5C53B

Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial dna polymerase gamma
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
385
structure length
363
Chain Sequence
ALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGRKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial DNA polymerase gamma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase subunit gamma-1
total genus 84
structure length 363
sequence length 385
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5c53B01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 5c53B02
3RF1A 1C0AA 1X2GA 1JJCA 1X2HA 4H02A 4UP9A 2G4CA 2ZINA 3UFGA 2E1HA 1GGMA 1PYSB 4TWAA 3PZCA 2I4LA 1NYRA 4YPFA 1B76A 2Q7GA 5E3IA 5K1PA 1WU7A 2I4MA 4G85A 3RKWA 1X01A 2Q7HA 2ZTGA 1E24A 3P8YA 4UPAA 2HNIA 4H2XB 2QHTA 3LC0A 4YYEA 2CGHA 3W3SA 1SETA 4P75C 1KOGA 2EJFA 1YGBA 3QO7A 3V8JA 4ZTZB 1NJ2A 1YB3A 5C51B 2DTIA 3M4QA 4RQEA 4XU2A 4DQ2A 4KR2A 4E51A 4OP0A 4TVWA 3BJUA 1H4SA 1B70B 3R07A 2CJAA 4YRTA 2DXTA 2AKWA 3LSSA 3A5YA 4X5OA 4HWSA 1LYLA 3IALA 5HGQA 1IL2A 1H4TA 1BBWA 1V95A 3VQYA 3ICAA 2ZNJA 3EFSA 4HWOA 3VQWA 4HWPA 4L87A 3TUPA 1W66A 1EIYA 2IY5A 2ZZFA 1JJCB 3KFUA 2EWNA 1J5WA 4YRPA 4YCWA 4UP8A 2DU5A 2ARSA 2ZZEA 1B8AA 4H2UA 3TEGA 3ERRA 1L0WA 1PYSA 3TEHB 2DQ3A 3PCOB 1YFRA 3HXVA 3I7FA 3NELA 2J3LA 3L1AA 3QO5A 2DZ9A 2ZR3A 1E1OA 3P8VA 4H2VA 3PCOA 4YCUA 2ZCEA 2ZR2A 3NETA 3REXA 4TQFA 3UH0A 1NJ5A 1EQRA 4K87A 3HRKA 1BIBA 4BW9A 1FYFA 2DJZA 1SRYA 5F5WA 3HXYA 2P0LA 2DEQA 3UGQA 2ZGWA 1E1TA 3HFZA 4KQEA 2C7IA 4XU3A 4H2XA 3V8KA 2ZT8A 1NYQA 2AKWB 3MEYA 4HWTA 1Z7NA 4WJ4A 3A7RA 4CH5A 4RDXA 2E41A 4H2YA 4XTZA 1EOVA 4TVAB 1ATIA 4CS2A 2AMCA 4XTYA 4TVAA 1WNLA 2DTHA 4YROA 3VBBA 1ASYA 3HY0A 4YCVA 3NENA 1WQWA 3RKYA 2XGTA 1B7YB 3MF1A 2EL9A 4P3OA 3V8LA 2Q5IA 3L4GB 4YREA 3A7AA 1QE0A 3VQVA 2DTOA 2ZT7A 1EVKA 3V7CA 2ARUA 2CJBA 1WPYA 1EFWA 4NCXA 3VQXA 2ODRC 2ARTA 3A32A 3RGLA 4YRMA 1EVLA 3RKXA 4RQFA 3QO8A 1BIAA 4Q6GA 1ASZA 1G51A 