5C53B

Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial dna polymerase gamma
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
385
structure length
363
Chain Sequence
ALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGRKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial DNA polymerase gamma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase subunit gamma-1
total genus 84
structure length 363
sequence length 385
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5c53B01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 5c53B02
1B7YA 4K88A 1SESA 4OP0A 1WQWA 2FYKA 3QO7A 2J3LA 1KMMA 1J5WA 3KFUA 4P3PA 1X56A 4XTZA 4P71C 3M4QA 4G84A 5ELNA 1HXDA 2ZNJA 2DQ0A 4PG3A 5HGQA 4CS3A 3RACA 1NJ5A 3ERRA 2ZZGA 1H4TA 4YRSA 2ZINA 4YRFA 3HXWA 4YRQA 1WPYA 3HXXA 4CS4A 5C52B 1H4QA 3HY1A 4P75A 4XTVA 3EFSA 1SETA 2RHSA 3UGTA 4H2SA 4TQFA 4HWPA 2ARSA 2QHSA 3VQXA 2AKWA 3QNEA 1C0AA 2ODRC 2DQ3A 2ZCEA 5K1PA 2ZIOA 3CMQA 3HRIA 2ZT6A 4YREA 3VQWA 5KNNA 2DVEA 4PHCA 3RKXA 3A32A 1H4SA 1WNLA 1EFWA 3M4PA 3IKLA 2ZR3A 1EQRA 2HNIA 1ADJA 1BBWA 2DZ9A 1WYDA 4WJ4A 3PCOA 1BBUA 3PCOB 1B70A 2J3MA 3RKYA 4YDQA 4E51A 4BWAA 2I4NA 3HTZA 4Q15A 4YP0A 2DU7A 2E10A 4YRJA 5E3IA 3OD1A 4YRNA 3LSQA 2CJBA 2XGTA 4XEOA 2ZZEA 4UP7A 1KOGA 2ZT8A 3REUA 1ADYA 1Z7NA 4YCWA 3QO8A 1YGBA 5C51B 2DTHA 4WJ3M 2Q5HA 4ZTZB 1YFSA 1X2GA 1X2HA 4TVYA 2QHUA 3I7FA 3P8TA 4G85A 4UPAA 1NYRA 3VQYA 1USYA 4P75C 4UP9A 4OLFA 2LW7A 4P73A 4TVAB 1QF6A 2ODRD 4P72C 4YRCA 1B8AA 3LC0A 4KQEA 3HY0A 2PMEA 2ZTGA 4EX5A 1ASZA 1JJCB 3L4GA 4H2XB 2DXTA 4XU1A 4YCVA 1HC7A 1EVKA 1KMNA 3E9HA 4O2DA 2XTIA 3PZCA 2DZCA 2EAYA 3FJPA 1ATIA 3P8VA 4DPGA 3RUXA 4H2TA 2ARTA 4AH6A 4EO4A 1LYLA 4XTXA 3E9IA 2Q7HA 1G5HA 1G5IA 2ALYA 1PYSB 4YYEA 3V8KA 4TTVA 4P3NA 2Q7GA 4BW9A 1V95A 11ASA 1E22A 4J15A 2P0LA 3BJUA 4ZTUB 3NELA 4P74A 3RGLA 1HTTA 2E41A 2C7IA 2E65A 3HXYA 3TEHB 3HFVA 4CH3A 3NETA 4KR3A 4YROA 3NENA 4H2VA 2AMCB 4HWOA 2I4OA 1WU7A 2RHQB 2Q5IA 2ALYB 3IG2A 2DXUA 3VQVA 1B76A 1X55A 2QHVA 3TUPA 4KR2A 1E1TA 4YRTA 1X54A 4RQEA 4CH5A 2CJ9A 4H2UA 2ZR2A 1QE0A 1USYC 2I4LA 3ICAA 1SRYA 2AMCA 2CJAA 2IY5B 1VQZA 1B70B 4LNSA 4YRRA 2E3CA 2ZT7A 2E5AA 2DTIA 5C53B 1B7YB 2CIMA 4Q6GA 2ZZFA 1BIAA 3UGQA 4TQDA 1YFRA 3IKMB 3NEMA 1ASYA 4YRPA 4HWTA 2I4MA 3EFRA 3L1AA 2PMFA 2ZIMA 4YPFA 2DU5A 1NJ8A 1WQ7A 1WLEA 2ZXFA 4RMFA 3W3SA 4YRKA 4WF2A 2EWNA 3RIRA 2EJFA 4H2WA 4RDXA 2EL9A 3HFZA 4YCUA 2DKGA 4CH4A 1BIBA 4K87A 3A7UA 3UFGA 1H4VB 4HWRA 12ASA 1NNHA 4TWAA 4YRIA 2P5IA 3REXA 1GGMA 2E1HA 2EJGA 4DQ2A 3IALA 2AKWB 3V8JA 1JJCA 3L4GB 3HFZB 4WI1A 1EIYB 3V7CA 1EIYA 3MEYA 1NYQA 2Q7EA 1FYFA 3UH0A 4RQFA 2DTOA 3LSSA 4CS2A 2G4CA 4K86A 3QO5A 2ARUA 1IL2A 3HXVA 4HA8A 3RF1A 3BFMA 2C8MA 4YRGA 4P3OA 3A5ZA 1X01A 1RIQA 4P74C 3A31A 4H2YA 4CH6A 4H2XA 4XTYA 2DJZA 1YB3A 3A74A 4NCXA 4YRLA 1N9WA 1NJ1A 3A7AA 4XU0A 3V7RA 2DEQA 4P71A 3RL6A 3DSQA 4YRMA 4XTUA 2DDZA 4TVAA 4H02A 4UP8A 1L0WA 3QTCA 3WQZA 3TEHA 1EOVA 1PYSA 2ZGWA 5K1XA 3TEGA 4XEMA 2IY5A 1W66A 4XTWA 3HRKA 3P8YA 2RHQA 5F5WA 2E64A 3MF2A 4XU2A 5ELOA 4ZIBA 3HXUA 2EJ9A 1E24A 2CGHA 3HXZA 1YFTA 1EVLA 1G51A 3MF1A 4P72A 2ZT5A 4HWSA 2RHSB 1NJ2A 2ZNIA 1NJ6A 4XU3A 4TVWA 3A5YA 3G1ZA 3L2ZA 1Z7MA 3R07A 3VBBA 3A7RA 3V7SA 4HVCA 4X5OA 1E1OA 3V8LA 4L87A 4P73C 1SERA 2QHTA 3RKWA
chains in the Genus database with same CATH superfamily
1GGKA 3C1OA 4ETIA 1I2ZA 1QYXA 3TDNA 4BB0A 2XWSA 3OCZA 5A3QA 4KHPB 2RB5A 1NHGA 2CJFA 4RVNA 3VHXA 2R1TA 4ZXFA 4OVKA 4DLWA 3U7JA 4A10A 1SEPA 5IBRA 1V5FA 3INTA 4MGKR 3BBLA 4MVJH 2ZSAA 2GEVA 3IVAA 4UU8A 4BMPB 4O4IF 3AM4A 3L43A 1Z74A 4Q6BA 4HS9A 1JEAA 1UJMA 3EEQA 4QHTA 2C4HA 3BUSA 3DDUA 3LHKA 4Q9HA 4B0OA 4F46A 3B5IA 1AA9A 2HHCA 1G8HA 5AHKA 3DMFA 3HP4A 3OF3A 1SBCA 1T4DA 1HXDA 2RSLA 3KBOA 3WJ7A 2ZNJA 1D3AA 3QOFA 5HJ5A 1YF3A 1KMCA 2GKGA 5F12A 3PEYA 2W2QA 3BX1A 3RS4A 2AG6A 4RHFA 2Q5FA 2DUJA 3NM4A 2BGUA 2BKAA 1HDGO 3EGOA 3PGKA 4OPMA 4XLLA 1MAVA 4NHOA 4F3RA 1U7ZA 2FW9A 4WIAA 2JH3A 2JLWA 3NONA 2HSGA 3OAAA 2ZOSA 1XU9A 3LBHA 5EY5B 1PCXA 5JDCA 3I5UA 3FYUC 2X41A 3C1TA 4XTVA 3HXMA 1NFFA 1I3LA 2VPXA 2BLLA 1AKQA 3RQIA 2XR1A 1UKVY 2J5XA 4H2SA 3F4LA 3K1ZA 4FONA 5EWLB 4YP1A 4LYJA 1U4NA 3TOSA 1CERA 3X0DA 2IT1A 5IS2A 1J2YA 2EFEB 4LJ4A 1XVAA 5C37A 4U9UA 4AU1A 1Z39A 2OAGA 2DXIA 1QAOA 2ASEA 2UUOA 3ABRB 2G0TA 3WLPA 5TLSA 3O8NA 1QBGA 2O8DA 1KK3A 1CBUA 5DYIA 4PFQA 5C7YA 3WS7A 4YI5A 1XTKA 5EA2A 1EX7A 5AWFC 1XT6A 5G1OA 5KYYB 4ND1A 5CCDA 5KTPA 4QIHA 1QZXA 3OKCA 2J33A 1ZVKA 1I3NA 2CVQA 1OXMA 2XUFA 4KYIB 5IRCD 2O54A 1PFYA 3W3AH 5I7WA 3L49A 5AR1A 4ZOLF 4CDMA 3C3JA 4KI7A 2IYYA 3QSYA 4NLLA 4P33A 4PGHA 3ZQJA 5LQSA 2ONZA 4IZHA 3A32A 1LNQA 2BSQA 3VO9A 3ZI0A 1I5OA 1PG2A 2AUTA 4IIFA 1YZLA 5CT5A 3TIVA 3ZWKA 5L3QA 3UTCA 4Z8YA 3ZE2B 4D4MA 1SPXA 2J0UA 4CN9A 2QD5A 2C7OA 3RREA 1SVLA 3BZBA 3UUWA 5IH3A 4JXJA 3AV3A 2PUTA 1EQRA 3P4UA 4KN6A 2ERYA 2WKRA 1BBWA 2DZ9A 3QYPA 3IQFA 1Z8DA 1NSTA 2C7BA 4O4LF 3NNSA 4KLRA 5DSTA 5BORA 1U28A 1Z6ZA 3OFND 4FOOA 3ZHUA 3IUEA 3P9CA 1YR8A 3Q7PA 3EXHB 5BW6B 3H4TA 3PNVA 2XA1A 3KT6A 5JDIC 2ZQ5A 2KLHA 2G0AA 4GOLD 2GETA 3TG8A 3OLXA 1X7WA 1JHYA 3LUCA 1XJ5A 