5C51B

Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial dna polymerase gamma
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
418
structure length
363
Chain Sequence
ALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase subunit gamma-1
publication title Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial DNA polymerase gamma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 89
structure length 363
sequence length 418
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5c51B01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 5c51B02
3HFVA 3HRKA 1EVLA 1NYQA 4H2XB 2QHSA 3V8KA 4YRCA 1PYSA 2DJZA 2DZ9A 2E64A 2ZNIA 4KR3A 2EL9A 1YFTA 3VQYA 4P73A 4EX5A 1USYA 2ZGWA 4O2DA 3HY0A 5C53B 2AKWA 2I4LA 2RHSA 4P3NA 3A32A 2DQ0A 3REUA 3EFSA 1B7YB 2ZINA 3A5YA 3A7UA 3UGTA 4HWOA 3UFGA 1G5IA 4YCVA 3VQVA 2ZR3A 3IG2A 3M4QA 4G85A 3ICAA 3QO5A 1N9WA 1SRYA 1RIQA 3FJPA 3TUPA 1X01A 5KNNA 4K86A 4TTVA 1X55A 1NJ2A 1HXDA 2XGTA 4XTYA 2G4CA 4H2UA 2ZT6A 1WPYA 1PYSB 4P73C 4ZTUB 4UP7A 5ELOA 1H4VB 1WQWA 3UH0A 11ASA 2EJGA 3HXZA 4Q6GA 2ZT8A 5ELNA 3RKYA 3RGLA 1ASYA 4P71A 1WYDA 3A7AA 3OD1A 3RACA 1NJ1A 1KOGA 3HY1A 1EOVA 5K1XA 3HXXA 4AH6A 1ADJA 4OLFA 1JJCA 1X56A 3VQXA 12ASA 2P5IA 3TEHA 3RF1A 3MF2A 1WNLA 1B70A 1HC7A 2ZNJA 4KQEA 4CH5A 4YRPA 1QE0A 1NJ5A 2E41A 4P71C 1H4SA 4CS2A 4H2WA 1QF6A 3IKLA 1J5WA 4WF2A 3E9IA 4XU2A 4TQFA 1EIYB 3V8JA 2ZIMA 4YRLA 1HTTA 5E3IA 4XU3A 2RHQB 4YCUA 1YGBA 4ZIBA 2CJAA 1ATIA 1JJCB 2EJ9A 4HWPA 4P3OA 1G51A 2FYKA 4HA8A 3TEHB 3QTCA 3HTZA 1E22A 2ZT7A 4BW9A 2ARTA 4DQ2A 4UP8A 2CJBA 3HXWA 4RQFA 1B70B 4YRIA 2EAYA 4WJ4A 2DTHA 1Z7MA 3L2ZA 2Q5HA 1BBWA 1BIAA 3HRIA 4XEMA 3E9HA 2Q7EA 1WQ7A 2ZZGA 3V7CA 3MEYA 4YRNA 3IKMB 4WI1A 1B8AA 4UPAA 1SERA 3NEMA 2J3MA 2CIMA 2DXUA 1EVKA 4P72A 1G5HA 4P3PA 4KR2A 4Q15A 1LYLA 4YROA 2DDZA 3L4GA 4PG3A 2EWNA 1E1OA 2ZTGA 2DTIA 4XTZA 4XU0A 4YPFA 2RHSB 2AKWB 3M4PA 4CH3A 4YRSA 1NJ8A 2LW7A 3RKWA 4E51A 3WQZA 1ADYA 3A5ZA 4YCWA 3V8LA 3P8VA 2XTIA 3RKXA 2EJFA 2HNIA 4P74A 2PMEA 4P72C 3P8YA 3CMQA 4WJ3M 4H2XA 1KMMA 2E3CA 4YDQA 3A7RA 4J15A 4K87A 4H2SA 1GGMA 3MF1A 4ZTZB 1Z7NA 3LSQA 2DZCA 2DU7A 4K88A 4XTVA 3L4GB 4LNSA 3LSSA 2ZXFA 1IL2A 3A74A 2ZIOA 4TWAA 4HWTA 1WU7A 4XTUA 3I7FA 3KFUA 3TEGA 4P74C 2DTOA 3HXVA 2I4MA 4NCXA 2E65A 3QNEA 2ZZFA 4OP0A 2AMCA 1KMNA 4YRGA 2E1HA 5HGQA 2E5AA 2DKGA 4H2VA 2C8MA 1NYRA 2ZCEA 4XEOA 3V7SA 3RL6A 4RQEA 4TVAA 1NNHA 3VQWA 3ERRA 1BBUA 5C51B 1ASZA 3A31A 4CH6A 2C7IA 1YB3A 2E10A 3V7RA 2CJ9A 3P8TA 3L1AA 4CS4A 4XU1A 4P75A 4RDXA 3IALA 1SESA 4YRJA 3PZCA 2ZR2A 2DXTA 2ODRC 3QO7A 4UP9A 4DPGA 4TVYA 1SETA 2AMCB 1EQRA 1X2GA 1C0AA 3VBBA 4TQDA 2QHVA 1L0WA 4X5OA 4YYEA 4BWAA 3RUXA 1B76A 2IY5A 4YP0A 1VQZA 1FYFA 4XTWA 4L87A 1V95A 1E1TA 4CS3A 3NETA 4YRQA 3W3SA 1USYC 1WLEA 4TVAB 3HFZA 3NENA 4G84A 4P75C 2ALYA 2PMFA 2QHUA 1X2HA 4H02A 2ZT5A 3PCOA 3LC0A 3HXUA 2ARSA 2J3LA 1EIYA 1EFWA 4YRMA 5K1PA 1NJ6A 2ARUA 4RMFA 2ZZEA 2DEQA 4YRFA 2RHQA 2P0LA 4YRKA 3HXYA 3EFRA 2Q7GA 1H4QA 4HWRA 1YFRA 1E24A 4TVWA 3RIRA 3R07A 2I4NA 2QHTA 3BFMA 3G1ZA 4EO4A 4PHCA 4YRRA 2I4OA 4H2YA 2IY5B 2CGHA 1H4TA 3QO8A 5C52B 3UGQA 1B7YA 2DVEA 5F5WA 1YFSA 2Q7HA 4YRTA 2DQ3A 4HWSA 3HFZB 3BJUA 4H2TA 2ALYB 2Q5IA 4HVCA 2ODRD 4YREA 4CH4A 3PCOB 3DSQA 2DU5A 4XTXA 3REXA 1X54A 1BIBA 1W66A 3NELA
chains in the Genus database with same CATH superfamily
1COZA 3LBHA 2C29D 3GJXC 4NECA 3HFVA 1NFFA 3HRKA 2AOUB 2OD9A 2X7XA 3MVEA 2XT6A 2PBLA 1M73E 4JX9A 2QHSA 2VZ0A 3AP1A 3QYFA 4M54A 4NBTA 1TL7C 1YI8A 3KYCB 5DLDA 4A6EA 1QS0A 3CMCO 3UUWA 1D04A 1TK2A 4TYYA 4GVPA 1H2XA 4OHPA 2E64A 5HDBB 1ZD4A 4UUBA 4HTAA 5E95A 3RBAA 4DWJA 1JKFA 3MWEA 4BVHA 4EDFA 4JI4B 2PMBA 2GXUA 1K89A 4DQVA 1B4DA 1ESCA 2PG3A 5LWHA 4JLPA 2PKWA 3DQZA 2X5NA 3P96A 4GRAA 4B6EA 4UTRA 4P73A 2HNKA 2X4DA 1M1YE 2IYEA 3B7WA 3EGWA 3K0FB 4IIVA 4L75A 4KSBA 5FUWA 2XUOA 5DBEX 3ZJ5A 5BUSA 4LF7B 1MU0A 5JNWA 4ROTA 2HJ9A 3V00A 4E08A 2I4LA 2OORC 3AKEA 4PXSA 3G0BA 1O7JA 1VL1A 2QVLA 1U7WA 1DIBA 2I6UA 4HDMB 4AZWA 4QEZA 2A9FA 2JG3A 1WX1A 1B93A 1WQ1R 2G67A 2YJGA 3NWPA 4ZCSA 4DY4A 2Y92A 3A7UA 1KU0A 4A6PA 3B9PA 2EQAA 2H6EA 3IEUA 3VX3A 4EG1A 1P5ZB 3LLVA 3D1VA 3RROA 4ISBA 4UM8B 3QWIA 4WVFA 2OSBA 4RIEA 1G6Q1 5C4MA 3SQLA 1IBSA 4HNAA 1ZYUA 4C7MA 3V4RA 4ZARA 4DDTA 2XD4A 1DLJA 3R5HA 3I2HA 1VHTA 2JJ1D 4CG0A 1JFVA 4Z4GA 4P5EA 1PJCA 5C1OA 1RAIA 1EG7A 1PNRA 2B37A 5H7XA 1Z39A 1GU1A 1U5AA 1UMDA 4HAIA 1JZTA 1NNUA 5KWVA 1FYXA 2QTAA 3A0RB 3PL1A 5I8ZA 3VKWA 1P5JA 2ZQ5A 2GGSA 1IUPA 3QLVA 4BP3A 3N2GA 1N32B 2EFDB 5TVKA 1BMQA 4JKIA 2P9FA 2ENUA 5IAJA 1ZVQA 1T5HX 3IDOA 3OLYA 4ZCTA 5IWAB 3HLTA 2P27A 3NIGB 4WASA 1FP1D 1EWQA 1NT4A 5B3JC 1ZUHA 4FGZA 5ALXA 2UV8A 4LFAB 5IDQA 2WM8A 1QQBA 2RC6A 1XK6A 2I1VB 3LQQA 1YRYE 5FLKA 5EEGA 5IC6A 1P4RA 4A0SA 1FMJA 4AK9A 1WQWA 4UBMA 3GBVA 2YJTD 3PFFA 3U6BA 3U2QA 3ME5A 1IRXA 4AN1A 4ESEA 11ASA 4HH4A 3HXZA 3EXFB 3IO5A 1MX1A 1I6KA 1ORWA 3QUCA 1T4MA 4AUEA 1XRJA 4EI2A 5CNJA 1DBVO 5J58A 4QICA 1OLSA 3C1TA 3BJRA 3Q6MA 4EQ6A 4P71A 4OMDA 4YTEA 1EXWA 1YE3A 2H16A 1A1VA 1D1TA 3OQIB 1Z0DA 1OLXA 4RX1A 4MAFA 1KI8A 3WK4A 5D5HA 3CG0A 3ASVA 4UAUA 1XRQA 4F4DA 