5C51B

Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial dna polymerase gamma
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
418
structure length
363
Chain Sequence
b'ALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase subunit gamma-1
publication title Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial DNA polymerase gamma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 89
structure length 363
sequence length 418
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5c51B01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 5c51B02
4K87A 2QHVA 2PMEA 3FJPA 4H2SA 2E64A 3A5YA 4WI1A 2ARSA 1LYLA 1ASYA 1BBUA 3PCOB 5E3IA 1SERA 4YRNA 3OD1A 4XTVA 4TVYA 3EFSA 2DEQA 1QE0A 2ZR2A 2QHSA 4YRFA 3A7RA 2E65A 1ASZA 1BBWA 4G85A 1Z7NA 4P75A 2DXUA 4H2UA 1L0WA 1E1TA 3WQZA 1IL2A 4NCXA 3RL6A 2C7IA 3V7SA 3TEHB 3VQWA 2I4OA 4YCWA 2EWNA 1B7YB 1ADYA 4HWTA 1VQZA 3HXZA 4K88A 3V7RA 2ZIOA 2DTOA 1YB3A 4J15A 1RIQA 4PHCA 4KR3A 4KQEA 3L4GA 4CS4A 2PMFA 4BW9A 2Q5IA 4XU1A 2DZ9A 4XTZA 4XU0A 2ZCEA 4YRRA 4ZTUB 3HRKA 1EVLA 2DDZA 2CJAA 3NENA 1BIAA 3RF1A 4HWSA 3HY0A 4YRPA 2I4MA 2IY5A 2RHSA 2DKGA 1X2HA 4P3OA 1NNHA 1EFWA 1NYRA 4XTYA 4P73C 1ADJA 3A5ZA 4YRTA 3HXWA 3EFRA 2Q7GA 1N9WA 4ZTZB 2E10A 1EIYB 2C8MA 4YRCA 4CH4A 2ALYA 1USYA 1C0AA 4H2TA 1H4SA 4YPFA 1SRYA 2Q7HA 4EX5A 1HTTA 4XEMA 4H2WA 3A7UA 4TWAA 4H2XB 2ZT6A 4XU3A 3REUA 4Q15A 3BJUA 3A32A 4CH5A 4PG3A 3MEYA 3IKLA 2ZINA 3V8LA 4UPAA 4XTWA 3L2ZA 2E1HA 3HXXA 3CMQA 1B70A 3M4QA 2LW7A 1QF6A 4H2VA 3NELA 3A31A 2E41A 3RACA 3RIRA 1KMNA 2ZTGA 3L1AA 4P71C 1JJCB 2ZT7A 3I7FA 5C52B 1B76A 3HY1A 1G5HA 4UP7A 4TVAB 1NJ2A 1H4VB 2I4LA 1G51A 1HC7A 4K86A 1EVKA 4OLFA 4RQEA 3VQXA 4XTUA 5K1PA 1WQ7A 4Q6GA 4XU2A 1WYDA 1WNLA 4CS2A 2DU7A 1PYSB 3QTCA 3HFZB 3NETA 4HA8A 2AKWB 3L4GB 4YCVA 4TQDA 1E1OA 3P8TA 4HWOA 4YCUA 1SETA 1WQWA 2DXTA 3VQVA 2ODRD 4XTXA 3IKMB 2AMCA 4LNSA 2HNIA 2CIMA 3VQYA 3HFVA 2DZCA 4CH6A 2EJGA 3LSQA 1EOVA 4YRIA 3RKWA 3TEHA 3TEGA 3VBBA 3RKYA 5ELOA 3P8YA 4YRMA 3V8KA 4YRQA 1X01A 2FYKA 1NJ1A 4YREA 2ALYB 3UFGA 3QO8A 2XGTA 3R07A 4P74C 5C51B 2ZNJA 2ZNIA 2CJ9A 2RHQA 1YFRA 3QNEA 3UGTA 4P3NA 2DTIA 3IALA 3KFUA 1WU7A 1B8AA 4CS3A 4H02A 1KOGA 1X54A 2E5AA 4AH6A 4YYEA 1NJ8A 4YRLA 1V95A 3HRIA 4P72A 1NJ6A 1Z7MA 4BWAA 12ASA 2DQ0A 4P73A 5F5WA 2ARUA 4OP0A 2CJBA 3ERRA 2XTIA 3W3SA 4YRGA 1EIYA 3MF2A 11ASA 2EJFA 4P75C 3IG2A 4EO4A 1FYFA 2ZZFA 2I4NA 2ZT8A 4H2XA 3V8JA 2J3MA 3P8VA 3E9HA 4WJ3M 4P3PA 3M4PA 4TTVA 2ZR3A 2P0LA 5K1XA 4RMFA 2ZZEA 3E9IA 3DSQA 4UP9A 4TVWA 1E24A 3HXYA 4UP8A 2ZIMA 4DQ2A 1HXDA 4RQFA 1BIBA 1WLEA 4HWPA 3HXVA 3PCOA 4O2DA 3G1ZA 4WJ4A 4H2YA 3LSSA 4P71A 1E22A 2ODRC 1JJCA 2P5IA 3HTZA 3LC0A 2AMCB 4HVCA 1YFTA 2Q5HA 2DU5A 1W66A 3QO5A 4TVAA 4YRSA 4L87A 2ZXFA 3REXA 4YRKA 2ZZGA 3PZCA 4YROA 3RUXA 2G4CA 2ZGWA 1WPYA 3TUPA 2IY5B 2RHSB 1NYQA 2ZT5A 1SESA 1YGBA 1X2GA 1X56A 4TQFA 3ICAA 1PYSA 3HFZA 4WF2A 1B7YA 1X55A 2AKWA 2RHQB 5KNNA 2EL9A 4E51A 4ZIBA 5C53B 1USYC 4KR2A 2DQ3A 3RGLA 3UGQA 3BFMA 2QHTA 2DVEA 4RDXA 4DPGA 1NJ5A 3A74A 3A7AA 4HWRA 1YFSA 4P72C 2Q7EA 5ELNA 1KMMA 1B70B 4XEOA 3RKXA 1ATIA 3NEMA 3HXUA 3UH0A 4YRJA 2ARTA 3V7CA 1J5WA 4YP0A 4P74A 1GGMA 2EJ9A 2DJZA 2QHUA 1EQRA 1G5IA 2E3CA 4G84A 4CH3A 3QO7A 2DTHA 5HGQA 1H4QA 2CGHA 2EAYA 3MF1A 2J3LA 4YDQA 1H4TA 4X5OA
chains in the Genus database with same CATH superfamily
2QYOA 4YQEA 3ER8A 3K1TA 2W71A 1ZGZA 4R54A 2VSYA 1HFKA 2BI8A 2QD3A 1MC1A 4MR9B 3SHTA 1W85B 1SEVA 4FR0A 4WN9B 4PAWA 2IK8A 5HMMA 1PZNA 1ZD9A 2D2IA 2PQ0A 3LBYA 2QTZA 3FA2A 5EPEA 1QRAA 5HTOA 4B85A 4CR8A 3PUKA 1XQ9A 1H9AA 3N59A 4RIGA 1L7MA 5DEIA 1RI4A 1GG9A 4BEBA 3BCHA 3OU7A 3TZKA 2VSQA 3D4PA 3PCOB 1F38A 4TLEA 3OLQA 4DQUA 2Z9CA 1E69A 4J0DA 5T4EA 4D9GA 3J81A 1SG0A 1YACA 4X8HA 3PSAA 4IX9A 3ZYCA 3ILVA 2WD7A 2WB2A 1FY2A 1SIWA 5CXSA 3JQ8A 4AJIA 4C0WA 2EP5A 4KSYA 3GJ5A 1BCRB 1SD5A 1N77A 2NV2B 1BBWA 1Z3IX 1CNFA 2UZAA 4N8EA 5FWDA 2YRWA 2C3MA 3GP3A 2DXUA 2G9UA 2OOSA 2ZRPA 2IYYA 2WV7A 1DBVO 3B2NA 3H3JA 1K92A 3GJ4A 3TRJA 3LV8A 4NYIQ 1RXVA 1IL2A 2WWXA 4DJAA 3R6WA 1H6CA 1QGUB 1Y37A 3JD4A 2BLNA 3OD5A 4G5HA 4KGVA 4YCMA 3PLAE 4MUNA 3PQDA 3NYQA 4L5BA 2JK0A 5EKTA 4EG5A 1T24A 5AOBA 2F3UA 3UTCA 2BDTA 3UENA 3WGMA 3WRYA 3GCWA 4Q9NA 4QT0A 4ISCA 1QGDA 1IJBA 4JLVA 4G25A 4UASA 1BCSA 5C1BA 4PPNA 4HWTA 3IE2A 1E1CB 2YZKA 1YJXA 4FDMA 4P34A 1MNQA 4RU1A 1U0EA 4UZFA 1CDDA 1FFAA 4LJ8A 2OCYC 4YIKA 4J9UE 4JLUA 3QPWA 4XJTA 4CIVA 3WISA 3M4JA 1AHIA 3C45A 3E1KA 2QGNA 3NYIA 2WU4A 3VKUA 2PPLA 4AUNA 4P83A 3FHLA 1OF1A 1Y3IA 2AW5A 2OZKA 4FNOA 5KYUA 2DR2A 3VR0A 4F6LA 2HHAA 2ZJFA 3HN6A 2A3RA 1SXJC 3P45A 1G4UR 1NQTA 1P0PA 2G0NA 3HNPA 4C9BA 3O8QB 5LU8A 4WOKA 2YIVX 1E66A 2QVXX 1G5PA 1V1RB 3DD1A 3O7MA 5JPIA 3KSRA 3UK0A 4V0QA 1CUEA 3N2LA 4BE9A 3ONEA 3MRSA 1F4VA 1N33B 2VT6A 1KQNA 2RGBA 2V74B 1PT9A 2GZRA 4KLCA 5CB8A 1TK3A 3AZPA 2NUPB 1RBYA 2OP0A 1NV8A 3P9XA 4QOFA 5A0FA 2WHXA 3SN6A 1Y6QA 4FOPA 4LWZA 3DV0A 4D5EA 1JF8A 4RLSA 1W6UA 2AX4A 2P0AA 4NNPA 3GAZA 4Q66C 3WK9A 1DP4A 3S7ZA 2A7QA 1K6IA 1A4UA 4FN4A 1ZRMA 4G2NA 5CB6A 4DV1B 4H15A 5GY7A 5DOZA 4X61A 2J41A 3FWKA 5LBIA 4BX2A 4WNYA 3MERA 