5C51B

Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial dna polymerase gamma
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
418
structure length
363
Chain Sequence
b'ALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase subunit gamma-1
publication title Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial DNA polymerase gamma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 89
structure length 363
sequence length 418
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5c51B01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 5c51B02
3HXWA 4YCWA 1YFRA 1NJ2A 4TWAA 3L4GB 4RMFA 4HWPA 1SRYA 1X01A 4P72C 1PYSB 1C0AA 1GGMA 1QF6A 2ARUA 2Q7HA 3I7FA 5K1PA 3A7UA 1X54A 4XTWA 4O2DA 3IKMB 1NYQA 4YRIA 4WI1A 2DZ9A 5C53B 5ELNA 3TEHB 1WYDA 2ZGWA 3HXZA 2CJBA 4J15A 2DQ3A 1B8AA 3M4PA 3W3SA 4RQFA 4BWAA 3EFRA 4YRRA 1G51A 5K1XA 3BFMA 4E51A 4CS3A 2ZIOA 2DKGA 1B7YB 2ODRC 3RKWA 4HWTA 4UP9A 2DXTA 4P71A 4OLFA 4K88A 2EJFA 1EFWA 3EFSA 3HXVA 4YDQA 1J5WA 4G85A 2Q5HA 2ZINA 2IY5B 2PMFA 2ZT7A 4YROA 1E1OA 3P8TA 1NJ8A 3A7RA 4YRTA 2E5AA 11ASA 1NJ1A 3A32A 1B76A 1BBWA 1SETA 3V7SA 1WU7A 2DEQA 4H2VA 3L1AA 3HFVA 3HRIA 2ZZFA 4DPGA 1BBUA 1WNLA 3QO7A 4YRJA 3UFGA 4ZTUB 2ODRD 4HWSA 2RHQA 2C8MA 2E1HA 1EIYA 3UGQA 2J3LA 3DSQA 3ERRA 4BW9A 3NELA 1X2HA 1Z7NA 1FYFA 2E10A 4AH6A 3MF1A 2ARSA 1H4QA 3V8LA 2P0LA 2EAYA 3E9HA 2G4CA 1ATIA 4YRGA 3LSSA 3HRKA 4YRSA 4KQEA 1SESA 5C52B 3TEHA 5C51B 3HXYA 4DQ2A 4P3NA 3VBBA 2XTIA 2DU7A 1B70A 1YB3A 4XTZA 1H4TA 4K86A 4YRKA 3HTZA 4XU3A 1NNHA 4H2XA 1ASZA 1JJCA 4TTVA 3VQXA 4CS4A 2RHSB 4TVYA 3P8VA 4HA8A 4LNSA 4KR2A 2ZT6A 4Q15A 3A5ZA 4G84A 4TVWA 3HY1A 3HXUA 1E22A 2I4MA 2FYKA 4EX5A 1NJ6A 4P3PA 1HTTA 3HFZA 4P75A 2ARTA 4H02A 1G5IA 2AMCB 1ASYA 1EQRA 1USYA 4H2TA 2E65A 4XTVA 2HNIA 3RF1A 2QHSA 3PCOB 2CIMA 3VQYA 4YYEA 3IALA 3L2ZA 3E9IA 2EJ9A 4P3OA 1VQZA 3RKYA 3RIRA 4P75C 1HXDA 4TQFA 1YGBA 2ZZGA 2EWNA 1EOVA 1IL2A 4CS2A 2ALYA 3ICAA 3OD1A 2DQ0A 2XGTA 1HC7A 4XEMA 3V8KA 3MEYA 2E41A 1QE0A 4KR3A 2DVEA 4P71C 4UP8A 2ZT5A 2C7IA 4YP0A 3RKXA 5ELOA 4YRMA 3A74A 4YCVA 3A31A 2EL9A 4YRCA 1WQWA 4WJ3M 2QHUA 4TVAB 3L4GA 1KMNA 3NEMA 2DU5A 1PYSA 1E1TA 3MF2A 3IG2A 4HVCA 2DTHA 1WLEA 3NETA 3TEGA 3REXA 4H2YA 5E3IA 4CH5A 2ZNIA 4XU2A 1H4SA 4YRFA 4P74A 2DDZA 2Q7GA 1Z7MA 1YFSA 2EJGA 1NYRA 4OP0A 4EO4A 3RL6A 4CH3A 3V8JA 3WQZA 2DTIA 1EVKA 3PCOA 4L87A 2LW7A 1ADJA 4X5OA 1X2GA 3IKLA 1B7YA 4WF2A 2RHQB 4P74C 1EIYB 2AKWB 1H4VB 2ZTGA 2CGHA 2ZNJA 3TUPA 2QHTA 5F5WA 2P5IA 4HWOA 3KFUA 1E24A 4UPAA 3RUXA 2ZZEA 4XTYA 3A5YA 2J3MA 2IY5A 2ZCEA 4YRPA 1X55A 2ZR2A 1X56A 4PHCA 4XTXA 2DJZA 3PZCA 4XU1A 4YPFA 1V95A 4TQDA 3HXXA 3QO5A 2DTOA 2ZT8A 4YRQA 4PG3A 3REUA 3UH0A 3LSQA 3QNEA 3CMQA 12ASA 4YRLA 1B70B 1USYC 1RIQA 3RGLA 4Q6GA 2E3CA 4CH6A 1WPYA 2DZCA 4H2XB 1BIAA 3M4QA 2E64A 1JJCB 4TVAA 4YREA 2I4OA 1BIBA 3A7AA 1EVLA 1SERA 2CJAA 3HFZB 4H2SA 4ZIBA 5HGQA 3LC0A 1ADYA 3FJPA 2CJ9A 1KOGA 2Q7EA 2I4NA 4XU0A 1N9WA 3HY0A 2QHVA 4RDXA 4NCXA 4YCUA 5KNNA 1YFTA 1NJ5A 3V7RA 1G5HA 4HWRA 2I4LA 4YRNA 2ALYB 2Q5IA 2RHSA 4WJ4A 4XTUA 2ZR3A 4H2UA 1L0WA 2ZIMA 4P73A 3RACA 2AKWA 2PMEA 3BJUA 1W66A 3V7CA 3QO8A 1LYLA 2ZXFA 3NENA 3VQWA 3R07A 4K87A 2AMCA 4UP7A 2DXUA 4ZTZB 4CH4A 3VQVA 1KMMA 3QTCA 4H2WA 3P8YA 4P72A 1WQ7A 3G1ZA 3UGTA 4P73C 4RQEA 4XEOA
chains in the Genus database with same CATH superfamily
1GNQA 3F1KA 1R18A 4Z3KA 3HJNA 2TMYA 3W3ZB 5GV8A 4UU7A 1PJ8A 1T1RA 4B74A 1NBME 4DILA 1J2TA 3B6IA 1NC3A 1H2AS 2PKQO 3ZK9A 2OKGA 4RD1A 2HY7A 4JLNA 1RRMA 4OFWA 2P2CA 1ZM3A 2ZULA 3R5TA 2EX4A 1FLDA 4CL8A 2GN9A 1YFKA 2PMKA 2AN5A 4P9NA 5FBRB 2O8BA 1SD2A 1XDBA 1Q16A 2P7HA 4R1QA 3IT1A 1XMIA 2SCUA 1R3UA 1N2CA 4QUEA 721PA 2PT5A 1K89A 4MUKA 1Y9EA 4ZWNA 3PF8A 2H57A 3Q6IA 1WPGA 3U1VA 3EMVA 5A7GA 1U02A 4A36A 3C87A 3DV2A 1VJRA 3BRWA 2QE7D 3H5RA 4URFA 4DCNA 4XTWA 2ZI3A 3LVBA 5C37A 4MUGA 4D0RA 1QFXA 1YQUA 4JMPA 5CXSA 1RP1A 3JQBC 2Q4RA 1UBMS 2VJOA 1NUQA 3AUUA 1I0ZA 4LZLA 1PZNA 1DFIA 1ZC4A 3HJHA 3UJ9A 1HF3A 1WM1A 4QEKA 3GLRA 4R9UC 4A4DA 4LV8B 5JZBA 4ND4A 4HB3A 4PTYA 3SVTA 3ONFA 4HDMB 2C0PA 4D98A 1CP3A 3L01A 1YVEI 5CX1A 3D4LA 5FBVB 4YIKA 2AXEA 3BFJA 3IMEA 2VP6A 5FT9A 1FNNA 2VDKB 5LU9A 1XNJA 2NYVA 5T3YA 2P68A 3QEBZ 4RQFA 2B4RO 4PICA 4D45A 1BSVA 3EVBA 4M0KA 3SS8A 1T91A 3IQIX 4YMIA 4JGBA 4HEA6 4EJSA 1I5OA 3IH5A 1MAHA 1RCFA 4P6VF 4C4OA 4K0KB 3I28A 4CS3A 1BG6A 2OD7A 5EMKA 5F7JA 3ANMA 2HU7A 1DWOA 4D0GA 5ICSA 1Z8FA 3CEHA 4J7XA 2IP2A 1B7YB 2HCFA 4JLAA 2PX6A 5ALUA 2YXEA 1ILEA 2WJPA 4B09A 1U81A 1Y1LA 2W6JD 2B3DA 2IHYA 2GVNA 3D7SA 3E8SA 3FNIA 3QF4B 4G67A 3DKPA 4DQVA 2NVBA 4B34A 1U5CA 1DC6A 2VPIA 5A4MS 2REQB 1BW9A 4OHUA 1YU9A 4R3UC 3PVSA 4L5YA 2VPPA 4V02A 4ER3A 3HP4A 3FBTA 4YDQA 3TVDA 3RHSA 2E48A 4JB0A 4J2TA 4OPMA 2J3HA 4UULA 4QLBA 1JECA 2R7NA 1Z0ZA 4EEKA 1N2IA 4QGSA 2I6XA 4OU5A 4EHFA 3SIRA 4UBOA 4FB5A 2CWDA 1NTOA 2PZBA 4OEHA 3TCKA 1SUSA 4K1LA 2I4RA 2Q7XA 2Z3ZA 4LGVA 4DNOA 4XIYA 1SD1A 4JH0A 4EHNA 4AM8A 1T5IA 5B4VA 3G8AA 3NHYA 5C31A 2E9SA 1YWGO 3KT3A 4WK4B 4YK7A 4MYUA 4AJ2A 5FNVA 4V3BA 4J07A 4URYR 3RUIA 5J5AA 4L8WB 3HXOA 4DNPA 1DAMA 3UN1A 4WZBA 3VKVA 1N2CE 