1XD8A 1CK4A 2EP8A 4ZZ0A 1FXWF 5EFOA 3R44A 3MWDB 2ZPAA 4BFVA 5JAUA 4WZBA 2UU9B 5F7JA 2VC2B 5FUXA 5CYPA 3WLNA 4F2GA 5JMOA 1J49A 3UFBA 1P1RA 3U2QA 4RD4A 4RK1A 2OR3A 2DY1A 5ALVA 3ADKA 1DT5A 3KZCA 3VZPA 4JLWA 4HEHA 4WVFA 1E96A 4TKUB 3SS9X 3MWEB 5JS8A 2HSJA 2HJ9A 3RVDA 5F9FA 1LI5A 4RV4A 1I7NA 3KOMA 4FYHA 3V32A 3OTOB 2BBOA 1ZRMA 4IVQA 4CGYA 5C1IA 1Z8HA 2QB5A 1X2HA 4WKGA 3RLFA 4OX9Y 2QT1A 2QZZA 3L8HA 2FPSA 3I7FA 1U99A 4Q1CA 1IY0A 1C30B 2H5EA 1NYRA 1FYWA 2BKEA 4GXQA 1EK1A 2GPBA 3GRUA 3ZCPA 3MMZA 3WGNA 1CZUA 1F8UA 1NVTA 3B36A 1WBJB 3KUUA 3T4EA 4HNVA 3KYDA 1NVBA 4XLZA 1YKSA 5AVKA 1L6RA 3KLNA 3KJZA 2IYXA 2IIQA 1B4DA 5TMDA 4CW7A 4GBJA 4GPBA 5FEMA 3MK31 13PKA 5FPPA 2NSHA 1SNYA 2C3OA 2VPWA 2YWHA 3DL7A 1QF6A 1FOEB 1RJGA 2BJWA 4Q82A 3MFYA 3DMYA 4JDPA 1W9MA 4F96A 1WY7A 3A4LA 2PZEA 5JH7B 2I1LA 1PEKE 3DOJA 1G20A 4AX8A 4GQAA 3CMMA 5BN4B 4I4TF 1D8TA 2FPLA 1Z18A 5ALUA 3TW4A 4ALIA 1SZCA 4NCIA 4KIFA 2INGX 3NOOA 2NP6A 2ZTGA 1BXGB 3AF1A 2IY7A 2QMHA 3ONVA 4U4AA 4YJGA 1A7KA 4H2XB 3LO5A 1ZUD1 1VG9B 4YBRA 2JLUA 1LDEA 1QH8A 3ENVA 3H2HA 1UMDA 2LE0A 3I09A 3OQVA 3VU9B 1SU7A 1PEYA 5IAKA 1QSGA 3I5XA 1W36B 5ALOA 1TEXA 1QYCA 2F9MA 2X9VA 3EUAA 4PYOA 4EJSA 4XWWA 4GEGA 3WICA 4LHVA 1Z4MA 2WWRA 4WCFC 4JDUA 3WLKX 5JAPA 1VGVA 5JHHB 4O33A 3CCBA 3P8VA 2VP4A 4XQ9A 1R6BX 2IYNA 1BOOA 3EW9A 2ZM5A 1EFRD 4Q37A 2K6GA 3PL1A 4JUBA 5GONF 3FPCA 3FXAA 2J9ZB 3ZBTA 4DNPA 2HA3A 1WXXA 2AX3A 3AIIA 5FOUA 3V8VA 2RHJA 2NN3C 1ODIA 4F3KA 1K27A 2YWBA 1YMQA 3GHHA 3PB3A 1YFKA 4KPFC 1EBUA 4JLKA 2P2GA 2QG6A 2JI9A 2H1WA 2GFIA 2R7KA 4EM6A 3VHQA 2OO5A 4Q4HB 4QULA 2WEKA 2ZRJA 4NU6A 3DOIA 4PQRA 4IIXA 1Y6RA 1LDMA 2B2NA 3D64A 3GA7A 5CT4A 4CUZA 2Y9MB 2PQ0A 1N5RA 2JJYA 3LWDA 3Q12A 4P3YA 3HI6A 4KDRA 2VSNA 4YAGA 5AW4A 3CVXA 4AS1A 3ROKA 2QL9A 1V95A 4PN3A 4QOEA 1NC1A 1IUKA 3DTVB 2B1IA 4N8SA 2OT3B 1WWKA 4H1HA 4XB2A 2OHHA 4KE6A 2VDNB 2O2GA 1CIVA 2FEXA 2B83A 3SSMA 3DKVA 3GEEA 4K9SA 5F4ZA 4HDQB 2W37A 3RGLA 3D2BA 3O8OA 5IJ0A 4DV7B 1XMQB 1SBHA 1DUIA 3D6VA 3I0NA 2PRIA 3IQGX 4HDRA 4J6FA 3TEHB 4WE3A 1YK1A 2O8BA 3ZY3A 1CFJA 4MUNA 3EZGA 3P9ZA 4V0NA 1DLJA 4PLFA 4RGQA 3UMFA 4OI1A 2HK6A 2AFHA 3V2UA 1AS3A 1ZEJA 4FW9A 1Z5GA 2VZ9A 1Q74A 2RHQB 3LHSA 4N5MA 5AHXA 1DJMA 3O31A 5J4YA 3KL2A 3Q8XB 1WMBA 4X3OA 1JHZA 1PSDA 1QONA 4W63A 4D99A 2HQBA 1SG9A 2QGFA 1ZISA 3BICA 5HP4A 1P77A 3KZNA 4ARIA 4FU0A 4CQLB 4B3DA 3O83A 4FT4A 4I9FA 2PKXA 1GUBA 1M2GA 2ZE7A 3ENKA 3L84A 3MCUA 4LEIA 4PTYA 1GPMA 3TZKA 1SXPA 2QYSA 5LKRA 3ZNQA 2PUCA 2C4KA 4Y67A 4ZI3A 1E8MA 3PGMA 3Q5DA 3BAZA 2XMRA 4LDPA 1GVHA 1N6HA 4W9RA 3IE1A 5CU7A 3EGVA 3BRWD 1K7FB 1NPDA 5M34A 2ZR2A 5AJYA 3OMLA 4QDUA 4RFLA 3QENA 1E2UA 4AWXA 4EB6A 2YINC 3GBVA 2O52A 2FZGA 4NYIR 3RUDA 3BQ9A 3UJ3X 1SU4A 2ZRMA 3FB1A 3N76A 3L01A 1N5KA 2XKKA 2C94A 4DV4B 1XNHA 1ZKDA 3S8MA 1ZIYA 3HJUA 3TW0A 5KTOA 1XNQB 2ZT7A 3A9CA 2HRQA 2PS0A 1YQDA 4D0GA 3BXEA 2JH8A 4RANA 5D5QA 1ZOSA 3GPLA 1E4EA 1XYVA 2A7QA 4KO3S 3QKUA 3AIOA 2BEVA 3L1VA 5A6VA 2ZZMA 4LZNA 1AHHA 2OSBA 2BE7A 3Q5EA 2R6CA 3WL6A 1NVEA 1NP3A 1Y82A 4DR1B 4TQDA 4OHUA 1SCQA 3AKCA 1O97C 2OXFA 2QTZA 1D4ZA 2PN1A 4L5BA 4Y7DA 3NYWA 5CPFA 5DI3B 2CEAA 5NULA 3WIVA 1XA3A 1VRCA 1F6DA 2H1RA 4Q47A 5KS2A 5JEDA 4P58A 4NJEB 1T35A 3VI4B 2GBFA 3GWZA 1TTTA 4P54A 5J4VA 1UT6A 3IPYA 1ELOA 1R0SA 2YVLA 4KFTA 2OV1A 3CLTD 1Y7TA 1I8TA 4QOJA 3TBHA 1RABA 3VC2A 2OM6A 2YIVX 3HU5A 1E32A 3EQ6A 4QSMA 3MWDA 4WA8A 1UUFA 2TMGA 5EERA 2HQOA 4WZBB 4E08A 4RDXA 2EL9A 1CQJB 3BFKA 4IHJF 3C7DB 3D02A 2ZRCA 1TM2A 4B6EA 2Q2QA 3UFXA 3C3EA 2PS1A 1YTLA 1RKUA 4FBMA 1AKEA 4L3VA 4M8KA 5DNVA 1YFZA 2QRUA 2FFBA 3INGA 2IYEA 1ISHA 3M70A 4UZEA 2VXYA 2H7VA 1YA8A 4F4DA 3H5AA 3IP1A 3P0FA 3IP7A 5HM6A 1LV8A 3DZKA 4BECA 4ZK2A 2XGSA 4D4IA 2XYRA 3KVYA 3EFBA 1TMKA 2DETA 1ZAKA 3AVOA 3NC1C 4NDZA 1MNQA 1WVGA 3RVRA 1D1SA 1JLHA 2V59A 4M46A 3VPSA 1Y4AE 4YCSA 3IFSA 1AGXA 5LWHA 4LVIA 4WI1A 4ENRA 1NF2A 4MCJA 2C9CA 1W6RA 2ADMA 4LJLA 1EIYA 4G1BA 4AMGA 3MEYA 3V4RA 1VGQA 1VYHA 2J9GA 2C3PA 1C4OA 2H7XA 4H59A 4U3JA 1E1KA 5AHRA 4F5DA 5B57C 1UWCA 1TQ8A 3BTVA 2NAFA 4G86A 5DNEA 1XKQA 2ZUFA 2EEZA 1TADA 2G4CA 3KQSA 4BGIA 2EX1A 5KVAA 3IURA 3BPSA 2YV3A 3B38A 1IVNA 1EQAA 3T4UA 1XTSA 3U1TA 1NSFA 1UKBA 2CNKA 2BFCA 2O7QA 4KQFA 4TZTA 4YRGA 3TTUA 3EVAA 3O8QB 2PR7A 2VP9A 4BN5A 3W78A 1HE8B 5AH0A 2NYUA 4WH0A 4PGAA 4YUYA 4RL6A 3V2IA 5K8VA 1YDWA 3MCVA 2H4JA 2YJ6A 4TMXA 3VZBA 4POAA 3KJXA 2BMDA 4H2XA 2IHYA 3WVNA 3NEJA 3AI1A 5D3KA 6ABPA 2HWXA 2ZWIA 3E5NA 4WN9B 5E95A 3JYLA 3K0CA 3UC9A 5CTJA 4RXUA 3DZDA 3DOCA 3GFVA 5AQ1A 1MABA 2GRAA 3GUCA 1YB3A 4QPZA 1I13A 1Y48E 4A6XA 1GUZA 1C3OA 4TLCA 6AT1A 3D8UA 2ODBA 3T1QA 1DSSG 1FB5A 4BNJA 2V1XA 2HXSA 1XN1A 2BKVA 2PD3A 1YQTA 1LTKA 1ZU5A 3ASUA 3FRIA 4DDUA 1D4FA 2AC7A 4LWZA 3KLMX 1T8UA 5EHQA 3ICOA 1V11A 4EUFA 2WW8A 3K32A 3OZUA 3V8MA 4ENTA 1B15A 1XE3A 3GEMA 1HFWA 3K9GA 3D3JA 1H93A 1XLTC 3GLUA 1M2OB 3LLUA 1KY4A 5HDBB 1OXTA 1X7ZA 4OKIA 5JCJA 3LHFA 2H16A 1Q1ZA 3F3MA 3S5UA 4Q02A 1KIAA 5CRIA 3OO1A 4DCSA 4LUCA 2Y2VA 1OIVA 1NXVA 1UOQA 2OCAA 4KAFA 3RIMA 4CKCB 3AVQA 2HMYB 5CDGA 4CPDA 4MQ5A 4E09A 1RQXA 1USVA 1UBNA 2I2DA 5DV9A 3M6LA 4IH4A 4M0LA 1NNI1 