1X2HA 4FHEA 5EEHA 1XRMA 1T43A 4ZFNA 3CRMA 3DKIA 3CQ9A 3F3MA 4CGZA 2GR9A 2JF0A 9LDTA 3K2IA 3V7FA 1U5AA 4BXOA 1X8JA 5BV8A 3WZ2A 1KJYA 4OOEA 1KK1A 2FWRA 3K1JA 3QWAA 2JFZA 5ENVA 3WLPA 1L2TA 1W8IA 5BRAA 4DADA 3EZNA 2R1ZA 1MQSA 1RWWA 1JH8A 5LA6B 2G7ZA 2G8LA 1Z8HA 4L0QA 1I32A 4ZGGA 1PE0A 3A6PC 2AW3A 4Y1FA 3DHNA 2WJ4A 4KGZA 3CRRA 4FE3A 4EUSA 1XMIA 2IEYA 2OO3A 3IJ5A 2X2FA 2ZBGA 1JVSA 3JATB 4JZYA 1XJ0A 1NQWA 3OQ1A 3D7SA 4JROA 1NY5A 1VHWA 5JFGA 4M89A 5F64A 2A9VA 4C4RA 4QKQA 4JDPA 3F78A 2LCQA 3CEHA 4RFSA 4JC5A 4WRRA 3ZDDA 3WL5A 3ZYZA 4QATA 4ZHSA 5FJIA 1TA9A 2E18A 2R48A 3O38A 4LBVA 3PNVA 4B6QA 4F7WA 1V3UA 1X1DA 5K0SA 1RS0A 2I2CA 1TQ6A 5EUCA 4DGSA 2JGJA 2O1XA 1I7PA 2ZPAA 3IQZA 5KEIA 1C2TA 5IYZA 2PSDA 2AZTA 2HCBA 4RVHA 3RFFA 3STXA 3OQMA 2Y4OA 2VATA 2VHQA 4LK2A 5JMOA 2N42A 3H4IA 4FNMA 3BHMA 5INTA 3ND5A 1GEEA 1S4MA 5IYZF 4MLCA 4R8RA 5E2BA 3ADCA 2IOHA 1V0JA 1IK6A 1Z0FA 2MJLA 1NVMB 3DZHA 1CS0A 3HXXA 2J32A 1B70A 4LRWA 3RYFB 1II0A 4D45A 3PCXA 5AKKA 2CW5A 1X80A 4ACAA 1XXHB 4LVJA 4NZYA 1LDEA 4TKMA 1JEYB 3KXPA 4I5EA 4CMCA 3DZGA 4FYJA 4EEZA 4ZI7F 3DT9A 3RACA 1GDDA 4LVIA 2Q5EA 4Y6RA 3UKJA 2Q1SA 4HNQA 4ZA2A 1H94A 4YCSA 5AIBA 4HDKB 3ROQA 2D5BA 4KH0A 1WY5A 3TUIC 2Z56A 1B93A 3JQQA 1MTZA 3AHFA 4URUR 2GJ9A 4XIJA 1VLMA 3GK3A 4AC9A 3K0AA 5HYVA 3U7FB 3THSA 3V1TC 5REQB 2WV9A 4XCXA 5JUWA 5DW3A 3C8HA 3TPCA 3TSOA 3CF4G 1OJLA 4HTFB 3WO0A 4S05A 1L5HA 3C87A 1VB3A 1EHIA 1ZY2A 1RE1A 2QTNA 3ASUA 3H8WA 4TSKA 4F12A 2RHDA 3SM9A 3KZKA 2REQA 4ALNA 4BVKA 3TPZA 2XT0A 3NH9A 2XVZA 4MUXA 2ATEA 4MS1A 5CEJA 1ND6A 1XQYA 2HA0A 3M3HA 1BE1A 4HAIA 4AMVA 2EGGA 1N34B 5E6RB 1CF2O 1N8TA 1R6VA 2EFEB 1KEZA 3WIOA 3GEEA 2Q7DA 4JOQA 1YB5A 1S1CA 4RTJA 3ENZA 2C7RA 4IOLA 4EZIA 4MS3A 1U7HA 2DU7A 1HY3A 2C5SA 2L69A 1PEKE 2VNAA 3DO6A 4LIPD 3WGGA 4E30A 3N2ZB 5LXTA 4AF6A 2DZDA 2XZOA 1PGQA 4N5LA 3Q6IA 3B6EA 2RIRA 1JG6A 4KMOA 1WWKA 4YIHA 1G21A 1OT5A 1B0PA 2YDYA 3B89A 3LKVA 4IDHA 5LXTF 3E27A 3BERA 4EVSA 1S8OA 1FRQA 5AFSA 1XVIA 3GCDA 3C15C 2O48X 3IRVA 5JSUA 1ECLA 4MCJA 4JODA 3TJRA 4KN5A 3MCWA 4DA0A 4EYOA 5EIEA 3C8ZA 1ZVQA 5L7YA 2QHXA 4H59A 2PV7A 1E2UA 2HQSA 1JTVA 1EFUA 2QN7A 3BTSA 4PX3A 4WN3A 3EIEA 3HYNA 4TMVA 3BIXA 3AP1A 1B0UA 1JKIA 3QM1A 4R0VA 4Q4LA 5FX2A 3T06B 2J3JA 4A1OA 4UHEA 3RKRA 5LNK6 4E4RA 4WNIA 4RESA 1IZZA 2XTAA 3DVAA 3AHJA 3CU5A 4FI3C 1X70A 5IZCA 5DMHA 1TEZA 3N39C 2EERA 1L7OA 2VBIA 4N5DA 2ID4A 4YP7A 4PTZA 3ZZUA 2W2XA 2WE7A 7REQA 3KPJA 1C9JA 3CRW1 2R87A 3LH5A 3MZ0A 3WFIA 4IUDS 3OCVA 2P2SA 3DZ8A 5K0FA 3T6KA 2R1UA 3RKUA 5LMZA 5TMPA 5IS2A 1VPVA 3NHPA 1WXEA 3K1AB 5J5AA 3EFOB 2DLDA 5KAMA 3ZS9A 4C0QC 2OFWA 1FQWA 3IERA 1CE8A 2QL5A 4IDOA 3PUYA 1J2TA 4QBFA 1UJMA 3HU3A 4P74C 1YBAA 1NPTO 4EK9A 4B83A 1E99A 1ZLYA 1W19A 1LD3A 1WU8A 3D4NA 4EEKA 5HQ3A 1YFRA 1J0EA 4KVGA 5K7SA 1N6HA 4MGYR 4N9WA 1FFSA 1J5XA 1RLIA 1YJAA 2SCUB 2QRVB 3BJRA 5BV0A 4KV7A 4ZC1A 4ZDIA 4IV8A 1VMIA 1DJMA 1E7SA 4LY9A 5E6SA 3ROTA 4TUYA 1NXSA 5F7ZA 5HFNA 1V3TA 5B3JA 4GICA 2CGEA 5FUMA 2TS1A 4P08A 4TUYF 3F5DA 2ZK7A 1ZUNA 3MFYA 3Q87B 4QPPA 3VGJA 3I8XA 4B7UA 4U9UA 1L5FA 4AH6A 3EGIA 4DLUA 2ZUBA 1Y3BE 1FFDA 1U63A 1CIJA 1HT3A 1G3IA 4REMA 3EEOA 1UH5A 4ENUA 2X23A 1ZEJA 4LZNA 4MCIA 4NULA 1UKZA 1UXOA 3NRBA 1E3JA 4I8DA 3AQIA 1XALA 2XWBF 2ZBUA 3H9BA 3T41A 4CCAA 1T5OA 3MQZA 4WPGA 2V7QD 2Q62A 4X6YA 2IF0A 4D44A 1J2EA 2F59A 1XZLA 1KFEB 2ZRNA 3DV9A 3QVOA 5FI3A 4BNTA 4EG4A 2WFLB 3OCXA 5F76A 4RSHA 3OJWA 3IULA 4HRXA 3UY4A 4X62B 1ZGJA 4DQXA 1V1MA 1HDZA 5FQNA 4AY5A 3IMKA 4YMVA 3RROA 1B8NA 1PGPA 2CJPA 2DHQA 1FVHA 1GV0A 2IOQA 2RH8A 3HRHA 4FFWA 4ZT2A 3TMYA 2NU7A 2PUJA 4HGNA 1N2JA 4DQVA 5AK4A 2PE5A 3FMFA 2YRXA 2PIAA 4PG6A 1NJSA 2HDOA 2HFKA 2IPAB 3B1ZA 4JCCA 3LZ6A 2P30A 3W3AH 2Q1XA 1KY3A 1Z06A 2WA1A 3RK4A 4OB8A 1CEYA 3ZZMA 5ABPA 4V0SA 2IU6A 3FCSB 2EBWA 5TT1A 4P81A 1IWBB 2Q07A 2ZZFA 1MMFB 1RTKA 2BD0A 2WZBA 4KR9A 3RVNA 3ZW8A 5ISMA 1K89A 2WT4A 3AIIA 1UOPA 3AM1A 1CIVA 3QKIA 1MPXA 1RBZA 2IU3A 3M4PA 1OPXA 3IRUA 2PUBA 1Y1RA 1ORTA 2FQQA 3R24A 1KI6B 4HRYA 5DNAA 3ZCQA 3WJ2A 4JP8A 2HNKA 4OGFA 4J90A 4KVAA 3RGWS 3EXEB 1E8MA 1FRVA 2C1EA 2Q3BA 2VTVA 3Q7PA 2R1VA 1YUNA 2OEPA 5DGCA 5L7WA 2ASVA 5KVAA 2Q4OA 4NKRA 2AZXA 5AUPB 1ZHFA 2JAWA 2FZWA 1QIIA 2CBXA 3C1AA 4HBGA 1U0NA 4QFDA 3OZAA 3OPMA 2PSEA 1QBGA 1FTSA 2QV7A 1QXSA 3B1YA 1C4KA 4X9XA 5H68A 1E5XA 4MJ3A 5EERA 3RSOA 3U9SA 1U3FA 4D9BA 4A15A 4CIDA 2XCIA 1ZJYA 4G5YA 3GFSA 1IOZA 3K16A 4NYJR 4DCOA 2C5GA 4ESOA 1K3TA 1E22A 5KDOA 1Z2CA 1PSWA 5AKGA 1Q6YA 1QNLA 2CNDA 3QFCA 1GO2A 1MU0A 5JYEA 1HDGO 4BFLA 2BWJA 2P69A 3COYA 5IJ0A 3AETA 4WH0A 1F8GA 2FW9A 2MOKA 2Q1WA 3HU5A 1ZD4A 5EZYA 5FUVA 4JGBA 4S24A 2CK3A 1LY1A 3NTVA 2H29A 5FB3A 3CLSC 3O4GA 3SDBA 3TR6A 3BHJA 2X6TA 3ZJ4A 5A5FA 5ITVA 5EZYF 3BK1A 4PPFA 2OBYA 1IL0A 1TADA 5IBRA 4DXAA 5LP6C 1ILWA 4IDFA 3H2KA 4OP1A 1TMKA 1J1UA 2X0IA 3HEBA 4LY6A 4XWAA 2ZJ3A 3TZQA 1L4MA 2WPDD 2GLXA 1UKEA 1NW3A 1JS1X 2BMEA 1DPFA 2R84A 1SU6A 3HP4A 5JWHA 1RRFA 3JQDA 4BNUA 2GF9A 1NG1A 3R1IA 1TVMA 5F51A 4IJQA 2VH2A 3WL4A 1M1NB 1RYBA 2G40A 2PGXA 5HF9A 3U49A 3CEPB 2A58A 2O07A 2EKQA 3LX5A 4PGHA 1BN6A 5EHIA 3MS4A 1T10A 4OQ4A 1YJQA 2EQAA 5BR1A 