2DDZA 4CS3A 1HTTA 1WQ7A 1WLEA 1X54A 4CH3A 4ZTUB 4WF2A 4YRQA 3UGTA 1G5IA 3E9IA 4J15A 3IKMB 5KNNA 5ELNA 3M4PA 4G84A 4KR3A 1X56A 1H4VB 3HFZB 3RUXA 3A74A 4RMFA 2QHSA 4AH6A 4YRIA 3NEMA 4O2DA 2RHSB 4YRCA 1SERA 4XTWA 3G1ZA 4XEMA 3P8TA 3HRIA 4XU1A 2ZIOA 4XEOA 3HXZA 2ZIMA 1G5HA 5C53B 12ASA 2RHSA 4H2WA 3L2ZA 1WYDA 2J3MA 1NJ1A 1NNHA 3V7RA 1NJ8A 3HXWA 4YRSA 3RL6A 4YRNA 3QTCA 1ADYA 2DQ0A 3RIRA 4YRRA 4TQDA 3IG2A 3REUA 4YP0A 4YRGA 2DU7A 1NJ6A 4TTVA 3A31A 2EAYA 4CS4A 3FJPA 3A7UA 1EIYB 3BFMA 4Q15A 2Q7EA 4P71A 4P75A 1YFSA 2E5AA 2CIMA 2E10A 2ALYA 4XU0A 4YDQA 4WJ3M 4P72A 4HWRA 3TEHA 2ALYB 5K1XA 2LW7A 1HC7A 2FYKA 4P74C 4P3PA 3HY1A 4CH6A 4BWAA 2EJGA 2RHQA 3EFRA 1E22A 4P73C 2ZNIA 3RACA 2RHQB 5C52B 1X55A 1H4QA 1RIQA 3LSQA 4K88A 4PHCA 2XTIA 2EJ9A 3HTZA 5ELOA 2P5IA 2E64A 2DXUA 4XTVA 1SESA 4H2SA 4YRJA 1USYA 3QNEA 2QHVA 2QHUA 4WI1A 4PG3A 4UP7A 2C8MA 4XTUA 1KMMA 1YFTA 3OD1A 1B70A 11ASA 3HXUA 3IKLA 4TVYA 4H2TA 3HFVA 4P74A 1USYC 4YRKA 1Z7MA 4HA8A 4P71C 2ZT6A 2ZZGA 3WQZA 3MF2A 2Q5HA 3HXXA 4CH4A 3V7SA 2I4OA 2CJ9A 4YRLA 4HVCA 4XTXA 2ODRD 2ZXFA 3E9HA 2DVEA 3L4GA 4P73A 2AMCB 4DPGA 3CMQA 2E65A 1B7YA 1N9WA 2E3CA 4P3NA 4ZIBA 4OLFA 4LNSA 4EO4A 2I4NA 1KMNA 2PMFA 4YRFA 1QF6A 4K86A 3DSQA 2IY5B 4EX5A 1VQZA 2ZT5A 2DZCA 1ADJA 4P72C 2DKGA 1HXDA 2PMEA 1BBUA 3A5ZA
chains in the Genus database with same CATH superfamily
1EXDA 2E7ZA 5A04A 4PFKA 3PX7A 1U04A 4K7JA 1VJRA 3HP1A 4V38A 4YCLA 1X2HA 2HNKA 2GBLC 1QWSA 2PMKA 3F74A 1YU9A 4GOKA 2HHLA 2HMSA 1JDPA 2IODA 1Y34E 5A5FA 4DMRA 1TKAA 4QARA 4EYGA 3UFGA 2Q49A 2XA2A 1XX6A 1RYYA 1WHTA 3GC6A 2A9JA 4U7PB 1ORIA 1RZRD 3K0CC 4M0LA 1DG9A 3SLRA 1WBDA 2BR4A 1Q1ZA 1Z5GA 1FLAA 1SCUB 3K8YA 4FC7A 4L8FA 1X8LA 4Z9AA 4EUHA 3HJFA 1FDSA 1UBOS 5CVEA 4C4AA 2XMBA 3O8LA 1W49A 4RL4A 5F7JA 3VR6D 1Y80A 1UDRA 1ZOLA 3HFGA 1F2VA 3ACBA 3KQMA 4RHCA 1K5PA 2X1LA 4Q4AB 5FBKA 3KALA 1KZ9A 2OQRA 3LGXA 4I8IA 5LA6B 4MICA 3AIIA 4HH4A 5DTEA 2O19A 5A6SB 4R9UC 1BX3A 3P8YA 1UDAA 1TA9A 