2HWWA 3UMYA 1JG1A 3WGHA 2XDWA 5E1BA 5FORA 1PTKA 1V5FA 3FUWA 4J3JA 3ROKA 4DV6B 4E5MA 4DEVA 5ERXA 4CL3A 2FGKA 1QYVA 1E1MA 4HDOB 4PG6A 4D4LA 1NRXA 1Z2OX 4EG6A 2P1ZA 4KGVA 4LVUA 3X44A 4MYDA 1E5XA 4JNKA 2Y68A 3AUFA 3E9NA 3M6AA 4TXMA 4WCFC 5EAIA 5IEBA 2JDIA 2NXWA 3EK2A 3H1EA 5BUCA 3OU6A 3E4DA 2O59A 1B1AA 4UTZA 4QOJA 4XVQA 4Y2SA 5E7IA 2BEVA 4HX2A 4MKHA 3WYDA 1E61A 2HU7A 5EZYA 4BXOA 1OXXK 3EGVA 4KE6A 1HV8A 3P1JA 2P4QA 2ZAIA 2R1UA 2JIBA 1RJFA 3DDOA 4MI9A 4NZ9A 4QA9A 4TTAA 3KQKA 5CFNA 1L5MA 1OI7A 2K6GA 4FDLA 2H8KA 4M1EA 3ZE1B 4GWLA 2GRJA 1GPYA 5F3RA 4EPVA 3PUVA 4R31A 1CUZA 3PEWA 3Q0EA 3TYXA 1XMQB 4CKWA 3JVUA 4S1WA 1KGDA 4DCGA 1GFSA 3KKKA 1KO1A 5CB6A 1RBZA 2XBUA 1QF6A 4LJ8A 2QNIA 3KKEA 3GA5A 4TL7A 3LT5A 3CFYA 5EEHA 5K8VA 3SNKA 3O90A 4D0NA 4ITUA 4YAWA 5I4CA 2WTUA 4TZ6A 3AJAA 1E2NA 1OZFA 4XCVA 2PU7A 2JCXA 2C0CA 2FEXA 4LDPA 4EG3A 4XYLA 1W5FA 3ORQA 1CZUA 2ZIUB 4NYMR 5DF1A 1VCNA 1QIIA 1KS2A 2RGWA 5T64A 1EAMA 2VTEA 2B7BA 4XU3A 1HT3A 1UXHA 3U80A 1IHYA 1LPMA 2Q5OA 3PSHA 3IH5A 5KWIA 1KYVA 2W6JD 3GLIE 1NQOA 2H3EA 3W5HA 4E33A 1M7GA 4CV1A 5EJMA 1TOAA 2HDHA 4JGBA 4BVLA 1E0KA 3DDNA 1VMDA 3CRRA 5D01A 4AN0A 3T1VA 2EJ9A 2CXNA 3EHDA 1G2QA 7ADHA 2JAHA 3TM5A 1G51A 4AI6A 3UGJA 4QUHA 3CUKA 1OZAA 2WPNA 1GQQA 3SSMA 1E22A 3GLHB 1V16A 2E4WA 4DSZA 1A82A 3EVBA 4DJFC 1E79D 2AWNA 3ZYCA 4WZBE 1NBIA 2ZYVX 4MV7A 2JLUA 4FFSA 3RJ5A 3SJCA 5JCOA 3Q10A 4Y6OA 4D74A 4RQFA 5DIZA 1CR4A 2EAYA 3M6VA 2AB0A 4OUKX 5GPBA 2A4KA 4R5HA 4CGZA 3BZUA 4N3AA 4QHTA 4DVJA 4LJLA 1I6MA 1R5OA 2RH8A 2XNSA 1I2BA 2Z2IA 4HL6A 4MV8A 3P4XA 3MTJA 3OLVA 3JVVA 2WZBA 1C7RA 2Q7EA 1IHXA 4JB3A 3REQA 1B14A 3Q3EA 2WUEA 1D1QA 4ND7A 3VKFA 4E07A 3SQDA 4G63A 1UP4A 1WF6A 1ICIA 1M1NB 1T6YA 2JLAA 2AFIB 3C8ZA 2WTNA 1PJSA 3MTEA 1F8GA 1H2HA 1L5RA 4MP6A 2Q49A 2VYVD 5JXGA 1GPDG 1XBTA 3CZCA 4BS9A 1WXDA 3H9CA 1EX7A 4A27A 1GQRA 3MCAA 2Z1NA 4KLCA 2XUQA 4AZ3B 1AHIA 3SR4A 4DMHA 5ICGA 2VPYA 3HCPA 3S8EA 1CS0B 1JKXA 3TLZA 1V7PC 4CEHA 5CUQA 3CO5A 3B3JA 5HKLA 5KKNB 1RWXA 5EHIA 1Y6ZA 5TPZD 1O57A 1PF7E 3D8TA 2IXGA 2H1HA 1NP6A 2ZJ5A 2WWFA 3QXXA 2Q3DA 3M1YA 5C3UA 2IHNA 4FGWA 1SN7A 2RHLA 3DE0X 3O1HB 1XKLA 3ZQUA 4DQXA 4O5OA 3GRFA 1FSFA 2OAEA 5LP6A 4C20A 4LGMA 4IJKA 1V5IA 4UNQA 3BF8A 1JLRA 4CH3A 3UHPA 2HREA 1VCIA 3HKEB 4YRSA 1NJ8A 2CYCA 2XOKA 1S8FA 3FPHA 2Z09A 4II3A 1E20A 4TLAA 5CBKA 2JGDB 3DT8A 2HQ1A 2J07A 3WRWA 4NBSA 3QVLA 3NBMA 4H7FA 5DX0A 3C1UA 4IV0A 5DK6A 1U3TA 5DP1A 4A16A 4A5OA 1JVNA 4KCGA 3A6GA 3MJVA 1A76A 3VH1A 5KQLA 1OYOA 1CQXA 3PA6A 3S3TA 1N0HA 2FEAA 3R75A 4Q9LA 3VR3A 2NSLA 2TECE 2WJAA 3DBRA 2GN8A 3OZXA 1OMOA 1VJ0A 5G4LA 1L9XA 1NZFA 2P9BA 1C8LA 2NYUA 1YTUA 1GXSB 1U5BB 1KP3A 2MYNA 4DJ5X 1DRVA 2EQBA 4DMLA 2A9RA 1RAEA 3HY6A 1GUYA 1P81A 4KFRA 4KXNA 4NENB 5AKJA 5AW3A 2FPXA 4QGHA 2O8EA 3P8YA 1A5ZA 4LYYA 3FLMA 4F91B 1UPUA 4XQ0A 3W04A 5G3YA 2JASA 4ND8A 4Q9NA 4AMYA 4Z9XA 4BNUA 2E3CA 2GCOA 4QD3A 3TSCA 1W4AA 4CYMA 4J15A 2QLFA 3OPYB 4H2SA 3HNOA 3MQ2A 1JLLA 5ESRA 3KOUA 3ZY6A 1ZM3A 4I8DA 4R84A 4YB8A 4NZYA 5SZIA 1C2YA 2V4MA 3Q3CA 4R2KA 2NX2A 4XCXA 4UOEA 4X0EA 2HBRA 3DBIA 4J6EA 1YZ3A 1JDNA 4K9QA 4EJ2A 3V2IA 4F3YA 2RG1A 5ARBA 4FFVA 3I62A 4QTUB 4ZDJA 4A5SA 4G0PA 2A59A 1ECPA 1W5BA 4JDPA 4ZVUA 4PFSA 1QQAA 1IYZA 2ZYGA 3G02A 4UMFA 9MHTA 3DM9B 2OSVA 3N2NA 3B53X 1WV0A 4WT7A 3LWNA 3D6UA 1FK8A 3HUEA 1HRDA 4UZSA 2BCJQ 5JZBA 3GLSA 1K3FA 2E9SA 3RGGA 4B87A 3Q3GE 4GUAA 3VZBA 4RFVA 3UIEA 3AEKA 3I7FA 1E7QA 4IMJB 2JGIA 2O48X 1Z6GA 1JU9A 4KPUA 1NBAA 1BWRA 1RKQA 5LYJF 2WTBA 2JFPA 3CIFA 1ACJA 4LHWA 4MS3A 2XWQA 4RSRA 2HL6A 2J5QA 1C1YA 4FYXA 2PUAA 4D4HA 1CD5A 1KRHA 2DCUA 3Q8XB 4YO7A 1E2KA 4ESOA 5E7MA 3ELWA 5FD8A 2ATIA 2CF5A 1W4ZA 1IBMB 5DN9A 4B3DA 4OHYA 2VF8A 1R0WA 2BLNA 3RS8A 3U3KA 2WZQA 4FXPA 4QEKA 2W2KA 1C41A 4HQFA 3HUTA 5AXCA 2Y0PA 4LGYA 3S1LA 1TADA 4B2PA 1P9OA 1ZIPA 1KARA 1W73A 4ZOAA 1YKFA 4OTZA 1QGOA 4A91A 3U4DA 3QW4B 3VSEA 1M34B 3C74A 5DM0A 2O05A 1UFKA 1I36A 2XWJI 3K5HA 1U1IA 3F9RA 4JELA 3T7KA 2C7OA 5AJZA 1QSGA 1ZUIA 5LNK1 4N76A 4RXMA 2D2IA 3BKXA 3I32A 4LQDA 4MGIR 4KHPB 1XKQA 2B35A 3GGOA 4C0HA 1ADGA 3NFRA 1AV6A 2BRUA 3PI7A 6AT1A 4UQLA 2ZYWX 4QXAA 3RYCB 4NOMA 1XALA 2I3GA 1I2ZA 2HR1A 2C7BA 2KWIA 3K5IA 3Q3IA 3OZGA 5HUHA 4MUHA 4LVNA 5A4JA 4WNCA 3HCFA 1H5QA 3ELDA 4FS8A 5HIMA 4A6DA 1BU8A 4MW6A 2X23A 4YUVA 1UAGA 1Z2AA 4XQGA 4JP3A 4BRZA 2XYQA 2OWDA 1JIUA 5KCZA 2P2NA 1N2BA 4XOUA 2AWOA 1KJ9A 3E58A 2OZVA 2CXUA 3HP7A 4Z3DA 3CNEA 1Q21A 5C5CA 1VI5A 1L5KA 3SNHA 2VFAA 5LZ8A 1FMCA 1DUVG 1YB5A 1KFJB 2GWRA 2VYCA 2WAMA 3GCWA 4YJDA 5JPIA 2EF0A 3RGWS 2C5LA 2UAGA 5JAZA 5CIYA 4Y7CA 4B79A 3NBQA 4AG6A 2YHAA 1C7QA 2MT9A 2PEYA 3M2PA 3MMPA 4NDAA 4AICA 3TUJC 4CIXA 3X1JA 3O83A 4ENUA 2GNAA 3UT5B 1EDOA 4L9RA 4UHJA 5EJFA 5BNWA 3LQKA 5DTIA 5DP2A 3FYUC 2Y93A 1W5AA 2PD3A 1TQ8A 3GO4A 1E1TA 2QU7A 4M1OA 5B57C 4R2LA 3E3NA 2ZRDA 3VTZA 4Z3KA 5T4HA 1V2GA 4TVAB 3ADPA 4QPDA 1RQXA 5BR8B 4QU9A 4G56A 1OJ7A 2QYHA 1H0SA 5CCBA 1Y8QA 4TV9B 3R7DA 3IULA 3EFOB 1T5SA 1UR5A 2NYAA 4MV0A 5TGZA 4WAUA 5ALGA 3AH8A 4PAMA 3K2EA 5AI5A 1XYYA 1EUDB 1USIA 4C06A 5BO5A 1E2DA 4BEJA 3QEAZ 3IB6A 2J3LA 1V7CA 3FCYA 4FBMA 4JOSA 1YKSA 