3D54D 3IHTA 5JDCC 2BOVA 3E6AA 1L4GA 3G0IA 1KH2A 1Q0ZA 3GA7A 3GLIE 4BZZA 4NVRA 4ZQEA 1B3BA 4ZTUB 1TCVA 3SF8A 3TGPA 1Y5RA 2VZEA 4P7GA 2LNDA 3WS7A 2IGBA 4BB9A 3OE5A 1D4FA 1ZIPA 4TYPA 3K6KA 1KEEA 3NTXA 3OZFA 3EF3A 1VJDA 4IEFB 4X1YB 4ZAGA 1GKLA 3TLMA 3WJ1A 4H31A 5ALIA 2WTUA 3E9RA 2C9CA 5EINA 3UJ6A 3WMEA 2LBPA 2X1MA 1PWXA 2E87A 1QTIA 4IHJF 1CZOA 1XLTC 2GPAA 2XAUA 2PG3A 4MWOA 4V38A 4NOKA 1YGPA 3N5KA 3DLHA 3LYAA 1L6RA 3H05A 2JCVA 3LX5A 1QKKA 4WERA 2EZ9A 1H4QA 3CN9A 4TLDA 4D74A 3HFGA 4R1LA 1Z6XA 3IL2A 4DNQA 4EA8A 4H15A 2UYCA 2YWEA 3Q3CA 1P2SA 2V3WA 3BWCA 2VJAA 2JLCA 3ES9A 3S1SA 2PWPA 1L5MA 4KUHA 4NICA 2VAVA 4PC1A 4LYJA 4NMWA 4CLHA 1R27A 3AL2A 2K7ZA 3TEHA 4I4TA 5J5VA 3HXYA 2AFRA 3VO9A 4YUAA 2JFHA 3SG0A 1DCMA 3GYBA 1JEOA 3DLIA 4EG5A 1TYBE 2YOFA 1ORWA 2QMZA 5CJ2A 1V8ZA 2QWXA 1I7LA 4PLCA 2OV2A 3IB6A 2GVDC 4OGFA 3QLUC 5T8KC 1JFVA 1ESMA 3DJYA 3B1YA 3E58A 2QSZA 3ADBA 3WGNA 3AETB 1RLMA 4CE6A 4RD6A 1XCLA 2YIJA 5BQ3A 4ZC8A 1XRPA 4I50B 1IXRC 3GFGA 4AF6A 1OTXA 3AEXA 2HCJB 3FNFA 2R1VB 2CUNA 1CUDA 1PYGA 1J24A 3SOPA 2C1EA 2VJKA 1JMYA 1W5SA 3GAFA 3MJFA 4LNUB 1E6LA 4G8JA 4KNWA 4Y9UA 2ECPA 1ULUA 1E9AA 2GPJA 3ME5A 3PVCA 5BOSA 2HKIA 4XM0A 5HNKA 4L57A 3MMNA 5JRDS 1XO1A 4X7MA 4P75A 3CG4A 5B30A 4DY6A 3G0OA 5E8JA 4LZWA 2QT1A 1Z45A 2CMGA 4MV4A 4MVWA 4DT1B 5BYKA 5CD1A 4C3OB 1ELOA 2A9VA 4ZRMA 5J4VA 3V5NA 1G5IA 1OA0A 1JG6A 1N0HA 1PWEA 4Z9AA 3VPBA 2A59A 2CUZA 2JAPA 1CBUA 2B1RA 2G0TA 4GBED 4W7IA 2AUNA 3G89A 1XA3A 2O3UA 1OXUA 1JDJA 3O0TA 4IF4A 1ZIDA 4LJAA 3WLJA 2HCRA 4OKIA 4TLEA 1TKRA 4C03A 1IQUA 4AJEA 5JIBA 1Z26A 3M4JA 4GBGA 1UPFA 2MHCA 2C3YA 3INRA 3NNNA 3EG9B 1QCCA 2V5UA 1M2VB 1ZINA 3KD3A 5KIAA 3N2IA 4C0BA 4FHGA 3WK7A 1GT91 1B6RA 1O96B 4YJFA 4TQFA 4C4XA 4IQ0A 4ZRDA 3I12A 4QDOA 4LDPA 1BFUA 4NFSA 1R3DA 3ONDA 1IL2A 1RHKA 2JHPA 4FHCA 4M89A 5A4FS 5CIYA 3CH7A 3P4UA 2BIFA 1M67A 2HA6A 3NEYA 1NF9A 4JOSA 4WUVA 1C1DB 1SCBA 4B3DA 4XYMA 1PUXA 4KWTA 3KXLA 2IZOA 1B41A 1DKRA 1T8UA 3BDIA 3I76A 4ND8A 2V0CA 4TOIA 3SMVA 2QU8A 1EHIA 4JYZA 1NGSA 1ZUD1 4I1UA 3KV3O 3M9XA 2O8DA 5FHRA 3I92A 1QE0A 3BXEA 5I01A 1W75A 3KZXA 4GOOD 1CETA 2GTPA 3NWOA 4EY6A 1Y7HA 2W2VA 2BFDB 2JAHA 2VYVD 3C6XA 1R2QA 2P6MA 3E84A 4WOPA 3WKEA 4AP6A 4C87A 3D31A 3H9QA 2QJWA 3KLPX 4IJ6A 4J8PA 2QZ9A 2OAQ1 1LA2A 3HI6A 4K40A 5ENVA 4FFBA 5E4YA 4C43A 4WVLA 3SCZA 4BNYA 1PG5A 4TL8A 1G0OA 2XGOA 1KBQA 2IHJA 2Z5VA 4JJ4A 1RAAA 4XUEA 1EVQA 4AL4A 5ELOA 1FX0A 2GPSA 2IU4A 4BNNA 1J23A 1PT6A 5FBZA 1FYWA 1BHO1 2YMLA 1RZRD 1IRXA 1LLCA 3JALB 3K9QO 3L8EA 1IBKB 4RM3A 1RJ9A 4J6FA 3LBIA 3FOAA 5L4LA 5CB4A 5GONB 1L7EA 4BB5A 4RQTA 3EAGA 4P92A 2X1HA 1UMDA 2FFAA 4UNPA 3ID6C 4UEKA 3W9UA 2VDMB 4P36A 4CETA 3UFBA 5KYYA 5FTMA 1M8GA 3V2UA 1K66A 2C8JA 1YE8A 4MWTA 1U2PA 5CR9A 1E1MA 4MVJM 1A8QA 3EIXA 2X6RA 4ENQA 2NV0A 3ABSB 1R37A 1ZN7A 5H59A 3UNXA 1J2EA 4ARSA 1CJCA 4CQLB 5HW0A 4TYNA 2CNWD 2H2FA 4H3SA 3E9MA 3ZX4A 1XVIA 1UL1X 2P9JA 2D5LA 1JA0A 1Y4DE 3PE6A 2G08A 4W9MC 1VZ2A 2R8BA 5BSFA 1BDBA 2CJPA 3DOJA 4ZVKA 3PYXA 3WNQA 1F60A 1QH8A 1E2IA 4FMBB 4HZGA 3UAOA 4EWLA 3S1AA 4L6IA 3SGLA 4AIIA 3REXA 3D8SA 4B6OA 3TPFA 4F56A 1R15A 1TYDE 4QFCA 4MS3B 3LTEA 2JASA 5IVIA 2E1PA 1MH1A 3NAGA 4N82A 3M6IA 4QGGA 1SRQA 3RVKA 4BXOB 2BJHA 1LPAB 4ANFA 1E2BA 1U5BA 3UJDA 1U0FA 3BGWA 2OXFA 2ZEJA 3LX6A 5LB2A 2DDZA 1C7ZA 1L1EA 3PFCA 5E8RA 4PSUA 2Q7GA 2DFTA 3EUFA 5DGHA 1M7BA 1RRGA 3TAUA 5BNIA 3L0YA 1ORIA 1S8OA 2CSUA 2YVLA 2YX1A 3V8JA 3C7CB 3ASZA 2QL6A 3HL0A 3PUKA 5C18A 3FR7A 3GT4A 3HTXA 2I4IA 3SD7A 1V8OA 2P7IA 3IOCA 3QSYA 1S2NA 1BXGA 2P9TA 1Z4PX 1EGQA 3PDWA 1RPTA 2W43A 1ADJA 1A7AA 1P0PA 1ZG3A 3P9ZA 3HDGA 4UCFA 3ZPXA 1HNXB 2Q7OE 3P0JA 3LGSA 4R8RA 4BO6A 1T0PA 1K3TA 2WABA 1CUIA 1DB3A 2VUIB 3E3LA 3NDJA 3OTIA 2C29D 5T3UA 1U7TA 1E3SA 1RIFA 1TZCA 3PPIA 1H8HA 3HEBA 3AB8A 5G1PA 4F2GA 4G97A 4NESA 1EXNA 3ONVA 2CVHA 2YQZA 2B83A 3VPSA 2W6MA 3QPCA 2CV1A 1V5GA 1U6IA 1WXGA 1B16A 3ILSA 3OBIA 1WEHA 3K96A 1UKYA 4L5CA 4TQAA 5FPSA 5HFJA 2QD3A 4C3VA 1L2TA 4DV6B 1ZD2P 1AS3A 2QXYA 2QGNA 3CIOA 1L5WA 3ZH9B 4FMCB 1GY8A 2GILA 3GJ8A 3PRHA 3Q7PA 3TINA 4D8UA 3FOZA 5LD2C 1KRWA 3DXYA 3VSAA 4YJ3B 1KY5A 4YO7A 2IOHA 4GGOA 5FFMA 3M5PA 3PQEA 5CBPA 2ZAMA 4D92A 1MB3A 3S2YA 2YRWA 4WESB 1XYVA 1FRFS 3D8HA 4BIMA 2EGUA 4DLLA 4GZ3A 1XB2A 3COZA 3QX9A 1H9BA 2BMVA 2C3UA 3GP3A 4MVYA 4ND3A 1UADA 4W82A 1NVMB 4F7WA 3O8NA 1PDOA 4LXXA 2V9CA 4JLBA 4S1PA 4ZQCB 1J1IA 1RHUA 2P41A 4IDGA 5AXBA 1SBIA 1EX7A 3NHFA 1DO8A 4ZMRA 2H4ZA 12ASA 3OBBA 1LW6E 1RIQA 1W4ZA 3N7AA 4Q6GA 2H4HA 2BPOA 4YC7A 1RXSA 1CVLA 5HBGA 4BMSA 2C8KA 2WDPA 2IYRA 2QRPA 4P4LA 3OT5A 2IUSA 1GQQA 3UT6A 4M1SA 3E23A 1P45A 2B0JA 2ORYA 4DWJA 3GLIB 5FA6A 3HU2A 1QOZA 4UM9D 4MVJG 6YASA 1Y6RA 3R3WA 4M46A 1QRSA 1EUYA 1OLXA 4BFWA 3SBOA 3SYRA 3QKRA 2J67A 4CEHA 1ZJWA 1DI0A 1MIOA 5E6RA 4CQMB 1UOQA 1FSPA 4JDPA 5BUZA 2IYEA 2VHZA 2AOVA 4TLMB 4W5OA 1C3XA 2DETA 3CRZA 1L8LA 5LA6A 2Q1SA 1GLVA 3E22B 2DR0A 2ATEA 1ZS9A 5TT0A 4QFMA 5GVSA 5LZ4A 4MVJH 4W6QA 2QYOA 3LP8A 4EFNA 2ZYSA 2QXUA 2VJDA 2ZTUA 1I01A 1NUPA 3OOSA 4KE7A 3HRHA 3QLEA 2HMUA 1AKWA 2LXNA 4PFKA 4XQEA 4DC1A 1M76A 5I9LA 1S8AA 2JC3A 1ESNA 2C59A 4YBZA 2UYHA 