2GO7A 2H4XA 3FCAA 3GRAA 3HFSA 3B6ZA 4RGYA 2OZEA 4UATA 4ALJA 1USYC 4RHEA 4U4AA 3ID6C 1M7HA 1V4VA 4IM7A 4N3NA 4UMEA 5ESRA 6ADHA 2FSVC 1DJQA 1XWWA 4KWHA 4NESA 4CWAA 3OAAA 5KKCA 3GYBA 3PXCX 1CUHA 5D5HA 1C8BA 3UJPA 4MUJA 1T1GA 2AOWA 5LL6P 2DWOA 3TB6A 4BEVA 1PV4A 2ZBVA 5AVQA 1F0YA 2Q5CA 3FI9A 1TUEA 4DPGA 2JKYA 4GNKA 2WYIA 5C37A 2CB9A 2G04A 2JVIA 1YRLA 2PR2A 4FGZA 4OFXA 3T95A 4LMPA 3K70C 1RRMA 2A8YA 3ASZA 1KFBB 2VDWB 4X91A 4E7OA 2PY6A 3S2IA 2YJNA 3MGGA 3BSFA 1JT2A 1PW5A 2A8EA 2XYHA 3SSOA 1QFJA 1M1YE 1TD9A 1O94A 1S2MA 1ZM4A 2I6UA 4RHXA 3GPLA 3HB0A 4QGSA 3PZRA 5GVRA 3HCRA 1WAMA 3EDOA 2VUIB 4G0OA 5AXBA 3DOJA 4U6SA 1J5WA 4L57A 2WJPA 4AF8A 2MT9A 1J49A 1JXAA 1F4LA 2BBOA 2NLOA 2QHUA 4N6OA 3LA8A 4NH0A 4PGFA 2B69A 3U1BA 3ECCA 4E09A 3BXXA 4G84A 4I3GA 1PKXA 4P54A 3A9SA 1GG2A 3LQFA 3IIEA 3QNWA 4HLCA 4QSMA 4JWKA 1QIDA 5ICMA 2FPPA 3TIXB 3U4DA 1PN3A 2PHZA 2Q50A 3E7PA 3K94A 1Q7RA 4DDWA 3SVLA 3REOA 3RV4A 4FIZA 1U3VA 3DCNA 4N8SA 3Q41A 5ELLA 4YAJA 5KYXA 1AXEA 1N7HA 4PZEA 1SB8A 2RHOA 1YR7A 1UPBA 4NBNA 4BZWA 2IBMA 4FINA 1AKQA 5K20A 4MQLA 2HHHB 2IHJA 5IH7A 1HORA 2IDKA 5DISB 2AA3A 4TYNA 2C3YA 2QZZA 2R6R1 3RBXA 3ZCRA 2PGLA 3TVYA 1U2ZA 4DLVA 1WCXA 5KOHB 1V2HE 3NHMA 5TXGA 5AM5A 2ERYA 1RPJA 4O08A 4RCVA 3EFSA 1WEHA 1C1DA 2IXTA 3I73A 2DERA 2M98A 4DLPA 4LXHA 3GLVA 2IYUA 2JEZA 3F71A 5K3OA 3OZXA 4LOKA 2NQ8A 3O9MA 5IARA 5H3CA 1JHYA 3FJ1A 3D9QX 4YS6A 4CZ2A 2NZWA 2DTXA 4V1CI 4F3NA 5L8VA 2C20A 4G85A 1BNCA 4G8DA 1NU8A 1NFQA 4A23A 3O3CA 4WKNA 1JDUA 1E2FA 3QPBA 2ZIXB 4MR8B 3IUNA 4G26A 5T4HA 3VR2D 1TO6A 3TUZC 2C1ZA 1UL1X 3R20A 1EVJA 1BXRB 1JYFA 1Q16A 3RK1A 3E0QA 1CP2A 4K03A 1SCAA 1E2NA 3WQQA 2I87A 5I4IA 1FSGA 5HE9A 3X1YA 2LR0A 1UBGA 1QDUA 3EPLA 5HP4A 3K6SB 1GZ6A 1USUA 1M10A 1Z39A 3CZ5A 2NYRA 2F43B 1D4FA 2JFVA 4NZMA 3L6DA 4MVJA 2MYUA 2NTEA 3IXLA 1S01A 2PKYX 3IAM1 4R7GA 4F21A 1VQZA 2DH6A 3T9EA 3GRVA 2XVXA 4MVJF 5HUJA 4E3WA 4ARZB 3UHJA 5K4GA 2FMXA 4IIJB 1VZ2A 1GPKA 1WZUA 1JJBA 1MQ8B 3EAGA 4U7HA 1KZHA 3L4GA 4CS4A 2X8JA 3PNBA 4QDOA 4RQBA 4BB6A 4MS4A 2QTTA 3LK6A 5F1PA 3SP1A 3S2GA 4CKEB 3DXFA 3F9CA 3MILA 5HMLA 2CVQA 4WZAA 2B5OA 1A5ZA 1UDBA 1ZGHA 4UOEA 5K0JA 3GAMA 5GJWC 1DAOA 1U8ZA 4YRDA 4CTKA 4RTLA 2BEWA 5IMSA 3MT8A 5AXAA 4ERNA 4OKSA 3B60A 3MTBA 3FNBA 3KJNA 4JQOA 4XYGA 5BRNA 2JFHA 4AJPA 3VR6A 3W0LB 1ZA1A 3GMTA 3RSGA 1ZWKA 1XPOA 4XOIA 4YP5A 5KOJB 3MLBA 2H5IA 4XWWA 1BIAA 4DIEA 3RREA 1C3XA 3HUDA 3JYLA 1IBLB 2DKGA 5ARCA 1SOMA 3LG2A 3KOWA 2G5CA 3ETGA 2C9CA 3I1JA 3G9ZA 1YS1X 4ZCMA 4WXHA 2X9GA 4B80A 1LBEA 3GB9A 2WJGA 5CX1A 1ZXLA 4PSAA 3OLWA 2R6AA 4MEAA 1TFUA 1SIOA 3EDYA 3G5AA 5B57C 1FNSA 3EVTA 2IDJA 4K1XA 2VJMA 1RYEA 2QG6A 1SU8A 3CEAA 1TA4A 1DQZA 1R00A 3BE5A 3CUKA 1EX9A 1P72A 2E9SA 3KQVA 4M8SA 1ICEA 3JD3A 4TS9A 4LMBA 5CDUA 2CZGA 2V7PA 4AW9A 1W4ZA 1T1EA 3DCJA 3T7CA 2QG9A 3LQKA 2F4NA 2I78A 3RU7A 1QYIA 4BNYA 4C1NA 2ZITA 2VR1A 3A1TA 3KYCA 2ODBA 4LXGA 4Z1OA 1W5TA 2IYZA 2ZSUA 2GCOA 4GVXA 4MARA 4QOEA 1TM2A 1A27A 1MX9A 2ZIZA 3NWEA 3Q7RA 4Y1RA 2XX3A 3E0XA 2V54A 3QUTA 4TWRA 4CYMA 1HXHA 3K30A 4H6PA 1CW2B 4WGGA 4US0R 2VZ8A 3E4CA 2OTCA 3BIWA 3NCHA 2Q3HA 3UJCA 3UQYS 1MG0A 1PJSA 3JALA 1N6IA 3KQWA 4N5HX 3S7TA 2EFHB 2JJMA 1CXZA 3QFHA 4CU2A 2BGIA 4MYUA 1PWZA 1GCIA 2EZ4A 2IXEA 5EZ6B 1LNSA 4MB2A 5BN4A 4RTKA 2ZINA 1HYEA 3LF2A 4ANFA 2ORYA 5AK0A 3OJ0A 5L6MB 3KCNA 2H1OA 4DLSA 2VDKB 2K87A 1T36B 2QN2A 3GGSA 4G65A 4RSGA 5B1SA 5HKLA 1MO5A 3TDKA 4LF8B 3L04A 4W6QA 4YXWD 4I19A 2APJA 4Y9SA 5KNBA 4H2VA 2PMCA 4O0LA 5CFRA 2C9OA 5BT9A 5K8JB 3FCUB 3GRPA 5TS3A 3P4UA 4DXDA 4M7RA 1A1VA 1U6IA 4AZ3A 2D5IA 4QNMA 5CIYA 3G2JA 4MJXA 3BWXA 4IICA 5U4QA 2XUHA 3O03A 3I7FA 2AQKA 1GNLA 4YCCA 3A04A 4IDDA 3WFZA 4X00A 3Q0IA 3GCGA 4WBSA 1XU9A 3NC4A 3GJ8A 1PZMA 1G5HA 2P7HA 3UT5A 4HVTA 3WK6A 3G2NA 5IKEA 4XR4A 16PKA 2Z58A 4CEJA 5JJIA 4ONEA 3UWPA 1QUFA 1WLYA 3UANA 3QW4B 1TU3A 3CJTA 4C4ZA 1G51A 4YP9A 2JH8A 3W9SA 4C3ZA 3GGJA 5BSGA 3WWYA 4JOBA 1NVXQ 2IHTA 4LTNA 2VHZA 3MCVA 4EY7A 1X8KA 2AYZA 3JYNA 2B1QA 4BZXA 2B6HA 4LYYA 4ZO8A 4XR9A 4Y9TA 3OU6A 1T6NA 3BPSA 1ORHA 5EE3A 2R8BA 4GE3A 1XKTA 3FSJX 5TC4A 1I2BA 2HBQA 2BFEB 3ON5A 2WM3A 2J3HA 3UMRA 9LDBA 3WAJA 4JUAA 3MHTA 1U4NA 1YB2A 5EHXA 5LQKA 2LIPA 3WFJA 3QE4A 1JWAB 1BJKA 5C4MA 1VP9A 4HD8A 2OC4A 1K9SA 2JI8A 3HVIA 2P77A 3U2QA 1KVTA 1U7XA 1G8PA 4RO0A 1YBMA 4AZ0B 4QAQA 3D4OA 4XJVA 4ZAXA 1A9RA 3MWJA 3KQSA 1A1SA 5D01A 1AY0A 2NSDA 2V7WA 3LX6A 1SCUB 5CCDA 2W6NA 4E5UA 4HEJA 3PE4A 4MW9A 5DNVA 3UBMA 3CZPA 3ZWMA 1DL5A 3NCTA 2V4MA 5J4KA 2OQIA 1DELA 1J0CA 2FWJA 4D9JA 1U3DA 2F17A 3NJ8A 5CURA 1O77A 2GJSA 3PQ7A 3L1HA 3O3MB 4K6HA 4JBXA 2E82A 4QM6A 5JS7A 3KLNA 3JVDA 2A6PA 1DUVG 1YHNA 3EEFA 1CRWG 3M6AA 1GV1A 2O6LA 1I0IA 4PQFA 3KQOA 4Q1FA 3EX7C 1NVAA 1E2PA 4CIAA 2BCGY 1PQPA 3JTMA 5T8KC 4QM7A 2W6IA 4RE6A 3FYDA 4N6NA 5E8RA 1X94A 2E49A 2HSJA 2WJIA 3UT0A 1RVV1 3EPPA 1YAJA 1U0HC 3OU2A 1CF9A 1NAHA 3BZUA 4FHCA 4BLQA 4OX9B 2B82A 2BEVB 5TGDA 3RJTA 3QO8A 1CULC 1YL6A 2VP9A 3E8MA 1SUIA 4PFKA 3IODA 1CY7A 1EFPA 4UBOA 1DC8A 3PB3A 4UCFA 3R7DA 1D2AA 1EQ2A 2J46A 5HQJA 4UHBA 1EXVA 2FWPA 1D7AA 3FR8A 4N7BA 2LDBA 4LECA 4PE5B 4X20A 1SU4A 5TJ9A 2RG7A 