3JAWB 5DYYA 1R9GA 4EJSC 4U6SA 3WQQA 4Y2YA 3TINA 2PIAA 1ZUWA 3H5RA 2YASA 1II9A 1UQRA 3QK7A 3F46A 2DEQA 3OTHA 4JS0A 5EESA 5FBWB 2VH2A 2RD2A 2Z3ZA 4EG4A 1NUSA 1Q1EA 2X6TA 2VLBA 3KYCA 1G8JA 4KQWA 4EYSA 1IUKA 2Q21A 2VHVA 3REOA 3D4PA 1AQ6A 1B16A 3I9NA 3IPAA 4LY3A 1TM3E 3DOUA 5CGQB 5AI4A 1U63A 1V9CA 2QX8A 1SXJA 2VO1A 3BJIC 2DWOA 1B3RA 3PUXA 4IMPA 4G0QA 3CCCA 3A36A 4XUEA 1Y6RA 3RU3A 3AXTA 2VYND 4WINA 3UO8B 5HJEA 3K0FA 2CL7X 4DQLA 4MAAA 3B6MA 4P4SB 3ZVKA 3U81A 1Y5IA 4HKTA 5LB4A 2A5JA 4D9BA 3G79A 2E6KA 5B2FA 1Z5PA 1IY1A 2P3QA 4XWAA 3V46A 4TYWA 2HO5A 3MGBA 4GNRA 4QBIA 3V97A 5CD1A 3NT5A 1O9BA 1UZMA 3FCSB 3Q7IA 1KTVA 2ZYAA 4AX4A 5U4QA 3G7SA 4G5SA 4IHQA 3PITA 2EATA 4E1BA 1BA2A 4YCDA 3GJ7A 3V8PA 1S7CA 5LQRA 2V0CA 1JP7A 4BNLA 3IE1A 4QBTA 3TR5A 1E96A 3I58A 3R4CA 4FYMA 2ALYB 1CT9A 4G23A 4KR0A 2AOTB 1GNPA 3GLUA 4QL3A 3CLSC 2WJVA 4AN4A 1VRWA 3PPVA 4C0BA 4PLPA 3U0VA 3IUSA 3GAFA 1UKVY 6REQB 1HOTA 3THWA 3FFXA 3YASA 4MIOA 2DU5A 1P5FA 5HKBA 1VLJA 1BIBA 2XVMA 4HFNA 5ESDA 3AL0C 2OV4A 3AOGA 5HOEA 1R8JA 2V7WA 1H2EA 1VB3A 2DBQA 2Z08A 3KXLA 1HYBA 3HCAA 5C7OO 3A3YA 5P21A 2XOXA 3M6FA 1E69A 4HAWA 1EVLA 3ODGA 1CY0A 3NUQA 2Z98A 5EJ5A 3GP8A 2GK4A 3IILA 4US0R 4TRNA 3F8WA 3B89A 5J4LA 2RE8A 2YJ6A 2ZR7A 2ZNIA 4RH0A 2Y66A 2FX2A 3PX3A 2C9OA 4DCSA 3L6OO 2VSYA 3IV7A 1RXIA 5BNFA 1VP3A 2BJHA 3G5MA 1XD9A 2PXHA 4C3ZA 2J6BA 3AG6A 1RWNA 5LZ7A 2IYQA 4FOPA 1ZNYA 3EXFA 3HUUA 1T8WA 1MQ9A 5CURA 2IC5A 1FU8A 3DZ8A 4X41A 2J7PD 1H94A 2Y1EA 3ROPA 5TQJA 3W1VA 3S55A 4B4OA 5CBPB 3CRQA 1CEXA 1CF2O 1SC1A 5CDHA 4BO4A 2H85A 2GASA 1YB4A 1TEXA 3ZWNA 1YS4A 2PJRA 4LW8A 1B7YB 2Q5JA 3DULA 3OZCA 4MRAA 5MN5A 1JH9A 4ACAA 3TIIA 1CR0A 3T06B 3RK1A 4BJ5A 4JJKA 3V7NA 1TMKA 3P5BA 3VQVA 1NRJB 3DAYA 3ICAA 5ALQA 4EECA 1AHNA 2FWAA 5FXMA 3LIPA 2DGDA 2ZYRA 2DEUA 3CXRA 4RA9B 5T6BA 3IQWA 4X64B 2OOSA 2CMKA 2ZTUA 1BW9B 3LXMA 1HT2E 4BWGA 2FEWB 4RD1A 4GS5A 1CVRA 4GXQA 3T61A 5KVCA 3IEIA 3H2KA 1AKTA 1NJ2A 1G4AE 1G9SA 3OF5A 3QE2A 3LUFA 1AF4A 4N6OA 2X2PA 1MP0A 1V5WA 1WP9A 4WECA 4GQAA 1N5MA 1PX2A 5GMOA 1EGMB 1ZIDA 4D97A 2X7JA 2GEBA 3FDFA 4Q3BA 1XAIA 1CJVC 2UYYA 5KVSA 1XJWA 2BUCA 1DG1G 1VYUA 5FNZA 1IXSB 5DYNA 1EHCA 2CNBA 4TYNA 4P5DA 3C45A 1QGDA 2GN9A 4UFPA 3OICA 1YZKA 2NLOA 4BTVA 3NU1A 4KQGA 4RTKA 4M7RA 2EKLA 1TCBA 4QC2A 3WYBA 4AQ7A 5DBOA 2OYCA 3OIFA 1WVGA 2CDAA 4OUDB 4JC4A 5IJ9B 4UXIA 5HILA 1IQRA 3DZDA 4H9GA 4UU1A 5JD3A 1ND6A 1K6IA 1XYGA 2FFJA 2LE0A 3VDNB 1ST2A 4Y2XA 3H87A 4FSHA 3WMRA 4HV4A 5FLXA 4K03A 4KBGA 4RD6A 4X6YA 3A7AA 5U4XA 2L18A 4Z9AA 2YZ7A 2PFGA 1ZHHA 3V6MA 5BW5A 3ZY4A 3DWGA 3RSCA 3BXHA 3K70C 3N74A 4OXKA 3AC0A 3KOWA 1ZCBA 2FEMA 4M8LA 1ORVA 1IB0A 1W0KA 3E03A 3MILA 4W9NA 3ENKA 4JEMA 2Z2KA 2VP6A 3H7AA 3WV5A 1V45E 3I45A 4G26A 1ZH0A 3GFVA 5BWBA 4KACA 1UQTA 4DVGA 4K05A 1HDYA 5L3SB 4LYDA 3VVCA 1G7TA 3B7PA 3E35A 4P5PA 3WGKA 4BZQA 1U5CA 2YWEA 3GLHA 1IN5A 5B7QA 1C0KA 3GYBA 3QUBA 4GLFA 2BI8A 2BFDB 4PV7A 1TW3A 3AVOA 1BDJA 1CW2B 2CVOA 2Z6VA 5BSFA 4WCFB 1QK4A 1NP3A 1VGRA 2YR0A 5DI9A 4BVEA 1DFGA 3HB5X 1GSAA 2G5CA 3RO7A 1R6UA 1F1JA 1U9ZA 4QASA 1DO0A 1GO2A 5L6LB 3AILA 5BQOA 3RTDA 1Y9DA 5EIWA 2X0RA 1E0AA 2I80A 3DXYA 3JTMA 3PWSA 5EZ5A 2B4YA 3EB9A 4H1TA 2EDCA 1H4SA 2BKEA 3W34A 5A3QA 3IP7A 4LC9A 1V4BA 2H5JA 3R6TA 4MQFB 3WICA 3HTXA 1L7XA 4PM4A 1Q92A 1WG8A 3HHPA 1D4OA 5EE3A 4NICA 3GELA 5CVTA 4MUAA 1CUXA 5FOTA 1JKMA 1M1NA 1YASA 3GN1A 1D6JA 4Q5IA 2AFIA 4OI2A 4NMWA 3PENA 2QY6A 4PU0A 5ILQA 1Z47A 1QYDA 2HOQA 3JVIA 5DE3A 4BLSA 3QYJA 2UYCA 3WSWA 1BYIA 2IHZA 1HTTA 1UJ6A 3RFCA 2DT5A 3SS9X 2H11A 1UCFA 3DFUA 1W48A 5KDLA 2I7VA 4RSHA 1SA0B 3CLUD 3EDQA 4MYHA 4RESA 4ZAYA 2NZ2A 4M0KA 2XXJA 1F48A 5LA6F 1I33A 2H3HA 5GIOE 1QC5A 4CV0A 1H2AS 1JJCB 4REMA 4ALLA 4QOFA 2PRYA 3L8HA 4I1VA 1OIXA 4RO0A 5CM8B 5FPQA 4HLCA 1GZ7A 2FYKA 2FQXA 1YACA 3RRYA 4AZ0B 3I5XA 1XKTA 2ZS7A 3SHVA 1M2HA 4XPIA 1JQ3A 2AQ8A 3NALA 1WLYA 4YMIA 3D3QA 3C4QA 4IO0A 4NQZA 2CNWD 3MGGA 2DERA 1I3NA 2BTQB 1G8SA 3PKJA 4B48A 3HKEA 1NMSA 3BJZA 3NC4A 1DHRA 2Q45A 1DL5A 2QT0A 1M0WA 4HDKB 4JVMA 4O4JA 4TS4A 3EIWA 3W3AH 2JGDA 4BB6A 1UIMA 3GYGA 2YUTA 5E6RB 5ECDA 1B70B 4YRIA 3P9YA 4WJ4A 4GXNA 4MJXA 3BFPA 4ZYTA 2ZI3A 3OWHA 4H77A 3CVUA 1HDEA 1P1JA 4M0LA 4NJEB 2CVPA 3DTTA 5ADVA 2XZDA 3RRJA 3L2ZA 2H2AA 4N9WA 4ZCLA 2VAVA 3BHIA 3L02A 2WY2D 3ROMA 1GG2A 1W36D 4A2PA 3EGOA 4DR3B 5JCPA 1SO8A 3WLIA 2AE1A 1GXSA 1JSCA 1U5BA 2F9MA 1N3BA 3G88A 3N8HA 1JJFA 1O6GA 3AUXA 4M86A 5NULA 5GP1A 4JYCA 4ASUA 2G1AA 2J33A 2IYYA 1MFZA 4IFTA 2JF0A 4F4IA 3TEMA 4F3NA 5KTMA 4ZPJA 2HJWA 1EUZA 1X9IA 2B1IA 2CMGA 1B8AA 1SERA 2YVAA 3P9CA 2J5XA 4Q16A 3WFIA 3NEMA 4OIFA 2CV2A 2FDXA 4G1MB 1WABA 1YQUA 4XLLA 3E81A 3ZU4A 1I51A 3EGDB 4BP9A 4ENSA 2GYWA 1LSJA 2O50A 5CFMA 3EX7C 4FUQA 1DQZA 4TL6A 1T34A 4DDVA 1YS1X 3EXAA 4JLKA 4ZEXA 2CCKA 2XSZD 3T34A 4ETIA 4JJ4A 1LRLA 5ED4A 4BQRA 3IHWA 3SBOA 1AXRA 1F8FA 3BK7A 3ANXA 4DARA 1WD7A 5JH7B 3UPUA 1UF9A 4OJQA 4XQEA 3SC2B 1EI9A 1T4DA 3IAAA 3RRMA 2V7XA 4X3PA 3K1TA 3VZSA 2P75A 4P1ZA 3ZLVA 4X62B 2FUCA 4GG1A 4Q4JB 3E53A 4LVJA 5FOXA 1PVOA 4MEAA 1I1QB 2FJUA 3FPAA 5LWQA 1S01A 1YBAA 2I8CA 5JS1A 2OHHA 3CJQA 2AR0A 4P35A 5KSZA 3RAPR 