4LVKA 2LDXA 1TMKA 1YA4A 3C7TA 3GAAA 4YP9A 4B87A 2QAIA 2WNSA 2YHIB 1E6CA 4OAQA 2I76A 1H0SA 4U39A 3V7RA 5ILQA 3QKWA 1KHHA 4Z3DA 2NO5A 3UW1A 2GBPA 4D4GA 2RCYA 3EFOA 3EYWA 4J0IA 5HIIA 3RSGA 3SPXA 4DMFA 3ABZA 3H4TA 1GSAA 4W9RA 1U2DC 4IMPA 4MYRA 2UZ0A 2GVZC 2XWBF 5LQNA 1QQTA 5TNXA 2GAOA 1Y8ZA 5IFLA 1WSBA 4XTUA 3GFOA 3ICPA 1UC8A 3IO3A 3ZKWA 4BC0A 1EE2A 1FP2A 2X9VA 1VCHA 4ZO9A 5IS2A 1ODLA 3H2ZA 1Q15A 1LBSA 4INPA 4RZXA 1K2WA 1G291 4JLMA 5EXPA 2NM0A 1C1XA 3C3JA 4WFIA 4PPYA 2JLVA 4GPAA 1ECLA 3AI1A 2EOAA 1QYXA 2PLRA 2QAJA 3LCCA 1A71A 1IEQA 2RCNA 3PJGA 4M53A 4Y6SA 4DLYA 3P97A 4WBSA 4RANA 4DVGA 3E7PA 2ZRNA 5BV0A 3CYFA 1AXEA 1IBSA 3CG0A 5FKJA 3EGDB 5JUWA 5KOHB 1J21A 2BBSA 2QTVA 2XOKD 4RNCA 4ZU6X 3SX4A 3IEIA 3MBIA 3FTFA 2ZJ0A 2ZAGA 1PJZA 3I6YA 2FKAA 1MGPA 1PR9A 5BORA 5DNUA 4AB1A 3K0FA 4IIJB 3KZNA 4ARIA 1AMNA 4Z3OA 3VR1A 4DRXA 1QQ6A 2P65A 3AI7A 4NCBA 4IIYA 2IEZA 2ZR9A 1A9TA 3AUFA 2VRNA 3KSRA 4NZ9A 3WA7A 3VPGA 1XZMA 3D1LA 3O3MB 1XZHA 1CUXA 4WOJA 1PQPA 1YD7A 3OESA 2ETVA 2ZIUB 4II3A 4OLJA 5CVDA 3LWDA 4YP6A 4AO8A 2XE6A 2VHXA 1O58A 3IXLA 1C41A 3LVFO 3U4QA 4JWKA 4LI0A 4URUR 4LF8B 1XEXB 2NQTA 1TADA 4FQ8A 2PRZA 1PZXA 3X1ZA 2IU0A 1ACLA 1UEXC 3FUCA 4U5QA 1EWYA 2YQ5A 4ID3A 3EIWA 3QLVA 2DKNA 4HEJA 3TTXA 2RBGA 3UG6A 2C2HA 2A1UB 1LSUA 4UM7A 3RVDA 4HADA 3L0IB 4RFSB 3G2OA 4LMRA 4NBVA 3VC1A 4GI5A 3QVOA 5ICMA 4J0GA 1KYIA 4ZYZA 2F6RA 3RVMA 1UMBA 3CMCO 3EDRA 3DDSA 2QTCA 5FL7D 3W06A 3VU3A 1FSGA 5AT1A 3MQ2A 1CUGA 3HPQA 3RSQA 4HPWA 2NLOA 4XRRA 1LC0A 2QYSA 3RUEA 3TSYA 4L8VA 4N49A 3TF5A 5DJ5A 5KMGB 1SD5A 4O2AF 2CF5A 2FLVA 3A27A 4J29A 1R0LA 3MILA 4BRWA 1N5RA 5AVUA 4RHYA 2QN9A 3Q8WA 4GPTA 3TEHB 4CN9A 2VH1A 3G85A 4INJA 3H9CA 3A4IA 3E8XA 1VGRA 1N3BA 3AJAA 3KPUA 4QYIB 2N46A 2FMKA 3CR8A 4IJWA 1E2MA 3WRVA 2E3JA 2H48A 4A0FA 2Z1MA 4ENWA 3U7RA 5FFFA 2XBUA 3F6YA 1N32B 4NY1A 4DMUB 2Q2VA 5CJJA 1M72A 1H6CA 4MUXA 2BSAA 3JPWA 3KR1A 4JDUA 1NIJA 2Q3EA 5K1XA 2WFAA 2F1KA 5D1HA 5AWFC 1Z7GA 5LD2B 5BV2P 2OV1A 1NOIA 1U7DA 2WUFA 1A04A 3C7KA 4X60A 1Z29A 4XPIA 4DLRA 1IDN1 1TD1A 2IP4A 4KIWA 4HWTA 1FXUA 2ZI4A 2OV4A 1O5IA 4L22A 4XD2A 4CM5A 1AO0A 2FOLA 2XSZA 3G2QA 1UAYA 1SUDA 4WXEA 2ZRDA 2VK8A 3CT4A 5AW3A 3ETJA 2F59A 3ESZA 2BMFA 2VDWB 2J9RA 1H23A 3NWJA 3P52A 4I6GA 4REMA 3W4KA 1V6SA 3AC0A 5FYQA 5THKA 5K8CA 1UC4B 3SQNA 3IE0A 2PO5A 3HP7A 1J7KA 3C7DB 2AEJA 3PNOA 4LZNA 4UEWA 3SOZA 1LTHR 4ETNA 4ZZIA 1NDHA 1DUSA 2WYOA 3FYCA 3N58A 4N0QA 4O4JB 2W8ZA 4ZAWA 3LLVA 2YCLA 2FPIA 2IYPA 1V1JA 1SB9A 4HDAA 4PNHA 1I3OA 4KUEA 5F2EA 1CUBA 3OC6A 5FHQA 5BQPA 2Z6UA 4BO1A 3QX3A 2C5FA 3FYUC 4QDTA 1MQAA 5ITZA 1EWQA 3DJFA 1L8OA 3C6ZA 2VF7A 1QQBA 3QFSA 1DNPA 5EFZA 2OCAA 3EA0A 1ZMXA 3D4NA 5JJIA 3JRWA 4XWAA 4B32A 4JP8A 4PZLA 1XPRA 3WLQA 1TF5A 3WAKA 1GG8A 3H2SA 4GAEA 1HMPA 1O9BA 3S7TA 2IZ1A 2GZRA 3GBSA 3SQLA 3KR9A 3W34A 5LP1A 2ZZFA 3ZCXA 2WJZB 4ZZ2A 5HPYB 1OFHA 3L6DA 4QGAA 2HF2A 4XSVA 1GZ5A 2IZZA 3A9SA 2F1OA 1MEEA 1T5OA 2XMGA 1DRKA 1RW4A 4QICA 1WUJS 2EF1A 3KB8A 3K70C 4HWSA 3KBOA 4QYSA 5AJYA 2UXCB 1C1YA 1FP4B 2H8GA 4H7KA 5EIOA 2R86A 3UGQA 3DAFA 3DSRA 3IBGA 2K5UA 3GUHA 2JJYA 1YRAA 3AUJB 4YAFA 5JY1A 1GCAA 1TKBA 2LUOA 2V7XA 4DSUA 2BF4A 2E4AA 5B58C 1DBIA 2V7TA 1NYTA 1Y8CA 2DC1A 2WFLA 1KWKA 4A3SA 3CX3A 4MXDA 3BVPA 5BV7A 2CFSA 3WHLA 3V8EA 1G2OA 1ZRSA 1Z7NA 2EIHA 2ZTLA 1GPH1 1NR1A 1NXQA 3HCDA 4GWKA 4RTSA 3GJSA 3EIQA 4BLPA 1RYEA 1JUDA 4WNCA 4O8CA 3SK0A 2PS9A 3SIXA 1MO3A 1PT7A 3H5OA 3ZZ1A 2C2ZA 3VZBA 1U31A 3GFPA 5JCOC 3FCCA 3CS3A 3UK2A 1JIQA 4EIWA 4RBNA 5CB4B 5DHPA 3TNJA 3ANNA 4YRSA 4WXPA 2WP0A 4PYRA 1D1PA 1XMOB 2XUZA 3P0IA 4N12A 3EH1A 3NEPX 3RTGA 3GF4A 2Z5GA 1ESDA 3RQSA 2CT8A 2YFQA 4CCSA 4PTZA 2R1UA 2ZSDA 3L7CA 4LSGA 2JAXA 3VHLB 1SBTA 3K1TA 2GI4A 1WXXA 3LW7A 4G4JA 4LC0A 4QOFA 3IUQA 4MPDA 5JAHA 3DE4X 4PC2A 4GECA 3AOGA 1H4TA 4K86A 1RWNA 2F7SA 3HTZA 3NM5A 2NXJA 3Q2KA 1UBTS 4H2XA 1FQWA 1YF3A 1ZOLA 2UVPB 2R8YA 2Y4NA 1DC3A 3LJKA 1RXWA 1GKIA 2X1LA 5A0VA 1NRIA 4XEUA 1NUHA 2LRHA 4PC3A 3W6NA 3WLLA 1FTYA 2BFOA 5EVJA 5KQPA 4UQLA 5K0ZA 2RI1A 3KX2A 3TW4A 4MDFA 5BRAA 2VATA 1G55A 3D5TA 5BN1A 3PFBA 2UV8A 2Y68A 3MAAC 4UVHA 3TZ6A 3NHSA 3OY7A 4NTZA 1AO3A 2XNCA 1N2ZA 4ND5A 5J4LA 2ISCA 3K4HA 5FUYA 1XX6A 4KXFB 3W3AA 4EECA 2R751 2FPKA 3B1KA 4PLYA 1KQ3A 1GILA 3NV9A 1ZUHA 4JHLA 4RH0A 1TYEB 2W6IA 4FFNA 1BYIA 3FE2A 4RQAA 4ZA2A 3VA7A 1ADBA 3GFQA 4ZOCA 3IKTA 3QLVC 5BSRA 1NUAA 2BGIA 2CUTA 4U02A 2IYAA 4Q4AB 5F9MA 4KFCA 4XTVA 2QJTA 1B2LA 1R0RE 3AFHA 1HOXA 1XRNA 1T6NA 3OF5A 5JG7A 1O0BA 2PGXA 4WFKA 1H22A 3CB2A 5FRDA 2O8EB 5DIZA 5EJ5A 1QAOA 4F9EA 3WKBA 1NE2A 2A94A 4DCGA 3JTEA 4TV9A 2F1JA 1LBQA 4BFSA 2P9QA 1VQZA 2R8RA 3V6LA 1ORVA 1AK1A 5E3HA 4BTLA 2GKGA 2I8LA 3GFRA 5DKFA 5JMOA 1BGXT 4LJSA 4ZU1X 4Q19A 1GFZA 1JHVA 4M3NA 5G0TA 1QYVA 2DAPA 4CNQA 2CXQA 4LJRA 4NS1A 4L4UA 4BWYA 1OZ0A 2VNKA 4G5SA 1AOXA 1E99A 2AW5A 3P27A 1DQYA 4LW8A 1GIAA 3UKOA 1N1GA 1JNYA 1UP6A 5TV2A 4DV7B 2AFHE 1GL3A 3LZCA 2H08A 4JJKA 1OFTA 4HGOA 5SZIA 1YDHA 3USCS 3W2FA 1JVNA 2XE8A 3JZAA 3NALA 3ANSA 4QG7A 1GTL1 4AYTA 4DA8A 5A4KA 1AK2A 1FNCA 2Y71A 3UJ8A 2BGMA 3T52A 2XIQA 2ONYA 3II6X 5EMNA 4DUYB 2JJ8A 2GKOA 4B4OA 3RS7A 