5THKA 3O90A 3ELDA 2QWXA 4ROTA 3WFIA 1EGVB 3FYHA 3UBTA 2EXXA 3CX4A 1K3UB 2WOOA 3ACBA 3HLKA 3JQ9A 3OBIA 3RUAA 4F7DA 4MV6A 4S35A 1J5XA 2IOHA 4QJ4A 4CMEC 5JXIA 1Z2CA 3A1TA 2ZRQA 4GQIA 4P72A 1T1RA 1GG9A 5IMSA 4INPA 3ELBA 3PFGA 5BSMA 3VU0A 4ZYTA 4BLUA 3HZHA 5SZHB 1FJ2A 4PO8A 1YZFA 4CG3A 3QQ5A 4P8RA 4EFLA 2EFHB 2QX6A 4YY3B 5BWNA 1W4AA 4QKQA 2EARA 2Y4OA 1AKRA 2AE2A 1J9EA 2Z04A 1Y1TA 5A0FA 2Y92A 2RGYA 3N07A 5KYXB 1KO1A 1CWUA 2WWTA 1BMQA 3N8NA 4JAVC 2G9NA 3SY8A 1KC1A 3ADOA 1D2NA 1I30A 2YBEA 4TYPA 1MUUA 4YVFA 2E6KA 1TJ3A 2C54A 4G36A 4KVAA 2PTHA 2DBRA 3E4CA 2HKIA 4PHHA 4R9NA 5BQPA 3I32A 1MD9A 1XRLA 4Z4FA 3PUXA 4QGSA 3ZVRA 1VL2A 5DLEA 3DEJA 4AYTA 4XR9A 2WSSA 2JJ8A 4TLEA 4D98A 4P7KA 5FTKA 3KS9A 4RPLA 1K75A 1SXJE 2J32A 3D8HA 4OSEA 2CE2X 4X97A 1RYMA 4RU1A 3ZCQA 1QG6A 5B6JA 1LS6A 3EUWA 3TGPA 1C4WA 4ZGGA 3QOYA 4C7XA 3Q2KA 1L7NA 3PFIA 3M4QA 1AM4D 3PDWA 1JHVA 4H15A 1UZUA 4WWHA 2OBBA 5IUKC 3R7WA 3V4FA 4JOCA 5LOVA 3ANLA 1ZSVA 2Z6AA 3Q7TA 3RS3A 3CHYA 1WZCA 2W58A 3QU2A 4M0UA 5KPDA 4DA4A 1ODKA 1ZM3A 3OKFA 3DHVA 4Z9YA 3P9XA 1HNWB 4IIJA 2H4ZA 3QRWA 2B78A 4Q7MB 2VS1A 3G5TA 1NRWA 3TQCA 1MJFA 2APJA 3JAKB 4Z7NB 1D0IA 2X22A 4HWKA 5AXDA 2AOUA 3R3WA 1IMJA 2Y93A 4NARA 1RBYA 1OFIA 2IPLA 2QAGA 1HRDA 3GJ8A 3G2LA 3BHIA 4H4EA 5T4HA 2LTAA 5BT9A 2Q4TA 5C34B 1T8YA 5SV2A 1OJLA 3PUZA 3WKDA 4J03A 3WP1B 2C5SA 4WLOA 4MA0A 2YN4A 1AUVA 3NMUF 4YUAA 3W8RA 5I3ZA 5LLDA 1MAAA 4HGZA 4Y2TA 5FOQA 1FVHA 3NIBA 2AYXA 1SC6A 1E4YA 4MR7A 1RMQA 4GMHA 4FQ7A 2I76A 2WKQA 3RHSA 5F51A 5TEWA 3OVMA 2MYUA 3DZJA 4R1QA 2AKWA 4ZARA 1FU8A 4Y30A 1FUKA 1K8QA 2MMGA 2R86A 1D9ZA 2RJ3A 1KI7A 2DQ3A 1LTHR 1OMOA 3OC0A 3PDHA 4UEWA 5EUCA 3FSEA 3E6AA 1DUVG 4LBVA 1GDTA 4F91B 5IK2D 3EWIA 4CQJA 3L8FA 2ZIUB 5L4SA 2JCXA 3IMKA 4MRNA 1U7HA 1XYGA 4MAFA 5HUQA 3UPTA 1RAAA 3VZSA 2DVEA 3AB7A 4TWBA 1Y8QB 4CEIA 1PT6A 3C7KA 4OQNA 2Q0HA 1M34A 2RI6A 3NJ4A 5FT9A 3MJCA 4Q93A 4UBNA 5AUPB 2Z4SA 4K6CA 2QGNA 5TV2A 3P9PA 3UT0A 1UPTA 1I3OA 2VT2A 3BHNA 3NGLA 1XZPA 4DSOA 1U9YA 1D09A 2QTHA 1Z29A 2UYGA 3EFHA 5DIFA 3RC1A 1GG2A 1T2NA 3VZRA 3GNTA 3R7WB 2AS0A 3UAYA 3ZU6A 3TOVA 4AG5A 1HLPA 4G9BA 1F1JA 2FFJA 2FPMA 4GR4A 1WEHA 1YI8A 4LOIA 4R9UC 4WOBA 2FJPA 1VI2A 1Q7RA 3ZGZA 3EUEA 3COVA 2C9BA 3GAAA 3VTZA 1IRXA 3KU4A 4Y6QA 1I6LA 3RHFA 1Q1BA 1ZM7A 3TRIA 3ZHOA 3MUFA 3RARA 4F11A 3SR4A 2AMFA 3OBBA 3GDFA 4TZKA 4UNIA 1PAUA 1Q7BA 1SKYB 3CH7A 3T1YB 2HO4A 4NENA 3L6UA 4AP6A 5T6MA 1MTZA 1R50A 2NG1A 2NADA 1Y7HA 2R6FA 2R4QA 1NTRA 2F3RA 2QUAA 3H87A 3CUSA 4YMUA 5CBKA 4AF8A 5HZGA 2H3EA 2MINA 4KYVA 4XIFA 4EI9A 4E94A 3P9KA 2CJBA 2R0QC 4DA9A 3BS4A 1ZVVA 3LGAA 4UE2A 2ZDQA 2V4ZA 3H97A 2GXUA 3HEAA 4L9WA 1Z7NA 1FSFA 1Z37A 4LHZA 1P80A 2OORC 4IIEA 1T2DA 2DBYA 3Q15C 2X9LA 3PV0A 3KXIA 3ZGNA 1A50B 4GRDA 4IUBS 2NW6A 3O6VA 1CZOA 5FNZA 3D6UA 2XPCA 2GF2A 4BZQA 3OIYA 1Q20A 3BXOA 3PRJA 4N3GA 1NZDA 1ZQ1A 3NRBA 3P2EA 5TF4A 2YWJA 1II9A 4DBLC 4WBNF 1FQWA 1T5DX 1SVUA 1Z2NX 1BIFA 2I78A 1WZEA 2PGOA 2X5OA 3K71B 4FMCF 3W06A 4W5RA 2FMKA 2H0RA 3H1GA 3T7KA 1W46A 1I4DD 2WQZA 4E2WA 2QRGA 4TRRA 1VIYA 3KYDB 3ROGA 3CKKA 3S3TA 2ODTX 4D81A 4OLFA 2Y0BA 3BMOB 1PJRA 3CH4B 3JALB 4R8VA 1XMSA 2D4HA 5E3HA 2G1UA 3PKJA 1V4VA 1DAGA 4XSVA 1NVDA 2D00A 1IVYA 2B37A 4M1WA 4U39A 3IODA 1ZZEA 2GD2A 2PL1A 4I81A 2E89A 3NDPA 2A58A 1FFCA 1H1DA 2WLSA 2ZYDA 5C4MA 5JBNA 3KKMA 2Q50A 3GFQA 2ZCJA 1LPMA 3KRTA 1YS9A 3MLBA 4MVJM 3EX7C 4XW2A 5E8JA 2GXAA 4KQEA 1M0SA 3GT4A 4KR6A 3SJCA 3OPYI 5A5VA 4XM2A 1KYTA 5JRDS 1R3DA 2V8BA 4MIKA 3UF0A 1CRLA 5B58C 5KOJB 1OAAA 2LP4Y 5GPBA 3P8ZA 4YAUA 4EIWA 3GEBA 3LQ1A 3G0GA 5COQA 5JPDA 2ZLBA 3UYKA 1E2KA 2G4VA 3GRYA 3WIDA 9MHTA 2JEOA 4TN1A 2Q7OE 4MV7A 1L7XA 1K7XB 1RP1A 2XVYA 3PD7A 3WJ1A 3AY3A 1F2DA 1TO1E 3K70D 3DTTA 2QUZA 3TLEA 1R0XA 2XADA 4JJZA 5FUBA 4ZJPA 2F8TA 3BDAA 2CV2A 3B3GA 4E22A 4O1IA 4YH1A 5TSDA 5AM3A 4KE8A 1OYYA 5JD4A 4I1PA 4EY5A 3RUXA 4D6YA 4H2TA 4JBXA 1Q2UA 3IE2A 2FRVA 4AH6A 3CX8A 1JA1A 4FPXA 3KHTA 1OI3A 2VCEA 2E3JA 5K03A 3SFTA 1HE1C 3F5DA 3PQ5A 4EQ6A 2VDVE 3Q11A 2A8YA 4DZTA 1QGUA 4N0QA 4UHJA 4M0PA 1HZZC 2IPOA 5HKOA 1HY3A 4LVNA 1EXNA 4GD3Q 3BERA 5CX1A 4BO1A 4QLOA 3KOYA 2H51A 5IYZB 5F5LA 3CLUC 1LK7A 1TQDA 1AKWA 3I5MA 2HWKA 5LLTA 4WECA 4XFDA 4LKOA 3MVEA 2NO5A 1Y3BE 1Z26A 2XGOA 4D9CA 3T3OA 4HXFB 1T9ZA 1P1CA 3QMWA 2UZ0A 5DYWA 2QQGA 5HW0A 3D3WB 3PHIA 3OZFA 1K2WA 3PXCX 1XZQA 4DPLA 4IQGA 3L02A 4P7FA 1Z15A 5F52A 2Z2ZA 4RAQA 5DGHA 5FWYB 2CVZA 2ZW9A 1DKNA 4GWLA 2XB2A 2W2NA 1HTTA 4C4SA 3DMHA 4LGCA 1OJ7A 5F7ZA 4J0FA 2GB4A 1LBQA 1Z45A 4PQEA 4HEA1 3UJ8A 4DYVA 1BGXT 2XUGA 3V1YA 1A7JA 3R7BA 3V46A 1VL6A 4HWOA 4DSAA 3OQNA 1QB7A 4S04A 1OILA 3KXLA 2OYSA 5LB4A 3DE3X 1WU7A 1L6IA 3TPFA 4UUMA 3K0BA 1TI7A 1T3TA 2HF2A 3FZEA 3DONA 3MCTA 3PC3A 4DMHA 2ISSD 2CBZA 1F12A 2EKLA 4YAWA 5FDFA 3N58A 3IPLA 4C1BA 5BQOA 1X55A 1D2HA 2FUEA 1OUMA 4CKWA 5IW8A 1JG3A 1EP3B 2AJLI 3MSCA 3EIEA 4YRZA 1PGOA 1XRQA 1QIMA 4HT3B 4RZXA 1IOLA 2X8WA 3FVWA 2EYUA 4CM8B 4BMVA 4G4JA 5JZVA 1JDTA 1XTUA 1XTTA 3L3BA 2EZUA 3IPCA 3TRDA 2G5TA 1ABBA 2QBYA 2IEBA 4D56A 3A4YA 2AKAB 1POWA 3BD7A 3GP3A 4GFDA 4W99A 5DPMA 5HBRA 2NUAB 3WIEA 1QE0A 3STXA 4AKTA 1M2EA 