4Q7LA 5ILOA 1FP7A 2Q99A 1TJPB 2XYGA 3MWFA 4XIJA 4A26A 5AJVB 4CV3A 5AQ1A 4L4RA 4BVAA 2HMTA 1NSYA 3EVTA 3TMAA 1NJGA 4H7IA 4J0IA 3V8LA 1E8MA 4M1WA 3R77A 3W3ZB 3AMVA 1L8XA 4A15A 5E3HA 3SM3A 1NUTA 1NW4A 3WLHA 4HNTA 3OT1B 3BB4A 1TCUA 1I3CA 4EGFA 1XZMA 1I01A 3R9KA 1A9SA 3CW2A 4F4CA 2C9YA 2ZZNA 5FI0B 2IYZA 1CY2A 3WWOA 1M54A 1M34A 4BV2A 1BH6A 2EGUA 1C30B 4K87A 5GZ3A 3O3MB 2HT6A 1PKEA 1C4WA 3MS4A 4K3UA 4LXTA 4WADA 5FBQB 1T9DA 5ER6A 3S27A 3PK0A 1NUQA 3TE7A 3WY9A 1K3UB 5HE9A 3OAAA 4D9KA 5KJCA 1YGPA 3RYCA 2GPAA 2ZULA 4CM3A 1N6NA 3T3OA 3CXUA 1FE8A 1C8BA 2W6NA 3ENZA 4Y2VA 1JWLA 2VJPA 4FYVA 3QWFA 2QL7A 1CNEA 2H0AA 2ZJAA 3D3KA 3V8BA 1HLPA 1UBKS 1Z4NA 2OHIA 3LBYA 4HFMA 4IWYA 4TMZA 2UYOA 3I0NA 4GUDA 4YCCA 4KH1A 5FLYA 4W5WA 1Y5RA 1RXVA 3R7AA 4H1WA 5BXQC 3K9WA 3DMPA 2W43A 3OP4A 2ERXA 4QHSA 3DV9A 3C5WP 4TKUA 1R0LA 4EUNA 1QH1B 2GZ1A 1V9SA 3FOWA 3WWEA 1CF4A 5THQA 4YLGA 2C4UA 1RMTA 2P9JA 1QRTA 1H22A 1XAHA 4NONA 3A6JA 2YQ4A 4C76A 3PUIA 3A11A 2IUYA 4E94A 3JAKB 2QPOA 4P4TA 1NQTA 5K6TA 4OP0A 3I42A 1ONOA 1I30A 4YRGA 3OZDA 3KALA 5HVNA 1F9EA 2GEFA 3CO0S 1P6UA 2J31A 3ESZA 3SI7A 1CUWA 1QHIA 2HUNA 2AZMA 2V7PA 3LSYA 3UT5A 3RTGA 3ZD6A 2XA1A 4EPRA 3RYHB 3FSEA 3V48A 4I4IA 2WE8A 1JNXX 2AKEA 3ADCA 1PGPA 3VX4A 2H9IA 3ZDAA 3PRKE 1JXQA 2XYHA 3FBTA 4H7KA 2BD0A 5B3AA 2WJIA 2NACA 1SCKA 1V4NA 1Z8FA 2WTMA 1VRVA 1OXTA 4GQBA 4KQ2A 4TVAA 4R7ZA 1NNHA 4UM5A 1WEHA 2PVPA 4BNJA 3H1AA 3EIFA 4CI9A 1MAHA 4UVIA 3T3MB 3MUOA 3ZCQA 3U1BA 3OTOB 2HRCA 4LMAA 1H23A 4PQEA 1JWAB 1EU1A 3A27A 3EFOA 1QHYA 2CE7A 2ZBGA 3HGTA 3JRWA 3E15A 1GQFA 2Q9BA 4HT3B 2PS0A 3VQTA 1EUDA 4ARSA 3AVVA 1UK8A 1QIMA 5E9QA 4BX2A 1PFKA 2R4TA 3I0ZA 5HIIA 1Y80A 2PH1A 3JAWA 2IUUA 2Z4RA 2JFNA 1I3OA 1ZH4A 5DHFA 1LNZA 4X61A 4X65B 4RDXA 3ZEIA 4H3SA 4OAQA 1UBRS 5BV8A 3C6KA 1J9ZA 4P4UA 1P3Y1 2J3KA 5FV4A 1S8AA 1GPLA 4O4LF 1T35A 2P5YA 4XDHA 4OSEA 3BZWA 5H83A 2F1HA 2G72A 1P44A 2QPTA 2FB9A 4B2IA 2VPWA 4YV0A 3QO7A 3TXAA 1BDMA 4X63A 1P45A 3OO1A 2XB9A 3RSOA 1XZBA 1W30A 3DDHA 1SHKA 4FINA 2DP4E 4KN5A 1EFTA 1JLHA 5TMBA 3RFVA 4ZI7F 3RNOA 4PQRA 3WJAA 4P4SA 3HXQA 3Q88A 4GKAA 1UPCA 4GM4A 4MOWA 4RQBA 4WKGA 3GUUA 3AJEA 5EQTA 5JASA 3NRCA 3RV4A 4K0KB 3WJ1A 2L2QA 1OVMA 3HBLA 5LZ4A 1XN1A 3HYLA 4M9SA 1P61B 3G0GA 3MHPA 1RC1A 2NO4A 3COVA 1CF9A 4CS3A 3DE3X 4FHGA 4HAVA 4J7CA 4JYPA 4BPRA 3W3SA 4D9JA 3GHYA 2Q7XA 4EIWA 3UG6A 1IJFA 1MPXA 1OY1A 5BWCA 3G0DA 3DLAA 1PE0A 4RNCA 1A9TA 3KFXA 4OHRA 4R40A 2ALYA 2BC9A 2CD9A 1TRHA 3L7CA 3RC1A 2AOTA 1GDHA 4Z3OA 1GKLA 2UZ1A 5D00A 1VIDA 4U7HA 5DULA 2J0QA 4ZK6A 3D8HA 3IDSA 3BF7A 3UMRA 3QXJA 6REQA 2WU3A 1J99A 1YS9A 4OLJA 4ZODA 1R6DA 2BGTA 2YY5A 4QDXA 4F4HA 4EG7A 3TO5A 1YRWA 4NMMA 4BGUA 3WDKA 1P73A 2IV2X 1Y8RA 2AF3C 1OBVA 2ZEJA 1J42A 1JN0A 1PJAA 1YZUA 1FMTA 3OFSA 3NKVA 5GJWC 3MFQA 2LPMA 3TVTA 5JDCC 3NVKI 4AUMA 2HU5A 1EQAA 1QFYA 3O9VA 5ALOA 1GV0A 2XF2A 3C7TA 4AY6A 1SUEA 3PHBE 1LDGA 3ZQ6A 4EJSB 2AFHA 2YHUA 1VRCA 5DX8A 4EUHA 2JFFA 4NTZA 4Q4LA 2CD7A 1EHIA 5EIFA 4DZZA 4F2HA 3B52X 2A0WA 3CLHA 3I6YA 3P9XA 4MWZA 3PFNA 4IH1A 4EB6B 5KPDA 2BUAA 1RCTE 3Q2KA 3QRWA 2X6RA 4BRWA 2ZRJA 4FVTA 3P9RA 1XZEA 5MF6A 5ARCA 1XRMA 5AW4A 1JVBA 1VE6A 2UDPA 4IF4A 4LBVA 4WE3A 5CBPA 5F51A 1T2FA 1ZU5A 2EWWA 3QV2A 4CT4B 3ER6A 1NC1A 4JKOA 2YJ3A 4B6OA 4DCJA 2OKCA 4NCJA 5ECWA 1B7YA 3D4OA 2CMFA 3PHGA 4AROA 2ZJ7A 4DUZB 4UUQA 3ZIUA 2AI2A 5CDFE 1T26A 3BXXA 1G0NA 1VYVA 3N75A 2BEWB 3TIFA 5HNKA 1HGXA 4H2TA 3A6HA 3HLYA 2X0NA 3Q7TA 3VPSA 4ERXA 3T3NA 4RA9A 4LYEA 4YRZA 5JSYA 3VSCA 5EGSA 1BW9A 3ZCXA 5CB4F 3PCOB 5IG2A 4QG3A 2PJZA 1YE8A 3IVMA 3UC5A 3M9WA 2MINB 4A1FA 4N5NA 2YNMC 1MIOB 4CM9D 4RZUA 5BNZA 2HMVA 5AK0A 4BFTA 4UPDA 4YQYA 1VJTA 3E23A 2EAUA 2RBGA 1KVQA 3FNIA 3QMPA 1Z26A 4RPHA 5TF0A 3X43A 3ZOKA 4KR6A 3ZE2B 2G04A 1I1NA 4YUXA 4LY0A 4KQKA 2DZ9A 2X1VA 5CAEA 3WKEA 4G0VA 3E8MA 4FDVA 4MVXA 4B81A 5JD5A 4UM9D 2SCUB 1V1MB 3S5JA 4EL5A 3KBOA 5EMNA 2JFWA 4ROSA 5A3SA 4GOKA 3D7KA 2I2DA 4IGEA 2F8MA 3EXIB 3R2JA 3FZYA 1ZL2A 1HM5A 5IJ9A 4OUDA 3K7EA 3VUFA 1LRJA 1XZPA 3C3PA 4LNAA 3WMEA 3OA0A 3DDUA 1P9LA 1R4AA 4C07A 5LM3A 1KO8A 3F5FA 3PFKA 5IU6A 1IU9A 2I55A 5IK2D 4LZWA 3C3BA 3Q15C 4EB3A 5JQGF 3W6UA 5JVDB 3NBKA 4OP1A 4UM7A 4CJXA 3A6PC 3HE3A 2YV1A 4QATA 3A4LA 5CHYA 3KD2A 4XD2A 3ETGA 1T0IA 1PNOA 2FWMX 3LVFO 1QP4A 1UKAA 3VZQA 2BGUA 2F1IA 4TUYB 1R0BA 5DYWA 4QKQA 2X7HA 4PPQA 3HQ4O 5L3SA 2G28A 3D7MA 3F98A 1DC7A 3ICQB 1GL9B 1PN3A 4D8YA 1VG8A 1HXDA 1TM2A 3L0PA 2B5VA 2WJZB 2BFDA 2Z5LA 1EUCB 2ZSBA 2G4CA 4HDNB 1ZSNA 2B69A 2IBSA 4WCFA 3RS4A 3ZQKA 2R11A 4TTRA 3Q6IA 2R85A 2GTPA 2PLRA 1LY1A 3K32A 2PAFA 4KP7A 1PYSB 3E5RA 1SVOA 3QG1A 3JZAA 4OJNA 4ZMSA 3QITA 3IIEA 1VM6A 2PYZA 4Q9IA 5HQTA 1O6BA 4LOAA 3EVDA 4D9EA 3G2JA 1FDWA 4PCLA 4RABA 4C2AA 1IHPA 3SQXA 3ASUA 4JA2A 2IPXA 1BROA 1J2UA 3DKRA 5FH9A 1Z75A 1JPUA 1RQGA 4MQFA 1BKSB 2EFCB 4TVBA 1F5NA 2E0IA 3SZ3A 4RY9A 2PGNA 3RHTA 3AP3A 2DPHA 3BMNB 1Q0ZA 1X1DA 4HDAA 3QNUA 1K88A 3LQ2A 4BO8A 3RKYA 4M1QA 1E2PA 2WMOB 2VBGA 1EZZA 2A1IA 5EJAA 4YV1A 3ONEA 3PNYA 4DEXA 1MB2A 1GZDA 4OLAA 3EXHB 2E3JA 2HW8A 2IXBA 2XYRA 3IKVA 3LU1A 4QUKA 5LC1A 4ETWA 3A3KA 4Z2YA 3RVOA 3PHIA 1HOXA 