4RFLA 1K98A 1BCRA 1ZD5A 2X40A 2CNDA 1N2JA 3E7DA 3H1FA 1T8RA 3JV7A 3WIEA 2ZBRA 4Q02A 3NBXX 2YZNA 1SETA 3EVGA 4W4TA 2GILA 2BTOA 3IVAA 4MPTA 4PPQA 2F00A 4TRMA 3UMCA 4N7RA 4CKBB 4CM9D 4F2HA 5ADVA 3NWOA 1KK1A 5EWJA 4X8HA 2INGX 4FHFA 2O3TA 3E1KA 4Z8XA 2AMVA 1GNRA 2GCIA 3B12A 4DQ2A 3IT1A 2O8BB 3JQ7A 5EXXA 3F9RA 1NG9A 3GW8A 4TVWA 2X41A 1J5XA 4GPAA 3RRYA 3VZPA 3RLIA 3ST7A 4MJ3A 4BO2A 4CIDA 4BGIA 1DCFA 4YAUA 1IONA 1QYDA 4ZQCB 3WBKA 1DBQA 3WTBA 2BEWA 2BMEA 1ISGA 2Z57A 1G20B 1Z2EA 2QEQA 3CCBA 3RASA 1S8NA 1ONSA 1UXOA 2VOEA 2RCNA 3Q9NA 4JK3A 1WS6A 4M0EA 2GLUA 5DXFA 1I2MA 1PEKE 3D4LA 4JT4A 3FPKA 4V24A 4B6GA 1XJCA 1YRBA 2R65A 2R5WA 3ANTA 3D1LA 3IAM1 3JR7A 3ITNA 1J42A 4HADA 1VDZA 3JQGA 3DL4A 3PIDA 4II2A 3RAGA 3TCXB 4LC9A 3WFZA 5A7FA 5KNBD 2WJJA 5KNDH 4JEHA 4ML3A 4CEJA 1B1CA 1RXCA 4KXYA 1F14A 3LX5A 4HGNA 4DA6A 2NQ2C 3FLMA 1FFGA 1ZW6A 4NNPA 1VA4A 3FFXA 2B37A 1UAGA 2ZIAA 3ZCUA 1IQ0A 2PZLA 5AK3A 1KF0A 3CNBA 1NN0A 1AZWA 1RMQA 2QL9A 3G1WA 1DPGA 1WD7A 2CLSA 4FUQA 3P2MA 4IUCS 1JZSA 3AHEA 4BLTA 5CLGA 4DIUA 4ZI7B 3RR2A 2VJKA 3Q15C 3GLIA 5FBRB 2PZJA 3G2JA 4DDWA 2IHUA 5FAXA 1QIFA 1AOXA 1RSZA 3B82A 4E5YA 3R9WA 3RHSA 2P9HA 4JOSA 1KYIA 3T1OA 1OAOC 3DYVA 4PC7A 4MRNA 3C70A 3T99A 4EUNA 3EZGA 5IU6A 5HP4A 4TWBA 1H8ED 1ECCA 1GGVA 2J5RA 2D62A 4JCCA 1WU8A 2KX7A 4NTZA 5CH5A 4UP8A 2CUNA 2DHCA 1B8AA 5H5JA 2VXYA 2HCTA 2HPAA 4XJVA 1CCWA 2RGYA 1P18A 2F67A 4XYGA 2GAIA 3IIKA 1Y1RA 3DHNA 4IXNA 2EKQA 4QFBA 4NJEB 4ZIRA 2C0CA 2R11A 2BMFA 4ZRMA 3DWGA 5C31A 1E1RA 3LK7A 1SHLA 4IV5A 1U98A 3C6XA 1CY6A 4XIYA 4EB3A 2A67A 3KTAA 4PTLA 3RSSA 3PHBE 4W8OA 3LPAA 2UZ1A 5BOSB 1E5XA 4IUDS 2A1TR 1GO2A 1LBSA 1EJ0A 2FWRA 4UC0A 4A1FA 1E89A 1F8UA 3MOGA 5JXHA 2X0DA 2VJNA 2BKEA 5D8DA 3NOOA 4M55A 1BEEA 1SC1A 5ER6A 5LZ9A 1EESA 1KI4A 1P3JA 3UH0A 4TTAA 1EUQA 4LYFA 3GT3A 3W2IA 4JXXA 4UXIA 4PICA 2B5VA 1PAUA 1UH5A 2YOFA 4BVAA 3KU4A 2OHHA 2OPBA 3BMCB 3OJLA 4CM4B 1YFJA 1P72A 1JKXA 1H85A 3ROQA 4J1TC 3HO1A 3IAUA 4GBED 