2PWZA 1XZHA 3A1DA 3L7IA 4NAVA 2CHFA 1GPUA 4ITRC 5CX1B 4B85A 1TIKA 3UANA 4F5WA 1T25A 1R7RA 3LLVA 4BAGA 1HE3A 1KH2A 2M6SA 4HN4B 3DCYA 4WZAB 1MKYA 2ZYTX 4PZCA 4HX9A 3MF4A 1QHEA 1EH5A 1EESA 3PQ2A 2A35A 3EDMA 2W9XA 1VQZA 4L0QA 2D2VA 4OQFA 1RPZA 4P83A 4A16A 1L8LA 2B4TO 2OFWA 2PVSA 1RIFA 3GH1A 4KGDA 1U8ZA 3HJGA 3WQQA 2VATA 1F20A 1Q0UA 5F73A 1B7YB 1X92A 1XMVA 1GSOA 2YWGA 5FBVB 3WGQA 1M34B 3C8UA 2QLJA 5F78A 1UFQA 1VKOA 4FFDA 4FOLA 3ZW9A 1R4NB 2EGHA 4DKJA 4H0FA 3OPYB 2XOKA 1U5AA 4QUIA 4YJ3F 3OE7D 3SXUA 1SQGA 4L4ZA 3JQFC 3E3MA 3IKMB 3FNFA 4PLGA 3WK6A 1Q22A 4B47A 3R8CA 3NLLA 2QM8A 3D4LA 3MS4A 5KJ1A 3EFRA 3L1AA 3TMYA 1RU3A 3AZQA 5JALA 3EYWA 1H1LA 3HVJA 4B5LA 3ZXSA 1RI4A 1Q7TA 4PLWA 1EFUA 1II0A 3D2AA 3UEOA 3V4VB 3IHKA 1EZ1A 1YONA 3PG5A 1GP2A 3WWYA 5L9AA 2K2WA 1D1TA 3DZFA 2SBTA 5DSXA 5DW3A 5IF3A 7ADHA 5L3VA 3HL0A 2FWNA 5GJCA 5A3VA 3INYA 1Z73A 4YT5A 4CT0A 1BO6A 2HU7A 5F21A 1JQEA 4L3WA 4R5HA 1ZIPA 2C4WA 3E48A 3A25A 4K3UA 3OOSA 3GA5A 4D8UA 1GUFA 3LCCA 4UBLA 4CL2A 2NZWA 2WYWA 3AYZB 4D4JA 5C1DA 3RIYA 2C4VA 1DXOA 1EJ6A 2NPIA 3DMTC 1W8DA 4DLUA 1FDOA 4TM8A 1V4BA 2VH2A 4MGZR 4R0NA 1C0IA 12ASA 1P0MA 1ZUHA 3QELA 2G77B 4MARA 4BP8A 3CY6A 4I4IA 5KTTA 1WTAA 2QRNA 2UZAA 3PSHA 2TSYB 1U5BB 1XGKA 4I1UA 4JOBA 2HAEA 4AUEA 2I2AA 2ZU6A 3E7XA 2XJ9A 3WZ2A 3ZCXA 4GX1A 1J8VA 2FFRA 1E7MA 3N87A 3W6OA 1BJRE 1XA0A 4GL4A 4RY9A 2KM1A 1VL1A 3PFCA 2HEIA 4ZI5A 3IOMA 4G5YA 5DU2A 1AC5A 3QEKA 3EZXA 3ROPA 1CR1A 2Y99A 2C8JA 3OQIA 3Q40A 1K7CA 2PT9A 1M75A 3GGOA 3MBIA 3TGWA 1F0NA 1HNZB 4G5RA 1XAJA 2J7KA 4FFLA 4OA5A 3IIEA 1CUFA 1U7UA 3CX3A 2ECOA 1ZVQA 3ESDA 3TLCA 1IJFA 1E4VA 1QK3A 3K4PA 4Q4AA 3GX1A 4O5AA 1YBMA 1E99A 3IBSA 3SICE 4QT4A 3LUGA 3GP8A 1X01A 3BKXA 3HFGA 5AW7A 5EXTA 5D85A 3HBJA 2R4TA 1KAGA 4LDNA 2XAUA 4IYRA 1VOTA 5AJTA 5JFTA 2CJPA 1BXGA 1W75A 3SYLA 3WIUA 4ENPA 1I7SB 4IHAA 4CV1A 1P4JA 5TE9A 1JMYA 2BEJA 3O8LA 3TOXA 5AW1A 2DJZA 1S2OA 2I03A 4GP6A 5B5SA 1W36C 3DV9A 4LSZA 3SJUA 1KP2A 3NCTA 4YRLA 2BKUA 2W22A 1PDOA 3DPSA 2O7NA 3QNUA 4M76B 1Q7GA 2QTAA 4Z0NA 4MGIR 2WJWA 2YICA 4MEAA 3RBVA 3QBTA 4MWBA 1GU1A 2IXBA 5LZ7A 2PNJA 5ICMA 2H9YA 4J9VA 3VVMA 3W7VA 5JNVA 4PAWA 2V7GA 4A8JB 5C81A 3E84A 4L73A 4OSOA 1EVJA 1ZNXA 4WPGA 3AHEA 1RQGA 1VKRA 1QGUB 4ZYZA 1FTNA 1VXRA 3DDCA 5DT9A 4M9SA 3UJAA 3C3MA 1T8WA 3C24A 4UKDA 5KDDA 1P3DA 2PIDA 2FRDA 1GUAA 1E1MA 1PG5A 2FK7A 3NP9A 1IWOA 4N3AA 3IIIA 1A9QA 5ALJA 1QHHA 2O6LA 5JFOA 2ZBGA 3BA1A 3NWEA 4KAAA 4NC9A 5F76A 3I1JA 5DULA 1G6HA 3UT5A 2W2XA 3EVGA 4YGXB 3TD2A 4ZPJA 5ILGA 3F6BX 3TLJA 1ZH2A 1WB6A 3EAFA 5JQWA 5C3MA 2OCYC 2YNMD 3VDMA 1XI2A 3DLIA 2VDQB 1D5WA 1E5LA 1P0FA 4UM9D 4C04A 1ONBA 1KHTA 2AN5A 1PRYA 1K3FA 3TZ6A 4E13A 1SXQA 4K9QA 5KWVA 2EJVA 1V2GA 2ERXA 1NW7A 1I7QB 2CGHA 3CLSD 2DHEA 8LDHA 3GLSA 3TZLA 4M8SA 1H2YA 1CUWA 1KZGB 2EF1A 3AF4A 3AHIA 3FBWA 1NJ2A 4I8XA 4P2BA 5C1OA 1V9LA 3JVDA 4MUKA 2CKMA 3EZ2A 3IR7A 3A37A 2JHGA 1O9BA 3KVRA 3A5YA 3G1ZA 4G89A 2ROQA 3H8WA 4DDVA 4RUKA 5C31A 5EHGA 3D8TA 1CPYA 4E1BA 3HKBA 1IXRC 5JSKA 2ZJ0A 5BVHB 3U6KA 2P4QA 4PLVA 3DOHA 3MTQA 3WISA 1RRVA 1BNCA 4WY8A 3VC1A 3CF6R 5AJXA 1B74A 4CG2A 5JFGA 1A96A 3B7GA 3WWEA 1P62B 1AHIA 4I9HA 4B3SB 1GU0A 1Z13A 1DAHA 3IC5A 4N0MA 4FYIA 2QR3A 2ZB4A 1EB8A 2GT1A 1XQ1A 3AIKA 1RQLA 1AKVA 2QORA 5EJ4A 2I3GA 1KU0A 2YOHA 3FY4A 1A5TA 1GARA 1IBSA 2IU6A 3T7SA 1SESA 2WT8A 4KYTA 3SG0A 5K0GA 4K0RA 4IQ8A 1Y8ZA 4HUTA 4EENA 1JEQB 3QIAA 5AYVA 1E9VA 1NVVQ 1T8SA 2JB9A 2M98A 2ZIFA 3RC9A 4RTLA 1EFLA 2BRUC 3D3QA 4UARA 3RR2A 2SKDA 4QJ3A 1L7EA 1MENA 2SKEA 1CUBA 1I4EB 2VTVA 3KIPA 4MDHA 2WTEA 4WLNA 2VJMA 1TYDE 2H1CA 3EMDA 3OJCA 3ZHVA 2RARA 1JQBA 3H5LA 4ZOLA 1MW8X 3OURA 1V7CA 2FPGA 1QCDA 2V96A 1GQRA 2JLAA 4PG3A 1QBKC 5E2AA 3PQEA 4KLAA 4MV4A 2H2AA 1XX6A 2ZB7A 4V24A 4IMRA 3EPLA 4IIJB 4BZZA 3VHRA 4OFXA 1ZXLA 4M1QA 4TUYA 5HDQA 1CT9A 2GESA 3HA7A 2FZ4A 5E2BA 4N0PA 3TF5A 4FE3A 3PHGA 4P7JA 1QVRA 3M9LA 2FSIA 2WJAA 3PFHA 2CXQA 3VNUA 4X90A 5GGXA 3SHVA 1OD6A 4MSUA 3AC0A 1Q1GA 1YCGA 4AXXA 2QN6A 4WCFA 2I8AA 1KEKA 4TXHA 4GX2A 1W52X 1B3BA 3FDJA 2PLFA 3NOVA 4FFVA 2ZB2A 4AO8A 2LV8A 2VVTA 1TX4B 1GZ7A 1VKZA 3BE4A 1UC4B 4A9AA 5KYGA 1FXSA 4UEOA 1DWPA 1R4MA 3R7AA 3SCZA 1EAMA 3DDOA 4QVIA 5LMNB 1FQKA 1GIAA 1A0OA 3OKAA 2O8DB 3H2JA 4QT0A 1LSJA 3QNEA 4OH7A 1UEJA 1X39A 1EVEA 3ECSA 3F49S 3IKVA 4XASA 3G17A 5IYZA 1A27A 1YR2A 1KZYC 4BB6A 4EDFA 1EWTA 1E3DA 1A7UA 3DYBA 1A97A 5DLDA 1KKLA 4UTXA 2I7DA 3Q9SA 5IUNC 1ZUNA 3RC7A 2EF0A 2ZIOA 3ND6A 3VDXA 1OWOA 1L4MA 3KB2A 3VQWA 3ROFA 3HB4X 3D6FA 5BXYA 2ACEA 3SJ7A 1SKUA 4BUZA 3RKXA 2ZI5A 4BCCA 2V3CC 3T5MA 1JSXA 3GA0A 3GBSA 3HDYA 4YWJA 2DBZA 1ZD8A 4B3IA 3REFA 2R9VA 4HZUA 3QVGA 4EY8A 4X91A 3GJ7A 3EQ2A 3IV6A 2DCUA 3M4PA 4QECA 4JBGA 5CM8B 4DEXA 1FP2A 3HO8A 4Z9BA 1YQGA 1R0KA 3CNHA 3JTMA 4TT3A 3FF1A 5H3HA 2VDWB 2W6NA 4LJ8A 4RESA 4YJFA 3ZGYA 1R9NA 1WXQA 1V8ZA 2VRCD 3ETJA 3G6KA 4ENQA 2VBCA 1B70A 1E3IA 3M4ZA 1A95A 3ONEA 3HA3A 4B6FA 4BMNA 2H63A 4U3JB 5EIEA 1I7LA 3RGGA 1VLMA 4C0HA 5CM2Z 2IYSA 2H52A 2N9UA 2XXJA 4BWAA 3WNVA 4Z4HA 5CLQA 2A0YA 5U9CA 5FBQB 2J0VA 3ME5A 1P4HA 3PIDA 3S6JA 3OZXA 4O8ZA 4BHTA 4PG4A 1I14A 1VLHA 2C2OA 1N1DA 2DLNA 