3L5KA 2IDJA 1ZOPA 5F35A 3WRXC 4AT1A 3CEHA 1SA0A 4RKWA 4EMTA 5LBTA 5KJ6A 1EE1A 4JBGA 2QNRA 4WLVA 4F60A 3HGQA 2R1TB 3HVUA 2GCEA 4ZAXA 4OLFA 5EE9A 3IX7A 1JJCA 1JIXA 1GZSA 1HE8B 1U7XA 1AMNA 1FC0A 3ONDA 1HZZC 4X24A 2G0TA 1FDOA 1WDLA 2D0DA 3EIHA 3NB0A 4HAXA 4AZ0A 5DNCA 5FPKA 4PAQA 2ZYIA 4JIGA 3GD7A 2X0FA 2ODNA 2AXQA 3RF1A 3MCUA 4LQCA 2D2FA 2DKNA 5H02A 1QQTA 3DZKA 1O9HA 3EQ2A 4G1FA 3P45A 4J49A 4MPTA 2DUUA 5D8DA 4V1CI 2HSGA 1WNLA 2Y3IA 2ZROA 4O1HA 5E6RA 2R6FA 4MUGA 2FJ0A 4GM1A 3D5QA 1B70A 2Q0QA 2HCTA 4ZHQB 4RD2A 1KAMA 3IP3A 1S4MA 4NEHB 4QU0A 3EC7A 4NJEA 1FL9A 1X38A 1ECFA 4AJ4A 1QV6A 3TRKA 4C43A 4NOKA 4A2CA 5JAPA 4MVJA 3ZH2A 5K09A 1SRRA 1UBTS 2X1LA 1WCIB 4L5YA 2PGDA 3OM9A 5AQEA 3O2NA 3FY4A 1SCUB 2AHRA 3IKLA 4IZ6A 3S2SA 3ABIA 3CCBA 3ZZTA 3F4LA 3GEDA 3IOYA 1HFWA 3A14A 1BKDR 1K06A 4Y7DA 4TQFA 4FT2A 3UMGA 1Y1SA 1GPKA 3FJYA 1W8IA 4FFLA 4QU8A 5IT4A 5KOIA 5KQGA 3B1FA 3OHSX 1Y37A 4FYJA 3QTBA 4R2IA 1NTRA 1FFBA 1OBCA 1WP4A 3EGDA 4PGMA 4OEHA 1FQOA 3W5JA 5KQPA 1Q7BA 4KSYA 4EKIA 1F3OA 4WEOA 4JUDX 2KSQA 5C1IA 1K7SN 1U11A 4IGAA 5K6RA 1YDGA 5KREA 2Q28A 5ITWA 5JH7A 1M5RA 1OI3A 4FC7A 3UWSA 1ODIA 5AIAA 3QE3A 2HU8A 1MQ8B 3B5EA 4OATA 4EELA 4JNCA 4IICA 1OPRA 4N0QA 1IVSA 1TZMA 2D0PB 4G09A 4KRYA 1WMAA 3P9PA 4UP8A 4MLDA 1J90A 1CQWA 3DBOB 4XWKA 1B23P 1CVIA 221PA 4ZU6X 2XWBF 4IIHA 3IERA 2GPWA 1JR3E 1YVDA 3OSZA 1SIUA 2FPOA 2JRCA 2PANA 2JAPA 5B36A 4BV3A 3OIVA 1L6IA 4ZT3A 3RSFA 5AVKA 1BBWA 1G1AA 3SX0A 1DIRA 3HRIA 4NV1A 5LDHA 3PFWO 2CF6A 3A4NA 1MG5A 4NE2A 4RHYA 5FUBA 1G8YA 1IQPA 2INGX 3TLCA 1KE2A 4AULA 3E5HA 2AUTA 2P3OA 2WM3A 2ZBEA 3D4IA 1EFVB 3PBKA 3IMCA 2JPDA 3WADA 2GILA 3CPHA 3N05A 3ZXXA 2B8JA 4YA6A 5JCXA 1NVTA 2GKSA 3FMOB 5EGNA 3F4BA 4H6XA 1PYGA 3UKDA 1L4UA 1XR3A 1C30A 1KY3A 3WB2A 2J3MA 3FKSA 1PSDA 2X5KO 1XF9A 4U7GA 4I19A 3EVFA 4PO1A 3WIEA 3Q41A 4MLCA 4MCJA 5TVGA 4HJRA 1KAOA 1LA2A 2WG0A 2ZRQA 3O8OA 5K0ZA 2FEPA 1HURA 4PLTA 4W6QA 2APJA 3TI7A 1N2OA 4S2UA 2IIVA 1PDWA 5CVUA 1RS0A 4M0FA 5FUQA 1TM4E 4M4SA 2XV1A 4EK9A 4XU0A 1C50A 2VPTA 1Z45A 5BNTA 3NYIA 4GSYA 2BHNA 5LCXA 5CIWA 2M2IA 4NCHA 1CRLA 4HPJB 2NU6A 2QE7A 3LGAA 2B98A 1S9DA 3B7GA 1HYGA 3GDGA 1MEEA 1IOZA 4ZOLF 3BCUA 5CB4B 3M5PA 2WQ6A 3MG9A 2H2DA 1ADYA 1D9ZA 1JSLA 1ZJYA 4FYHA 4P8RA 4B8WA 3O3CA 3SMQA 2RKWA 2WU1A 5I7HA 3MSXA 3HVHA 3D7NA 3KKPA 4NF2A 1J2YA 1EIZA 4C6SA 1SUDA 3JAKA 1F3LA 2C97A 5AJYA 4Q00A 3CPEA 1OLOA 2R66A 4JBNA 3SM9A 2BMEA 3IYLW 1QB8A 1XCGB 1PR5A 1W1IA 3COYA 3G2PA 4PX3A 1K4MA 2E82A 1RT9A 3CNQS 3H16A 4IDEA 5ERGB 4QM6A 4IJUA 3R7BA 2PMEA 2IYOA 4PQYA 3AVXA 2V5AA 3NW9A 3RYHA 2JHAA 4GYWA 5JZOA 1PSZA 4B4KA 2JK1A 1H6CA 1QV7A 5KSWB 5FUMA 5ALIA 3GCXA 3C16C 4MHTA 5AHXA 4E4RA 5IZ4A 3GJQA 4YAUA 4FWTA 1JT9A 1T24A 3PQFA 1EUYA 4JYAB 4ZTZB 2RAPA 1H8HA 2NM0A 4KQIA 4W7IA 5A2QA 3N0RA 5ALLA 3UWDA 3ETDA 2QL5A 5CYPA 1BWQA 3NHKA 1E60A 5ALJA 4CXMA 4YH1A 3IIJA 4X6XA 1O5TA 5FT9A 2QN9A 1RXSA 3EEBA 4NESA 4A36A 4AG3A 4KE8A 3Q0IA 1PR1A 4EY3A 3KT6A 4Q9HA 1E99A 1ONPA 1MMFB 2ECOA 2G17A 3H84A 4PPYA 1P9WA 3ASYA 3UMVA 2WW8A 3TZCA 3I92A 2QD4A 1XCJA 2O57A 3DYVA 1AQYA 3OQNA 4J0QA 4C5CA 5JJKA 5FR1A 2R44A 1N4DA 2NO6A 4J75A 4ZVOA 4DANA 2CXHA 4RNDB 1UBNA 1HUQA 1WOMA 2DQZA 4R5MA 1IXZA 1XU4A 3TTXA 2C5GA 4Z1MD 1CZRA 3U26A 3IPRA 1B0UA 1P3DA 3C70A 1WY7A 2ZZFA 3MELA 4RD4A 4AS2A 4O2AB 2WWXA 3ND8A 2CEKA 3AKYA 3PNPA 4DRZA 1P0FA 1T9CA 1UPTA 3LBAA 1NVVR 5DXFA 3PKIA 5JROA 5A5FA 4O1MA 4DDKA 3GGGA 4U6NA 8ADHA 2PQMA 4CR7A 5KYWB 4A8HA 4DB2A 3W7VA 4N7MA 2DKGA 2IUEA 3ILYA 1RWBA 7ABPA 1GR1A 1RFLA 4M2LA 1GT91 2IYUA 2HO4A 4ER3A 4TLCA 5JXWA 2ZRAA 3C6QA 1GAWA 4M0DA 1X94A 1YHZA 1S2OA 3ISVA 2CB0A 4MVJG 1Q7GA 5CT5A 3CF0A 1IQ0A 1W0JA 2J5KA 2HMWA 2OG2A 3RL6A 3OQJA 1PJ3A 4LRUA 4S0XA 5E8RA 3RR2A 2GBCA 1D5WA 1KMHA 4L0MA 1R6AA 3A1FA 2Z8ZA 1MGOA 3ITKA 2XMRA 4TTIA 4KPEC 5SY6A 2Y05A 3U5TA 3FYUA 2F1KA 3U7JA 1FUIA 3SY8A 4BMDA 2CFIA 5GIPE 1E1QD 2ZJ6A 1P4GA 2JLBA 3IDQA 4M1ZA 3TSZA 3DW1X 1TA0A 4E12A 2BBOA 2QX6A 1E9CA 3L1AA 4KSCA 1BIFA 1QFSA 4E1VA 3CB4A 2KBFA 1OGIA 1OT5A 3TQTA 3DLPX 3O73A 1MF7A 1Q50A 1ZN2A 1QRDA 3N6VA 5DRYA 1LGYA 3L0BA 3RLFA 4DV4B 3TD6A 2R68A 5ELLA 1OZGA 3JQAB 3VSBA 4MH0R 2IYTA 1NRIA 3K92A 1SKMA 2O8NA 3MPUA 4L15A 4F1KA 3DE7X 4EJSA 4KXLA 2QM8A 2Q9AA 4FMPA 4I36A 3KZKA 2QZJA 5JSZA 3I34X 3K6SB 5FTJA 2QRQA 3Q9SA 2QE6A 1TFRA 2L19A 4YV7A 5HZGA 1V47A 1YQEA 4QUEA 2QX4A 4S12A 3TQQA 4ZYWA 3LUHA 1R8SA 3FZQA 1Z2EA 4DCVA 3EOBI 1SETA 4EB6A 7MHTA 1X2GA 3O74A 2BM1A 4AJIA 4ZPXA 4L5AA 1Y9AA 4PTZA 2VRNA 2OCYC 4K6FA 3F6EX 1LVHA 4XTRA 3K30A 3KOXA 4D3SA 4G0MA 4WN9B 3OPVA 1ZAYA 3KWLA 2X9VA 1VQZA 4FFMA 1Y7PA 4KV7A 3HABA 2COKA 4L95C 1G2PA 4KDEA 3TOCA 3WXBA 4YUYA 5LXTB 4Z51A 5IPFA 2JLZA 5L40A 3WYAA 2JLYA 2JIOA 2BEWA 4F4UA 1MEJA 3RVBA 4Q1EA 4OP2A 4P75C 1YBFA 3O7WA 5C46F 3PLAE 3ZHSA 2VHZA 5TARA 1L1QA 3HYRA 1QU3A 5EVJA 3H19A 3PCOA 4B3SB 1HLFA 3L4EA 5DRTA 4BUZA 3L5OA 4MWTA 3T3PB 3A58B 4DLSA 4R1MA 2DB3A 3FGPA 2VBFA 3FVWA 4QWMA 5G4KB 2Q1WA 2QUKA 4NPAA 4QPJC 4DL9A 5FWXB 4ZCQA 4KPYA 3SG0A 3E9QA 3GJ5A 3LQYA 3N0VA 3UMCA 2GHQA 3OZSA 3KV1A 3A4MA 3GH3A 3PC2A 1G98A 4N54A 3WNBA 2Q2OA 2PT6A 3VV3A 2IKSA 2TMKA 1CX9B 