VZNA 3RI9A 5C9AB 4LHLA 4WVVA 1VRH2 2JG8C 2WFF2 4FPKA 2QQPA 4HKWA 3LKJA 4HN1A 3WY6A 1V9U3 4L9BA 2B42B 1NCQC 1YXWA 1RHI3 2Z42A 3WW4A 2DV9A 2X8KA 1WW4A 1GQHA 3AYAA 3VDDA 2XLFA 4BE3A 3W59A 2ZMKA 4OI1A 1S0BA 4Z92B 4XFHA 3VDDC 1QJX2 4D69A 4XBLA 1GZWB 2X29A 2GDFA 3MIDA 1BYHA 2GH8A 1HRV2 3NWKA 1PGW1 4IESA 4MX3A 3KT7A 1LOFC 1OLRA 3LA3A 4XQ4A 3ZSJA 1CJDA 3D82A 3M7AA 2NZ9A 1VAKA 3SITA 5LRSA 3IIAA 4WM7B 5BNQA 3AFKA 2VOVA 4Y1ZA 3OY8B 3O12A 4RQPC 3VHOA 4Y5Z0 1F9KA 4FPCA 4IEXA 5L19A 2B39A 2Y38A 1IS6A 1OOPB 3AP9A 1S55A 1COV3 1J3RA 1RC6A 3QLQA 2UURA 4FT8A 4QQ2A 1G8WA 1V6OA 1MR5A 3BU7A 4BIOA 5HI0A 2BVVA 3ZFGC 3IWZA 1X7NA 2VW2A 4AVVA 1ULFA 1TQ5A 3WDTA 4I2OA 4PCRA 1SLBA 1TMF3 5GLZA 2ZGLA 1HRV1 2SLIA 4J6GA 4GH4A 2I45A 3ES4A 1YFWA 3VBOB 4ES8A 1PO13 4M3CA 5BNOB 1DGRA 2PN5A 3ZO0B 4I09A 4CDWB 2XL9A 4YNIA 3VZKA 2ZS6B 5JI9A 4L97A 1S0JA 2WLQA 1QNWA 1QQP2 1SLCA 4M3CF 1AL22 4P9XA 4AVSA 4P14A 1OPOA 4Q4W2 1RUC2 1SBFA 1RUH3 3OBTA 1WGPA 2P3KA 4IEVA 4DFSA 3H8UA 2RS52 1JBCA 1KXGA 1R091 2ES3A 2UWBA 1C1FA 4YSFA 4BMEA 2JG9A 1U0AA 3APBA 1XE7A 1ZRCA 1UPSA 2BNMA 2MNGA 5AC91 2WFPA 4RSUA 1F5JA 1X8EA 5JI7A 2E7AA 2JG9C 3FBYA 1QDOA 3RMXA 5K0UC 1QJU1 5T52A 3ZYRA 4JV4A 2A3YA 2ZKNA 1AUYA 4JCKA 2ERFA 3M70A 1G86A 1N1TA 1ZBE1 3ES1A 2DUPA 3NAPB 4QX5A 4DINB 1N3OA 3TN92 1ZBA3 2ZGMA 3M8LA 4HSJA 4NVPA 1RB8G 4N7IA 1EV11 4OI2A 3WCRA 4FCAA 3ZXLA 3LOBA 2A73B 3KM5A 3N3HA 3C3VA 2Y0IA 1NE4A 3R4DB 2CGPA 4R8HA 3UJOA 1OQEA 1V9U1 5KHGA 2WNUB 5EWSA 2JX9A 4LBKA 1YO8A 5J96B 2RS51 3DUIA 4YVWC 2ZX2A 1AYM3 5GLTA 1DQ0A 1RHI1 5F6LB 3VBFA 4RL7A 3M3OA 3QBQA 4LHKA 3P3NA 4Y1UA 4PBPA 4XIOA 2PAEA 4GMP3 3KZ4C 3VKFC 1IS3A 3K48A 3ILFA 3POYA 2NMNA 1WCKA 5FCCA 4L92A 3CL1A 3DV8A 1T6GC 5FREA 2R063 4B8EA 2ZGSA 