2QRHA 1Y3HA 1XF1A 5K3EA 4A10A 3KEFA 2EGHA 1JDNA 2FUCA 3T12A 2TECE 3RB8A 3HO8A 3QGMA 4Z4HA 3AFOA 4YRMA 2Y05A 3DMNA 3W5IA 4O2BF 1J1ZA 5EPUA 3OUTA 1CW2B 5IJ9B 5JS7A 1L7DA 3AIIA 4JBYA 4C30A 5FUMA 2YJGA 3UWDA 1VIYA 2B1IA 2HK7A 4Y6LA 1FVOA 4UPVA 2OFFA 2Q6OA 1XMSA 3RFUA 1JHOA 4GOXA 5BW8A 3UK1A 3OM1A 2R48A 3AM1A 1OASA 1AZTA 1P7CA 1ZWKA 3SJCA 4CKWA 1Y8AA 2GBLC 4PO3X 4LRSB 3SSOA 4BL5A 1LY1A 3FYUB 3DE3X 3Q0TA 3CKKA 4ED9A 2JCGA 2YJ5A 1OZFA 3DE2X 5GWXA 3JWIA 1SG6A 1JZTA 3D8BA 1VHDA 1BN6A 2VVTA 3NBAA 4IRXA 4BFXA 2OZLA 4YJHB 2Y1GA 3MF2A 1FS4A 1ZIYA 2VTVA 3PDCA 2ENWA 4TQGA 1JLMA 4PCVA 3G6KA 4YJGA 5E6RB 3GZ4A 1J39A 2XUPA 4U0JA 1OFGA 2ZS7A 1GU0A 4GD3Q 4XOUA 3AVUA 1MT0A 1VRCA 1GQSA 3M4NA 4CL0A 2WI8A 1YC2A 3DT6A 4UBJA 3SDBA 2WSMA 3O0DA 5EP2A 1AKEA 4FGLA 4GYJA 5HE9A 3G5UA 13PKA 4UFPA 5TT1A 3DBHA 3L05A 4Q9IA 2YV5A 3SI7A 4BUJA 2P2DA 4F3CA 3K70B 1GGFA 2VXYA 3T3NA 3GGDA 1E3QA 1WPXA 2EBWA 2YYAA 2HF8A 1G7RA 1T0JB 5DYYA 1O6BA 1EEXB 5CRIA 3O8QA 4N0PA 2ST1A 3RVJA 5FTLA 1HUQA 4EO7A 3MHPA 3R4VA 5I8PA 3VNSA 2MSNA 1P3DA 2H52A 1ADFA 3DNMA 3I72A 3DL7A 3NJRA 3SC2B 3TZBA 3AP1A 1YHZA 3GRZA 4UMVA 4D9CA 2E18A 2RK4A 1TUBB 4FT2A 4ZAXA 3FYTA 1S7CA 3EIEA 4XWTA 4AULA 1LSOA 2C7BA 2I65A 3VHRA 3IKLA 1NU8A 2V7BA 2A9KA 4LMBA 3QEMA 5ARCA 1CKEA 4FCCA 3N75A 3CRQA 3DTVA 3OEED 1PU2A 4Y1GA 3OIWA 4NU5A 4L5BA 3FHCB 4UVEA 3HLKA 2X5KO 3DT8A 1PYOA 2BEUB 4G0VA 1CR0A 1H4VB 2REBA 2V7GA 2CCKA 2XE7A 1K7SN 1C1XB 2QD4A 2DQ4A 3WX0A 1NX9A 2W22A 3LTNC 3ZCSA 1KY2A 1L5HB 1Z22A 2E21A 2QLNA 1ZI9A 4TWIA 3PR3A 1Q1QA 1UK9A 3PG5A 4X7RA 1TMOA 1ID8A 3JX9A 5FTJA 1E24A 1PFVA 1G4HA 3UB2A 4BNHA 1Q22A 1FU4A 1WDMA 3KPWA 1XA0A 3T7CA 5AI5A 3TL2A 2FE4A 1J2JA 1OVMA 2Q0QA 3QM1A 4QYWA 1DADA 4YRPA 4E08A 2IEYA 1GFWA 2XRFA 3PICA 3M49A 1ZISA 2CUKA 4CPDA 1P7WA 2XDYA 2ZAYA 4GL4A 3WB0A 4DM4A 5H02A 1DAHA 3ZV4A 3PD7A 4EGSA 4QVKA 3UMYA 3DDHA 1NVKA 3O26A 4PIVA 3WJ7A 4LX0A 4HCJA 3RYCB 1VB5A 1A8PA 4XGNA 4TXLA 5GPBA 4LKOA 1YTUA 4IFEA 2FG7C 2PUGA 2WEKA 1OOEA 4I5FA 5COQA 4R7GA 1QVWA 3GOQA 1H5UA 2XR1A 3CMQA 2AFIA 2H1SA 1R10A 4IJUA 3QWHA 3PPYA 4OU4A 4RABA 3E9QA 3UAZA 4CRWB 5IF9A 1PJ3A 3OLYA 3RGLA 2QUHA 4DCPA 1PVOA 3RUCA 3WRXA 2P5UA 4S0XA 3W5BA 4DSNA 4G0NA 4W9NA 2DBZA 4BGUA 3AR9A 3W4JA 3WZMA 1BQ3A 3TM4A 4EA7A 3AWDA 4ZVLA 1GPBA 3WGJA 3KM0A 1UP4A 2I22A 3KVYA 5JTUA 3A1NA 3DLAA 3N0RA 4DR3B 1DEOA 5ER9A 4AFNA 1GV1A 4PRLA 3UB4A 3R75A 5C2JB 2WJIA 3R7SA 1H2ZA 4OH1A 4JL5A 2COUA 1ECGA 3OJOA 3REFA 3TZLA 3WLMA 2I54A 5A1TA 1L4YA 2C4TA 3OCZA 3G0HA 1EM8A 3TRFA 3T3IA 1ZR2A 2GXUA 2Z8YA 1CNFA 2W2KB 1A95A 1T4GA 5EHGA 3ANLA 3WGMA 4OVKA 4V03A 5BURA 5HRUA 5BWBA 4YXFA 2JLRA 1XD9A 4ZICA 4B7AA 1UIMA 3MOSA 1A1VA 3GQVA 1YOBA 3WMGA 1T13A 1W5BA 2A14A 4S1WA 3VSBA 2ZYTX 3QVWA 4QU8A 4DLPA 1ZN8A 3FPEA 3TQIA 2O2EA 2TMDA 3ROXA 4NHOA 1WDTA 2JVKA 3K2IA 1MC5A 3N5CA 3NEJA 3PFKA 3X1KA 4AZSA 3FD8A 1U2GA 3ESXA 1SCAA 5DBFA 4D0SA 4RDXA 1PD1A 1KK2A 1ZESA 3KSDO 4PIMA 3X2FA 1FUEA 1SOMA 1FVXA 2FY8A 1L4HA 4NBLA 5AK5A 1VI5A 1VSVA 2LTAA 2ZI7A 4RZHA 1EGAA 1EBUA 2FZLA 1CDZA 2VJBA 4KQIA 4H7DA 4TSFD 3KAPA 4LK3A 4MJ3A 3TYXA 1FBTA 2Z83A 4G63A 1OYOA 1NXSA 4QSHA 3H8WA 2J30A 4FU0A 3T5TA 3UHAA 5B4TA 4YWJA 3RRNA 1P1IA 4R69A 1O08A 4RESA 1K6EA 4C7KA 2BUAA 3OM9A 1Q11A 4TWRA 3LECA 4P3KA 2PJZA 5TMDA 4CTOA 3CB4A 1ZUNA 4U2EA 5FPKA 1G2QA 1FDUA 3FAZA 1IWOA 3KK0A 1N6PA 5JMPA 2DGDA 1Z2NX 3O38A 1U7ZA 4EKYA 4CMBA 2VI5A 3GDGA 1TCBA 1GGHA 2RHLA 3JVIA 3NBMA 2ZXFA 3EVEA 3JARA 3O93A 4TTTS 2Q2WA 4B3HA 5LQCA 1AN9A 3U3OA 1ZJ6A 4YIHA 3D3NA 2JLQA 4EMSA 4E33A 1M66A 3SWWA 4BNMA 1NP3A 4AY3A 3NBXX 1UQRA 1ECCA 5D3MA 4LBYA 4MO2A 2ILVA 2R6AA 3D7NA 3IRVA 4JBLA 1NQXA 2AFIE 2Z08A 3O7MA 5ESWA 3SIWA 6REQA 3O7WA 1KMMA 1SKQA 1TM4E 3LRTA 1W1IA 2EKZA 1WQ7A 3RYHB 2C4KA 2MSWA 3LL7A 3KYBA 5EVCA 4DDMA 1IPHA 6LDHA 4WN9A 5DX0A 4O4HB 4E46A 3GDFA 4XGRA 4MKRA 5IAOA 2JGRA 1K27A 1Z5WA 2MJLA 4MW7A 4H6WA 5ALMA 1W4LA 1PJ2A 4D9BA 3J80A 2RGUA 5IANA 2PRYA 3UKJA 1VYVA 2FZ4A 2OCPA 1N8NA 1NI3A 4IWXA 4RPKA 4D2IA 1W8IA 1E20A 1E3DA 4LRUA 1WMSA 2FWIA 2NWQA 2NPOA 2O1XA 2QVGA 7REQA 1LX7A 5LQAA 4ZOEA 2WV9A 2I2FA 4FKMA 4YTEA 1YA6A 3FPAA 3L18A 5JR3A 4DJTA 1DIBA 3AB7A 2D5BA 2GYUA 3C3AA 3VZRA 1RWKA 4TYMA 3DXFA 1OREA 2ARUA 3KAQA 4GE0A 3RVRA 1NLUA 4RQBA 4WZ6A 1BQEA 2AFHB 2Z43A 3FHOA 1KXZA 1TKAA 1EU1A 2FEPA 3U5TA 3D81A 3FOFC 1PNOA 1ESCA 3A7UA 1PD0A 1X54A 2OXCA 2VRBA 2C3OA 3F74A 2R1TB 1L5OA 3PQ7A 4ZT7A 5GIOE 5D2CA 4CQNA 2I2XB 4TRRA 3WSTA 3N28A 1PQ4A 2ENUA 3P9QA 2MTBA 3U09A 1LRLA 2VPYA 4RH3A 4J1NA 3NT4A 4EB3A 2WTMA 3NDBB 1KSFX 2XWJI 3CZ4A 4P31A 5BR7A 3SZGA 2JLBA 5TMPA 2FUG1 3NHRA 3HXZA 1SCDA 1CR6A 2XUDA 2YZ2A 4QQKA 1NRJB 1HQKA 2H5JA 1JG7A 3LZDA 4PYOA 2M6KA 5ETJA 1EXDA 2J07A 2PUEA 1KZHA 4ARZA 1VJCA 2CVQA 3SJUA 5DBOA 1QIKA 2Y77A 1RXYA 4NSNA 4G41A 4TMYA 2F8MA 4CM9D 1Q7CA 4WMLA 2IDMA 4GPIB 4DJFC 2GEUA 1SBQA 4X44A 4X95A 1FFAA 4YR7A 3DZIA 3Q0IA 2GA8A 3WKAA 5I7RA 5LUAA 2ZRGA 4KODA 2HQRA 1G60A 2IVZA 3EE6A 2YDXA 9MHTA 3G9ZA 1U3GA 3I73A 4HAXA 2KW5A 4M0CA 1XCBA 4MPPA 2ZREA 3GA5A 4TM8A 4YONB 1MJFA 4P71A 1MFPA 1J00A 3ZE7A 1AQUA 1QIEA 2OMKA 3TTVA 4BVAA 4EVRA 3T5DA 2MR5A 1V8DA 3AHJA 