5EXTA 4UBLA 3PNVA 4EKDA 1EM6A 1FU7A 1SQ5A 5PGMA 4R9UC 1IOLA 3P9NA 3AVUA 4I9UA 4F56A 3T4PA 4TKVA 2SCUA 4CKZA 1V1MA 2EP7A 4H4CA 2Z2ZA 3G9UA 4KQ6A 4WTOA 4WK6A 2O2SA 3H05A 4FFOA 3DG9A 4PNZA 4ZQFA 2X9NA 1SQGA 3AW8A 1IATA 4D7AA 1O96A 1R15A 1UBCA 4NMLA 1KOJA 4PHCA 1U0GA 3I6MA 3EXIA 2OZKA 2CJWB 3NEJA 4OQZA 2FOXA 3ZGLA 3JQPA 1Y4UA 4EZIA 5JI3E 2EC5A 2YCBA 1M3SA 4GGMX 3QQ5A 3LQ4A 3HJGA 1KYQA 2DOKA 4JL8A 2H5IA 1H4TA 3OF2A 2CYBA 1UM9A 1N9GB 1TC2A 4FDTA 1FFXB 2G09A 1P4AA 2VAWA 2W6PA 2CV1A 3U3DA 2QX9A 3RRXA 4EGQA 2GCGA 1ZH2A 3QU4A 3BBLA 5CLHA 5FBZA 2PGIA 2UZIR 2QW1A 3INYA 4KVFA 3STUA 5M5BA 3L7DA 2Q7HA 4BZZA 5CH3A 5AVOA 1EFPA 4R1QA 1FTSA 3ZWMA 2FMHA 1Y9ZA 1TF2A 3DTVD 2XCRB 4D9MA 5BOVA 2RGCA 1UC4B 4BLWA 4TUYA 121PA 1YA6A 5C31A 3QJ5A 1QX3A 3KHUA 3K0AB 4AF8A 1PP4A 3F3SA 3TF5A 1GCGA 4W7SA 3RSQA 1P2FA 4ITVA 4FOLA 1FQJA 3A4YA 3NAMA 1VGVA 2C2GA 3H8WA 4QQKA 1UDCA 3KP1A 4D0RA 2QRPA 2RHTA 4HQ6A 4HDNA 3N6XA 4GOOD 1C3VA 4S35A 4D96A 5E9WA 1E7MA 1LF0A 1QCDA 3ETEA 1X3SA 2P2DA 3Q72A 1WF3A 3DEFA 2G06A 4ND1A 1ZH8A 1PYSA 2DJZA 4G1EB 1SD2A 2W6QA 1KK2A 3OH8A 1N7HA 4ILEA 5JCJA 2VPIA 4B5LA 4BKUA 4W9RA 3AJRA 4RDCA 1C9EA 2B1JA 3NJRA 4JLBA 1E1RD 4W5HA 3HLKA 3M9XA 4KVGA 4D99A 4HB2A 1X1EA 2A9JA 1MO5A 3ZHCA 1KIMA 4MZDA 4H15A 1PK9A 2ZIWB 2BMVA 2FR1A 2XCIA 4Q21A 2D3WA 4PBTA 4UE6A 4Y1RA 3BMNA 5CRIA 1USWA 3ANNA 2QI9C 3KL2A 4EFLA 4KDFA 3V2HA 5I7VA 1CDDA 1Y3BE 2R00C 3DDWA 3PDHA 4KIGA 3ESCA 1GZ4A 1WS6A 1XTQA 3KEGA 3KJXA 3NV7A 1F06A 2OYRA 3HJUA 1DIHA 4CW7A 1G20B 2ZINA 2PBFA 5SYAA 4BFZA 5EHZA 1ECGA 3AR4A 4HWOA 4QT0A 2H07A 4C4PA 2ZTMA 3STXA 2ZQZA 1Z5VA 1G5IA 4XRRA 3O0DA 4ZFNA 1GPJA 4G85A 4DXAA 3UC9A 3O03A 4PG4A 3U17A 1A9XB 3B48A 4FZ5A 4EATA 4BNKA 4ZO6A 2H1OA 3FJPA 5BSWA 4IV8A 1PT7A 5CVCA 3SEQA 3VNUA 1KKLA 5THXA 3QXCA 5BV2P 2P9CA 5KO2A 1ORTA 1F4PA 2C88A 3LTEA 3T35A 4D44A 2K7FA 4JR0A 2Y1XA 4R9NA 4X66B 1SUCA 4LJ7A 1PGJA 4OH7A 3STWA 4I55B 5GONA 2YMMA 5AK4A 1CCWA 4QFBA 1XDSA 3FPGA 4F97A 1OILA 4I0WB 4I1YA 5G3ZA 2NVUB 4B3CA 2LXNA 2X8WA 1F9AA 3ED1A 3PC7A 3KU1A 4LF6B 5D2CA 2B2XA 2CFCA 4DCTA 2QROA 2ROQA 2VXYA 1XUOA 5K5EA 1RLIA 4I4NA 1O5IA 4WZZA 3OQ1A 1HSZA 1P80A 1WCIA 2OXEA 3C5VA 1Z8HA 5EYPB 5JC8A 1EMDA 1SCUA 1B8NA 4I4TB 4Q01A 1DC5A 1KEEB 2VOEA 1HR0B 4GOJA 2P77A 2GYUA 2OO3A 1R0ZA 4E30A 3BD9A 5E1OA 3AY7A 4P82A 3CKYA 3MD9A 3T0IA 1VKJA 1OASA 3TRJA 2ID8A 3HDYA 3JQRA 2P5UA 4HDSB 4AB1A 1BQ3A 1WULS 1RJDA 2RHHA 4HNHA 3MGAA 2WWYA 1AX9A 4IUDS 2RCYA 2FF5A 4ZI3A 1I94B 2DBYA 2JKZA 4KGDA 4M1YA 5YASA 3WL4A 5B1EA 3SVZA 4V24A 3WLPA 3EDYA 3HXXA 3FDIA 2AW5A 3MLEA 3NM5A 3RIGA 4BAUA 4MVJM 1O94D 3KM0A 4P93A 1ZH6A 3D7LA 3UAZA 5DHQA 1H8EA 2XQVA 4YCAA 4ENRA 4EHFA 3BSYA 5JBNA 5M7EA 4CHTA 2AMLA 4BLOA 3PVSA 3D6FA 1SHTX 2FZLA 3DFZA 3EZ6A 4IDCA 4PVCA 4CIYA 5DNEA 5E6UB 3NDJA 3LRXA 3PNLA 2GRUA 3PD1A 2Y4OA 1XL1A 2ASVA 5I9TA 3C3JA 4RGBA 4YYZA 3FUVA 3CZAA 1A97A 3DR3A 1I24A 2BH9A 2Q9UA 1NN3A 2RHJA 5I8WA 5TPWB 3L4JA 4D80A 1AUOA 5H5JA 3P0FA 1XTTA 3T5MA 3G49A 3LUKA 4HEQA 3ZE0B 4IHJB 3OPMA 4H16A 2QRMA 1HDZA 1AGNA 4CS2A 2MYUA 2FSUA 3QU7A 2PH3A 1ISMA 1PLKA 1T1RA 2HK6A 1C9KA 2PEZA 4JQCA 4YO8A 2JH8A 1A77A 4AWXA 2V55B 3GA7A 4EB8A 1J5WA 1BNCA 3NNDA 1FX0B 4B80A 5DSZA 1UJ4A 4EFKA 3QH4A 4YT2A 5C8YF 1EFVA 3HP1A 3TPFA 2OMKA 2RHDA 4RSGA 1YSCA 5B30A 4OBWA 4BCCA 1AK9A 1SG9A 3ZXSA 3TTTA 2MSWA 3LC7O 2YRXA 1RBYA 2ZJBA 3RG2A 1E8DA 2YOHA 1DELA 5B1YA 4LOHA 3OY2A 3W2TA 4RPKA 1L7RA 3FETA 4LRXA 4EA7A 3GVPA 3JVDA 1TEZA 2OBMA 4J1TC 1Y5NA 3GPCA 2DFNA 1E3MA 1WUKS 3ISJA 3NHFA 3DOCA 4IPTA 3P2IA 4RVOA 3T1HB 5K0LA 1FSSA 1J21A 2J4CA 3K9QO 3NHRA 3FGOA 3I2JA 5FNVF 1KH1A 2DFPA 3BMXA 3OTQA 3V4SA 2IVFA 1IULA 1ZKDA 1G8GA 1K6MA 3K20A 1HE1C 3W9YA 4MRRA 2O3JA 4IYJA 5IVIA 3OVMA 1H66A 4BMCA 3ZHUA 4PHGA 3T1YB 2QZPA 3H2GA 4ZCMA 4AKGA 5E2AA 4MR9A 3MWLA 5FBLB 1ZR2A 2WDPA 1CEYA 2GVNA 2QGFA 5BVGA 2CDRA 2WYIA 4X3OA 1I7LA 1RTKA 2P4HX 3LVBA 1JEOA 3ZK9A 1CQJB 3I2FA 2O2IA 5B6IA 2CSUA 1XNRB 3EN0A 2OG1A 5CB4A 1YQGA 1KH2A 3D3NA 4CEJB 2I7TA 2B8EA 4KR9A 4HRYA 1CR2A 1J8FA 4OQPA 1LLFA 4KI7A 3O2SB 3G1WA 3CRW1 1J1IA 3G1TA 1DJQA 1IUOA 1XOIA 1QG4A 2CHEA 2ZSAA 4OQXA 5FL7A 2ONYA 3SD7A 2ZI5A 5GINE 2AKAB 3HA7A 1NQVA 4BVGA 1JYEA 3QWHA 1NULA 3FWPA 5AYVA 4RXTA 1SCQA 2EERA 1R4ZA 5FX2A 1K8RA 3UCEA 3AIMA 2CLLB 4UPAA 3CR8A 4PZZA 4KYUA 2H5EA 3QJGA 4OB6A 2E18A 3G2HA 4L4UA 4Z8XA 3UJHA 5FBHA 2F4NA 2FXVA 2VUTA 4R51A 4Q4CA 5CEJA 1BXRB 1QDUA 1XTVA 4CN8A 2OM2A 3DP9A 2FMIA 5TE9A 5EJ7A 2ISCA 1MX5A 5FFFA 2GPNA 5BMVF 3F74A 1CY4A 1PS9A 2OGWA 4Q1DA 5IP5A 2C1XA 3BGWA 4K5QA 3SLGA 3T7TA 1P0CA 1NR1A 1LPSA 1JQEA 3R0VA 1VSBA 2QXUA 4V0RA 3WGOA 1A2OA 3AP2A 4CLEA 1GM5A 2CWDA 3LPMA 4LF5B 5FEUA 2O6HA 5KWJA 4XTZA 3D3WB 4G97A 3RTAA 3W7AA 3IGFA 8MHTA 2I0FA 1C7ZA 3ERCA 1YCDA 2JHGA 1Z0IA 3H97A 4QRHA 4PFKA 1XCLA 1PWYE 3KJFA 1QP0A 1DAMA 2JIDA 3A1TA 3NC0C 2PZAA 3OHPA 2FSSA 2WA1A 5BWMA 3P2OA 2VYQA 3OIDA 2C92A 4RMNA 2WG1A 2IUSA 2WJGA 2J3DA 4X7PA 3F0TA 2RAFA 1ESNA 4O2AA 3BK2A 1D0IA 4D1YA 1N0WA 2CDNA 3QOFA 1SEVA 5DWDA 1I4TD 5ETJA 4EGJA 2PMWB 3RAEC 4LFCB 1UEXC 4R7TA 2IQIA 4PGAA 5EIHA 5JD4A 4HBGA 4L7VA 1U81A 2NO5A 3CEPB 3STVA 1Z35A 2AT1A 2II6A 