3VBSC 1QKQA 1XNKA 2ZAHA 3BALA 4Q0VA 2HWB3 3V0BA 4XJ9A 1BCXA 1VAMA 3ZFEB 1VR3A 3DPRC 4PQ9A 4I3PA 4KG0A 3JB8A 4YGDA 1LULA 2GC3A 4RA0A 5LEKA 3RJ2X 4D7SA 5IK8A 2R32A 4YYOA 4XDQA 3D0SA 2WLPA 4LO4B 1HXS2 1RUH2 1VBA3 3OYWA 3O5SA 4LLOA 1WMDA 3E5UA 5T5OA 1COV1 1Y43B 3ZXFA 4PLMA 4BMBA 2Z69A 4C1WA 1O4TA 1YJKA 3VBUC 2WA4A 4PBOA 3WQ0A 5JZGC 5JPNB 5JDBA 3ZSLA 1W39A 1JUIA 5JOYA 4GQ7A 1VBE3 4HZFA 4PLNA 1CPNA 1NYWA 1URXA 1H30A 1SFNA 1EY2A 4KG8A 3POSA 4QD2A 5BY5A 2OVUA 3G7DA 2DU1A 1BEV2 1EAH2 4FAGA 1PO11 3L9JT 2IZWA 3ENRA 4QT6A 3WG4A 1QOOA 2RE9A 2GZWA 3RJRA 2KXLA 2GSYA 3ZVXA 1S0DA 3MYXA 4F83A 2RMU2 1IS5A 3KGLA 4XILA 2D7FA 4HVOA 2R042 2UWCA 1RUH1 4Q29A 1D4VB 3D5OA 2QZ3A 5BYNA 3VHRA 5KBFA 4JGYC 2GC2A 4MSVA 2BBVA 2BQPA 4MGKE 4XHXA 5KHHA 2RM23 1J3QA 4BQ1A 4MXWA 4CEYA 4EJRA 1MS8A 4D3WA 4C91A 1MZ5A 4YGEA 3B94A 5DUVA 4BWOA 2OZJA 4CEYC 4E4ZA 3RG0A 1K5MC 1GQGA 4WZFA 1KRIA 3WXPA 1U5YA 4LBJA 1OMIA 1CAWB 4TYSA 4AI0A 3U0ZA 1W6NA 2AUYA 3HQXA 4AI1A 2FBEA 4N53A 4Q4Y2 5T5JA 3R6SA 2ZTNA 1ZBA1 3VBRC 3HBZA 3H0OA 1HW5A 1IKQA 1W2UA 2YGMA 4YVSB 1NE6A 2I74A 2ZX1A 1VALA 3FLPA 3MPBA 3DN7A 4LBMA 3WZ1A 1X36A 3S30A 4ZKTB 1LOEA 5GLUA 3QH7A 4YW1A 4Y26A 1FNZA 2OYZA 3ILNA 4JGZB 3WOGA 1V00A 1FT9A 4QQLA 2K2SA 4BYYA 1VJ2A 4S2FA 4Q8KA 1Q8QA 1LHOA 2V73A 1AYM1 2D40A 2QZ2A 2VXRA 3TB0A 1MZFA 3MIHA 3EXUA 3HMYA 1S0CA 1LODA 4GMP1 4Q4X2 1SACA 4AI8A 1HRI2 1Q56A 5FPZA 1C4RA 4IV1A 1RUE2 4Y20B 1FV3A 4W6WA 1FOD2 3HR9A 2R061 4IV1C 5C9AA 3VBHC 2HWB1 2WNVA 5I8TA 3LWCA 3A4UA 2NQYA 4GB32 5E89A 2R072 3THTA 2WNVC 4CP2A 3AYCA 3AZZA 1ND3C 1JN2P 1W6QA 4FP3A 2DCTA 1FYUA 2ZA9A 4ISQA 2DFBA 4BM8A 1RVF2 3IN9A 2CV6A 4IEOA 4AQ6A 1VBA1 4GWNA 1J3PA 4IEPA 4COZA 1WLWA 3IM0A 3PVOA 5FBZA 1RUG3 3FUOA 1UW8A 