1K5DA 1RI4A 1HLPA 3ADKA 4MQ6A 5DCUA 1CDOA 1WBJB 2QY6A 4WD3A 3A0RB 3TTSA 4B5LA 1U7OA 3PQ4A 4B83A 3FNBA 4PNPA 1HSOA 1N2EA 3FROA 3H4MA 1EFVB 1ONSA 5BNZA 3M3HA 4BE4A 2WC1A 3HWRA 4H7IA 2O2CA 4C78A 4LRXA 3F8SA 3ZTYA 5FI0B 1CYDA 5GOZA 5A9RA 3W7AA 1WCIB 5AP9A 4IGFA 1E2GA 2BEKA 3JQ6A 4RIFA 5T6BA 1NJ1A 1II8A 3KU4A 2FZKA 2P79A 1YCFA 3R3VA 4MUNA 3ZU6A 4BCBA 4F7DA 1A9OA 1J8FA 4KOAA 3VKHA 1WBDA 4B3XA 1M9NA 4MLPA 2B4YA 1ODTC 3CW2A 1YZFA 4O08A 3L41A 1CZNA 3KUUA 1IBMB 3FIUA 3UMJA 1NW5A 2QTWB 4A8JC 4JLDA 4BP8A 9ATCA 3ULKA 1GR1A 4LQ4A 4F84A 1N6KA 3GRCA 3PQ5A 3W5DA 3Q12A 2PUTA 3VSEA 3ZEIA 3AF4A 1RMQA 3DTTA 3GRUA 1J0XO 1IZ9A 3IBYA 4HZUB 4QUAA 3DBIA 4FHEA 1EMDA 1OKKA 2CDCA 1FDTA 1WHTB 1U1FA 2VDJA 3GARA 1L5NA 3AR5A 3V1NA 2DU8A 1H0HA 3O5AA 3WQBA 4C22A 3A25A 3KEQA 1GVNB 4KDRA 3M1IA 1C4KA 2J3LA 2P4EA 2HWYA 4JCCA 2E82A 2V7EA 5AD1A 5HIMA 3CTPA 3VR0A 3V2IA 3DS8A 5AVYA 3IAM6 3KT6A 4FFRA 1K9SA 1P77A 3R20A 2RGAA 2QRGA 1DWQA 3SQWA 2WU8A 4V1CA 1OBCA 3LX8A 4KG7A 2I5PO 3VH3A 2FUKA 4Q02A 1QR6A 1JI3A 4M9ZA 3TLXA 4FHZA 3CO0S 4E0BA 3QTBA 1BWPA 1VYHA 2LPMA 2ODNA 4IHKA 2YYYA 2EAYA 3EIHA 3SC4A 4G0WA 4BFVA 2IKSA 4HQ6A 1UQTA 2WQZA 3HR4A 4W8OA 1U8FO 2HPAA 3S40A 1ONNA 4FM9A 1X1EA 3HUUA 3AERB 3GCGA 3P9SA 5EXEA 4MAMA 4EELA 3HYNA 4EY7A 4DR2B 1T8TA 3F5DA 4QLAA 3DZKA 2G80A 2YICA 4F5EA 2DCUA 3GEEA 4WK2B 4XTZA 1P9NA 4K6KA 4MW4A 1NVXQ 1P4JA 3R7NA 2UYOA 1FTGA 2OZLB 4G5GA 1UAGA 1J0DA 2Z2KA 3TE7A 2LKDA 1YOVA 1V7CA 2O2SA 2WBLC 3FUTA 3HYSA 3MJ4A 2VP5A 5DI3B 2MSCB 5K0JA 5E6UB 5FB3A 3PT5A 3P8VA 2RGGA 3VXKA 2AYXA 3HG7A 1YKSA 3T3DA 2XD9A 2AVDA 1SQSA 4TN1A 1IVSA 4MW9A 3HKCB 2ZWIA 3BGDA 4QD3A 1P7PA 1C30B 1XXHB 3BQMB 4U7TB 4IIDA 1AV7A 2ZM6B 1FIUA 4QQRA 2GXQA 1JFSA 1X0XA 2P2YA 3DBHB 5LP6F 1EGMB 3M33A 3OQIB 4Z0PA 2C9MA 3HFZA 1IJKA 1XTTA 1Y8QA 4Z4QA 2IHVA 2QRLA 3IQWA 4WH0A 1Z2CA 3M9WA 4N54A 5L3ZA 4D8WA 5IXSA 1TTQB 4WXMA 4GH5A 4R9NA 3SEQA 2J9ZB 4P54A 3D6NB 2CYAA 1OH7A 2WHQA 4EJFA 4AICA 4J16A 1UC5B 1Y9DA 4A27A 1OI3A 4AXXA 3Q8KA 4KPUA 2I7TA 3ELWA 5L53A 5BSUA 3KWJA 1UMKA 4L4YA 4GQAA 4XLTA 3RPEA 4C0HA 2ZBQA 4CG1A 1ZWLA 5A5DA 4ENSA 3JASB 4E1VA 1GTSA 4N0DA 3ZHSA 2I99A 3L2ZA 2Z4RA 3C16C 3RIEA 1YJ5A 5E2BA 4ZPJA 2EV9A 3W78A 4BMVA 2P9EA 4Z4IA 2C00A 4KE6A 2DT5A 1KWGA 2OV6A 2PGDA 2V7PA 3OX4A 3SDZA 1UT5A 1Y1RA 3BYZA 4AJKA 4EG0A 1UXGA 4FFSA 1OWOA 4HAIA 3F6CA 4EEXA 2C78A 1MG5A 4LJKA 4X20A 3UO8B 4QG3A 2D2FA 2Q8QA 3IVMA 4CMIB 2HBZA 3JZIA 2OILA 3C1OA 5ALLA 1MO5A 1AXRA 2C61A 2QL5A 3H16A 4FOPA 3WJ2A 4E2ZA 4MIEA 3GI1A 2PZGA 4BDTA 4BGEA 3B60A 3PI6A 4PZDA 4WACA 3JATA 1YUNA 4JITA 5P21A 2AVNA 4DIMA 4ZI7F 1QHNA 2B69A 4CI9A 5G53C 5LZ2A 1D7AA 4DV2B 4P0QB 1PWHA 3T61A 5ARDA 2EQAA 1O4WA 2XX3A 1PNVA 3O4HA 2XNKA 2CD7A 1M75A 2B1GA 3SDSA 5K6RA 2B99A 1WE2A 5IK2A 2FPXA 1GADO 1LNZA 4P71C 1EVJA 1Q3TA 4KWHA 4M49A 4UP8A 3CNBA 5EJ2A 3R7LA 2C7IA 1GN8A 2DFDA 4IAOA 4GYWA 1KYXA 4UCWA 2A5YB 2O0JA 2ZR0A 4RIEA 4BQRA 2X9LA 1WMBA 3TOCA 5KYXB 3CN7A 1NWHA 3ZNPA 3WL8A 1P5FA 3IT0A 3VKGA 1U0SY 4HGZA 1OMOA 4DABA 4F4FA 5L40A 2D0IA 2Q7DA 3PIRA 1A96A 1MT3A 2L82A 2UZAA 5DRTA 3MWEA 5JFOA 4JNCA 2X7JA 2ZBVA 3E7FA 4FOTA 4MUFA 1KYQA 1CEQA 1NE7A 4DEXA 4LZZA 5GAJA 2UUAB 4DREA 4MVCA 4DMLA 8ADHA 5J1SB 2RG7A 3ZE0B 1MAAA 1S3FA 2EFJA 3F4KA 4HKTA 3ZDCA 2KWIA 1V8FA 3BFVA 3QG5A 4X1IB 2XZPA 1YS1X 3EAFA 3TQTA 2A3RA 2V1XA 3PPXA 1TO1E 3ND7A 3NRCA 3NUGA 3QXCA 4JJZA 3R76A 3W3AH 4CIDA 3IG2A 1QBGA 3BD7A 3OZ7A 4B3IA 3H9JA 1IWBB 3KPVA 1T29A 3HABA 4MCHA 5AKYA 2GUGA 1I94B 1TU4A 4JT2A 1DOHA 1MFZA 1P2UA 3GNTA 1FUIA 1GSIA 3B51X 1HA3A 4HDSB 4YFYA 4A8JB 3HZOA 4N7BA 4ONEA 4DDKA 4DJJA 5LQMA 3KQLA 1UPBA 3AYZB 1TUGA 3MWFA 4PGAA 4MS4B 3AVTA 5K9ZA 2OB1A 2B8TA 2NTEA 4A9AA 1YBAA 3RJ9A 1H4SA 3Q3GE 4J9UE 4OJTA 1NW8A 1X7ZB 2G40A 1KKUA 4BIIA 1JKIA 4C6HA 1OWLA 2JAUA 1LU9A 3L4KA 4M9CA 4KNYA 5IJ0B 1U1CA 2QZPA 4EO4A 2BGUA 3UAGA 4WPGA 5DLYA 3A0UA 2DLCX 3AK4A 3PFNA 3GWZA 3OM8A 3G2NA 4OMCA 1JA9A 4GKVA 4M7OA 3TKYA 2PKQP 3CW9A 1OD6A 3D5QA 3P20A 2AIRA 3IAXA 3IUSA 4U6NA 4ZAZA 1XHEA 2G6TA 3WNCA 3TBKA 1DAEA 3T9DA 2V5VA 1C7EA 4RHCA 3DMYA 4WT7A 1CXZA 2KE5A 2VN8A 2DB3A 1J09A 2AGVA 5AICA 1GPDG 5TVKA 4DLKA 2NADA 3B6MA 2PUDA 1ZPDA 4H59A 4BNGA 4C4ZA 4R8MA 5CDUA 4ZZ1A 5KUTA 2AG8A 2X4IA 1NAIA 2XE4A 2ZYIA 1JHZA 3HEMA 4JJIA 2VQDA 1YL6A 2HU5A 3TJZA 2FFRA 4QU5A 1FZTA 3KFUA 1RE0A 1T4CB 3CCCA 1E9BA 5EWMA 5FPYA 1Y42X 3OIFA 4KPFC 4P0PB 1KH3A 4UNNA 3ACDA 3VI3B 4UAUA 4AJOA 4B43A 3IURA 1NR5A 3V34A 3R7BA 1TDJA 1M1YB 1QXSA 1D2GA 5A0TA 1AKUA 1C0LA 3BF8A 1X7GA 2ZR2A 4IH1A 3M6UA 1I4EB 3MJEA 3P9NA 4MKGA 4DAOA 3ELBA 1KE2A 1E5XA 4PYJA 3QOWA 4B4DA 2YV2A 1SWVA 4GIBA 4ZO8A 4YMVA 1TYCA 1RI2A 3B1FA 5JADA 3LQRA 3THYA 4GVLA 3DMHA 4DCTA 4MO9A 2E0IA 4IVQA 4NV3A 4D9IA 1GU1A 4PN3A 2HTFA 3L6EA 5KX5A 4XGIA 2DPLA 5KQLA 4B8WA 4IHJB 4YT2A 1EJ6A 1F14A 2PYIA 4QATA 1YZKA 4DV4B 4CHGA 1WS6A 5IEJA 3UATA 2ATVA 2AV6A 4FN4A 5CBKA 4CH6A 4NOMA 1E9RA 3KC2A 1I6LA 3QUCA 5FAKA 2POCA 2IXAA 1WHSB 3TWOA 2AN9A 3H2GA 3KWFA 4FOOA 2NS6A 3OFND 1HETA 2AYYA 3EVCA 4JQYA 2W70A 3W8RA 4WEQA 5BMVA 4F9TA 3BT7A 1TPZA 1Z2OX 3HYTA 4YGYA 4XVCA 3GPIA 2UUCB 3GAZA 3RBVA 5I6DA 2JHGA 3TSAA 3RV4A 