2NV0A 4JSRA 2AMVA 3ZWCA 4C2BA 3QUAA 4AJJA 4CLDA 2PUDA 2W6ZA 3KKLA 3TZLA 2Z4TA 3EE6A 2H4ZA 3GFSA 4PG7A 1IOVA 5BQPA 4JI1B 3U37A 1CUVA 2O2JA 1PJ4A 3L92A 4XUGB 4ZVNA 2X5OA 2W2QA 4MQ5A 4LPSA 1VE7A 3BB1A 1MC8A 1W581 2X9LA 3IAFA 4YCNA 5ESXA 5CLLA 1R8QA 2DZCA 5F2OA 4B6PA 3NH6A 3O8QB 1JR3D 1PBNA 2XQGA 4G2TA 5HDQA 5HF9A 4PONA 1O5OA 2C20A 1P62B 1AU9A 4ZZ1A 2GM4A 2EWVA 4OXQA 1FFEA 3F9CA 3RC8A 1OIVA 4FT4A 2AA3A 3FOAA 4V0MA 1N92A 2VL7A 3L41A 2AQIA 2QTBA 4K46A 1U2RA 1CY1A 2HGZA 4J7XA 4MMYB 3MOIA 4R1OA 1FLAA 1QVZA 4WA7A 4OI1A 4A6XA 4DXDA 4PCUA 3JQAA 4EY6A 1WRBA 5L6MB 2IK8A 2QKYA 3OFJA 4LOLA 3ZU6A 1QGUB 4RVCA 4D45A 5KOYA 5HP4A 3O4IA 3I9V6 2O2HA 5D85A 1U3VA 1W5EA 2R5FA 4OAOA 3IPXA 5IM4F 3K6SA 4NCXA 3QWAA 3ZDYB 1E6MA 3VR5A 2DPMA 2XBMA 3HU5A 1UC8A 1JHYA 2EJCA 5CD9A 4NJMB 3GV0A 2HT1A 4W7HA 3MQZA 5ALMA 2XYVA 1IZ0A 1PL8A 5DT9A 3W8RA 3O8RA 3PFIA 3M0EA 5EMMA 3T4EA 5DN6D 3OMLA 1ABBA 4ZVRA 2VJKA 3WAJA 4RA6B 2ZUBA 1XFDA 4K9DA 4PICA 3DT6A 1WU8A 4WN9A 4CBVA 1KO4A 3BKWA 4GE0A 4H4DA 5KINB 1FTWA 1BO6A 2ZCEA 2R6R1 1XVLA 1QNLA 4OSOA 3ROTA 2HSEA 3WGVA 4YUWA 3KCNA 5LXTA 3QPUA 2I9KA 1U7OA 3V7SA 1LX6A 3B1VA 3MTBA 4GU5A 2FMTA 1TD9A 2J30A 2R25B 5HEKA 4KL8S 4MP8A 4ZAFA 4D4KA 3TZBA 2BHSA 2QN7A 1SUFA 3EISA 2DWQA 3R3WA 2FZ4A 1ZM4A 2ZE6A 4G89A 2D2VA 4Y0NA 2CJ9A 2ZCUA 4WH0A 5G4KA 2RC5A 4HQLA 3A7DA 1Y98A 2PUFA 5FWXA 3ZQ4A 2WF8A 3OIYA 4ZANA 4DIKA 4CUZA 1R66A 2G6BA 3QPAA 4GMDA 4MWOA 3NT4A 3HN6A 4MVJH 2GX6A 4N0DA 1KZHA 1OH7A 3RSHA 2ZG6A 5LQSA 4HVLA 1D2HA 4GX1A 3S68A 2YJ5A 1LK5A 5HGJA 1V48A 5HPYB 3KPVA 5A6SB 1L7OA 1N7IA 3FHJA 3N3BC 1XO1A 1CE8B 4MUYA 3MJDA 1ZGJA 1HKUA 3PPXA 3SEAA 1ENZA 3QY0A 5JDCA 3RS2A 2IIQA 3AEQA 3PTZA 2EBUA 2Q6LA 4FHEA 4HGOA 1YJBA 1G8AA 4YJ2B 4DTCA 3I76A 4J2OA 4KQ1A 1WQ3A 5KNBD 5DM4A 2YMLA 2A1TS 4JC8A 4RLQA 2IGBA 3I5AA 4MV4A 1Z0UA 2BSQA 1B76A 5JBIA 3N6RA 3QPCA 5EWJA 1PT8A 4BTEA 1PK8A 1N9GA 2HLDD 2VPPA 1FFXA 3AUSA 3FCCA 3GLKA 4MRPA 4XTWA 3LHSA 4J0JA 1FFDA 2VA9A 2Y2VA 2WF7A 1DXHA 4YJ3B 2NAFA 1BWPA 3K73O 5IH3A 1G2OA 3DL7A 3OQBA 4S1TA 3ROZA 1ZD5A 5I5GA 5H3HA 5J47A 4RD3A 4XJVA 4PYNA 1NBMA 1GG9A 3ECSA 1NI5A 4UOQA 2CXQA 3LLSA 4X54A 3K0EA 3DMYA 4X8LA 3UK0A 2PMFA 1BMTA 2P2YA 1BU5A 2J7KA 1KZ7B 3TIVA 3VO2A 1PR3A 1EBFA 1TI7A 3C3XA 2WU4A 1P9RA 3I0MA 1T4BA 4XD7D 5EY5B 4IUCS 2VF4X 1YRQA 4X85A 1B43A 3K0AA 2FW1A 2L17A 3ZIAD 1B6SA 4RKEA 1XJ5A 1QKIA 4M60A 3V42A 5FOVA 3R7WB 1MX3A 3C87A 2GEJA 4O4HF 1NMEA 2VKQA 3C8HA 4XE5A 5I7SA 1JMYA 4PPFA 3GUZA 3QTLA 1SHZA 4E2YA 1IPFA 5H70A 4KR7A 1XZFA 3FZEA 1EFHA 1E3EA 2P0LA 2ZIAA 3ZX4A 1DAOA 4RY0A 2AZXA 1WCWA 2YNMA 4TZ0A 2IPLA 2IU4A 1AK2A 3WLFA 2IXEA 3D6TB 5A03A 1H4QA 2IZZA 1UFRA 3DEAA 1SHUX 4DLRA 2B30A 5FWDA 5CLQA 1CUSA 2PLAA 5JZMA 2J3QA 2W2MA 3GAMA 2QVCA 4YBRA 3I2IA 2X1HA 1X1RA 5JO9A 3PDIA 4JV5B 3LA8A 3KR2A 1XEXA 4ARUA 4BOYA 5IF9A 2ZRIA 4AY2A 1RRMA 2HHAA 5G0SA 4EZBA 2OXIA 1JTVA 1UINA 4UJ5A 4PZUA 3QO8A 2CLSA 2GK3A 3JQGB 3LY7A 4EX6A 2SKEA 2ZDQA 3U4QB 2O4UX 5DHUA 1FJXA 3PDCA 1G20A 4F8JA 4EVQA 1G8FA 4XSHA 2WABA 3DVRX 5K4HA 4B3RB 4DCNA 4AQYB 1T4GA 3EZ7A 1O03A 1J9EA 2OV6A 4YRTA 1XIVA 1QIDA 1XZIA 1IZ7A 1JQBA 2QL6A 3FI0A 1SXPA 3P26A 1VG1A 2J9GA 4G5OA 3X2SA 1A9XA 4HVCA 2WMNB 4M49A 3NTRA 5EIXA 2FNAA 2FUG6 3KUXA 4OYHA 3H2YA 4UNPA 3RHZA 1SQ6A 3U3ZA 4DZRA 2JLXA 1E3TA 3P7MA 4W5OA 4FMDB 1YB2A 1G63A 3UWOA 2O3TA 2RJNA 3U0BA 1X54A 2BDEA 3LUDA 3OLWA 4IG4A 1TYAE 3FF4A 4OHUA 4U7TB 4PWZA 3ML1A 3WNCA 2GD6A 1NIJA 1EFAA 3WISA 4I55A 5K3AA 4XVCA 3QLJA 1N6KA 5IDWA 1TUGA 3N2EA 1ZC3A 2AJBA 2P30A 4E4TA 3GLTA 4BY9E 5BUQA 2YICA 2NZUG 3KSMA 4UU8A 2Z1MA 2PX6A 3U13A 5J2TB 4OHBA 2FG5A 3RFFA 4X90A 3NV9A 1MOQA 1KA9H 1N1GA 4LUCA 1Y8CA 2WSIA 1JALA 2HK9A 2I54A 3HDGA 1KE1A 5HS4A 3F90A 4DA4A 3LQ1A 1PT9A 1L5NA 3ND9A 4GOMD 3KVYA 2Q6KA 4I4TA 3V5NA 3EVCA 1KEEA 2GXAA 1UP7A 3F6YA 2C4WA 1OI4A 1ZX1A 2OGTA 3LDHA 4EF4A 4MVCA 2G1JA 1E2IA 2GEDA 3ABOB 4KH0A 4OBEA 3A1SA 3ICEA 2DJIA 4ER0A 4LJKA 3MTDA 5MFPA 2PT5A 1KAHA 2WYWA 3R3VA 5DW0A 4EW3A 2BCGY 2IPNA 5BV0A 1ZCAA 5DGTA 4DCOA 3O8CA 4P83A 1N5LA 2XEDA 3GXOA 3I5MA 3SN6A 3GJ8A 3ZLBA 1HETA 1W4BA 2QOEA 3UFGA 1J20A 3KXIA 4DA9A 4FGSA 4RVUA 3ROQA 4HGQA 2HWUA 1CTQA 1K3TA 2CB9A 3LT4A 4JZKA 1B8UA 3QW2A 3VYWA 2NVOA 1EDBA 1G2IA 4TTPA 1T4CA 4XWTA 3KTAB 2BSAA 4FILA 4WLUA 1TLTA 4YMSA 5DW3A 4UXJA 1N2HA 1OVGA 3B3FA 3DMTA 5T8KC 1SBYA 2NPFA 2JAUA 3EWIA 3AHJA 2FG6C 3CB2A 3AKDA 2E89A 3UAGA 5UKDA 3RWMB 4C29A 4GPD1 1ZU4A 1ADBA 5GGYA 2FCAA 1X55A 3F96A 1M6WA 4XFDA 4OQFA 3FZGA 5E6UA 4ARVA 2JJ1A 1UBSB 3EOZA 3NHJA 2OYSA 4QOEA 1ZBQA 2HSZA 4RK4A 2ZTLA 4C0LA 4E2XA 4ZVKA 5JDIA 5GOTA 3A04A 3M70A 1HZZA 1DQSA 2I1LA 3DYBA 2R6JA 2BFAA 1E4YA 2DM6A 3CNBA 1AUXA 3SZUA 4D6YA 5BWOA 5TPWA 5ELOA 1TFUA 4F71A 2IE8A 2GZHA 3FUTA 3D6JA 4UDXX 5DYTA 1QTNA 1TLFA 1JPNA 1X7ZB 3TPZA 3ZWVA 4BCBA 1H4VB 1F20A 4JU8A 1FNNA 4Q18A 1LBHA 3HFSA 3QFFA 3FYCA 4GMHA 4DC9A 3ND7A 1Y1QA 1FS4A 3DAGA 1FX0A 3FFBA 1EFDN 2BI4A 3R4VA 5A9RA 1MH1A 4IV5A 4C4AA 2XF8A 4L9WA 1KP2A 2P0YA 1FLDA 4GMXA 4Q34A 3CLTD 4TXNA 2WP0A 3I12A 1P19A 2G88A 4FZVA 4O4IA 4NYIQ 4B4DA 2B1GA 2NAPA 3UB2A 5EZYF 2WWHA 2WICA 3BL6A 3OIUA 4O25A 1RPAA 1G5TA 