3M5WA 4I46A 3ENQA 3G8AA 4AJ1A 3M1AA 4LFBB 3OWOA 1WCYA 1T35A 4WKPA 4E7PA 1OH6A 2YJ5A 1EZ4A 3W5JA 3MIIA 1FSPA 3U4QB 2BZGA 4ZTBA 3WHKA 4DR2B 3C5WP 4GM1A 3AI7A 3ZU3A 4H31A 2X5JO 1T6YA 3RAGA 2B7CA 4UTNA 1K88A 5ILGA 4GX0A 1XCMA 4DDUA 4FYMA 1KH1A 4I1UA 4GH5A 2NVBA 3IAHA 4KFTA 4HDNB 1NP3A 3BG5A 4YRLA 2OXCA 4GM0A 4YAWA 4QTUB 1JFLA 4X54A 1BE6A 1GKIA 4H7JA 4N54A 2C7PA 1L7NA 1ZISA 3ROKA 2DTDA 2Q9UA 5LUBA 5A4FS 4LMRA 1TRHA 5H7XA 4NDZA 5D3MA 5A7FA 2G8NA 12ASA 1U11A 1Q2XA 3WV5A 4KMRA 5P21A 1XTTA 1CHNA 1LJUA 1NRXA 4OP0A 4EG3A 1FJHA 4MRMB 5AM2A 4IG4A 4M1EA 3PA8A 1T34A 3CLHA 1X6VA 3E84A 3FRJA 1U5BB 3VHXB 3CLRC 3LQYA 1ZCAA 2PEYA 2VZ0A 1QG6A 1N0IA 5F23A 2EAUA 4CMBA 1C7JA 2XJ4A 5A4IS 2FEKA 1HGXA 1M6WA 1D0IA 1LPAB 3PGVA 1E2QA 5IKPA 4DWOA 5JCZA 1VSUA 2F64A 4CHTA 4E5DA 3EGDB 2GBGA 3GJ6A 1UP7A 3L7AA 3V6LA 4BO8A 4C0JA 1L5WA 2CYBA 4MLDA 4GZ5A 4PCLA 3RLIA 1IB6A 5HZHA 3EEIA 5FBWB 3PXDA 5FTMA 4JD5A 3UF0A 5EG5A 1VLJA 1WA5A 1HDYA 3DO8A 1I1QB 2Z8ZA 1E1NA 5AM1A 2R7NA 3BJIC 2NZ2A 5BV7A 4FMDF 3NQ41 4J16C 3M5CA 1OLUA 2YNMC 2RD2A 2DWCA 3G3EA 3O4FA 5F9MA 2MSKA 2I3AA 4MQFA 3HCPA 2IY7A 3P0FA 2TMYA 4AFNA 2WFZA 3OTQA 1U2DA 4TVWA 3GARA 3K6KA 1EXNA 4BKQA 1DHTA 3IKJA 1JR6A 3V7WA 1TM4E 2J45A 4C0AC 4BGDA 4C88A 2H7YA 1TI7A 1MC5A 5K4AA 4PCAA 1Q22A 4BP3A 1H6BA 4WZBA 2W42A 2EJVA 4NE2A 3L93A 4UJ5A 2O3QA 2VPQA 3QOFA 1BWRA 4IBOA 2M9MA 4NCKA 4F3CA 3BIFA 3PDWA 1OYOA 2VYQA 2NU6A 2AMCB 1Z73A 4BMNA 3FTCA 1B41A 1ZGBA 3DAOA 3H8SA 4Y1EA 1FB5A 1T4CA 4D9EA 1DEHA 1Y1SA 1WCWA 4AMYA 4LV6A 1QC5B 1XKLA 4DLBA 4C7MA 1E1LA 1QPBA 1RT9A 4JEMA 4WD3A 2G1JA 3RGGA 3Q7TA 2G5GX 3S0JA 1XYGA 2CLEB 1WXDA 1FNDA 1HK7A 1RWKA 5IANA 8OHMA 2PZ8A 2A35A 2HPVA 4HB4A 4E21A 2CMDA 3RUXA 1JU3A 1Y33E 3CNEA 3LVRE 1WMFA 4G0ZA 1H1DA 2B37A 2MTBA 4LOHA 3B51X 5B7QA 1Y6GA 3R9XA 1OZAA 2V97A 5WRFA 1CEXA 2VHXA 2GX6A 3VI4B 1VLHA 4M86A 4N5IX 3CE9A 3I3SR 5JROA 2IOFK 1X1TA 3HBAA 5AIAA 1XVAA 2D2XA 1ORWA 3PX7A 4Q7KA 2NIPA 1PYSA 3UA4A 2O3RA 4IVQA 3R3YA 3INNA 3ZZ0A 4B3HA 4A6XA 5JOQA 5I9IA 1AXGA 1QAOA 4QEKA 3UGJA 1QGED 4F9GA 4Y98A 2IV2X 5KNNA 5IDXA 4POOA 4B46A 3RC9A 4KPUB 4F9TA 4EB3A 2A9FA 2GT1A 3JVUA 3GLFB 1EPUA 5TPZA 3W6OA 3GJYA 2ZPUA 1C9YA 4RZSA 3EUFA 3DVLA 4FLEA 2HCJB 5F2KA 3WHIA 2HH9A 4CMKA 3C3MA 1N9KA 4R6XA 5IFLA 1X1SA 3HXLA 4U3JA 2FH5B 2NU8B 2X86A 1ZI8A 2ZGVA 1G8MA 3BZBA 1XL0A 1HH4A 3KOMA 3BFMA 2P2DA 4W5JA 4ME6A 3ZQKA 5A6VA 1RDFA 4IKEA 4LOAA 3D6JA 3EH1A 4NJMB 2MYNA 4W5HA 1IVYA 5HBGA 4ESVA 1YZUA 5K6RA 3O93A 1TZMA 2AN5A 5I7RA 2F9LA 1TUBB 2XNSA 1RACA 4QOGA 3KS9A 1JKJB 1RC1A 3ANYB 3S27A 3I5MA 1E60A 1LNZA 1L5KA 1EM8A 1X42A 4IIYA 1BHJA 4UEQA 3CUVA 3UMGA 5BV2P 5KQMA 1MIOA 4WLEA 4BOYA 4G1EB 1QQ6A 3V1LA 2CUZA 8LDHA 3MWEA 1ATIA 2DFPA 1PS8A 3D7KA 3IQGX 2AE2A 1L8QA 1S89A 5I5EA 1K5DA 2IXBA 3OE7A 5DHRA 1Z83A 3I9KA 1Y7HA 3VFDA 2D2FA 3CVJA 3PX3A 1I4WA 4TN1A 5JO9A 2NUBA 2XGGA 3FW1A 2X6QA 4IH1A 4R1SA 4UHJA 4ZVKA 4EB0A 2XXAA 1T8WA 3PFWO 1G9TA 4ZQEA 1PGJA 2HMWA 1I1HA 2QL9A 4G63A 3A1NA 4IQGA 4L78A 3TGLA 2IX9A 5JI2E 2ZUWA 1FNNA 3LP5A 5HGQA 4FYYA 5I7EA 4PVCA 1VE3A 4Q12A 2BP7B 2EAYA 4Y2YA 3SQOA 2GFIA 2FRXA 4R9UC 4BN0A 2J0QA 4IIXA 2OV6A 2VDUE 3AFHA 3BQMB 4I55A 4AKSA 1TJNA 3GHHA 2WAXA 1SBTA 2BHSA 3ZVKA 1GY8A 2JFPA 1G8FA 2CLLB 2WUWE 3PDHA 2I1VB 4I55F 4NVRA 1O4VA 3RBAA 2B8WA 3T38A 5LQUA 2H07A 2WU8A 3SF8A 5AWFC 2IPLA 4H2SA 2J4DA 3E9RA 3U7GA 3K53A 4KE8A 2IEAA 2JK1A 2W4IA 3Q3IA 4MKRA 4AICA 4HB3A 3C1OA 2O52A 3CCFA 3DEHA 3VYTB 1E7WA 3FXAA 1MGPA 3IAUA 2OPHA 2JAQA 3HXQA 2GEJA 4DAOA 3AGQA 2OD7A 4MI3A 4OFBA 1W4BA 4ZI5A 1F2UA 4ND5A 1QHYA 2PZKA 4X94A 3RVKA 3WIVA 3HZHA 2IEIA 4Z3KA 1DAFA 1A9ZA 1AS0A 3AR9A 3QKUA 5K3FB 4A2CA 3AG5A 5JNSA 3AHEA 4MA4A 2YYYA 1EDBA 2DT5A 4MV1A 2X0FA 4F60A 2E65A 1CJBA 3UWSA 4QXPA 4R1PA 4GECA 3UMSA 2C2ZA 5I47A 1PQWA 2Z6AA 1EA5A 3ZCSA 4H2UA 1PJCA 2W2QA 3Q3EA 4PC7A 3RVLA 4D8XA 1ZNZA 2OHHA 4L2IA 5AI9A 5LZ7A 4TL9A 4RMHA 5FF9A 1OBCA 2FDXA 3R09A 5HK8A 3I12A 2CK3D 4X64B 3T3HA 1FQKA 4LCEA 1ISPA 2JHPA 3STWA 1AQLA 3IAFA 1MOSA 1E2HA 1H9BA 4FCVA 2FPWA 1W52X 3W3AA 2PS9A 2P6UA 4Y7CA 4F6CA 1NSTA 2BEKA 3CXUA 3CF4A 4CN9A 1DXQA 1B7GO 2NN3C 4JX8A 3SYLA 1D1SA 2GZAA 5KUTA 4LDPA 1W49A 4H2DA 4NBVA 5CT4A 4XQEA 4IXMA 2VBCA 1DOAA 4L28A 3CLVA 4PLYA 4ZYXA 3FPGA 2GAOA 4V0RA 2GPNA 3TDMA 1U94A 2Z2ZA 4QD3A 4CM4B 3ZBPA 4CXMA 1DJOA 1JDTA 1YCDA 5CBPB 3CR8A 1SY7A 2NW6A 2HLPA 4V24A 1CQJB 3ESAA 4FGLA 1ZBDA 4D1YA 1NNI1 1XQ6A 1U6JA 1QAMA 2W6MA 4X3CA 2MIIA 2V58A 5H1YA 1KY5A 1SHKA 3MLEA 1H0SA 3QBJA 5JBQA 1FXWA 1XF1A 3L1UA 4RHUA 4ZK6A 1I36A 1NAIA 4RL4A 3K96A 3OAAD 3PDCA 4RQUA 4ZT5A 4MUIA 4OV6B 3VC1A 1WMAA 2ZI4A 5IT9A 1FXWF 1M0TA 3FNHA 3I9NA 1ZN8A 4DCNA 3HM9A 4LJKA 2LUOA 4MLPA 1SN7A 2CJAA 1ECGA 1E1DA 2AJDA 2AZ4A 3NATA 3PLNA 4HQRA 1B16A 4N0PA 4R2LA 4WV3A 3VOBA 3VU1A 4E32A 4EB6B 5HKAA 3NDBB 2VHJA 4O2AA 3PCRB 3KR0A 1DTSA 1U8TA 4XYBA 1FA9A 4GKJB 1EUCA 1RQ7A 2I2AA 3GFQA 4U7WA 1UOEA 3FTNA 1K8QA 1DPGA 2IITA 3CWCA 3HBNA 3LUFA 4RD6A 4O2AF 4JHLA 4PO9A 4B7AA 1DCFA 1KVQA 3C24A 3R3VA 1UXJA 3HLYA 5DNCA 4Z53A 2CHVA 4YRBA 5IF3A 1Q0ZA 2ZWIA 5CG1A 5G02A 2QTLA 1PP4A 2QM7A 4BC0A 3UA3A 5ICFA 1O94D 3KFVA 4MWEA 