2R1DA 4AQ2A 5C8CB 1J59A 4TSVA 2IC1A 1PNFA 3MIBA 4K6BA 1VBE1 3TNQA 1RUE1 3R4UA 3JBG3 4DQAA 3MPPG 1GKBA 3MFAA 3H1MA 4Q8LA 4CEWB 1HLCA 1BK1A 1HQWA 4EN9B 5KXDA 2QVSB 4CDXB 4A7ZA 1RGSA 3WDUA 2NPIA 1VBC2 2QCSB 4JRLA 1VBD2 3OY8A 1EPWA 3FHIB 3ZYIB 2TNFA 2ZGQA 4AEDA 4BA6A 2RS13 1F2NA 4QPGC 4LBNA 3ECQA 1NQJA 4AEDC 1WMEA 5I91A 3IT8A 1AR93 3AKSA 5ACA2 3FUQA 1POV3 3FLRA 1OQDA 1KFXL 3ETQA 2RM21 4RHV2 4YM3A 2OW4A 1HV1A 2YDEA 3J8F3 1REFA 5GJ6A 2JKBA 4BLJA 4OHXA 1QWRA 2RHPA 5H9QA 1NCRB 3WG2A 3J4UH 4MGIE 1EYBA 3JQWA 4LE3A 4N9HA 5BNOA 2HWC3 1WW5A 4BCUA 2GC0A 1QJY3 1RTVA 1NA1B 1TNRA 4META 3WQ7A 3K51A 1NY72 4QU2A 2XVLA 1DDLA 4K8FA 2B46X 3JCIA 4QGLA 4R9DA 3PTYA 5EYYA 1I1EA 5DUWA 2NYYA 4FQ4A 1HIXA 3RYKA 2JD4A 3SCGA 2PLV3 4E2QA 1LHWA 2QFEA 1YRZA 5KXCA 3KSCA 4AHWA 2XJRA 5CFCA 3C2UA 1X82A 4FPOB 3KT4A 5ACA1 4UW5A 3B5LB 1M4WA 3CNAA 3AZYA 1WA4A 5CFCC 2WS93 3UJQA 5K7PA 4TZDA 4J1XA 3IDCB 2VNOA 3RYRA 1W0OA 3NAPA 2IXJA 3MW2A 5BXXA 1HX6A 4JDNA 4JTOA 3B93A 2QDRA 3FZ3A 2JECA 2ZHMA 2FQPA 5BNPC 4PDWC 2BW8A 4URTA 5A33A 4KL1A 1IZ3A 4O9EA 4HKOA 2GC1A 2ZZQA 1APNA 4AFCA 1IPJA 2WNUA 2RS12 4I3GA 4XFIA 5EFUA 1AR82 1C5HA 1R1A3 2EA7A 1XRUA 4INDA 2VVFA 1IGOA 4LBQB 4UW6A 2PHTA 4IL7A 2CWMA 1AHSA 1GLHA 1ENRA 2XKOA 1RUG1 2PAKA 3VHNA 2CYFA 3MI8A 2D3SA 3ZX7A 1FMD2 2D97A 4IV3C 4UW4A 2BWCA 4DB5A 4RS5C 1BBT3 4XMIA 1OPMA 2AZ5A 2PHLA 3JBG1 4OUSA 5J98B 5T50A 1DLLA 1Q8PA 1GYKA 3ZFEA 2A3XA 1LB2A 1CJPA 1W0PA 2OIIA 3MF9A 2WZPP 4OI0A 4QQHA 2BFUL 1YI7A 2ZX0A 2V09A 5IK5A 3BCWA 1GFF2 5EZWA 5AVPA 4CDUC 4YW2A 2AREA 1CGPA 2RS11 3KQRA 3RNSA 2VU9A 3AYEA 2NM1A 4M3CE 2LTNA 4JC1A 4Y1VA 3EJKA 2RJKA 3IDEA 2XPJA 5KXEA 1LU1A 3PMEA 2XWBB 1AR91 3AMNA 4E2GA 4W65A 1DGWX 1POV1 1QF3A 4AGRA 4EWDA 3HIFA </