3AERB 2QDKA 1GKYA 2HTFA 3DB2A 4G26A 5J63A 1X86B 4JB0A 2X76A 1WCYA 5I51A 4QTUB 2AX4A 1MQSA 4ZYYA 1HI9A 1XMPA 4UQOA 4ZTZB 1FZQA 5JXWA 2WTUA 2OQ2A 3K8OE 1DIAA 2I6UA 4I46A 1U5CA 1NAHA 3GAZA 3A4VA 4PLHA 3EPPA 5EMLA 4QE3A 4GT1A 2QHUA 4I5GA 5HTKA 3P8TA 2BEKA 2QJTA 4XA8A 1SVSA 4RV5A 1M6VB 4ZRDA 4C0JA 1Y6JA 1VKNA 2FLWA 2HSWA 3O9ZA 3OQJA 4H3VA 1UT8A 1U0SY 2PWBA 4UE6A 5ES4B 2GO1A 4AKEA 8MHTA 4MPRA 3G2IA 5EPOA 1PBTA 4DCPA 3IJ5A 4NK4A 5CNIA 1SC9A 1JDUA 4K8RB 4CNQA 1AS2A 5TPWB 5AMXA 3LQRA 3WWPA 4AROA 1NMSA 1YRAA 3HMQA 3CT6A 1PK7A 1S2GA 1MGOA 4C88A 4EFDA 2N75A 3R20A 2A0UA 2RI0A 4WMLA 1L4UA 1T2VA 2C2KA 3D4IA 4YAKA 3G2KA 3KT0A 4DIMA 5ITWA 1XD2A 1IN5A 1IN1A 2YV2A 3JQAA 1KDRA 2LRHA 3OSUA 1WMFA 2QTVA 5K0CA 1FRNA 3A06A 1KGDA 2OC9A 5IH7A 1GAEO 1TZKA 2J6IA 5LP6C 4DIFA 2M2IA 3X1MA 4MKHA 4IXMA 3RWOA 1T9DA 1LTQA 4HFRA 5B55A 1VSUA 1DO2A 1QVVA 1B00A 3PHHA 5FQNA 1MOPA 1TAGA 4P0QB 2G71A 3B78A 2KB0A 4BATA 1Y3IA 1TYCA 3Q1LA 3ROMA 4KSCA 1DBWA 2OZLB 3ZY5A 4FN5A 4W8GA 2H85A 4UTVA 3UJ6A 1P9WA 2H9IA 3R4VA 2NU8B 9LDTA 1C0KA 3DT8A 1TVEA 4PX3A 5DKFA 4FX5A 1Y3HA 2HUPA 3V4ZA 1L4GA 3GB9A 4N6GA 4DILA 2ZE6A 1ID8A 2G76A 2QTCA 5LZ4A 3QMPA 1E2QA 3CX7A 2FZ5A 5EKXA 3U31A 3L4EA 2HPAA 2PD4A 3NXSA 5H59A 5KX5B 2AR9A 2C5GA 2XDQA 3NIDB 2KMLA 3ISJA 4EHLA 1HT2E 4MLCA 5DGDA 1G5HA 4H7DA 5HMLA 2N1BA 2CD9A 2G06A 2VG8A 4JUAA 2ALYA 3YASA 1H6DA 3HBAA 4ZGBA 2A9VA 4Q1AA 3UMVA 1SKQA 5KPJA 1JZQA 3TW6A 3LNCA 5IABA 1IPHA 1EFAA 4AJPA 4BB9A 1Y34E 1Q84A 2QROA 1RP7A 3MGAA 4UMFA 5B6PA 3GEHA 3ZGOA 4BVBA 1G9TA 2X7XA 4WGFA 1VP3A 4NF2A 2J3EA 1BFDA 1GA1A 3S27A 4NJMB 1XG5A 2QL6A 3B5JA 1UZLA 4YCMA 3LRXA 5AXBA 1RRCA 3R0IA 4MWOA 4WZAE 2DCMA 1M10A 3ZQKA 2TMKA 3C5VA 3RHZA 1X14A 2HB6A 4GOND 1MVOA 3KPWA 1I5EA 2DPMA 1OKKA 1JFVA 1M6YA 1TFRA 2WU0A 4HDAA 4KH1A 4OA8A 5LYJA 3VZCA 2QSJA 2OMKA 2HTEA 3GEGA 3I2IA 4IGFA 3ZZMA 3EF1A 5K05A 5KQMA 1XSEA 2QL7A 4XJSA 2CEKA 1LJ8A 2NU7B 2WTXA 3EN0A 1E98A 4BNVA 4N48A 1DDIA 3LK7A 3B20A 4PIMA 1H94A 4NBTA 3PU6A 3O4IA 1MJGM 2BBSA 2YTZA 3H5RA 4R9VA 3M1LA 4BNIA 4ZT5A 5IM4A 2OCBA 2P1RA 1PW7A 2FFQA 1LLUA 5T64A 3ZXXA 4NBKA 4CQMD 4I0WB 3S2IA 5ITVA 1L1EA 3LCUA 1FYEA 2QLBA 4ZVTA 1G20E 1D4OA 3BIXA 3DZHA 2VZLA 3G9TA 3IOCA 2BPOA 4K9KA 3RUEA 4ALJA 4E15A 2GDZA 4EY3A 4I7EA 4D0SA 1L7AA 1PV1A 4CLDA 3UXMA 1DE0A 2UYOA 2P1DA 3JAKA 3WKBA 2ZBQA 5D84A 1OASA 1HFKA 1XVVA 2GS9A 2CDAA 4PC7A 1CR6A 2BN4A 4N6OA 4Y1RA 2NU8A 4E2YA 1YS4A 4EHAA 2F4NA 3EWSA 5DM0A 2YCLA 5FJJA 3WLHA 3TI9A 5AM4A 4PZ9A 4GNRA 1E1TA 1UC5B 1T8TA 4RTOA 1GNVA 3D6MA 2OA0A 2NGRA 4X84A 2VT6A 1KR5A 1QKIA 2IP2A 2QYTA 2WD9A 3UXHA 4J94A 3GLFB 2JVIA 2R6GA 3HN6A 3CLUD 4M60A 5P21A 3STUA 4LVLA 3JRNA 3NBAA 1F51E 4LZPA 4YJHA 1R8QA 4CIVA 2P7IA 4GR9A 3H3JA 4JL8A 5AK0A 1A8HA 3OCUA 3LXXA 4QICA 3ZY6A 3H9UA 2CBGA 3F3YA 1I1NA 4BNUA 2FSVA 1T43A 4B1FA 4EB6B 2YVUA 1I0LA 3W4JA 2R7NA 3ROEA 4UAVA 2FEAA 4PQFA 2EW8A 4S0ZA 2DULA 4YRRA 2GD1O 5T7BA 4NTZA 1KSHA 1VJCA 2EERA 1QHGA 1GG8A 2BFEA 1V8OA 2H00A 3FYUB 4WQMA 5EWMA 4E5NA 4KREA 2ONKA 4L9SA 2L19A 2WJPA 2B4RO 4DV6B 1UQRA 4I2VA 5F1OA 2RHBA 5JOQA 2PL3A 2OHOA 3WHLA 1OSNA 5HS6A 4PYIA 3QHQA 4C78A 2YN2A 4KRYA 1N3IA 2I3BA 3C6YA 3L18A 1CUYA 3H2SA 1T1SA 1M1NA 4L1KA 3MJFA 4QGGA 1N6RA 3H19A 3L8MA 5DI3A 4LMAA 4K9LA 3DO8A 3RH0A 4BX3A 5HQJA 2BH2A 1FFDA 3A6GA 5CYGA 3P0EA 1FUEA 2X23A 2VDRB 3DE1X 3OE4A 1JNYA 1VSBA 3R4CA 4J7UA 3UCFA 2WFLA 2CMFA 1Z38A 1UK9A 4Z8XA 1CUAA 4OHZA 4A0HA 1JLMA 5D3MB 4AK9A 3EVCA 3E22B 4YRKA 2R85A 3FMPB 1W1UA 4Y1EA 4XFKA 1JEOA 4YV2A 1KQPA 3O03A 3EGIA 4S1WA 2EKDA 1Z16A 5EIBC 5BV0A 3UK0A 3HA2A 3DOEA 4W9MC 1EXMA 4ZVRA 3G0DA 5A9RA 1TUEA 4JP8A 4HFJA 4C0KA 5M29A 1NGSA 3E7DA 5AKIA 3D0RA 3OCXA 4Y1RB 2DKGA 1ENYA 3FCOA 5F64A 3RS0A 2PQ6A 3TIIA 3C6KA 1TVKB 3ZDEA 1MJ5A 4L5YA 3OPQA 1J39A 3DAHA 3B9QA 2AWNA 2CXHA 4AL4A 4X85A 3FB4A 4E2FA 5AJVB 3A7UA 2Q6VA 5LMZA 3DULA 5CNJA 3CO5A 3WGKA 4LQ4A 4Q4JA 5JISA 3E9EA 4P5EA 1NQWA 2EGGA 1ITZA 3DDHA 4YALA 4BMDA 4B75A 3GLFA 3ERCA 4EW6A 3A6FA 3HGMA 3X2SA 5JXJA 4RCZA 3VJLA 1RWQA 1GGMA 2NUPB 2EJGA 4NH4A 4LQDA 4RKFA 5IC6A 3TB4A 3TK1A 3Q9LA 4CKEA 2DB3A 1L7QA 3OLYA 1URPA 1Y80A 3BMCA 3HZRA 4ZDKA 2Z5VA 3BDVA 4ZHQB 2QF7A 2FV8A 3NHUA 3KPVA 1UDXA 1YB1A 2FEWB 3T61A 4QARA 3M81A 5KCMA 4F9EA 5EWMB 3SZRA 2COEA 2RGUA 3R23A 4UM8B 1S5PA 4G63A 1M8GA 2IELA 1EFKA 1DRUA 4MUMA 4X71A 2C82A 2QTVB 1SC4A 5BOSA 4CGZA 2W6JA 2H1LA 1T3ZA 1FZTA 1LRKA 2W48A 5IX8A 1N2CB 2FGKA 4NICA 2VCHA 2BGMA 3BMNB 1N1MA 4H3KB 5ALLA 1SU8A 3A5ZA 1AUPA 2J9XB 1Q83A 1CYDA 1DFGA 1I9GA 2FHPA 3DL2A 1V5GA 4G0ZA 4Q0MA 3WA6A 1B0PA 2A1IA 2K2QB 4H18A 4JI4B 3PE6A 2RH8A 3TNFA 1GHTA 2P2ZA 1T2AA 3PQFA 3MOSA 1DX6A 5EJ2A 5K7SA 3OFSA 1KQGA 1Y9EA 5KWJA 5EKDA 2MHCA 4RCYA 1TO6A 4Q3KA 2H2DA 2H31A 1JLLB 1WUJS 2JFQA 3E22A 5CBPA 4OYLA 4DA6A 4YUWA 5AK3A 1ZK2A 2GDJA 3E8MA 1FP6A 5G3ZA 3VR6D 3ZW8A 2PS3A 4KMRA 4JR2A 1HOTA 1U3TA 3VC3A 3QX3A 1KJ9A 2Q2WA 5GM2A 1DTSA 3TZQA 3ONNA 1A8QA 3OZWA 3WBKA 1H0RA 1Y8AA 2D7JA 3ZD7A 2J85A 5CJJA 1ZUNB 5JXGA 4QYMA 1MB2A 2KX7A 2XAAA 4X66B 3V00A 2XHEA 5LQJA 1J90A 2WHPA 5K51A 2B7CA 2HUNA 4HAOA 1WHTA 4MZDA 4H02A 4QODA 3WQRA 2ENUA 2V7XA 2XMZA 3ORHA 