2A7XA 2I2DA 1ZM2A 4UNQA 5G0VA 1SCQA 3IUQA 4YB8A 4URXR 1TOAA 2E10A 1W2WB 5LZ9A 2C8MA 2VNHA 2R6CA 1ZR4A 2UZIR 4QLAA 4TRMA 4CH4A 1I4LD 1IJFA 1DTWA 1ST2A 2DFVA 3THOA 4C6TA 3QEMA 4A2QA 4RD0A 1W4LA 3AG6A 1DADA 4YPFA 2Z95A 4L95C 5F2OA 2AT1A 1C9DB 4MRVA 4HVAA 1JHDA 4FZVA 1N2OA 1DO0A 1Y7LA 5ALZA 5LOVA 4KQWA 1HLFA 3LLUA 5EP4A 2QRKA 4OHZA 1QOPB 4RVSA 3E81A 3EGOA 3FH0A 3C5CA 2UVPA 5LOVF 3UHPA 3GX1A 1G2OA 1X15A 5TF0A 5EP1A 1P44A 1JUDA 1GYQA 1Z8NA 3P0RA 2X5NA 4KBGA 5DBHX 3DMDA 3ZDXB 2B35A 4FS3A 4BASA 4RE5A 4LWPA 4E88A 1PUXA 5EJ7A 2V3WA 2O8BA 3V8LA 2AQIA 3D5TA 4BDTA 3FFAA 3AUXA 2CJFA 4M4SA 4XPZA 2X58A 3UXMA 3CV3A 3RCBA 3VJMA 5KWJA 3AF6A 3SZRA 1ZIPA 1EVIA 3HJFA 4AN0A 2B25A 3FCOA 3WWOA 1MJFA 4MZDA 4EPRA 1SHJA 2ZTUA 1TPYA 4J1QA 1C0PA 3RIRA 2CUTA 3C98A 1GIAA 4EFLA 1V26A 5ED0A 4AUMA 5A3JA 2G06A 2JAOA 3F7OA 4F4JA 1N3LA 3QTBA 3X3HA 2PS3A 3KP1A 5CK5A 3FE2A 2P8SA 1J07A 1KNQA 2IHVA 4XM1A 3RUIA 3LXRA 1D0VA 1TCUA 1QZXA 3ASYA 4XUCA 3HY1A 2B30A 5IDWA 3NFYA 5KZMB 4EPWA 1E1MA 1P1BA 3TIVA 1R8QA 3R3ZA 4TZ0A 1NJ2A 5TPWA 3ZV6A 2HWKA 4DIDA 3I6BA 4P0TA 2I4LA 4Q47A 4YJGB 2HNBA 3PEYA 3UJ8A 1N1GA 4AY2A 2HZBA 4K86A 3KYBA 4WOJA 1EVKA 4ZPXA 5TQVA 4HV4A 4RULA 4OHKA 3S6JA 4XIIA 5C7LO 4FEYA 5LQRA 1GFWA 1KEPA 3VJRA 2VEOA 3OETA 2VP3A 2NVWA 1JHZA 3Q15C 3ESXA 1QCDA 3S55A 5CD1A 4PR3A 2NYAA 2I55A 1T9GS 4GP9A 3R8FA 4QUAA 3OZVA 1KI4A 1CS4C 1QR2A 1A69A 2QPAA 4O1HA 5FUYA 3TQRA 5ITSA 4HOYA 2AKWB 1WW3A 3KEGA 1KEUA 2ZSKA 3OQIA 4MVJD 3JQAA 2CLOB 1C9MA 3ESYA 3HUTA 4ZDKA 2FSPA 2I7CA 1K86A 5EIOA 2XUJA 4JYAB 3HCBA 4BJ1A 5LKAA 2EZ8A 1ZUD1 1A5SB 3CBGA 3KYDA 2AEJA 2O2HA 5HF8A 2CDAA 3L3BA 2RBEA 2CHEA 4K81B 1Q7TA 3R7SA 4B3DA 5MF6A 1YA6A 3N87A 4RGVA 1XNQB 2J9RA 4HG2A 4KQ2A 1AF7A 2DXTA 1IVNA 2ZYGA 5CJJA 1JNXX 2FPMA 3NBQA 3NDPA 5J4HA 2NWQA 4LNSA 2AC4A 2OO5C 4HEQA 1EJBA 5ES4B 1EG2A 2CDBA 2QOEA 4PAOA 7AT1A 1LPBB 3LSQA 1XLWA 2O2SA 2Y0CA 3AZOA 1KPHA 1TYCA 2QR5A 2R9VA 4UAJA 4A5OA 4EA8A 4ZYUA 3KQUA 3AKCA 2ZQYA 1XZIA 3FLEA 4FYHA 3VR6D 1NKTA 3HV0A 1LJ8A 3TW4A 1EK5A 3RABA 3C3PA 3P8YA 3MMXA 3ZGNA 4N41A 4G3XA 1IBCA 4N7JA 2QD1A 4TS1A 4OY3A 1E2DA 4GWGA 3T15A 2R8ZA 2AC7A 4H3VA 3DONA 1MJGM 1OGYA 2ZI7A 1G5FA 3E7DA 4TWBA 1LLCA 4HYQA 4ZI2A 1WF3A 3SOPA 5JCPA 4W9MC 5KCMA 1NULA 3C3BA 4M7PA 4F9EA 1WPGA 2CV1A 1RJGA 4TT3A 1BE8A 2ZI9A 3D3EA 2KE5A 2QN3A 1Y42X 3FFTA 1X9GA 2UYCA 3AEKA 5IAOA 1XZCA 3ROGA 2XOEA 2XCTB 1VSTA 3DVRX 4LI0A 3RTAA 1J2RA 2VHYA 3EPRA 1HE4A 1JPNA 2IYXA 3L8CA 4MJLA 5K05A 2X8AA 2AC2A 3D6NB 2IP4A 3LVFO 5H0IA 5JZOA 2FW8A 1TZ2A 1MFZA 3HU1A 4B2YA 3GCXA 1WMSA 3VYRB 3ORYA 5JTUA 5CLQA 2R1TB 1HE5A 4B7XA 3C14C 2WB4A 3M49A 2QPOA 5UKDA 1WU7A 2SICE 5C18A 3ZCUA 1U7WA 2R6ZA 3B1VA 2QSJA 4UOQA 1EI9A 4PANA 4RC9A 4BMCA 2PT5A 4Q3EA 4LN1A 3RHSA 2RKWA 2ZR0A 4XD2A 3KHSA 1NJ8A 3TWOA 2ZTHA 3QHQA 5ESDA 4F5DA 2RIPA 4TKZA 4GVPA 3V8BA 1E5LA 4C4AA 2VP0A 1V8PA 5IFKA 3K92A 2OCGA 3F4LA 2FK8A 1J0XO 5ILOA 4YT4A 4QLOA 1HE8B 1TQ4A 2ZSBA 4BRWA 1CJCA 1GDHA 3MOGA 3SDZA 5L45A 5MGNA 1YB7A 3QY9A 2VS1A 4NAHA 4QELA 2PJZA 1QGYA 1OWMA 1JE0A 1X1RA 2FZKA 2ZB3A 3BB4A 2O14A 3IPRA 4PXYA 4RY0A 5BO5A 3VR4H 4CF4A 2HK7A 5CT6A 3DHVA 2Q2QA 2PO5A 1BDJA 2IE0A 4M54A 5KNBD 1IBKB 1R0RE 3V9PA 4R1QA 4HSEA 1XD2B 5MFPA 5FOXA 3N6VA 1TAUA 4GC5A 3HJCA 4ZZ0A 4AI6A 2I7DA 5DFAA 3EC2A 4TYMA 1MCZA 1I6LA 1I4EB 3A06A 5AKYA 3G2MA 3BULA 4FX5A 5EKDA 4RTSA 2WJHA 4ND8A 3U0BA 4RTRA 4R1OA 3TXXA 1IXRC 2ZT8A 1SRRA 3BXHA 3L4JA 4ZVNA 3AU9A 2UZ1A 2CCKA 4KZKA 4WJ3M 1P3DA 2PLWA 3GJTA 2LXNA 1SBHA 2JGIA 2ZR3A 1JDNA 2R8YA 3MS7A 2P0LA 1J8QA 1Q74A 3SHVA 3WIEA 3ZGOA 4FKBA 4UE2A 4O3FA 2WHPB 4CQJA 3KQKA 3W8EA 2IC5A 2P6PA 1L9XA 2UDPA 2VG8A 2XMPA 4R5HA 1FOEB 2BFDB 1N6NA 1T0BA 3A6KA 4PHHA 4R2XA 3UM9A 1JFVA 2ZS7A 2CBGA 5DXFA 2FN9A 4B40A 5A6SA 1YZGA 4KSBA 3V8RA 4C06A 4MIKA 4WXRA 3UUFA 1E9CA 4ZHQB 1H05A 3NP7A 3KNZA 4H60A 3PUWA 1CRZA 5G4KB 4PZYA 3GUZA 3MSCA 1KBQA 1UFQA 4PX5A 4O2DA 4QQ8A 1Z29A 5DB4A 4WJ4A 2R65A 1VPWA 4QQKA 2GRJA 1UKYA 1U3TA 6REQA 3OURA 1IY1A 1H0RA 2A9KA 1O0SA 4K9PA 3HTZA 4R1NA 1Q0UA 3L6EA 1TCBA 3GA5A 3IAM6 2GRAA 4ZRDA 1KK3A 2Q5HA 3F8TA 3OCCA 3RQSA 2PZMA 4LJRA 2R68A 4TVAA 2BFOA 2G6BA 3TE7A 1IPFA 2Q3MA 3GFOA 4YRKA 3F6CA 5HWSA 1E9VA 2F3RA 3KKEA 1W36B 2BDEA 3DGEC 2Z08A 2HRZA 1XKXA 1JMYA 4M1TA 1K5HA 2GN9A 1FDUA 2IDZA 2DJ5A 3N2KA 2QVZX 2OSBA 1PV1A 2ZGWA 2VIIA 1YMUA 4KE9A 1P1FA 3I83A 1WDMA 3KZVA 3AV0B 5EIFA 3T7DA 2RI0A 3UXYA 5JSQA 1W581 3OO1A 5EKSA 4C05A 4O63O 1SESA 3DLTA 3HVKA 1LTHR 2BMVA 5CLFA 1UFKA 4YJFA 4TXNA 3FSRA 3L7MA 5H9WA 5HZKA 4TQFA 4TVKA 2BKVA 3QTTA 1EFVB 3LKDA 1RSZA 1G3MA 5A3VA 2OGUA 2W6ID 1CJSA 4KQXA 2OXRA 2NAFA 3IBFA 2FZGA 3CT6A 4JLAA 4NCJA 4S1NA 4TOIA 2NV6A 4TV8A 4M9RA 5E4JA 5G3ZA 4BZQA 4WBNF 2X41A 3GUCA 1QHIA 4LCJA 4RL6A 5K8LA 4JBWA 3EE6A 3KXIA 2ZSAA 2H4FA 3FHJA 3N1UA 4WXYB 4DIBA 1Q12A 2HUNA 4OHPA 4TV8F 3LSTA 5AHOA 3VO2A 3SHOA 4ZIBA 4RDIA 3FBTA 4MQ6A 2F1KA 4B47A 2BN4A 2H1HA 4PPYA 3TBHA 1PL6A 1YIDA 1BX1A 3P9IA 4Y2XA 4QU9A 1NXQA 4INPA 1XOIA 2C8KA 3VOTA 2DVEA 4ENPA 4BAUA 1NJ5A 1MG5A 3R7BA 4E07A 2QL7A 4EHKA 4YQFA 3V8MA 1G18A 4FYXA 4G0QA 4OXYA 4D97A 3LECA 3DF9A 2CLFB 2JHFA 4PHTA 4DLNA 4HS9A 