1N3IA 1XTIA 3JQEA 1J9EA 1EFPA 2ZIGA 1BIBA 4JN6B 1VLZA 3FAKA 4YAGA 5IU6A 3MB8A 3LV8A 3OKAA 2G7MC 4P7BA 5H82A 2ZDHA 1VIMA 3TLKA 3I9V6 4B47A 1NQUA 821PA 3GCZA 4EY3A 1M8FA 1V4VA 2ZBRA 3I34X 1G5QA 4HLUA 3M8KA 1HOTA 2PK3A 4ZV7A 3LC0A 1E77A 3ENQA 4IX1A 4TKUA 5A7HA 3K53A 1YFJA 1UJCA 2J1LA 5K3CA 2NSYA 5TDHA 1FJHA 1TJ5A 4DSAA 3GEPA 1VHQA 3BMNA 1DIRA 1HT1E 1XK6A 2A0FA 3N8KA 3NUZA 4LAFA 4QQFA 3U1BA 1N9WA 5K8LA 3EGIA 3S29A 1Z0SA 2BRUA 3BXGA 1NNSA 1OXBB 2PQ2A 4GOLD 4KJZA 4Z8YA 3IVGA 2NXEA 5A62A 5B2EA 3PQ8A 3A10A 4P32A 1GD1O 1BH2A 2Z3VA 3FGZA 4Q82A 4GL2A 4K28A 2XYQA 1IN6A 1JFFB 3O4RA 4YCUA 1HFWA 4G4GA 4OSOA 1Y4ZA 3CZ5A 1E8NA 2Q2NA 3OHMA 5FA8A 1BMTA 1NLFA 5I3ZA 2REOA 4PXAA 5I9IA 3R7WA 5JJCA 4Q12A 1X39A 1GUZA 3WA6A 2XMDA 4IRMA 4Q9HA 1E64A 1SUPA 5LLSA 1OPRA 2VHUA 2BSQA 3THXA 4G5HA 1GTVA 2O1WA 3CX7A 1ODJA 2Z57A 4WE3A 3C5VA 1USWA 5JAPA 1M0SA 1KFCB 3N0XA 4RHEA 4UDYX 1SC6A 4Q4CA 1E1QA 1YQQA 3I5YA 4XIJA 2GBCA 3C4JA 5BWLA 3NVMB 3Q7EA 4OIFA 4RE5A 2CW5A 3AESB 1XAJA 3WGQA 4CMKA 1H66A 3RACA 1JEAA 1W59A 1XKTA 4FGJA 4PM4A 2H9YA 2QYHA 4BAZA 1BMQA 5CTJA 4YMLA 2PMEA 3EXHC 1P9RA 5B2ZA 1A9QA 1FDOA 1X1DA 1ZDMA 3HMQA 4Z1MA 2FTKE 3GLKA 3MT0A 4D42A 1JHMA 1TGVA 3P7MA 2QTLA 4BWFB 2JDIA 2QM8A 2YJZA 4N65A 1UJBA 3H83A 3IP6A 2QMUA 3H8VA 1L5LA 5G0SA 3STHA 4HLQB 2DXUA 5EGSA 2NO9A 2WYIA 4F97A 3A3NA 1R6DA 1KI1A 4BWGA 1ZXXA 3TD6A 4FGUA 5F1PA 4ECEA 4GVPA 3HBLA 1TW3A 3O8OA 3OQBA 5ALNA 3UTDA 2ZP1A 2QG9A 4BO8A 4D9EA 1E1CB 3ZGZA 1UBOS 3UT5A 2VEDA 2PD3A 1E9SA 2BI7A 3MGBA 4QU0A 2WJHA 1JEJA 1MUUA 3FCYA 4C9BA 1SXQA 4GMFA 3WQHA 4OOFA 1CQIB 4NATA 4OJYA 1EIWA 1NN0A 2GF0A 1NL3A 3P5BA 2PGAA 4UREA 5CB8A 4Y2TA 4PNEA 1PAUA 1ZBQA 1H2RS 2INGX 2GBIA 3ED5A 4QTZA 5DNEA 4DR5B 4TWAA 4WECA 1ORRA 3I9LA 4NFHA 4L9SA 2CXRA 4NU6A 4DQLA 4RMFA 4YAKA 1DQRA 3WWDA 3B12A 1EWKA 3N9IA 2PZJA 3GBPA 3VHXB 3VYVA 2AXPA 3A9TA 4QASA 1UPXA 1L5FA 3RTBA 1QF6A 4TTJA 1RS0A 1Z6YA 1UC9A 1NHGA 4V1CB 1XLUA 4E13A 1JLHA 2Z58A 2Q7HA 2JRLA 4O4LA 5A7FA 2Q6TA 1N0IA 2FV8A 1RQNA 1IUKA 1H9AA 2D62A 3HWWA 4KFTA 4QYTA 5DM0A 4EW3A 2BFBA 1SJ9A 2IPMA 3T9EA 3AW8A 4N3AA 4BO9A 2Y1XA 3RC9A 1PZMA 3LPMA 2XECA 1CY2A 1TT7A 1KU6A 1V3TA 2G5CA 5G4KB 2OG2A 3JPYA 3OKFA 4FCVA 1Q95A 3WI7A 2AI2A 3PJDA 5KKAA 1YBFA 2Z1NA 3RVBA 5EJ9A 2IYQA 4ZQGA 3KFVA 2FW1A 3PC4A 4B6PA 1O3YA 5AHOA 5AI0A 5BMOA 3OT1B 2CJBA 2B98A 3K32A 5LKRA 2ZRAA 3LIIA 2C03A 1T2EA 1WABA 1KC3A 4LDZA 3UF0A 2OD9A 5EQFA 4NU0A 1BWQA 3NONA 3ROMA 2HEGA 3L5KA 1P1FA 2QN2A 1GPAA 1ZOSA 2QUJA 4UHEA 2A0XA 5DYWA 4AN4A 1CV2A 1IHPA 1OB5A 1NQTA 1YOVB 3DBLA 4FEYA 3BGVA 1KI7A 2JGLA 2VR1A 3EY4A 1R8JA 3FHLA 4D6PA 3KVVA 4UTVA 3VQTA 5DSTA 3V8PA 3LLUA 1HORA 1M1ZA 2ODRC 1U6KA 1K8XB 2ODBA 2BYTA 4XX0A 2P9YA 1QR2A 4LIPD 3RODA 3BE4A 3VV3A 4MVJD 2BZSA 4NQZA 3NBUA 3TB6A 3L0PA 3WBBA 4MAAA 3RSHA 3X1MA 3EWAA 5GTDA 4W99A 1OV6A 2BKUA 3KZVA 5D5PA 5EP1A 3SX0A 2CFTA 4LRWA 1TEVA 3PUYA 2X6QA 5A6SA 4CN8A 3LHKA 4FOSA 4I08A 4V0NA 1W96A 2JBAB 1SPBS 2PZ8A 4N3CA 3GIWA 1J33A 5EYPB 3AUAA 1YJAA 2ZVDA 3DKIA 4M1EA 1TM7E 4EA9A 1W9HA 2WSSA 1LBHA 3VO8A 7ABPA 3CVUA 4HX9A 4HFJA 2GK6A 2N42A 3EXIA 2DQKA 3DDUA 3PKIA 3QE3A 4AT1A 1S3IA 1F9EA 3A4YA 3C98A 3MSXA 1QSGA 2HDWA 3ND9A 5CUQA 3SF0A 4E07A 3EJ6A 4IDFA 4NZNA 1HEIA 4HLUC 2E6KA 3JS5A 3JU3A 3M6XA 1JDZA 1JWAB 1N2BA 4CIAA 2V58A 2EATA 1YQWA 2VZ0A 3KEMA 3LCUA 4RS3A 1JAXA 2HPZA 1KP9A 1QQAA 4NFYA 3QPBA 1I7QB 4CM3A 3AV0B 4QBKA 2P1ZA 2VC2B 4GP6A 4KAFA 3EC1A 2P40A 5D86A 5HS4A 1CY4A 1LPNA 1ZR4A 2IOFK 4RVGA 4W5HA 1KR2A 1NVVR 4WV3A 3VSDA 1XNRB 3WLRA 3L1HA 5J1TB 3RSLA 3U6BA 1T3ZA 5FTNA 3K72B 4ZVMA 1TL7C 4PSAA 3K1YA 3RLFA 4F4CA 3EUAA 3DFUA 1HZJA 1JXAA 4IJKA 5IVPA 4RLSA 2XBMA 2PLNA 1PHPA 1KJ8A 2GA9A 4HNSA 1IXZA 4LJLA 3T3MB 1XT6A 3EHEA 1CEXA 3ZNOA 1G8JA 4MQFA 3G0GA 5CB6A 4AWBA 3PEWA 3PFFA 4LXIA 1P31A 4NEQA 3BD8A 3CUVA 4PSKA 1NBMD 2HMAA 5IAJA 3D7MA 3IERA 3N07A 1OBOA 2B92A 2C2GA 4MS1B 3PGKA 2FPGA 2L17A 1ATIA 221PA 2Q3DA 3JQ8A 4MIKA 1ODKA 3OU6A 5AM5A 4EPTA 2C04A 2J46A 2CLHB 3MD9A 4Y98A 5ULLA 1EXWA 3VX3A 3WXMA 2IYUA 4FJ2A 3B8HA 2EW1A 1WW8A 3LU1A 4EBFA 4DQ2A 4FYPA 4EZEA 4WY8A 4ZJZA 2IC5A 1ZD8A 3EXHB 4RE6A 3CE9A 5U9CA 3VBBA 1N2OA 3ESRA 3CZQA 3ESDA 2JAQA 4LV5B 1PTJC 4OKNA 3VNVA 2C54A 1YRYE 1B70A 4IOJA 4ZOBA 5EXXA 4LC1A 3AKEA 1NNHA 1AKTA 3BKWA 4GWLA 4RVNA 5CJPA 1W4RA 4TX1A 2CLOB 2QL7A 3T5BA 1S9HA 3PP8A 4NX2A 2DKFA 2ZRHA 2DY0A 3P9CA 4PPNA 4RULA 2BGGA 4QDKA 1K4KA 1LTQA 2BKLA 5B1EA 1N6LA 1IUNA 1Y33E 2Q0SA 2BMEA 2C94A 4ZVSA 5CXXA 4BNDB 1E22A 3FJOA 2NPFA 1ZAKA 1XTRA 1ZD3A 2KX7A 1E7MA 2V54A 1KDRA 1R0XA 4KMRA 4IV5A 1JTFA 3SXUA 3ZZUA 4OGKA 2C5GA 3L93A 4BVKA 5HUQA 2M9MA 3HGMA 4NONA 1G9XA 3OAAA 3K16A 3V00A 1JP7A 3GRAA 2AMCB 2GB4A 3H2BA 1L4UA 2LDBA 3LDGA 3TLBA 2R4QA 4IL5A 1AKNA 2ZPUA 3HB7A 2AKAB 2LD4A 1UKAA 3PQ3A 2N3ZA 3GJ7A 1A4RA 1G4UR 2NU8A 2UZ1B 2QHSA 1DPFA 2JGEA 3SKXA 3HXPA 4RDIA 2B36A 5CFPA 3SXJA 1LTKA 1JJBA 1REQA 3ESQA 4MJXA 2YKGA 3ZXIA 3BTUA 4HVTA 1XDGA 2A30A 4OXKA 4B3FX 1EHYA 1USUA 1LK7A 3AGQA 4TZTA 3ZZ0A 1DDOA 1FXSA 3SY8A 3ZDQA 1RIIA 1UBJS 3DAPA 2AN3A 2V6MA 3V3KA 4FLMA 3DCJA 5JO0A 5I8WA 3GUVA 4DBLC 5J2UF 2M2IA 4IVRA 2IOFA 2B7CA 3GVXA 