5DTEA 3VOTA 4FIDA 1P1KA 1Z75A 1CUXA 5LFAA 3EFEA 4WOKA 1HT0A 4IUDS 1KO4A 3MOGA 3ZY2A 2FPKA 2RAUA 3ES9A 3AUAA 2PAAA 4OI2A 4EVSA 5ARBA 4BRSA 2VK4A 4FCWA 4LRXA 2IZ5A 4O4IB 1QIKA 4NJMA 5JMTA 3ZDZB 2BMWA 2HSEA 2QTMA 2WMDA 1A76A 1NM5A 3HACA 4Y8VA 3CCFA 7REQB 4PLTA 2XV1A 5GJVC 1NBWB 1TRKA 1GGJA 4S24A 2FQQA 2BEVB 4DL9A 5B2EA 2R2AA 3WYGA 3KQMA 1CZRA 2JHAA 3SSNA 2DTXA 2CNWA 1OH8A 2E4AA 1GQSA 1ULZA 1T5OA 1KI6A 3UA4A 2NUTB 2QX9A 4B74A 3EPKA 1CF2O 3AIMA 2VHZA 3F46A 1B42A 5FI1B 821PA 4FMCB 4J3NA 4UOZA 1KY3A 3T41A 4C21A 2QG9A 4HPJB 2P9FA 3W5JA 3KEOA 5C5CA 1JG4A 2GPJA 3VBBA 1ZO8A 3FW1A 5J2TA 2OD7A 1NUPA 5EQTA 4LDQA 4M0EA 4WXPA 3TX2A 5BMVB 2ZUVA 3ANTA 4FI3F 4G09A 4R9SA 1E2EA 5DEIA 1Q19A 1U8TA 2VF2A 4MRPA 3ZGVA 3VH2A 3COJA 1DCTA 4QFDA 2B8TA 2ZQYA 4L87A 4E31A 5JEEA 1D7AA 5JAQA 2AG8A 3GZTB 5AI8A 1VE1A 2Y1DA 4EYGA 1W25A 4AQ7A 2QHTA 1TMOA 5F77A 4IRUB 4DTCA 4B33A 1MJGA 4GC9A 4AJJA 4PO9A 2BUAA 2VK2A 3C6ZA 2BMAA 2C2BA 3QXXA 1R12A 1BFUA 4IF4A 4JSYA 1WB5A 1DO8A 1NN3A 1VMIA 3M6IA 2IU4A 4ZC8A 1CZHA 5KJ6A 5KUTA 3QO7A 2WNIA 3O1HB 2IF0A 2ZB8A 4GMKA 4WESA 4YJHB 4ZP1A 5KSPA 5F9HA 2P6NA 5LU8A 2I2CA 2VLBA 3PYLA 5BWOA 3P9YA 3AR5A 3N0VA 3I9OA 3P97A 3T94A 4D9HA 5KNLA 1SXJB 2XMPA 1IXYA 1PJSA 4UQPA 2AI3A 4HNAA 1KERA 2A0WA 4KXVA 1DOHA 2XTNA 3VU1A 2V6BA 2FOXA 2PJZA 4LXQA 2H0QA 2UZ3A 5ALTA 4MGEA 4OQXA 5JR3A 4F3TA 1E79A 2W00A 2QRKA 3S29A 8ABPA 1U4OA 1U2EA 4NCNA 1C1DA 1VB3A 3GG9A 4JIMA 5FTJA 5KC8A 1UFKA 1U9CA 4R2WA 4U8GA 2LGJA 1T6YA 1PO7A 3PUJA 3DG9A 3HXXA 4CS4A 3PT5A 4F86A 1E3TA 3TTVA 5KMGA 3DBOB 4MMYB 5JJIA 3R5JA 2IYQA 1SUPA 1FSPA 2PM8A 4UNRA 3OEED 4L9AA 2VHJA 1ZN8A 1GPJA 4DV0B 1YE8A 3T3EA 5J4LA 4O3FA 4HGQA 5LIPA 5T67A 5E7QA 1HNXB 1K92A 3WZLA 2HCRA 1OGJA 3QY0A 2VHUA 3FROA 4A92A 4ZK6A 3G5AA 1YU6A 4URHA 1DAEA 3NC0C 1JLRA 3B6JA 3OEYA 4PC6A 3WBFA 3GLGE 5D3MA 3IV9A 5K3CA 2R8XA 2NO0A 4A1OA 4Q48A 3GJSA 4X64B 3IAUA 4TL6A 3O95A 2IYVA 5JSFA 2O19A 2PU5A 3GGCA 2GN9A 1IM8A 2R62A 1P6UA 1IN7A 4ZJUA 4HH1A 1L3CA 2QKYA 4OTZA 3U7GA 3O91A 4YACA 7MHTA 3CN7A 4HRVA 3FKSD 3SEZA 2HF8A 4C20A 1X77A 1PP4A 2X13A 4Q7EA 3N70A 3DF7A 1C7IA 1OFTA 2PPLA 3KJGA 1VGRA 3LVRE 5KJEA 1G3RA 1N8NA 5J5VA 1R10A 1UEIA 3ZE8A 5KEIA 5JSZA 4O4HF 1KDVA 3PTLA 4R2HA 2W6OA 4A6EA 1HE2A 1GGEA 4HZUB 2HBZA 3OOJA 4J16C 1W6UA 4B7XA 3NIGB 1P45A 1XR3A 3G8YA 3QITA 1V1RB 2FW7A 1SHJA 3QELB 4HLUC 4OHXA 3UXEA 1WUTA 3ZU5A 3F3SA 3HZZA 1WQ4A 4RK7A 1SXJA 2WYIA 1P91A 1E3WB 2CWWA 5KHOC 3KETA 1F2UA 4INOA 1NXXA 4CLXA 1P7VA 2QA5A 1OQAA 2JGDB 1WYDA 2X15A 3ZR4B 4AN4A 5AUNB 3ZVMA 3CZ9A 4BMOB 3AT1A 4QRHA 4RPCA 2W6MA 3P19A 4TYWA 5K8CA 5DGCA 2QTNA 1CDOA 4KDCA 1U2QA 4HBGA 1BKYA 3QFTA 3DC7A 4G0XA 1IXSB 4IAOA 4XJVA 4QBTA 1JLSA 1ZK3A 4FWTA 3W5BA 3DP7A 2VQ6A 2O0HA 1ZRSA 4M98A 3C7CB 2FE4A 4MQEB 5IT0A 4F8YA 3ND7A 2CGEA 4O29A 4ADSG 2ZYRA 2PU7A 3UMGA 3L0ZA 3L7OA 3RJ9A 2ZJ7A 5E3IA 3DHYA 2RIPA 4GLJA 3AVWA 1RRMA 2FWJA 3L0OA 2EG5A 4FW8A 1FFHA 3OJOA 1C3LA 1YFSA 3EQ7A 1XAGA 4LI3X 4EF4A 4Z2AA 2JK1A 3V4PB 1QVAA 4AKIA 1OE0A 1EFPA 1NPTO 1V3VA 3PFKA 3LK6A 1X7HA 2J5RA 3PE3A 1KBZA 3EDRA 1A98A 2EVWX 4GPTA 1M2JA 4KQ1A 5L4LA 2HA7A 2B4AA 2DPHA 3CTMA 2HJVA 1GCOA 5BSEA 4HL6A 2FPUA 3UFXB 2XQIA 4FGZA 4GSKA 1TUGA 1Q6YA 3H65A 5JQGA 4GZ6A 1H5QA 4Y0NA 4MVCA 2E0IA 3K8YA 1IQRA 4W82A 1RPNA 1SK9A 2XRFA 4UW9A 3FETA 1EI9A 2BD0A 5D01A 2IU3A 4ZV9A 3RVOA 3SLKA 4XVUA 3IVRA 4B87A 3EQ8A 1II8A 8OHMA 2GSDA 1I80A 3L1JA 3BGDA 2PMEA 2AT1A 3JQ7A 1DKPA 1MGPA 1OX4B 2XCLA 3NALA 5IP5A 4K5QA 5HOQA 4XIYA 1N2ZA 2VYFA 1IBKB 3ILVA 3LIPA 2WG0A 1GPKA 2CBXA 5DWVA 4ZICA 2QD1A 2JFZA 1JG1A 1JN0A 4JT2A 4XVHA 4ZVOA 5CB4B 3VPDA 5LP6B 1ULTA 1K88A 4C4TA 5FD8A 1OWMA 1XRJA 4MI6A 1G21E 4EG4A 5G53C 2ATXA 2ATCA 2AEJA 4RZIA 3EBOA 1ACJA 1OU0A 3KLBA 1JI0A 4EYSA 4P0TA 3V42A 4LG1A 5IKEA 5C0OE 1RAHA 5A6SB 2HT6A 1MXFA 1NLUA 3BZUA 1YIAA 2CXSA 3QA9A 4JODA 1AGYA 2E7ZA 5C5IA 3UHOA 3W9SA 5ADUS 2ARTA 3DP9A 1OWLA 3FKQA 3M34A 4GMGA 3OLQA 5DF1A 1RHJA 3FG9A 4L28A 5DMXA 5CDYA 1VL8A 1E9AA 3L9XA 1T0BA 3PTZA 4JHXA 1YO6A 1TTHA 3LY9A 2WLTA 4TKUA 4TKVB 4UPDA 3W9YA 5BUCA 4C3UA 3RVQA 4M54A 3TVDA 4FYJA 5BVGB 4L8WB 1K98A 4NY1A 1MOQA 4N54A 3FCAA 3ASZA 1PYSB 1HSZA 3RS5A 5AVWA 1EGAA 4TQGA 7YASA 2KSQA 4YECA 4AS3A 3R74A 1J2UA 1UJ4A 1RYBA 4KE7A 5DM2A 1P2UA 5FV7A 3G0HA 1VJTA 1G5QA 5EJIA 3VNRA 2GFQA 4P80A 4Z0TA 3LX4A 2BM0A 4AY2A 3FA2A 3V6MA 1JAXA 1SCDA 2AZTA 1NOKA 4I50A 1W5EA 1I2BA 3DL0A 1DC4A 1GILA 3C3WA 3GUHA 3OEHA 4HZGA 4NEGA 4F04A 3ER8A 1F6WA 2QIPA 1EBFA 4ZHSA 1QIFA 1R18A 2DR3A 3FJ1A 3HWX1 5HE9A 1RI5A 3AKEA 1JEQA 1J8YF 3CUTA 1CUJA 2FN3A 1M2OA 4FYPA 5FI3A 1JVNA 4MVJF 1O94D 3RRJA 4HSGA 3A4IA 4B43A 4BV8A 4D0LB 1G59A 2H2IA 5GZ1A 4FCCA 2D5AA 1JZSA 4H7IA 4QLAA 3NDIA 3IEMA 1FNNA 2JI8A 4HNAB 3EQ9A 3SR3A 3NB0A 2VHWA 5CG1A 3JD0A 1KIMA 4OAOA 1SBNE 3ZHSA 3PHJA 4J0CA 2D2FA 2EJTA 2WKSA 2YFQA 3FR8A 4IUCS 4EI2A 1ZD3A 2OXCA 2WV9A 3G1WA 4QWMA 2XT9A 2J9RA 3A10A 4E5PA 4PRKA 1GZDA 3NC4A 1F0PA 2WF5A 3H04A 1V48A 2VN8A 3LA6A 2Y1FA 5GINE 2M1ZA 5JS1A 5DP2A 4BLWA 4OP3A 3K1AB 2PBLA 2IBMA 4ZEXA 3WAJA 4F3CA 2IBSA 1L4KA 1SOMA 2P40A 2I8LA 1X54A 1T5IA 1V8BA 4FE4A 4I3HA 4J7AA 2OESA 1J99A 2NLOA 