4HWRA 3SBEA 3GEPA 4XCQA 4EBBA 2BPOA 4YGXB 4O5AA 2AN1A 3KC2A 4LDAA 5DHFA 2J30A 2FPLA 3DE5X 4H4DA 2R8OA 1UT6A 3OUZA 1S8NA 5COBA 3C4QA 3GGGA 4O59O 4P53A 4YN3A 1G42A 1SA0B 1KMMA 1H2WA 4ZQIA 5CDFE 4PSKA 4UD6A 2OKCA 4WK2B 4KO3S 1NVTA 4PLVA 2LIVA 3PE6A 3UH0A 5DSTA 3RTCA 1K9VF 3EVZA 3GLQA 1YZNA 4OBEA 3A1SA 1HOTA 5J2TA 1LBTA 3EGVA 2Z8XA 1UBTS 3BGSA 3LT4A 3PRJA 3OOSA 4WKGA 4ES6A 1QZTA 1JG1A 3THRA 1PQ4A 1T0HB 1K7YA 2PCJA 1W1WA 3DBOB 3IP9A 4GSKA 5AOVA 3PUZA 5J2TF 2A0KA 3H18A 1ISJA 3PWSA 3VMMA 5BPFA 2PKQP 3VR3A 5HILA 2H92A 4OBXA 2I1WA 2PZLA 2BYTA 4RIFA 1SQSA 4V0ME 4CH3A 1JLLA 3FOFC 2BH9A 4LHZA 2VPXA 3DAPA 2IHUA 2Y99A 3PR2B 1WDKA 4RF4A 3IHKA 4YDQA 2BGNA 3TLGA 3RHFA 2GHRA 1OLSA 1JFFA 1WDTA 1FTYA 1WUJS 4Q1AA 4WK0B 5D7NA 1FLAA 3CX6A 4K9OA 2C4MA 1UQTA 3VYVA 2ZREA 4MZXA 1OZHA 2XI4A 3HGTA 4K87A 5G40A 1UBJS 2B1JA 3UB4A 3VBEA 2W2MA 2OCBA 1RJDA 3BC1A 1P4SA 2MYPA 3BCSA 1JJAA 2OO7A 3UAWA 4AZTA 3A5YA 3MNFA 2WR8A 2ZIUB 4C89A 5AM3A 2XNCA 5IJXA 4DY4A 1VI2A 5E6UA 3QXXA 1XEFA 1KR5A 3STVA 1WXQA 3S2YA 3FI0A 4ZYWA 3TTVA 2R3SA 4O8CA 3I01A 3MS2A 4IJVA 1WZIA 4TVYA 3EBOA 4MWDA 4NICA 3DYIA 2NU9A 1L5NA 1FFYA 3AESA 3QF4B 1CX9B 2HJ9A 3HVJA 1NN5A 2QMEA 4K46A 4YFYA 3L1KA 3DDWA 3G2OA 5IPFA 4U7DA 4KQGA 4JT2A 2FX3A 1IOLA 4NAUA 1ASZA 5HIJA 4B33A 2GN6A 1Q0SA 3BE4A 3EF1A 4MVYA 1WSAA 4F06A 3MVEA 2FWNA 5FOQA 1RC8A 1KARA 3H1BA 4A8JB 1K1EA 3NRCA 4YI5A 2X5XA 1GLNA 4Q34A 4D4HA 1ZUWA 1TT7A 2ZRMA 4LF7B 3C6BA 4JVOA 4EAAA 3RTEA 1JHVA 3RADC 2GUGA 5C8XA 2NYVA 1UC4B 3EF0A 4K9NA 4XASA 4LXIA 4BN5A 4UHHA 4DMMA 3TCNA 4U7GA 1EWYA 4QOHA 1FIUA 1ZUIA 3COPA 1E6LA 2XDAA 5IAAA 5DHSA 3OSUA 4QBIA 4LZPA 3ZZNA 3REQA 1EQAA 2ADOA 4MA5A 4PGAA 2ZBDA 4MKIA 1V5FA 2KS6A 3I37X 3L7LA 4GMFA 2VT2A 1JDVA 4D0RA 1UAYA 3GEDA 4ZPJA 3M2TA 3KWLA 5U1PA 4IFBA 1O6ZA 4L5JA 4IGEA 3F2VA 1RIQA 2FPUA 3KOYA 4JYPA 2P0YA 4U9IS 3UHOA 3C3JA 1EX7A 1JLHA 3DB2A 3F90A 5AVVA 1HMPA 1FUYB 2G9ZA 2O8CA 3TL6A 1WMBA 1E63A 3UAOA 3JQFA 2VJPA 1E9AA 3KL4A 4LYGA 3RF7A 3T3MB 1D6NA 3QSGA 4GXNA 4DDVA 1QZUA 1PBNA 3R5TA 5TPZD 3AUSA 3RC3A 1YE3A 4UBMA 4WBXC 4XB6B 2W43A 3NM6B 3IEVA 5F12A 4FYPA 2JBWA 4CIYA 2JLUA 4G1UC 5F7OA 4WT7A 1FX0A 1GKYA 5ALHA 3NVKI 2C3UA 4NXMB 1O6FA 2RC6A 3BMNA 4G4JA 2ROQA 4YP1A 1DS6A 1SOVA 3L7JA 2XE6A 1SZPA 2XW6A 3BILA 3C6YA 1RMQA 3T1OA 2RGUA 3ZX4A 4TROA 4QC2A 5FIUA 1A50B 2HU8A 3A6JA 4FXOA 1K97A 1I7NA 1L5OA 1Y63A 2BMDA 3JQBA 1SUFA 2CNKA 4IGFA 2CZQA 4LEIA 5AOAA 2WDZA 3WXBA 5CTJA 4CFZA 2X1MA 4CKBB 3K9FC 3IILA 4P73C 3BXFA 3LBAA 5CM9C 2JHCA 2QSYA 1JQ5A 3L1IA 3F7NA 2IUEA 1VTKA 1DV2A 4D8WA 1U04A 2X15A 3HWX1 2V7VA 2ZATA 5ALNA 3WHPA 3P9YA 4UPVA 3OE7D 4B6FA 3B6JA 1FQJA 1N8NA 3OFSA 5EXEA 3L4BC 4LJLA 1H4SA 5BVGA 4LFCB 4DLKA 3KE9A 5IZ4A 1GGFA 1SURA 1TGVA 1M2VA 2OQ2A 3GLFE 2HA2A 2J7PA 2JG3A 3PV0A 5K4HA 4RZHA 4YBZA 2GXUA 1TMOA 2VBGA 2ZVQX 3E22A 3LQ4A 3UG7A 3U4CA 4HDMA 4ACBA 4H2WA 2QQ5A 4H7DA 4JJ4A 4H2XB 2P8JA 5EXSA 4F1JA 5IVKA 2JJYA 4FDTA 1JN0A 1K3UB 1OFGA 2FV8A 3HA5A 4WOPA 5IM5A 3SVTA 2QAGC 2BKLA 5D85A 3DMTA 5LJIA 1AQUA 1I3LA 1QYCA 3D6VA 5D51S 3V2GA 1DMSA 5JEEA 2CKDA 4IAOA 2ZSFA 2OFOA 3MJRA 4GXTA 4INOA 5H82A 2RKBA 1DEKA 5FR1A 3IKLA 3TJZA 2I7TA 8GPBA 4GM4A 2WG2A 2WIGA 2ZJ2A 2Q3DA 1US8B 3DH0A 3TM5A 3JZAA 3CW9A 4L6AA 1X19A 1M54A 2XBLA 3QNUA 4QZVA 2E1HA 1JIIA 5JJBA 1ZXXA 5I01A 1QGOA 3M4QA 3T5CA 1O8CA 2GTHA 2J33A 5AJVB 2P6RA 4NTZA 3FOBA 1U31A 3BJEA 1I3MA 3NELA 1RYHA 1VPLA 1VI6A 2HA3A 3HKBA 3OIFA 4JS0A 4H6XA 4QNNA 3RK0A 1OW3B 3VZQA 3ZDEA 2VA9A 3HG7A 1YTUA 3H1AA 2PU7A 3A6EA 4F4CA 3HV2A 1EP1B 1W8DA 3B1WA 3LC2O 3F97A 4IF6A 2ZT7A 5BW6B 3GJXC 4HLNA 3ROFA 1YK0A 2NM0A 3V7NA 5ALQA 3PJGA 4GS5A 1T8TA 3EJWA 1U7ZA 5ER9A 5CR9A 3VXKA 1E1KA 2CDRA 2PQMA 5CYPA 3SK0A 3ZX5A 1H3EA 2BGMA 5CH3A 4FFPA 4K9DA 5CJ2A 2ZWPA 3JSAA 4D9MA 1T6XA 4ZK2A 3VNVA 1NBME 1ESEA 1D03A 4OO3A 2Z43A 4PGMA 3RWMB 1XEAA 4EF6A 2FOLA 4B71A 4ZCTA 3E8XA 4QODA 1OXSC 2X77A 1HNXB 3C7KA 3SQMA 3HZRA 1ZINA 4NFLA 4D80A 1GGKA 2X2EA 3DEKA 4DQ0A 2PYZA 3RS8A 4HDSB 3TTYA 1K6EA 1S6YA 1Y80A 2H63A 3RS5A 821PA 3W2GA 4GPTA 3WSWA 1IIRA 2ZTVA 2FMHA 1ZC4A 4KDFA 1O03A 1XZJA 3FPEA 3EWNA 3HJHA 5G0TA 4D8YA 1VGQA 4MP3A 1WBJB 4J6FA 2Q0HA 3W3AD 4EI7A 2Y77A 4D0LB 5FRDA 4EFDA 1G20B 3R9IA 1JB9A 3I9LA 3WK4A 1GJRA 3WB1A 2AWNA 2ZSDA 2DWUA 4DRXB 2WUFA 2Q3FA 4LDNA 3RKSA 2N9UA 3AVOA 3CNHA 3RSQA 5BVHA 4AJJA 3ZH2A 1AUVA 2RHLA 3DHWC 3WGQA 4HWOA 1V43A 3ELDA 5JCOA 4TRRA 2AG0A 2D8AA 2I6SA 3HNRA 1X8XA 4RCZA 4EPYA 1H1LB 3AL3A 4I6EA 3CJQA 1CRQA 1Y3CE 4GPIB 2VJNA 3WGHA 1T9AA 2B8TA 2VF8A 3F6PA 3ANNA 2BMWA 5FFNA 3LWBA 2XQIA 2PQ2A 2I91A 3HKEB 2B3DA 4LJ7A 1EOVA 2XRYA 3CUUA 1BIFA 1PK7A 2XXJA 1OVMA 2I29A 4Z0HO 4FYIA 3B52X 2ATVA 2BFBB 3PK0A 3K4QA 4II7A 2G5PA 3GLHE 3FJOA 3HDJA 4JSYA 3ZHZA 3KWMA 421PA 2QMZA 3EGEA 1IB0A 1Z6GA 4PZDA 1H8ED 2COEA 4AUKA 4ER3A 3BMXA 4DR5B 2ONCA 3QFTA 4UOZA 3I9MA 1X2EA 1XG5A 2WJYA 1X38A 1ZGAA 4TN5A 4J0FA 3S3TA 2TSYB 2FVXA 4CKXA 3T1TA 2B99A 3AFGA 2XUQA 3BGWA 1W94A 5EIXA 5CJPA 1WQ1R 1Z22A 2E4VA 3V48A 2FGKA 1R12A 2WKSA 1Z6YA 4G5GA 5LKRA 4HLDA 1N0VC 2PVCA 4N47A 1LZKA 2A5GA 4JI7B 5C51B 1LEHA 1EJ2A 4MYRA 4QO7A 4CIBA 1T3HA 5AI8A 1S02A 4Q03A 