3HCFA 4URZR 4U7DA 3O4JA 1BDBA 2DFPA 3VKFA 3IBGA 3B20A 5LYYA 4B6QA 3JATA 2ZJ0A 4H1TA 3W3AD 1YR3A 1GGJA 1GSAA 1KQPA 1YL5A 2BMJA 1PS8A 3B8HA 3DR3A 3EXFA 2A0KA 3UOWA 1NBMA 3QVUA 4KR6A 3DWFA 4LSMA 1Q5PA 1UMDA 5HKOA 2L69A 5LLDA 4L15A 3M9WA 3MC1A 3PJEA 4HB2A 3ZWXA 5I4CA 3O4HA 4CCYA 1FU8A 2HZ7A 2OBXA 4IWXA 1ZCBA 1XD2A 4U6NA 1NSTA 1W0CA 2VRCD 3FG9A 4IDEA 1VGVA 2Q5FA 5BXQC 3MELA 1MW8X 1X0VA 1ZAKA 3BE8A 3E48A 5CFOA 2GN6A 2R00A 2H11A 1P80A 4KCGA 2DP4E 4NECA 2XF2A 2JBWA 1PUIA 2OV2A 5JEDA 1GXSA 3TVYA 3ZDBA 1OFTA 4B3DA 4HNAB 1Y33E 5CJPA 4YAJA 4KB5A 5AW3A 2UUPA 1PIWA 4I3GA 3DT9A 4FT2A 3STWA 3ZOZA 2ATIA 2FW6A 1TJNA 2EGUA 3IQIX 3BB4A 3PYXA 3WGYA 1KR5A 4Y2HA 1Q95A 1OI7A 1Z7BA 5FULA 1SM4A 2V7UA 1ASYA 3NCTA 1R9MA 1Q0SA 3K9NA 3WLJA 3SX0A 4V3BA 2UVDA 4YMHA 3H84A 4ZZIA 3L6EA 2OCPA 1TIPA 3I0NA 3HB5X 1TYZA 1B7YB 2HCJB 3PFWO 4IHJB 4WK2B 3MHPA 3LQFA 2NO7A 1FX1A 1LVGA 5L45A 2VWPA 3L4GB 4LVCA 4PXSA 4B80A 5FAKA 1Q0PA 2A88A 4X7MA 3A7AA 5EFZA 3E9MA 5HZKA 4M49A 4F5WA 2DTOA 5A9SA 2DKOA 1VL2A 3LNCA 4E22A 2UUBB 2BRUC 2A8YA 5EWLB 2FG5A 2FWPA 2G0NA 3NEYA 5LQRA 1ODTC 3W5VA 1PE0A 1R2QA 2FZEA 3HZZA 2FYTA 1YAJA 3PB3A 1ISRA 3BGWA 3C4VA 3GJ8A 4TLMB 4JP8A 5EMKA 2B78A 3N7UA 4MJXA 1SOAA 5L4NA 4MEBA 4C88A 1Z7EA 5ADWA 1EFWA 5EUBA 2BD0A 1IAVA 3OX4A 1TF5A 2QYHA 2FMHA 4HX2A 5KNBH 1HM5A 2E21A 4TLAA 3A32A 1U9IA 2H59A 3BD7A 4DLWA 3JQFA 4S05A 3V9PA 2Q3FA 5KKCA 3U3JA 4H1UA 3OPQA 4ERXA 1U9ZA 2CY0A 2RGUA 3LFUA 1FZTA 1JT2A 4Q6GA 3S29A 3SQLA 2J3IA 4DGQA 3IBFA 4DMHA 2DBRA 3ZWKA 1IATA 1HTTA 3AKCA 5K03A 3EIFA 3T9FA 4CL3A 5AVYA 1F6BA 1TRHA 2GWRA 5GM2A 3THXA 1ZK0A 2IYTA 3R0JA 4E0BA 4QQKA 2GEFA 2GYUA 3MLAA 1LLDA 1V3TA 1GFSA 1VBFA 4RW0A 5PNTA 2IZ5A 4AG3A 3EXHB 5GADl 1RJGA 1TE2A 4RK7A 4DEXA 2V7VA 2OO7A 4CUKA 2EWWA 4OHMA 3IKMB 4YJHB 3QI2A 3EARA 5ELNA 1FIUA 1C30A 3X1DA 1QP7A 5IC4A 3FYCA 5DM0A 5TQVA 1IZYA 1A71A 3CS3A 5DEIA 1RBQA 5CT9A 4E2XA 1A7JA 5AW1A 1XROA 2AXEA 3A74A 1RQXA 3GRKA 1KK0A 1P0QA 4X60A 3OAAD 