2EJBA 1MU0A 2PT6A 3H0EA 2W4QA 2FSUA 3U4AA 2CJ9A 1R6UA 4ETNA 4KRFA 4RHCA 1QAMA 4ARUA 4FSHA 1YOVB 3I9NA 1RWXA 4F4FA 1DJNA 3U0VA 1P7YA 3B6IA 5AKXA 4FIZA 1NW9B 1Y1RA 4QEDA 1VM6A 1QGAA 1FDSA 2AHRA 3RAJA 3FTFA 1RBMA 1I51A 2G80A 4TX1A 2ZIEA 4IO1A 2VXOA 4TLAA 3ZE1B 4QO8A 1U2ZA 4YCAA 2X1VA 3EDCA 2OBFA 2HZ7A 1RMYA 4PE5B 2B3DA 1N0WA 2CJAA 3UPDA 4L75A 2IHTA 4OAPA 4QXOA 3ZWAA 1V8PA 1XA4A 1QFJA 2GRUA 2HU5A 2WP8J 3C16C 1HE5A 4UCXA 1X1DA 3CF0A 3FVTA 2QUKA 4BIIA 4CV2A 4D9FA 1BN7A 1D8AA 1Z0AA 2CCJA 2D13A 4ML3A 4Z9XA 1C7FA 4AN0A 2XUJA 1UP4A 2WNSA 3IQHX 4DIOA 2CW5A 3FKJA 1BIAA 1YBHA 4XSHA 2VSYA 3RTAA 1UJNA 2C2XA 3TQQA 1Z7EA 4YAOA 1HQDA 5TDHA 1PD0A 3WHKA 5AVXA 4KPEC 1Q50A 4URYR 2WFMA 1QCYA 3K16A 4X6YA 3ZHTA 2ODWA 2FOLA 4JVSB 2VWQA 4CTOA 4LJ5A 1TA0A 1DEAA 1SUEA 3N2LA 4HGYA 1PHRA 2CFCA 3QVUA 2AN1A 4Q9IA 3RM3A 3SJBA 4DJJA 4HQKA 4ZCTA 5JC8A 1WMSA 5LWQA 3BMXA 3FZYA 3QVSA 4XIIA 4BNHA 1ZD1A 2G6TA 1NVKA 3K72B 4CE6A 1UOOA 2J41A 4RTPA 3GWGA 1NX6A 1WPGA 3ETNA 3KQKA 3M4YA 1GKKA 1J5PA 4PV7A 3ZU4A 4V0RA 1N2EA 2EQBA 2GO7A 1WW8A 3FTCA 1ZG3A 3TW8B 3SF0A 3TGLA 2CLOB 3KVVA 3PC7A 3QG5A 5ICFA 4HNQA 1K7YA 5DVZA 4BV3A 1WSWA 3N5CA 2JFHA 1KIFA 4RSRA 1U3WA 1GL9B 4XKJA 3RI3A 4D3YA 3KR2A 1T6BY 2HI0A 3KNZA 4HGPA 3W6NA 4UM9B 3PTAA 1F8GA 3D4OA 1H4VB 2DFKB 3NWBA 1JSCA 3LRPA 3QKWA 4BKOA 5IKOA 3F96A 3K96A 1YOVA 1PGPA 2VFAA 3PLNA 3RRBA 1QYDA 1ZP6A 3OZSA 4XX1A 4ZV4A 2IH2A 2ONJA 4N76A 1T0JB 5EP1A 1MV5A 3NT2A 3IHTA 3SM3A 1KJYA 1YZNA 4KDFA 3CUYA 2VAPA 4N18A 2YMLA 3MRTA 4ACBA 4BBJA 3L4GB 2F90A 2F9LA 4M1SA 3TXXA 5CD1A 2VNJA 3B85A 3RTCA 1BJKA 2D5BA 1X9IA 3HNRA 5FULA 2I7TA 4B32A 4NMXB 1SUWA 3GCDA 5TPWA 2D5CA 4YBZA 2AN3A 3CX6A 2X1LA 3QV2A 1QHIA 1L4NA 4P7GA 3T06B 1YKFA 2OCDA 3RSZA 2RC6A 4PQYA 4DR3B 4COOA 3DE2X 2A9JA 2RC5A 2N3ZA 2YJTD 3URMA 1E2DA 3W2EA 4M21A 5AM5A 2J0EA 3I76A 2IUUA 3HR4A 3UJ7A 1BS1A 2GHIA 2RGXA 3A05A 3PDUA 4QHYA 5DWDA 1P4SA 3INNA 4EHFA 2EDCA 1IBCA 5JAZA 1GNSA 1BCRA 2NO1A 4GPEA 4KRXA 4YJGB 3L8ZA 1T8RA 5GIOE 4HNUA 3GD7A 4CIAA 2RHRA 4X54A 3DR5A 3HR7A 2H48A 4EDHA 2AF4C 2O2JA 4HR7A 3RTBA 5FUMA 3ELYA 1KYIA 1EA5A 4XM0A 1OHHA 2GF0A 2I3ZA 1RWNA 4BVKA 2F43A 1ZOPA 2X0EA 3WFJA 1JSRA 2IW3A 4GM4A 3O82A 2A5DA 1E9BA 5DT2A 4EHIA 4B3CA 1PKXA 2J8ZA 2LCIA 2MSLA 4OQZA 4B6OA 3WMRA 1R6AA 1HYQA 1VHLA 5DCLA 5FTMA 3UWKA 1KE1A 1WETA 2WIBA 4MULA 3MQ4A 4JVLA 3QM1A 1ZGGA 2GUGA 2GUWA 2XE6A 2HN9A 3LX8A 3HUDA 3U4HA 1JJ7A 4LGVA 4KRGA 2EYQA 4FHCA 4H7PA 4TPKA 4BE4A 1TVMA 4JWKA 2EKQA 1QG4A 3EIQA 3IVGA 5F2OA 3ZV5A 3WQZA 4M88A 2HW8A 1RKQA 3DOFA 4R8LA 2WSLA 4ALKA 4D9GA 1MG5A 4U7PB 3EQZA 3H9QA 1A9RA 1T2UA 2MSNA 3PVSA 2WIJA 1O1YA 2PVPA 5KSYA 2WHRA 2Y2UA 4DUYB 1Y3CE 4OU4A 3UG7A 1L1FA 4H4DA 3AM3A 4ZZIA 1HG1A 3BD6A 2Z5GA 1SXJC 2ZJ6A 4P82A 2JGDA 4ZCQA 2MWMA 4MRVA 3AXSA 5IDVA 4YYZA 3WB9A 3M49A 4TQUS 3IBCA 4BNMA 2NNWB 3PEUA 5FAKA 1E6MA 2GAAA 3LVFO 1A72A 2CUKA 2EDAA 2EBHX 4ROSA 5IT4A 3PRYA 4CM5A 1VECA 1JDNA 2XQKA 2A0KA 5EE3A 4DSNA 2NU9A 2JGAA 4BXOB 4CV0A 2AC4A 3BL6A 1OZAA 4MQEA 1V45E 5KNDA 4IINA 1CKEA 1QAQA 2V58A 4MVJI 4IIDA 4OJQA 2JFGA 1MC8A 3TNYA 2LCFA 2V5AA 2HMTA 4WK0B 2BUCA 1E3QA 2Q46A 3LQYA 3R07A 4W5WA 1T9BA 1DCFA 4BE7B 4MKFA 1AD2A 3AFNA 1K1EA 2XUPA 3V7SA 3LZCA 3GRKA 5CVDA 3R76A 3BOSA 2IV2X 3LOPA 2BVNA 3MFQA 1HL3A 4JUCA 1MB0A 2A88A 3L79A 2FSGA 4KLZA 1VMEA 5A7FA 2F43B 4X5OA 1Y1LA 1U02A 2WWFA 3MT0A 1S01A 4OMCA 1UPXA 2QPLA 5HRAA 4PZUA 2XYQA 4MS4B 1Y33E 1HYGA 2ZTVA 3OJFA 3INRA 4KGXA 5AI5A 1ZESA 5DHSA 1N92A 1LNZA 3FMOB 3MGBA 5AKEA 4Q3NA 2RGAA 4BMYA 1W1WA 5F3RA 4BV9A 3VO1A 3M4NA 4LJKA 2I6GA 4PW0A 5ALKA 2I99A 2O14A 2ZATA 3DEHA 3KV3O 3F5SA 1QM5A 3C6MA 4OL9A 3I4LA 2WFAA 2GYWA 3SQMA 3U3JA 1X80A 1S1CA 2W42A 2XWPA 2HHJA 2WYUA 3F98A 3NKFA 4FE7A 4CMGA 2LKDA 2AN9A 3SPXA 4OQ4A 2P8SA 3QX9A 2O2CA 4ZO4A 2ZXEA 2WPDD 4G4SP 4KC0A 5ELNA 4NNJA 1KYVA 4RJJA 2C4NA 1YGPA 2C3YA 1SD1A 5EXSA 4EY4A 2P65A 1O94A 4CETA 2DQ0A 2C5BA 5CP8A 3QPDA 4G07A 4DS3A 2YR0A 3P71T 4R5MA 3C6QA 1PD1A 1RQ7A 2PRYA 3D2CA 5CX4A 5H02A 2WJHA 1KO5A 1PUIA 3R5FA 2PLNA 1O57A 3HXQA 3HO1A 1BXRB 4KOAA 3ICEA 4K9RA 1VLLA 3CB4A 4O4HB 3QWHA 4FDTA 4CT5A 1N5JA 3M4JA 1EK2A 4IOKA 3VR6A 4XD7D 1P18A 5HVNA 1IK6A 5C52B 2WC1A 3BWVA 3LPMA 5KINB 1W5TA 3RRXA 4WXYB 1N36B 3EY9A 4EG1A 3AHFA 4PPGA 2FR1A 2Q6LA 5E4JA 3DE0X 4B6GA 3EWAA 3L7DA 1OLSB 4G23A 4AICA 3HM2A 5MN4A 1N2HA 4OATA 3E58A 4X45A 4D97A 2EGUA 1HDEA 3ZHBA 5KREA 1NI4A 5DLQC 4TLBA 2RIRA 2DRIA 2C29D 2P6UA 4E46A 1OZHA 5BUSA 1RFLA 3HFSA 2E2WA 1PE0A 2YZNA 3WLAA 4BUCA 4RD3A 3SEFA 1RTTA 3ED5A 1IZ0A 1WP4A 2P9ZA 3NVMB 5EMHA 2UXCB 1JHAA 5DHTA 2XZDA 2FDXA 5I7FA 2J67A 2PNFA 1PZMA 2FI1A 1S6YA 3SIXA 1DJPA 1G6Q1 3JWJA 4M3NA 5BRNA 2OBNA 2D06A 3E5MA 1KS2A 1NLZA 2F3SA 4FSXA 3SWWA 3WGIA 1N33B 1TJ4A 4PHCA 1EDZA 3BWBA 2I4IA 2PE5A 1EFCA 4F60A 1JR2A 2ZRFA 1GA6A 3RSLA 3DWIA 3ZV6A 1CSEE 1DINA 5IT9A 2OQIA 3F90A 2CUZA 2W7TA 4TMWA 2ST1A 3C3PA 3E0QA 1M8PA 3L06A 3L6EA 1QHXA 4FCTA 3WYEA 1ODJA 5ETJA 4ZAVA 1IQ0A 2YCBA 1ADJA 2I34A 2A9FA 4B4WA 4Q3BA 3UJHA 5DMHA 2C20A 2WD7A 1M1YB 3HY6A 3KEGA 1Z0ZA 3QVOA 4UHKA 3T3IA 4D9NA 3LT4A 2X6RA 4K28A 1KE2A 3R3HA 4X24A 3RYHA 1YJAA 2QVBA 