4D9HA 4ICIA 5B64A 3D0OA 1PVDA 3FWPA 3QVXA 4NV1A 2WU1A 4YY3B 4MAFA 1V9LA 4J7CA 5LOVF 3K05A 3P0EA 2E4VA 1ZGAA 4KTTE 3PHCA 4R8VA 3TQSA 2OKCA 4DIOA 1PV2A 2EWVA 4C0JA 2ILTA 1VE9A 1QO9A 1A1SA 2FLWA 2PM8A 3UXHA 1ZO8A 2Q8NA 3FPGA 3COYA 1QGDA 3HACA 4IQGA 3P1JA 1YGYA 4XGQA 2QX4A 3X2EA 2BFWA 4IY1A 1BJTA 1AU9A 1VC2A 2DSTA 2YC4C 1Q0RA 3ZIAA 2P6RA 3F8TA 2PWAA 2P2SA 4ZEMA 4ZYLA 1KY3A 2JZNA 4BHTA 4BJ3A 4GP7A 4NHEA 4YCVA 4MUAA 3A4MA 3BRWD 1K5GA 4WQMA 2ZUUA 5TVGA 2PIAA 4L5IA 4EKGA 5DHFA 4JUIA 1POXA 1G8YA 3UAVA 1S1CA 4OH7A 2DFNA 4MITA 2CFRA 3PRJA 4D57A 1RHMA 3U7GA 3I6BA 4XEHA 3T99A 3MFQA 2VZ9A 4XFKA 4WA8A 4Z4EA 1WQWA 1BRMA 3F7NA 2DWQA 5F3DA 4CF6A 4CQMD 2B5VA 3R0QA 2C0CA 2VL7A 2O7VA 1GUDA 2PANA 3A05A 1KMHB 1JHUA 3AMVA 4LXGA 4EQZA 5KWJA 3N70A 4P5DA 3C8DA 3ZVKA 2B3TA 2OFPA 2PA3A 2WUEA 2IPNA 5BQ5A 4FSXA 3JQ7B 4IXMA 1XVAA 1BO6A 1JXMA 2WTBA 4UPDA 3RCBA 4XUCA 3ZU2A 4AY6A 4IOKA 2FDCA 3JWPA 1B42A 3EMKA 4RTQA 1MORA 2GHQA 2EHJA 4JR0A 1Z0UA 3AUSA 3MINA 1UKBA 4P4NA 4MA4A 5H4HA 2NU9B 3SHFA 4BZQA 3B36A 3F6EX 3IMFA 4J91A 3PX3A 3TEGA 1E1RA 1O57A 3LX4A 3P9XA 4KGXA 2P6UA 4RVUA 1K4MA 4BKMA 2RH4A 1J5PA 1L4FA 2NZWA 4OX9Y 1KZ9A 2DR2A 1X14A 2NXWA 3RAPR 2QSUA 3KDAA 3UHFA 5TF0A 2WKWA 1WMAA 2RHMA 5AOCA 4MSUA 3ADCA 3TOSA 1K7YA 3IP3A 1JG2A 3DBRA 1SK8A 3TQOA 4LWZA 3HY4A 4OATA 2FZCA 3M6LA 1JHXA 1BHJA 1BJRE 1J8DA 1ISPA 1HNZB 1V39A 5HXAA 4UD6A 1WSDA 2WKQA 3THXB 5JSYA 3Q8LA 3UK6A 2AHRA 3BM5A 3EUEA 4FGKA 5CH8A 4IUBS 1M1NA 1QHHB 1ENOA 2Z0MA 4MRRA 1N7JA 5DGTA 3LW8A 2OHVA 3MCAA 4HXEB 3GLFA 3SJ7A 4HH4A 3ZWYA 2CY0A 4YLYA 1HGXA 4KV9A 1I32A 4TN5A 3TPCA 5JAOA 2NQ2C 3REQA 4ZVVA 1E4OA 4OV6B 1RYHA 2EFGA 2JVIA 4PX3A 2ZUTA 5THQA 5K0SA 3G9TA 4WKBA 1JR3A 1J25A 4J49A 5CXQA 1A3CA 3TUPA 3ELDA 4N6NA 1DGQA 4WY5A 3B6EA 1KXJA 1RBYA 2HWKA 3MWDA 4KQJA 4NBNA 4RY0A 2R8OA 5AOAA 1HZZC 5ECGC 1JEDA 2R6ZA 2GNAA 5C8XA 2P91A 4IQ4A 2ZAOA 1EUDA 3R4CA 5EUBA 2G1KA 3ZDFA 2N9UA 1W48A 3O8OB 5LU8A 3WAGA 3U0BA 1U0EA 2BFPA 5B55A 4G0OA 4GR9A 3MCTA 2W4QA 2DJZA 4EG8A 2CV2A 1ADGA 3A9UA 3NHLA 2YWFA 1FDRA 5CT5A 1J5EB 4RPGA 1BU5A 4XI9A 3B6JA 3LD9A 3AEKA 3ZKAA 4DEYA 1C8LA 1EVZA 2HR1A 4YV1A 4B48A 1S2DA 3CM0A 3K2QA 3B8EA 3H1PA 3B82A 1SVLA 2O8FB 4PHGA 3ZDYB 4Y2JA 1XDWA 1U0NA 2D0OB 1Z2EA 3D2CA 1WQ3A 4JYBA 3S55A 4F46A 5BSKA 2SHKA 4OGLA 4HNQA 4Q1EA 3STUA 5CFQA 4L0QA 2XEXA 2PWBA 3HLYA 4W5NA 4NR0A 2QTFA 5A4JA 2PSFA 1K63A 4Y2RA 3PWSA 2Z5FA 4PO8A 4DB4A 1QP8A 2H31A 1IOWA 1CJKC 1XZIA 4BO0A 3FVWA 3QTLA 3EW9A 2OPBA 2R00A 4RIGA 4DWOA 5ITWA 2BV3A 1DIHA 1R0ZA 2HF7A 2JIDA 2Z6AA 4MV7A 1DAIA 1RAGA 4H16A 5HZMA 2BFEA 2UKDA 1SFRA 2GM9A 3QXGA 2TS1A 1DU4A 4M1TA 5ENZA 5FUVA 1VL1A 4MCJA 4AUNA 1F48A 2QIOA 3LUGA 3NHKA 2FE1A 4EUNA 2ZKIA 3H2IA 1C3VA 4AN1A 2OT3B 1E60A 1U8EA 4XVUA 3I83A 2A5DA 1HE5A 3DH0A 4GMDA 1CY0A 5MDHA 1JH9A 3QBTA 1G66A 4DQ0A 4OUDB 2EU8A 1Q7GA 2R7KA 4L27A 4TWJA 4UVDA 1UFRA 3GLFE 1JDBB 2DUNA 1NW6A 3AEQB 2CF6A 3DBLB 4XLLA 4QGHA 4L08A 5GIPE 3PRYA 3KHSA 3E0XA 3QXHA 4OBXA 2PFSA 1QZTA 4XE5A 4YI5A 1MLDA 4E7OA 2R4UA 4J3FA 4YLEA 4GDFA 1UCFA 3U7QA 1JR3E 4XX0B 3DF9A 3MJCA 4EUHA 2F3UA 3F7OA 1GNSA 4RMGA 1A8IA 4BMOB 1N9GB 3LY9A 4L1KA 5EJGA 5F4ZA 3K2EA 1KQGA 2RHSA 3TCXB 1WZEA 2CLSA 5BSGA 1JKFA 2D00A 1Z06A 3I9MA 1BU8A 2VYCA 4HO1X 4WJ4A 2ZSUA 4EGQA 3AG5A 4PYKA 1IONA 2DTEA 2EKLA 1H3FA 2ZIMA 4P73A 2G83A 1MN6A 5I7EA 1S7GA 2WF7A 2LZ0A 5KKCA 3Q8MA 3HYLA 2QZJA 4Q01A 4HAYA 4KZPA 1F0KA 3P71T 2ZSHA 5EKXA 4D81A 5ISMA 1SKYE 5B37A 1FDWA 4D4KA 2L0XA 4Y1RB 2VSQA 3E4CA 4OCZA 4BKUA 2GR9A 3A06A 2IIBA 3KZ1E 2W98A 4GPBA 2NSJA 4CV0A 3TVTA 4PLHA 3ZTTA 2XA2A 4QO8A 1DX9A 3TD9A 1TQHA 2B8EA 5JRZA 3AIMA 3T3OA 3PUHA 2D7DA 1JKJA 3NTQA 4MDYA 4ZMSA 2HBYA 1X70A 3G2PA 4TQUS 4OQMA 5DLDA 4QE3A 2MCFA 3V7WA 4RTNA 2YRFA 5JALA 1QTRA 2HDNB 3QWAA 4OHRA 1DTWB 4FYYA 4WK6A 3OZIA 2VPXA 3FSGA 1Y9JA 2IPAB 4PAWA 1M0WA 1QIMA 2ZYWX 4ESHA 1DUVG 2CLDX 1KZYC 4ZHSA 2NYRA 4I5IA 4KN5A 3TH5A 2L18A 2O14A 4DV5B 1KZ7B 4OJNA 1Z4IA 4I19A 5FOXA 1XCPA 3NW9A 4K6GA 3TR6A 2QN1A 4BU0A 4B6FA 4D4JA 5BPFA 1EK5A 3L82B 3VVBA 4QZVA 4IO0A 1N2HA 2QRNA 4P5EA 1QS0A 4BQPA 3K1AA 2GZ1A 4LX8A 1YS4A 4RJKA 4MQMA 5C8YF 2BKVA 2ZFUA 3TIGA 3JZMA 3JQGB 2MYPA 1FJXA 5KC9A 1AUOA 2H2HA 4Q9LA 2RAVA 1I80A 2FNAA 1XQXA 3KKNA 1IG3A 1U9ZA 2BHLA 4FDMA 4DPMA 1XVVA 3QVMA 4BV9A 2EG9A 5U4XA 3WMWA 5TB5A 4BRUA 1HL7A 4R40A 2H7XA 4M6WB 4DS3A 1XWFA 5JXGA 1NN3A 4OA5A 4UFNA 4WI1A 4ALJA 1E0SA 1PSZA 1QGUB 1Z74A 4MARA 4IGIA 2H51A 5FH9A 4IJQA 1IXSB 5HCUA 4N3BA 3N05A 1V2HE 3ZDRA 3UCFA 5KQRA 4GKAA 5LNK6 2PCJA 3M4PA 5DBEX 3W8DA 4F38A 3N53A 8OHMA 3IQXA 2GF9A 5EJ6A 2JW5A 1OAKA 3TX2A 3RF7A 2DY1A 3N8GA 4WKCA 1PBTA 3D6AA 2BJVA 5FUWA 1OFVA 4CEJB 4BWAA 4AMYA 3ZW8A 2GJ4A 1PJTA 2WTXA 4MP3A 1QDUA 3TKAA 5KTYA 2D3WA 4LI3X 2C20A 4CWAA 4ZFNA 1SUFA 4H3HB 4M76B 1RP7A 2W2NA 4KQXA 5AJTA 2VQEB 2I2BA 4W5JA 4AUMA 3IP5A 3T0FA 1Z4OA 3TLYA 1CRQA 1ODFA 2OBLA 3U3XA 4NWIA 5CT9A 2AOUB 2G5PA 3VYTB 2X9NA 3OHPA 1V2GA 4FZ5A 2VNJA 4M7WA 4KRGA 2F9MA 2GEKA 2IT1A 3HB9A 2Y0DA 2GM4A 3ETHA 2P3QA 3VTKA 3AY0A 1ONPA 2CB9A 4K88A 3BEOA 4HBGA 3TIIA 4RELA 5HF5A 1BGWA 1MOZA 1PGQA 1UXHA 3KP1A 3L4SO 5EJIA 4MGYR 1C3OA 