1LBQA 1MZVA 1OU4A 1T8YA 3KV3O 3QBTA 4I08A 1ZMBA 4LNHA 1RXEA 4Q6BA 4RMGA 5EWJA 1PZGA 5AW1A 2DXIA 1R7RA 1V8FA 4DCMA 3AJDA 1LF0A 4G24A 1VDZA 3MYRA 4KO1S 1PDVA 2QYSA 2QN9A 2VOEA 1IJEA 5JRJA 4ZEOA 3HCFA 1XK7A 4XFDA 5C8YA 4EQZA 2R62A 3TRFA 3OEHA 2MSCB 2MWMA 4LA4A 1TC1A 4YT2A 4TMZA 5F7XA 4JBYA 3ME5A 1UJ5A 3WQRA 5C8YF 1K6JA 1XU4A 2R86A 3B1JA 3PNOA 4I5DA 4R8SA 3BFPA 2M6KA 2B8JA 2NUTA 3K8YA 4ZOBA 3P2JA 4HAVA 4ON9A 2VJBA 2XGJA 4YJKA 3UAVA 3OLZA 4GOND 4TXLA 5HRCA 4JJKA 3D3WB 2JH9A 2QR2A 5BNZA 4G1BA 4PLCA 5I45A 1A2OA 4JUFA 3FNRA 1PLLA 3ZHOA 1DIAA 2WTMA 3EHDA 4BNFA 3NBMA 4QVGA 1R6BX 3DEZA 1ZJJA 2IP2A 4Q4CA 4L9AA 4II3A 2OFXA 3W8FA 2DR0A 2JI7A 1EIYA 1KZGB 3H0EA 3LM8A 4JJ6A 5EQDA 4WMLA 5BW5A 1FBTA 2VDRB 4TM7A 3UK6A 1GQ2A 2V96A 4HNAB 4HQNA 4P84A 2Y0BA 3B3QA 3PL5A 1C81A 2HW8A 3RR2A 1G9XA 1Z33A 3IEMA 4KAAA 4RADA 2OBNA 4L85A 4IXNA 5F98A 3G23A 5K99A 3F5SA 3PWZA 2I34A 1JA9A 1I6MA 1UAGA 5JJ5A 1E5DA 1X3SA 1XTSA 4TSFA 3TW0A 5FDFA 1PD1A 4PRLA 2J3MA 4BP9A 1MB3A 1KSHA 3C70A 2VDOB 5K2OA 3P2IA 5KJEA 4B82A 4BAZA 1G8YA 2GVNA 2AFHB 1QCZA 5I3ZA 2V55B 1SR8A 3N2EA 3AC0A 2BRUA 4PBRA 4DR3B 5GONB 2XGOA 3CURA 4G97A 4TPKA 3VTZA 3QV1A 2Y71A 1S7CA 3GZNA 4QOSA 2BGJA 4H0CA 2Q9CA 1SHLA 3E9IA 1VG8A 1UDRA 1W6RA 3GLUA 4FMBB 4GPBA 4D41A 3EN0A 2VPYA 3Q98A 4HNUA 4JFRA 1JR3A 2Y2UA 2OP1A 4MX8A 4JJZA 3HXYA 3R7FA 1WOYA 4IDQA 3O73A 3ZD8A 1LXCA 2ZIMA 1SVOA 1FQOA 3GC6A 4AO7A 5BSVA 2HSZA 5EXTA 2GBPA 3NNDA 2L42A 4RKWA 1A8PA 1FEZA 2P40A 1GZ7A 3TSZA 4KTTE 1U9YA 2OGZA 4CM8B 5JEDA 4GYWA 3NEYA 4CLHA 5EJ2A 3VZRA 2HIAA 4D5GA 3JQAD 1CQPA 4PQGA 1OLXB 5JADA 3ZDFA 5ALKA 3O4RA 4HVCA 1TKCA 2X9LA 2OCKA 4PZ9A 4UBKA 4X90A 4ZICA 1KZYC 3U5TA 3DLPX 5B58C 4HX9A 4EX6A 2EJTA 5LSAA 4NENA 3UAGA 1B00A 4I1OA 3E3OA 1I0ZA 2H0AA 2Z9BA 5SZHB 3J7TA 2IPMA 3SCZA 5ITWA 1MO3A 2ZSEA 3W5UA 4CTMA 1HFJA 1P80A 2ZSIA 4NK5A 5M2QA 4RY8A 1SD1A 5JS1A 1KMQA 3IOYA 3DEIA 4JWTA 2C95A 4UM9D 1P1JA 5DHTA 2W7TA 3VTKA 1A8SA 1UM9B 4P31A 1OHHA 4IXDA 2G9QA 2RHSB 1PS0A 1BROA 3NDIA 1ZIXA 4ND1A 5GOZA 2GPAA 2WC1A 3P20A 1DBQA 1CY2A 1JTEA 4UU0A 2X6RA 4YC7A 1RRGA 1R0SA 1T9DA 5JQGB 4J0GA 1FFHA 1HKHA 1TQDA 3G2KA 2BFPA 3HQ4O 2P35A 3KB1A 4C0HA 3ZV3A 1R0WA 1SXJB 4BNDA 1BC5A 4HNRA 3NIFB 2FG6C 4RBNA 2EL9A 4KIJA 2NG1A 3WYBA 4IP0A 2E48A 1VSBA 2C31A 3MBOA 5HDBB 1X3LA 2XWQA 5TB5A 5BOSB 1PNVA 1LA2A 5CLIA 4EJFA 4TT3D 4D2IA 4WCFA 5HM8A 4JEHA 1HL7A 4CQMA 3R7LA 4GF5A 4EGSA 5KX5B 1Z7GA 2E4XA 3OX4A 4DCUA 3RARA 4BHTA 4F84A 2OBXA 3R4CA 3HMKA 4ITRC 1SCDA 4MVJM 5EE5B 5C34B 3USZA 1KHTA 2Y1FA 5H83A 4RVUA 1E7MA 1UPFA 2P2CA 4LDJA 4MSUA 2WWTA 4G4IA 1PDOA 1H8HA 4MDEA 4B2LA 4PHGA 2ZU6A 3OQVA 5KHLB 1KWGA 3DTVA 1DBIA 1GRNA 4U8HA 3GNTA 1DDIA 1TAQA 4MVXA 4B3JA 3D8NA 3IIKA 1NBEA 3INTA 2HSWA 4K6FA 5J5VA 2PWBA 2OG2A 1JSRA 4H18A 4IF4A 4M60A 3C5VA 1ECJA 4MW2A 1NDHA 1QRDA 2SKCA 3ETNA 4E3ZA 3CMMA 3M9WA 4CG2A 3A58B 3BMQB 2BGTA 3P9QA 5EESA 2ATCA 1SVWA 4RMJA 1A9TA 1KBOA 5DYIA 4EDHA 4TL8A 2OHGA 2P6MA 1X7DA 4EMSA 3EIHA 4KQ1A 1NX6A 3V42A 1GGMA 2HL6A 5K5EA 2DJZA 3P9KA 1VLZA 4ZCLA 3W4IA 3LP6A 5HIMA 1G5IA 1XZMA 4C43A 2WU1A 1Z2AA 3RJZA 4HNTA 4ARSA 3N3AC 3Q8LA 4ED9A 1ZRHA 4P33A 1F7VA 1EIZA 2BKEA 3N8GA 4J3JA 3TTTA 3NUZA 4B2PA 4OAPA 3KKKA 3LHIA 4DJDC 2F1OA 4JR1A 4GL2A 1ZM3A 1NW8A 5DX8A 3SXJA 3PUJA 4AG5A 2YH2A 3OJXA 3TQOA 3A9VA 4HXGA 5J4LA 2Q4RA 4OHMA 3I6MA 2J0SA 3QNMA 2ST1A 4FIDA 4FK8A 1JSLA 4RZ3A 1GUBA 4KLNA 4Q01A 4EW6A 3HDVA 1J7JA 4AJKA 4IFTA 3BTUA 2VT7A 1UUFA 5T7BA 4KXMA 4OGLA 1FP6A 5AJXA 4LJ5A 2VTEA 3KZXA 5LC1A 3OHPA 1DAGA 2QX6A 1U7UA 1DMRA 3S1SA 2G63A 2C58A 4ML3A 2O8EA 4IGAA 2NP6A 2IGBA 1E7YA 3U4GA 4C20A 3ET4A 4ZU6X 4AMGA 4BNGA 1E2IA 3JAKA 3BK2A 5H9VA 3LBNA 4V0NA 4DSTA 1ULAA 4XTVA 2I03A 3RVSA 1UK9A 1V45E 1EE2A 4L22A 2FW7A 5EWLB 4DDTA 4DF3A 2X1HA 3LLSA 4DT1A 2X4IA 1Z28A 3IMCA 4EABA 5AICA 2OHVA 4Q3DA 3LAWA 5AYVA 2ZB4A 4O4HB 2FWMX 2Q1YA 4DCTA 1OFVA 1UKVY 1XYYA 2MSDB 4J6EA 2C03A 3BE6A 3EIXA 4B75A 4EJ6A 5IVPA 2PKCA 3NWJA 4XRGA 4DCCA 2IYTA 2O2IA 4MI1A 2OFFA 1GKKA 4D4MA 1R4NB 3PC6A 1EK2A 4KPYA 1L5MA 5J4YA 4R2WA 4TYPA 1R8SA 3KXDA 1GP2A 1DJPA 1CUSA 2OV8A 3R0JA 3U4IA 3GAAA 4QTTB 1ZZGA 3T5TA 3V34A 5I7SA 1H2RS 3ABRB 1L4LA 4JUBA 1ZEMA 4JU8A 4Z4IA 1VKJA 2JZOA 1V35A 4H1HA 3UFXB 4DMFA 1C1XA 4MIYA 4RVFA 2P1DA 3C1UA 3CKMA 3VR4A 1LWNA 1V1JA 1YA4A 3ONWA 2G4LA 4I4TB 4ILKA 5BPHA 1RKQA 2B4QA 2O8NA 5JISA 2YWXA 1P2FA 3QXSA 4LC0A 2AGVA 5LLTA 4RK6A 1XKQA 2PL1A 1SBIA 5L4LA 1RLOA 4FFNA 2ONZA 4Y0VA 1G60A 3Q9UA 4OX9Y 4GBMA 2CXTA 3E1GA 2BGKA 2Q3CA 3IVAA 5IJWA 3CW8X 2XQGA 4HXYA 3WBKA 1AKRA 2IYAA 2HK6A 2Z5GA 4FSXA 4BBAA 1JYSA 1MJNA 2IX3A 2PO7A 5EMJA 2Y1GA 1Y9AA 2JHGA 4MO9A 1Z0ZA 1PVVA 3T3NA 1RYFA 1MC4A 1UXKA 2WOJA 4LGYA 2V6FA 3W3ZB 5KSZA 4R40A 3STHA 3CNQS 3CTPA 4X97A 5KTNA 4K8RB 1YL7A 1Q44A 3V6MA 3HL4A 1WNFA 4AQ7A 1IN1A 3GIWA 4NV3A 3ZTWA 4XDGA 4C4YA 4ZYYA 3ZN2A 2AEEA 2ZW9A 2ILVA 2XUIA 4KPFC 1FMCA 2IZ0A 3M6VA 1QG0A 3PWKA 2C8VA 2ZTMA 4YRRA 4WCDA 3M4NA 1HTBA 4BLWA 3OZFA 1CY0A 1BKDR 2PU5A 4LJAA 3E48A 5CXXA 1Y9JA 3NHUA 2C9BA 1ZVMA 1Y3FE 1R0BA 3D6HA 1LF5A 2R4TA 4L5AA 1S9DA 3FOZA 4YVFA 3CKYA 4URWR 3CIOA 2Q3EA 3BGIA 4S12A 4U8GA 1JILA 