1B00A 4N01A 3EXEB 3PYXA 3W05A 2YZGA 1M0SA 4ZVTA 4MNTA 2AMFA 4H0CA 2EXXA 3NUGA 5CFLA 1L7MA 2AOXA 4ALNA 4K9PA 2O19A 1SOAA 3HBFA 5MN6A 3AI2A 1NBOA 3PEVA 2IKQA 5J5VA 1QYRA 1Y6JA 3MSCA 2HJRA 1DKUA 1SD5A 4MQBA 4MPRA 2PM8A 4V0OA 5ALZA 2EKBA 1E4EB 2V9ZA 3Q2OA 5J5CA 2R62A 4CKYA 3U5ZB 2BFCB 2GN0A 3WQSB 1P7ZA 2HYIC 1WIWA 4HGPA 4PSAA 4PRLA 4MW1A 4QLOA 4RZ3A 1NQ5A 1WWKA 1MUUA 2HXSA 1YFZA 4MQ4A 5A9TA 1RBQA 2R5NA 3HDTA 4CIVA 1CQJA 4Z8YA 3U4HA 4BLPA 1I7QB 3LK6A 1SRQA 2HM7A 1Q0HA 2QU8A 4BMNA 2ZNJA 1S8NA 4CEJA 1BEUB 2JJ2D 4IIJB 4D0LB 4MPDA 5ALUA 1QOZA 1Z7EA 2QTVB 1P1RA 4ECEA 4CU5A 5BQXA 1HDOA 4WW0A 4ZCPA 3BSFA 1V8OA 1K2VN 1U28C 2I67A 3B13B 3DEYX 1ODCA 2GI4A 1ZC4A 4E03A 3OZTA 1P5HA 2PD4A 2C5BA 3S1SA 4LBYA 5AVZA 1PGQA 4LWZA 2GVDC 1WE2A 3MMSA 2RCNA 1EIYB 3BHJA 4X9XA 2XNHA 5I7UA 3DUWA 1XNHA 4ZQCB 4C5BA 3E7XA 1P18A 3GP5A 3SYTA 4R0MA 2QAGB 4V02A 4LHVA 4Y9UA 2DWUA 1UDWA 2RKBA 3MD0A 2XDAA 5J23A 1XRRA 4XDGA 3FOZA 4WUTA 3QX8A 4AUKA 3TJRA 1DRWA 1O6FA 1XDDA 1JH8A 4DIBA 2AC4A 3FUXA 1NW8A 5C1PA 3G9ZA 4YFVA 1A9RA 3F97A 3QVOA 4JLNA 1CUFA 2Q1UA 4BJ1A 1IY9A 1CDZA 4B9EA 1AIPA 3MJHA 1Y3FE 3NPAA 3T6KA 5JR3A 1P31A 4C4XA 5IHXA 2PRZA 3TEHB 1TKBA 3BD6A 3D3WA 1R6BX 2P0AA 4EHDA 2ZT7A 3OEWA 1H0HA 2ZI4A 4MULA 1EP2B 4QNMA 4YDHB 1G5RA 1NKVA 1MG0A 2BFMA 2OY0A 1NDHA 2AC7A 1O95D 2DQ4A 1DVRA 2IXFA 4QUAA 2O0MA 1E2GA 1QQ5A 1YMQA 3M6WA 3P4UA 2W98A 3R3HA 3V8MA 3ZHBA 1J09A 4RPGA 2AZ4A 3DL4A 2Y1OA 2Q5HA 1LSSA 2O1XA 1NHGA 2WTEA 4HSGA 4ZXFA 3RJTA 1TM7E 1JA0A 1ONBA 4YEDA 3E9HA 4EI8A 3U7RA 1Q7EA 3E27A 3FHOA 1KYYA 3FMPB 2QLNA 3DFMA 4L3OA 4L22A 3U3XA 2PLWA 3BMCB 4KV9A 3BL8A 1V39A 1Q3TA 4W99A 3V7CA 2OLKA 4KQFA 4JAVC 3W77A 3NTOA 2PH7A 4Y2RA 4WZAB 4A0FA 3RH0A 421PA 4WDRA 1TQHA 1G18A 1H85A 3DONA 4JGGA 1YMUA 4Y6LA 1PHPA 1Z82A 1J0CA 4AC9A 2DR2A 1MDFA 1B41A 4TQUS 5LP6F 5EXPA 2HHJA 1LLUA 5AM3A 3WL6A 4G9BA 3H7IA 4O33A 2KX7A 3WIUA 1QK3A 3HI6A 5E9AA 1FTGA 3DZGA 4S1NA 3LIIA 4EHJA 3THYB 4P3PA 1P4HA 2QT9A 5U1PA 5HFNA 3SHWA 1UC5B 1IG0A 3I09A 2HADA 4JBIA 3STTA 3O8QA 3KCQA 2WV9A 4GZ3A 1QHHB 2ABWA 4WOCA 3DHWC 1VKZA 1HH4A 5CB8A 1VMKA 3F6SA 4J4HA 1G3QA 2XDYA 4D46A 4EYGA 4R98A 4WV3A 1GGFA 1HDXA 3RNLA 4AF7A 1GKKA 2G7ZA 1GVNB 3PYMA 4OK5A 1J5EB 1SUWA 5TPZA 4M55A 5TQ0B 1DQNA 1TRKA 3FPFA 3KB1A 4H7HA 4MVWA 4U9UA 1Y9JA 3UW3A 2FZKA 3VC3A 4X1IB 1LXCA 4Z54A 4HN2A 1BCSB 4WERA 2R1ZA 4GKBA 3OZFA 5ITSA 1F2VA 4D41A 1WB4A 1QGUA 1YO6A 5ALPA 3O8BA 1BHSA 3A5ZA 1KFKB 3AFIA 3HVIA 4IVPA 5IKMA 4FQ5A 1DCFA 2ETVA 4HGNA 1EBBA 3NVMB 1I4OA 3B8HA 4G0ZA 4IX1A 3HV0A 4L5BA 3ZGZA 4DJJA 2YWXA 4GBMA 2J5BA 4ZO8A 2BGKA 1NMYA 3C15C 4LOIA 2EJFA 2KS6A 2GARA 1M1XB 3IJEB 1TT5B 4X1OA 2FOIA 3AESB 1BGXT 4RA6A 4UXHA 1JHQA 1EVIA 1VHDA 2A6PA 1KYIA 1T5TA 2AXPA 2VAMA 5FUVA 2FV8A 4AKHA 4P72C 1QHEA 1AJEA 3K05A 3TQRA 2VHTA 2PDAA 3QE0A 4HTFB 4U3JA 1IM8A 3PNQA 1ZK0A 3QYPA 2V7TA 1WVMA 4BAZA 3K0BA 4D4IA 3ZS9A 4DR5B 1PYOA 2PT9A 3TLYA 5T41A 4IILA 4OGWA 2WWTA 3I4CA 1QHSA 1G42A 4S1OA 4F06A 3B5IA 3WNVA 4B3GA 3IESA 1P7VA 3VYTB 2IVZA 1YCHA 4IXWA 4L8VA 5E1DA 2WZCA 3G9XA 1KI4A 2IYLD 4DLTA 3A6FA 3WVNA 4LNSA 1QYWA 2FP4B 2VQ6A 3C98A 4FR5A 4PTLA 4DLKA 2QAIA 4DMFA 2O5RA 1EM8B 1Y4DE 1IL2A 5ALNA 2BGGA 2Z1DA 4UUAA 2VXCA 3LPNA 1WU7A 1DBSA 3NHYA 4QPZA 1F7VA 1ODSA 1IH8A 1PWXA 5EIOA 1GFZA 3PXGA 2R5WA 3E3LA 4DT1B 1M2KA 4D79A 3MCVA 5BP7A 1R8YA 5LQAA 4NYMQ 4RJIA 2O8CB 2AX4A 5G0VA 2ZU6A 3KJQA 3LC2O 3IBCA 2ESRA 4P2BA 3AHCA 2WSSA 1Z5ZA 1ZRNA 3QOWA 4ZV7A 1UK6A 1CE8A 2H2HA 5A6SA 3C1OA 1UPFA 2JCVA 5H3CA 3EHEA 4C05A 1MC1A 3WXMA 2HHHB 4NHOA 3DWIA 2X40A 4BNDB 1KDOA 3ST7A 1KMNA 4R2WA 1OAKA 4YJ2A 1PUXA 3ZVMA 3V1MA 3D64A 3A4TA 5F2EA 5CK5A 5HRUA 1T3TA 5KTTA 3PJDA 4BO3A 1AHPA 3HKDB 3IAXA 2VJYA 3K0HA 2R1VB 4LKOA 3P9KA 1WZUA 3S99A 3HC7A 3GLIB 4YJ3A 1YRAA 5DASA 3L7IA 2NT3A 4N8EA 5ESWA 5KWSA 3D0RA 3GU3A 1O87A 3PX2A 6ABPA 4PC7A 1WY5A 2WQZA 4KRGA 1TE2A 4L57A 2AEFA 4PHHA 1YFLA 4UCXA 4BEBA 1COWD 1SUBA 2ZVQX 4Y2TA 1KSJA 2QLTA 4JUBA 4LXHA 5K3SA 3LYLA 3VJLA 1FOEB 4NDZA 2C7IA 2I3BA 1JHVA 4QYXA 2ZI6A 2AOWA 2QT1A 2WEKA 3B6ZA 4WZBB 3HCNA 4J3NA 2FUKA 5K3FB 2VJQA 4OSPA 1YJ5A 4I6GA 4P75A 1ILEA 1PD0A 2G9RA 4MKGA 3R7WA 1SB8A 2QP9X 3CONA 4YQEA 1YVUA 2H2FA 4PAOA 4QAJA 3SF8B 4G6ZA 5SV2A 2BVNA 2QV7A 4BYMA 1L5FA 2GM3A 1GA1A 1Y4AE 4O1IA 4YRJA 1CUDA 2O7VA 2H4YA 4XW2A 2DLDA 3IAEA 2OP0A 1FNSA 1T9HA 1BQEA 3I73A 1ZXXA 3QVJA 4P84A 3UH1A 3WHKA 2G5PA 3ILXA 3ZI0A 3DJFA 1GY8A 2DXTA 3D1LA 3DP7A 3GZNB 5I4KA 1LW6E 3PICA 5C7IO 2GB4A 4XQCA 2QN6A 2EEPA 4Q7QA 2I6GA 1L8AA 1ZO8A 4LTMA 3T7AA 3ESXA 5IJ0A 1Q1NA 3W5CA 1A7JA 2I78A 1JBKA 4FSDA 3RIYA 2A1UA 1C0AA 3LT2A 5HCNA 4BC1A 3IT3A 4DM3A 3NIFB 2A57A 3DO6A 2Z95A 2WR8A 4LE1A 1FQKA 4KXVA 3HYCA 5KKCA 3QV1A 3KSRA 5T7BA 1ZCZA 4LDZA 4U8GA 2O2ZA 2Q41A 3EZXA 4GBGA 4J0GA 1E9EA 1WV1A 4AKSA 1E6KA 2EU8A 2DH6A 1XP8A 3VXKA 2ZKIA 1WKCA 3K9GA 4TV8B 5KMGB 4QBKA 2QHUA 3VPDA 3HCDA 4JVLA 1RCUA 3LAWA 1M2OA 3G2KA 3ONWA 4G1UC 4PO3X 3SXUB 2PO5A 4POOA 3G0CA 2CL0X 2ET6A 4HPXB 3HXUA 3QNMA 3SYNA 1QONA 3HBAA 3O7MA 4P80A 4HNRA 5AMXA 1MQSA 2CVQA 1YOVB 2C03A 1QLHA 1XJCA 2R6AA 3C3EA 1KSFX 3O1LA 2DLCX 2R6CA 2TMYA 2RKOA 2FSHA 4GEGA 3C6BA