3HPRA 1SD5A 5TSDA 1HKHA 2RHSB 1SERA 5I9TA 3AVVA 5DX8A 1AB6A 2W37A 4LYGA 1JPNA 1IBKB 2VI5A 2C2XA 2F8LA 3MN1A 4GXQA 2BFEA 1N6HA 2BCEA 4ND7A 4PX3A 2A0WA 1WCIB 1B26A 1TVCA 2F62A 5JFTA 3LXUX 2AW5A 5C53B 2XCIA 5AW6A 3D54D 2JGFA 3AKYA 1UF9A 2WM9B 3T7KA 3R6DA 4A7PA 3ZW7A 3L1VA 2JIZD 1L5SA 1F60A 5AKYA 3RTAA 3F6CA 4IGAA 3SWWA 1GPKA 2BN4A 3TW6A 4A2PA 3EW7A 1LBHA 2Q9UA 4Q5IA 5KI6A 4X97A 1TUIA 4S12A 3ZQKA 5KHOC 4WH0A 3SQWA 2NZWA 1NXTA 4MWZA 1E8DA 2NP6A 5HVNA 1A72A 4O4LB 4U2GA 1KDOA 4MNTA 2OCIA 4C7MA 4Y1RB 4I14A 3JARB 3RGWS 4ZHQB 1AV7A 1YZUA 2XKBA 1QHSA 4YRNA 1D2CA 1HDEA 1WXDA 2WW8A 3CZ5A 2OKGA 4YY3B 3HUFA 1G60A 4UEQA 1KPGA 4M7WA 4RZUA 4RBNA 1NNEA 3SFTA 4DDHA 3CF4G 2IIVA 1KYXA 2H17A 4RZIA 5EWMB 3MJVA 4N8EA 4OHRA 1U2PA 3LQRA 1VRWA 3TRIA 1A82A 1EHCA 2M1ZA 3REUA 4YRGA 1Y5RA 4FX5A 3BA1A 5FB3A 2AEEA 1Z6QA 4FYJA 1W88B 5FL3A 2HADA 1V8ZA 2Y1GA 3PFBA 3ROFA 1MX9A 2NP7A 4MS3B 2AXQA 5SYMA 3SSAA 1P91A 2ZK7A 2XUJA 5ITWA 2PXHA 3DZDA 1US8B 1O94D 3WNCA 4CE6A 1FFAA 2VL7A 1W35A 3CNEA 4AD8A 1JLSA 4FGLA 1GTG1 1KC3A 1F4VA 5ECDA 5HG0A 4I9HA 1JHZA 1MOPA 5A3QA 2BDTA 2VIIA 3SF8A 2MYTA 3UK7A 1NTOA 1ZN8A 3GNLA 3IP6A 3KXDA 1Q74A 2BE9A 2GM9A 1DV2A 5A05A 4BNHA 5GIOE 1U0SY 4RX1A 1DFIA 3GEPA 2F59A 1PG0A 3ELDA 4BJHB 1OSNA 1JMKC 2FW9A 2IOFA 2QN3A 4MGYR 3F7NA 1X9IA 3OZFA 2YWGA 3MILA 2AIRA 4A0HA 5AVJA 3GD5A 3OPXA 4IICA 1DRUA 1WMBA 1M34B 4KPYA 2CLHB 3FTFA 4HQ6A 2G36A 4EGCB 4QQNA 3CPHA 1X55A 3P8ZA 1G16A 4RANA 3IILA 3T1NA 1CUIA 1Q0TA 2MIIA 2PX3A 2XEXA 1V8DA 2W5UA 1P7YA 4RGQA 4AJ1A 2V97A 5A6SA 1UKCA 3HZHA 2WD7B 2ADMA 2MMCA 4FMDF 4BNDB 4UOEA 3KVVA 1E1KA 5C80A 1KQGA 2DPLA 2B4YA 5HF6A 1KS2A 1UDXA 1AUPA 1XKXA 2JHFA 2JJQA 4FU0A 3QYFA 2OT3B 4KNVA 2CV1A 3AUFA 5JZOA 4DIBA 1QH1B 3ZIAA 4CXMA 2X86A 3GZJA 4F1WA 2V1UA 4MVJA 2PA0A 2QUIA 4G8JA 4DUZB 4PN7A 2X7XA 4C1BA 3LBIA 1HNWB 4IH9A 2WEKA 3EVCA 3CEMA 1EX6A 4KQFA 4LEIA 3K5PA 4R54A 5IMBA 1IVNA 1UDBA 3IMEA 3PWTA 4JJAA 3V80A 4HB0A 1GNQA 4AZ3A 3DEZA 3L4SO 