1PJ3A 5THQA 4P4NA 4YDQA 2GZSA 3OQHA 2IZ7A 4LZOA 4EP1A 1OHHD 3OM8A 3PD1A 3TH5A 1JHQA 1WZUA 2HK9A 4Q7KA 4XDHA 2GJ4A 5B4VA 4WK4B 4DYHA 621PA 2J5BA 1N25A 5FUYA 3FM9A 3HTZA 4C6RA 5CFOA 4BLVA 3OPYA 1KI1A 4JJ4A 4Q15A 2BFNA 4QELA 2CNNA 2YHAA 4YRNA 3B6MA 4L5CA 3RSQA 5GV7A 1NVMB 3CTPA 4MW7A 1CR0A 3N8HA 1OOEA 1KOGA 3B6KA 4PBRA 2ES4A 2VF7A 4LSMA 1R0WA 3H2GA 4HX2A 3GYBA 1KSJA 3CEPB 3NHFA 4KXWA 1JEYA 4G0VA 1YBFA 1R2QA 4QYWA 4LVKA 1DXYA 2BFDB 5K6RA 2WY2D 3KXKA 1RLUA 3PNSA 4IKPA 4LRYA 1NP7A 2AIRA 2ZUBA 3K9CA 4DWVA 3DVRX 2GAIA 4LF4B 1FDIA 2VIIA 4PO1A 2II6A 4C6HA 2EZTA 1HT3A 5JO0A 3PT9A 4U2KA 2CC2A 3D0KA 3FUTA 5JYBA 2BELA 1N9GB 2IE0A 2R6ZA 1AE1A 2WF7A 3JZAA 3X1DA 1DJLA 3DCNA 4Y2GA 4AN1A 1F8YA 1VPTA 3OOHA 2C59A 3NTXA 4B7AA 1OZ0A 2L42A 1JYEA 1DBVO 3Q7IA 1CF4A 5KTSA 3FPGA 2V7EA 1B93A 3SKXA 1IOVA 3TIXB 3GY0A 1Z12A 3F4BA 4HAUA 1CVRA 3M1IA 2VJMB 4MV8A 4DMGA 1M5RA 3H2BA 5CVUA 4PG6A 3STTA 2R11A 3ONDA 1KVRA 1Z56C 2ZJYA 3RLIA 5BY2A 4RPIA 2GKSA 3NYIA 1J1IA 4P2GA 4Q3LA 1RAGA 5EZSA 4ZALA 1YFLA 1DKUA 1M1YA 3I34X 2D1YA 4KXYA 2PBFA 3SIPA 1L3IA 1VC2A 2YXBA 3I2GA 2UUBB 4B17A 3KZVA 4WSOA 3W2FA 4BKRA 1FPQA 1OREA 1DWOA 3ZBUA 3ST7A 4B6JA 3SYMA 4PEVA 4XRGA 1JKFA 2PRKA 1VPLA 2K7ZA 2VJQA 2J59A 3HEMA 3JD4A 2WWYA 4R40A 4ABTA 3D8NA 1JPUA 2GWRA 3RVJA 2JGFA 4YXWA 1ZWLA 3KFVA 3V3KA 3RCBA 1RTKA 2YY6A 1B8NA 1GZUA 2QMYA 2VP6A 3A1NA 5M3BA 2AI1A 3FNEA 5CXXA 1LF0A 5GOZA 4EYOA 1RWVA 1DB3A 5I9BA 1H8HD 4OQQA 2ZJZA 3QPCA 1L5WA 1ZM4A 3EVTA 1JFLA 2EBUA 4UXIA 1XZAA 2PZKA 3KL4A 4BC0A 4QBGB 3KJIA 2XYHA 3R0XA 1E9EA 4NG4A 4DJDC 4EARA 1C29B 1J33A 4WNAA 1DDOA 2ORVA 2AN4A 3B1WA 3DC2A 4QXMA 1KP3A 4DN6A 3HXLA 4PSVA 4M55A 2WICA 4BZPA 3V8KA 2JS7A 3CKLA 2QQEA 4GX0A 1N6NA 4C29A 1H2FA 1IL0A 1VYVA 2EZ9A 2VHEA 3GNSA 3KTOA 3NNDA 2W2KA 1I6KA 3QPVA 5IVIA 2QPOA 4D0NA 5MN5A 3WK7A 3NEAA 1M6EX 1HA3A 1YMVA 3IERA 4FILA 4O2AB 2O0KA 3QPUA 4W7IA 2P27A 2R5NA 3DLCA 3OA0A 4G2TA 3W5SA 3Q7RA 1TZMA 2QXYA 5JVDA 11ASA 2QQ5A 2XUZA 1Z3CA 4LA4A 2FZCA 1YC5A 1CFZA 2AQIA 2AWOA 2DPLA 5DJ5A 3DA8A 3RS9A 2HD4A 1VSQA 1JJAA 1VJ0A 1VYUA 4J49A 1JU3A 2CLCX 3ZLBA 1E20A 1LBIA 2FG6C 4M7WA 2ZYWX 3KXDA 4OEHA 4Q66C 1NZJA 4QQ8A 2HMVA 5BYKA 4CEHA 2BEWA 4BQIA 5AIBA 3HXYA 4EZIA 2LR0A 4IQ0A 1BE1A 2ZI6A 1YTUA 1SZDA 4DCCA 4H2VA 5DISB 5GOTA 4KWEA 2BDTA 2FQWA 2F3UA 3FBTA 4MW1A 4AIRA 5DBEX 4C4PA 2Q3BA 2EL7A 1BH2A 1S7CA 1XEXB 2B25A 3IG2A 1A2QA 2FWRA 2PK3A 1TM1E 1WL8A 2VHQA 1MB9A 3PNKA 5BYBA 5JAHA 1L5HB 2GHRA 4OK3A 3K4HA 1QWSA 3LFHA 1DBSA 5M5BA 4O4HA 1Z0SA 2H6EA 2WUEA 4O63O 5KDOA 5GP1A 4DMMA 1XP5A 1BA3A 4Q18A 4R16A 1KH3A 3IEXA 4RLHA 3FFTA 2P9BA 1L3BA 4ZTBA 2ZDGA 5EUQB 1ZGHA 1ENOA 4P36A 5CVVA 2OCKA 1MP0A 3C3DA 1TM7E 3AJEA 1B41A 2CKDA 3JRWA 3U4GA 3V7YA 5CDUA 3W5AA 4J1QA 1EXVA 1IHDA 5LZ8A 1YWGO 4H1TA 3BWEA 2D7CA 4Z3OA 2D1TA 4QBIA 3FGZA 4H2UA 2K87A 1PI3A 3FNQA 2ZRBA 4MYRA 4UVEA 2RHOA 5H3CA 5CA1A 4OAQA 3K3PA 4RMJA 3CWQA 3F7TA 2DECA 3JRXA 3WP0A 3GPCA 1GU7A 1DX4A 3ICAA 4RMIA 2O2YA 3HG7A 3MIIA 1ZHOA 2O8CA 3OUZA 3UQYS 4CXMA 5HIIA 4G8JA 1JNXX 3PUIA 2IY5B 3U39A 2ZZKA 1CRZA 2CFSA 1ZD2P 3C8DA 2GWHA 1M9NA 9ATCA 3SD7A 1FU4A 1EB9A 4I36A 2RGBA 2JCSA 3BF8A 2E5AA 1WLYA 1O8CA 3DEIA 4TTAA 1ZSNA 3MYYA 2P9HA 2PSJA 2P90A 3CEAA 3UBMA 1GRCA 1YQUA 1YS2X 3ETGA 1ONNA 1NNLA 3P5BA 1Z33A 2VP5A 3DUWA 2IF2A 1TEZA 5D3ZA 1J0CA 1PEAA 1CQIB 1NPYA 4TRMA 1THGA 1EG7A 1TF2A 3ON5A 5EMMA 1ZJWA 5BSKA 3ESXA 4C7BA 3RRMA 5ALZA 3ZS8A 1PR5A 1LK0A 5FTLA 1QHSA 1QE3A 3D7RA 4ID9A 1E6UA 4OSPA 1CB7A 2RGEA 5FIUA 1W1IA 3K73O 5IBPA 1GKIA 1H8HA 4RWZA 1NSYA 4EG6A 1LX7A 5GQSA 2CZGA 3REOA 4DUGD 1R27A 5LQNA 4FOTA 1YDMA 4WCDA 1QU3A 4HPXB 3W3SA 2VH5R 4YRBA 3DGEC 1DQPA 3JVIA 1FW8A 4MWSA 4D42A 1YFJA 3I6YA 1WHSA 5IYZF 3RIRA 4HB0A 1YDGA 2ZSEA 3UTDA 1IAVA 2PZMA 3CNLA 3SC2A 3I8SA 5IWCA 5ICSA 1GPNA 2JRCA 2YZKA 1NFRA 3HU3A 4LJYA 4O2AF 3WO1A 2V6FA 1FBNA 4EA9A 3A7DA 3AEKA 1K9VF 5AKKA 1Y81A 2PPVA 3FFWA 4BNZA 4CM8A 4I4NA 1A8IA 1QJ4A 1XJCA 4BY9E 3NM5A 5TEVA 1E7RA 2EW2A 3IO3A 2R6JA 4Z0HO 5NLLA 3WMXA 4AUMA 1FUUA 4ARCA 2ZJBA 1GGHA 5ECWA 4ZZ2A 4MUBA 4BRZA 4RLSA 3M9XA 4CLRB 2B20A 3DE7X 3MELA 2Q8NA 3GIWA 4EUNA 1PQWA 3GLKA 1JH9A 4CF4A 4RNDB 4Z2YA 1AMNA 4ZQGA 2ON6A 4EBBA 2D59A 1B1AA 1Z0KA 3IALA 4QYXA 2BHSA 3LLMA 1N7IA 3ZWPA 4L85A 4H31A 4BVGA 5D86A 3BMCB 3VR3A 1Z2EA 2V7BA 1FYFA 2I7CA 2PFSA 5JE8A 2JGKA 2Z6VA 3BL8A 4BO4A 5U1PA 4FC7A 4Y6SA 2NTEA 2XEDA 1ZJ5A 4E12A 5FR2A 2E55A 4D3FA 2GOYA 2Z3VA 4KXLA 1E9FA 1ULSA 3H5OA 4Q9AA 5ECDA 3W9BA 5JCZA 1KYQA 3C39A 3OLWA 3WTCA 3ZEIA 4F21A 1N77A 4RDCA 4CRWB 2FDRA 2CNOA 1T9GR 4JCOA 4HA8A 3B51X 2ZBPA 1S0UA 3FCYA 4OLJA 5K1ZA 2YX1A 4EQZA 1G18A 4P3OA 1II8B 2WYVA 2AHOA 3IBTA 1T9CA 4LKRA 4DCOA 1NMXA 2I22A 4FHFA 4UTZA 4C2AA 2PMCA 3PI6A 2QT0A 1GPBA 1TYBE 3AV0B 5CEJA 3ZWXA 3RFVA 1OLSA 3NIWA 1L4HA 3TZEA 5K01A 3IRVA 1OKKD 4Y3UA 2QZ9A 3U3RA 2ZIXA 4PYNA 4D9IA 2V0GA 2C7RA 1QH8B 5IJWA 1SKYE 1IMOA 2BZ1A 3AFGA 4Q1EA 4RKYA 3RANA 5A5DA 2ANCA 2ECQA 4NCXA 1G1AA 3VV3A 2CMKA 4H6WA 2ID4A 1I2MA 2X5KO 3RKSA 3IT3A 2IYUA 5K3FA 1NXQA 2W8BA 1BQEA 3J81A 4HB3A 4MXDA 4NZNA 2VPZA 4M0KA 1WDMA 2A4MA 2QZJA 3QXHA 5FBLB 2A67A 3SDZA 2WU8A 3ZKAA 4DV5B