3W5UA 3C24A 1Z37A 4IH4A 4N18A 1NX6A 3IGFA 2XHZA 2B78A 1AHHA 2PBFA 3JQAA 2QJFA 3OP4A 4QWWA 1ZVMA 2PMFA 1RLTA 1GRNA 1P4GA 3B3JA 5EL0A 3C45A 2JHFA 1Q1NA 1IY2A 2R00C 2DQZA 1Q2UA 3WLAA 4WGGA 4GO1A 1UDBA 1EFAA 3Q2OA 4Z1OA 3R6DA 3FPHA 2YDYA 2NTNA 3Q85A 4M1MA 3SEFA 4U7DA 3T7IA 1L9KA 4ZJUA 3FMPB 1VIVA 4YT8A 3W5CA 2QP4A 4KHZA 1IM5A 3B7PA 5CT4A 2I67A 3G17A 1PFQA 1MOSA 4F3NA 2O8CB 4LJ6A 4I2VA 5E4JA 1KDYA 5C46F 4H1HA 5AVKA 1WNLA 2UYYA 4J1TA 5ITVA 3A6HA 4NJMB 4ZYVA 4X61A 3UFGA 1OBFO 4GBJA 3TZHA 2GT1A 1TPYA 3LHDA 5CDYA 3FJ1A 3P9IA 4MS4A 3RR2A 4EPXA 2X3UA 3R6GA 1T6XA 1YI8A 5JCXA 5IULC 2RH9B 1NLMA 4H6PA 1XNHA 2R2GA 3QE0A 4KVZA 3AJ9A 3DZJA 1K6JA 1HFKA 3I45A 4GOJA 5F9FA 5F64A 2C8LA 5IUKC 3PNSA 4W8HA 1MIHA 1PDVA 2JK0A 3KQQA 2QW0X 3ZWPA 3QPWA 3TRDA 1SU7A 4IH9A 1I3KA 1KGDA 4K6HA 4E1AA 3G8YA 3MGGA 3NELA 1WZCA 2X15A 5KB3A 1U2ZA 3AVYA 1FYFA 4RIHA 4OIMA 3D43A 1J9ZA 1PS0A 2H1LA 1GITA 4O8ZA 1NNI1 3FUVA 1QGZA 1VMIA 1YI1A 3V8LA 1ZXLA 4Q9NA 3TRJA 2OBYA 1LUAA 1ZU5A 2EAUA 3E9HA 1KKLA 4FYHA 5EKSA 4A8HA 2WHYA 2YIVX 5LFAA 3TO5A 1W581 3L3BA 4CR6A 4B7CA 5B2FA 1P5ZB 3TZKA 1V1MA 1JQAA 3E9EA 2GK3A 3W8FA 1QIDA 4MYSA 1NSYA 4NENA 1JIIA 1EGHA 4GC9A 3TDKA 5C51B 1SCIA 4A2WA 5KC8A 2JLAA 3UEOA 3H5LA 4FKZA 3P2YA 2UUOA 4TS3A 4BUCA 2CNLA 1G9TA 3O91A 1EP2B 4ZK6A 4CMEC 3JR7A 5FFNA 3RC2A 3RGWS 3UW3A 5JH7A 1HL3A 1IY9A 2OAEA 4J0CA 3RIXA 5JY6A 1Q3HA 3K1JA 4LDNA 4ERNA 4H7JA 4KR6A 1M1XB 2NOAA 5MN4A 2C1XA 4YNBA 1Z33A 3RFXA 1K7CA 4Q3NA 3LQ4A 1ZOIA 3QI2A 1T9GR 3K70D 4EB8A 1GGJA 1IHOA 3VQXA 5DOZA 5FX2A 5H4GA 3GFTA 2ODEA 1EG7A 1YQTA 2DX7A 4URHA 3BL5A 1FFEA 1BS9A 5FULA 3WQSB 1IAVA 1OT5A 4HS9A 3VOAA 2XCRB 4KQKA 2C5HA 3VJKA 4XW2A 3JQDA 2PSHA 2ZDQA 3KV1A 3GVHA 5ALSA 2COKA 4AC9A 3U4HA 3T3GA 1ESZA 1JR6A 4ZDJA 1HYBA 1A9RA 3UV6A 3VC7A 4K3VA 4Q6WA 2GRAA 5G02A 1T0IA 5KQMA 2Y1WA 3AJRA 2HA7A 1JVSA 4Q9AA 3MGCA 1COWA 1U5AA 4R2KA 1F7UA 1IHUA 1P4RA 8AT1A 3JZDA 1VPDA 4JI0B 5F1OA 2MINA 1WOYA 3NBFA 4WZAB 1I7SB 4HAUA 2FPLA 3RF1A 4A0SA 4D5GA 4LVNA 4UDXX 3FF1A 4S35A 4BNWA 4QARA 1X13A 3IALA 2ZE5A 3U3KA 6ABPA 1PJBA 1P2DA 1XK7A 2R9VA 1HFEL 3HCRA 1A7UA 3N0WA 1ABEA 2IUFA 3O1JC 2C5EA 3JQ9C 1XCGB 4OHMA 5T4EA 3SYNA 4R0NA 3GLFB 3FWHA 1QFSA 4RFLA 4WKOA 5TSDA 4CLDA 2HIMA 2IZ6A 4TGLA 1Q19A 4X94A 1T9ZA 1ARZA 5JD4A 1U7PA 2YNMA 4XWYA 5DWDA 2A0UA 1ISGA 1C0IA 1KAHA 2BKEA 1T9HA 1SR8A 3ILXA 3QVGA 5ALFA 4NXMB 1T1JA 2CLEB 1DUIA 5TR9A 1IVYA 3TQQA 1A5TA 2Q1YA 3Q7SA 2HLDA 3UG7A 2FMXA 1OF1A 1D07A 4A6EA 2FP4B 1XEWY 3WSVA 2PUBA 2I6SA 1DBQA 1USVA 4KLNA 3SR0A 4G6ZA 2FXIA 2VRCA 3HN2A 4MKZA 3WY9A 4RTKA 2ZXEA 3HNRA 3KJXA 5EZQA 1F4LA 4XB1A 1ZK1A 5LP6C 4JI1B 3A37A 4DIKA 3M7IA 3TFOA 1NG1A 1KY4A 4MUYA 1DMRA 2FR1A 2Q07A 2OM2A 3WBKA 1O6GA 2IQIA 4NYJQ 9LDBA 2C9BA 3O74A 5CM9C 4DBLE 3ODGA 3B13B 1XVUA 1X80B 1Q50A 1SKYB 2JFZA 3IR7A 4UZSA 1RRPA 4ZN6A 4ND7A 1P2GA 3LBAA 3AEKB 3RKXA 3HVHA 1D4AA 1XZCA 3SICE 4YJ2A 1L7BA 3BMCB 3CWQA 3AVOA 3DVAA 3DKRA 1YS2X 2NVOA 2QMOA 2ZUWA 3LK7A 1B1AA 2G72A 2E5FA 4WOCA 2H2IA 4YEDA 4I50F 1VE5A 3UXEA 3JQFC 3EOZA 2PE5A 1E2NA 4L28A 1NONA 1VSTA 3GT0A 4N6GA 3ADPA 2GTHA 1KJJA 5AVOA 3OCJA 5CX4A 2PS1A 2ZJAA 3KRTA 3U4CA 3DE7X 3IDZA 3K71B 1WP4A 4GMGA 5BYBA 2QNRA 2I1QA 4AZWA 2W2TA 4BN0A 4C0LA 2QLFA 4R5HA 1P5RA 3PCRB 1ES9A 3A2LA 4CCYA 4P80A 3PTZA 3RQIA 3GP8A 4CVNA 2VRWA 5GGYA 1R0BA 3QW2A 4US2R 2DQSA 4JV5B 1JB9A 2A0KA 3I4LA 2MSLA 2W2MA 2W6PA 2Z04A 3P5SA 1Q1BA 4FUTA 4MK4A 3HMKA 4KE9A 3N2GA 2EYUA 4OO3A 4MVJF 1Y3IA 3JVDA 5EZ5A 3LT1A 1G17A 4URZR 3U1TA 1GUFA 5CDSA 1SCNE 4U2DA 2M6SA 1CJBA 2GXSA 5ALEA 2XSZD 1UWLA 4M38A 4MV8A 5C80A 3Q8XB 2VJLA 3QA3E 2P9CA 1Z3IX 2JRCA 1XKLA 5EZYA 1PJCA 5KYUA 2OO3A 2OHGA 2C7GA 4KIJA 1DLIA 3PZRA 4B8YA 1WEKA 1PJ4A 3IUEA 3ZOKA 4LHYA 1LPPA 4NG4A 4QRDA 1ZI6A 5HM8A 3D4IA 4TKMA 4R1NA 4YA6A 4BUZA 2V7UA 2PGLA 3Q1LA 1TLTA 3Q9NA 1NOJA 3TLGB 1R0WA 1XTJA 1DARA 3LSTA 1XTVA 2WJ4A 4ALKA 4I0WB 1K92A 4BECA 3AIKA 3KOOA 2CZQA 3ZLVA 3PE4A 1SHKA 1Y6ZA 4CCAA 4F21A 5JXJA 1NWCA 2IXBA 4C05A 1T5LA 3OVMA 3KKKA 3OICA 3QVUA 1X1AA 3PUZA 4H08A 3MTAA 1OC4A 1UINA 3CVJA 1VMAA 3EAQA 4HB4A 2E89A 4RD3A 4X6LA 1E0JA 4EQ6B 1MTOA 1E0DA 1LV7A 2I78A 3LS2A 4N76A 4PANA 1GAJA 4MGHA 5F5WA 4M4SA 2I1WA 1WW3A 5JW6A 3CGGA 2V6FA 3I0NA 4TV8A 3UHPA 1L8AA 4J4BA 3NWPA 3PDJA 4DR4B 2Q9AA 2EBUA 4EUFA 4NMXB 2IY5A 1NATA 1XAGA 3QKSA 1D6JA 4QTUB 1CERA 4CKCB 4LF6B 1S89A 1ULBA 1X56A 3R5FA 5BWMA 3VU1A 1UZUA 1QJCA 1ZJYA 2CYCA 3CZRA 4J0QA 2Q46A 4PX2A 2YQ4A 1JLLB 4QUJA 3QU2A 4U8GA 2CV0A 1EK2A 2IDZA 2ZYHA 4B5KA 3K9CA 2AJ8A 3K9BA 3PFWO 1FRVA 3PEFA 2D2IA 5H1YA 3U3MA 1N6RA 4X6YA 3WIBA 4BFLA 4WGFA 1COZA 1YB2A 3VU9A 1JFRA 3PTLA 3SYKA 4UM9B 4C2BA 2FP3A 4QX6A 4QULA 2WJAA 4TKLA 3B7GA 7AT1A 1RM0A 4JEUA 4CKBB 1WKCA 1GT6A 4D9FA 2RIRA 3BFPA 4F2DA 1C7FA 1H0RA 3V7UA 2AI1A 1A2KC 5IVDA 3SZRA 4FNOA 4HH3C 3CR7A 3JD4A 3L7DA 2QMYA 3K30A 4LBWA 2QJOA 4EG1A 3BWXA 4I9FA 4D46A 4EKNB 1OI4A 1KI6B 3Q1KA 3GH1A 5E6SB 1N7GA 1FSSA 1DINA 3A7AA 3QPUA 4RK7A 4E12A 1EP9A 1N3YA 1RM5A 2YNMC 2PT9A 5FO1A 1XLWA 2QPAA 4RLHA 1XJ5A 4PVCA 2OUIA 1DQNA 3BDAA 4RKRA 1JJAA 5A2GA 2YYSA 3C3YA 5KYGA 1HYEA 2YWJA 1KOGA 4P4SB 3ONWA 4TRMA 2MT9A