1MLDA 1RM5A 3DBRB 3K1ZA 1UBEA 2AG1A 5T41A 1NRIA 2YJGA 1JKXA 2SHKA 2YOHA 4BVAA 4DANA 1IUNA 1T2AA 1ZOOA 5BN5A 1QYWA 5I7UA 2I4TA 1HKUA 2IDMA 2PZGA 3FMOB 3VUEA 1MABB 2FDRA 4P3OA 1VP3A 3NEAA 4FKZA 4GMHA 3D54D 1MQ9A 1ZD1A 1EB9A 5K3SA 1ZNXA 3WVNA 4KGXA 5GOTA 3EY9A 1ML3A 1CUBA 1G8HA 1UBRS 4Q4HA 2V65A 2J08A 3JQ6A 4EYKA 2IY9A 4KBFA 2ZYRA 3M4ZA 3WRXC 2OK7A 1RXIA 2HYDA 5DLYA 3ZOKA 4M6WB 1PJRA 4M9XA 4GI1A 4XFJA 4ZTZB 1T1SA 2Q5LA 4FT4A 3MMZA 3JD2A 4NOJA 4KLZA 1YC5A 2OFPA 3BK7A 3JWGA 3MF4A 4R7ZA 4YRCA 3GLGA 3IEXA 4X1IA 2BHLA 4MP6A 2H1CA 4M55A 3H83A 5JS8A 1ENPA 1EE1A 1JHMA 3H1EA 4MRSA 5FTLA 4ZJZA 5JW6A 1GPJA 4BJHB 5ALUA 3VR3D 2D3WA 3V8NA 4UXIA 1DDOA 2J3IA 4WE3A 1JQDA 4FWIB 2AEFA 4LBYA 2Q41A 4I36A 1O5TA 4E5SA 2AJ8A 1P5HA 4B0PA 3ZY2A 1IWOA 4W9RA 2EJCA 4BRUA 4J43A 1XXLA 2XMBA 2IZ1A 4ZC8A 2GSDA 2IKQA 4A7PA 1MPTA 3EZGA 3EY4A 4BNXA 3PTLA 4ND2A 5D86A 1A2BA 3S1LA 3FIJA 1CUVA 1MEOA 1CCWA 4HATA 4O2LA 1ECFA 4OLHA 4RHFA 3FZQA 3KQYA 3OOWA 2XGMA 3N76A 2XDQB 3S1AA 3F2IA 5CCEA 3HBMA 4XGIA 3HNOA 5FA8A 4O2BB 3T9FA 2HPZA 4LZOA 1UEXC 2MHCA 5CLLA 1L8LA 4RXTA 3TTSA 5IKXA 1J2YA 3G89A 5A4KA 1RAAA 5L51A 1Q15A 5K6AA 1NOIA 5SYAA 3GPIA 3ZDQA 3FPBA 1CFJA 3A31A 5IAEA 3VHLB 1ADBA 5F3DA 3RSSA 3O8RA 2HZ7A 3AUKA 1QS0A 3LPNA 4GI5A 1WB6A 2QM8A 4KRXA 4ZZIA 3IAXA 3T5DA 1FDWA 4UULA 3IUPA 1JJCB 1FMLA 4JU9A 3T54A 3RM3A 1OOEA 2JVJA 2VPTA 4YAKA 1P81A 3TR5A 3L8HA 1MAUA 4CIXA 3IEUA 2H9YA 1G0NA 1P5FA 1ENYA 1S7GA 2HEIA 2O7RA 1DKLA 3R0ZA 4FW9A 4KPGA 1WOMA 3WKDA 5HOQA 5LJLA 1KYQA 4DB2A 1P9WA 2BAGA 2BZSA 4U6QA 1GG8A 4I0WB 3KPVA 3PNQA 3D8HA 3NTQA 4U39A 3T7KA 1ZVVA 1SK8A 1W0JA 1M2KA 3BX1A 5JI3E 1FCJA 1VPTA 2A1IA 3HBFA 4YHBA 5JZBA 2YX1A 2IUYA 3EDQA 2HBRA 3K0FB 4JITA 5JVDB 2OLJA 3UICA 3WWDA 3X1JA 1Q7GA 1AGYA 3HJBA 2C42A 4ZDJA 4AY3A 3U40A 5JR3A 1LSUA 1JLMA 2BM0A 2PWYA 2WSLA 4FE4A 4HQKA 1E7RA 2VDQB 3TH5A 1CUUA 4FMCB 4EO7A 4C7VA 2P41A 3C97A 3B5IA 3LHFA 3R40A 1N1DA 4TL6A 3LRPA 3Q85A 2Z2JA 1H3FA 1KZ6A 1IUOA 3TW8A 3EF3A 3D4IA 1DFHA 4YNBA 3VVCA 5IASA 2EFJA 2XTZA 3LPAA 3THWB 2FMTA 4DQDA 2QRHA 2W22A 1NXVA 2Y6VA 3B6MA 1U80A 1F12A 2GN0A 4BO3A 3ZWCA 3EOAI 3PFNA 3VU8A 3DOIA 1N6PA 1X7WB 2XSZA 3K3PA 3NTXA 4H35A 3U44B 4IGKA 1IATA 3CX8A 4L3VA 5DMXA 5ADWA 1W5FA 2XPCA 2ODTX 4WECA 4OPMA 3AEQB 4DGQA 2HA6A 5HIAA 5JH7A 1KORA 1XDGA 3L4KA 1NV9A 3UJAA 3EYWA 4P9NA 5KYYB 3JD1A 3UT6A 4DOMA 1M0SA 4F96A 5JH7F 1GZSA 5IUJC 4M9ZA 5IAJA 5LP6B 1ZONA 1M76A 4BN4A 3HDQA 3CX4A 4WKOA 1GPYA 4D3DA 3HFVA 4M9CA 2ZDQA 3NHYA 5C81A 1RBMA 3M33A 1FU4A 3LXXA 3FPFA 4MW7A 1CY8A 4NRDA 3EXFB 2QTVA 4LISA 5EIBC 5ADVA 3VZCA 2B21A 4Q0MA 1J5EB 1U0LA 1C3OA 5L4SA 4GEGA 4YK7A 4E2FA 2YINC 2FPGB 4ZCRA 1UBLS 2J07A 2HC9A 4EHNA 2LPMA 3AOEA 1G5RA 1RPTA 2DUNA 1XDWA 3HJGA 1HBJA 3L84A 4YRQA 1UZUA 2P62A 2VHVA 1R4ZA 1OXXK 2V3CC 1QH0A 2PTHA 1P4GA 2QN1A 1HZZC 3JU3A 2ZRHA 3DE0X 1Q0LA 1RC0A 1G17A 4UEOA 2ZR7A 3Q6MA 4KI7A 2X8BA 1Q0PA 1MB2A 2BZ1A 2X13A 4XPIA 2ALYB 4PEVA 3UH1A 2HFJA 3AHCA 2QTFA 2AFIE 5KYVA 1NP7A 3NDJA 4LF4B 1RE0A 2RHQA 4UCXA 3V55A 1BMQA 2C5FA 2GM3A 4IZHA 1C4WA 2VUSA 3WSTA 1RXWA 4DHWA 2FZVA 4EL0A 1U9JA 4NEGA 4Y30A 3SZ3A 1CYEA 2QRNA 5JBNA 4KFCA 4B3RB 3EIUA 1YI8A 4BVJA 3CLTC 2R2GA 3T4XA 5KAPA 3ITDA 1Z56C 4M7WA 1IQ0A 2ONJA 4BRZA 3B8EA 4JP3A 4BWYA 2J7PD 2CEAA 5BSRA 1O6GA 1KPIA 5EE1A 4AECA 3QKRA 3UTDA 3D1VA 2R6GA 2OCPA 1W46A 1RRKA 4NU0A 3C8UA 3V1NA 3B8HA 4OQNA 5LD2B 3RUHA 3WL7A 3M1LA 1OX5A 1DHRA 4MW0A 3TOZA 3HRIA 5GP1A 1EVEA 4H4EA 4DA6A 2FMKA 4YEDA 4CCWA 3AKZA 1ISFA 4BIMA 2HHLA 1SCJA 4LVMA 3A4YA 1L7DA 2CDNA 2J4FA 3BH0A 3B38A 3LHDA 1XMPA 2YUIA 4WADA 3ZI7A 3ANSA 4CLDA 1JJVA 1QO7A 2OZLA 2Y3IA 1C7ZA 1XN1A 1WVMA 2PR7A 3C3CA 3ZHXA 4RLFA 1CB0A 1ID1A 1T0UA 2FK7A 2QVBA 1A7UA 2YXNA 3JQ8B 4AJ9A 2H52A 3JXEA 1P18A 1Y4DE 3OT4A 4XX1A 1IZ8A 1S1MA 1NQAO 3CXRA 4Y9DA 3WDMA 2PKQO 4LQCA 2O3JA 4KRYA 3U0VA 4IVNA 5AQ1A 5B4UA 3FY4A 1Y1PA 2DCMA 2QK4A 3LUDA 1II8B 4Y8VA 4C7OA 1AVTA 3AVVA 3SSAA 1TYZA 2Z1DA 3KAPA 4EF4A 3UQZA 3RV3A 1RQXA 2BFMA 3PA6A 3W90A 2QJOA 4CLOA 1CQZA 5TQ0B 1VIVA 4ZKEA 4BFUA 1Y8RB 2W2NA 3T1NA 2WVGA 4OQPA 5EIAA 4EYGA 5CB4A 5CDYA 5B64A 2F3SA 3GOHA 3DOOA 4GPZA 2QD4A 2R6DA 3F96A 5EXPA 2A2ZA 5IWCA 5CB4F 2P67A 4NNJA 1GTL1 4JV5B 3Q8MA 2B3TA 1BCSB 4FWBA 2B4KA 3AB3A 3A10A 1MQAA 1Q57A 4WN9A 1PNOA 3C8MA 1MW9X 3FTPA 1IG3A 1V16A 2Q1TA 2BR5A 3DFMA 4KUGA 3RIYA 1LU9A 2AX3A 3MJDA 3B13B 5HCNA 4MV0A 2OM6A 4NYJQ 5IM4A 3G0HA 1IHPA 1JYEA 2FPIA 3NALA 1XMOB 4CKYA 4PTYA 3HO6A 3ZWNA 2B6NA 1BIBA 1Y6RA 1SQ5A 3A26A 4PM4A 4Z0PA 1F1JA 3PCOA 3V2UA 5AKXA 1JX6A 1EGMB 1Z6XA 5KYUB 3L82B 5IM4F 3GNQA 2WTUA 4U2KA 4JVMA 1YQ9A 1GU1A 3O8DA 3QYAA 4PYMA 1G4AE 3LC0A 3T1HB 4CUKA 2JGFA 2AMVA 4G67A 5ECWA 3MJSA 2ODWA 1V8ZA 1DG3A 1Q84A 1A5BB 4IV5A 5E0OA 1AQJA 4L9RA 1B0ZA 5B1EA 1JR2A 1NW5A 3QK7A 3M8KA 4PLTA 4PYOA 2GKOA 4P22A 4UVHA 1WZ2A 4IGIA 1QH9A 3ENVA 1HRKA 1U4OA 2PBRA 3FBGA 2HQRA 2LGJA 3UB3A 3NWOA 4B3BA 2ZVPX 5DX0A 4PIVA 4DIOA 1JJ7A 3D4BA 4AK9A 4XX0A 4FBMA 1ZH2A 2HHJA 4I9FA 3RF6A 4CKWB 5JLAA 3ROEA 3U6KA 1E2JA 2RH5A 5CT8A 4ZVPA 3FBWA 2RH4A 4HUJA 2P3SA 1RAEA 4GUAA 3TEMA 1IY9A 4DV5B 4PYQA 1T5TA 5KTTA 4J1TC 1YV9A 1KDRA 1QQ5A