1INLA 3G13A 2CNLA 1GN9A 1E1LA 2JGDB 1TKRA 1IEXA 4UNQA 4QDXA 1B4DA 2OBLA 2FPIA 3DFIA 5E4YA 1TFRA 2VDNB 2I3GA 3GJ7A 4F4HA 1RYDA 2J45A 4CBVA 2WD8A 2QRGA 4OSOA 4R69A 1PQPA 3CKMA 4RV9A 4E3ZA 3TQFA 1PJ8A 1YI0A 3DE0X 5KTTA 5K0LA 3IA7A 1ZIYA 3GLUA 1J2YA 3ILVA 3RPEA 1YZQA 1NQAO 4AUEA 4BFVA 3OFNA 4HZGA 5CK4A 2HFJA 2ZBUA 2DBYA 4GI1A 1LGYA 4KXXA 2O6LA 2YFQA 4C6TB 4Z4EA 3K0SA 1KFEB 2FEWB 4C4OA 3JTEA 2VP2A 4CKBA 4EY6A 5BUSA 1J20A 3ENVA 1MC1A 3TMKA 2PSJA 1DC6A 1N1EA 3QVMA 4J4HA 3GJRA 2JI8A 3OQIA 4WY2A 1EIWA 1CUFA 3MF2A 1FS6A 1S3IA 2MHCA 2IHVA 2C1ZA 2YL2A 3DSRA 1PR0A 1XQ1A 4XASA 1W36D 2X5XA 5DEOA 3F6RA 4KQKA 5JSYA 4AS3A 2Q2QA 1WY7A 4OL0A 2QR3A 1MNQA 2H1WA 2P3SA 1Q57A 3ICPA 3P52A 5I8ZA 4NYJQ 4KQJA 4PXAA 5IP5A 5MF6A 1DIRA 4OX9Y 1JXOA 4HDSA 2HRCA 1NQXA 3R3UA 4ZVKA 3AOEA 3IUQA 4IGIA 2W2XA 4JJFA 4ZALA 4PGMA 2HF2A 4WOPA 2BR5A 4EVSA 1AMOA 4WN9B 1Z38A 4XIGS 3WYNA 4DWJA 1WBJB 4OY3A 2AR7A 4J0GA 4DPGA 1FPQA 1W85A 2Y92A 4EKYA 5H9VA 1Y3DE 5FWNA 3QKUA 1PT5A 2ZTVA 1R3DA 3ZR4B 4MRVA 2EKPA 3CTPA 4BLPA 2HU8A 3E2MA 3MQ4A 1KSFX 2O06A 3VJKA 1W4ZA 4GLLA 4E2ZA 3B6KA 4C29A 5AVKA 4D80A 2H5LA 3ZJVA 4EI9A 4YRFA 4XRGA 3SXUA 2RI1A 3PHIA 4ZQBA 1OV6A 2A2ZA 2FRXA 1R4NA 4RM2A 4IPTA 1XEXA 3PCXA 1ZEJA 4S0XA 3D6VA 4G9GA 1TU4A 3UBTA 1V45E 3AJEA 3NW9A 2QVZX 1FSGA 2WT9A 1QOZA 2HFKA 4OXNA 3TBHA 3TIGA 2P5YA 2ODNA 1XVUA 2MU1A 4GEKA 4YCAA 5DHQA 2QTHA 4EQ6A 4H02A 4GOMD 5IH7A 1U2EA 4JUDX 4M1WA 3TXXA 3CVUA 5TQ0A 3ZD8A 3AEUA 1VLMA 2IHTA 4KKVA 4PFJA 3WB0A 2RH5A 2VR1A 4Y18A 2E1HA 2ID8A 3SHQA 5CA1F 1U8XX 4GI2A 1C5KA 1N36B 4PC2A 3LDHA 3AR5A 4RA9A 1BE6A 2A5LA 4GPBA 4HFJA 5ICFA 1GA4A 4Z7JA 3RV4A 1B76A 2ZI9A 3EVZA 5FNZA 2DC1A 1N8SA 2I4MA 2AD1A 4E5KA 2ORYA 3AVTA 2AX4A 3BMOA 4Q18A 1HQCA 5FUWA 1B2LA 1G6Q1 2NTYC 2JJ1D 3RVQA 3DXFA 1IUOA 2IKQA 2AS0A 3GEBA 4P3XA 2WICA 4P4SB 5A4DA 5K3BA 4EKNB 5C1BA 3MOIA 4Q24A 5JXWA 2QRKA 3ABIA 3LC0A 2CNBA 3AM5A 3FVQA 4CG1A 4DF3A 3FI0A 5KKNB 3T9CA 3OWHA 2I2XB 2YOHA 3W3SA 4Z4HA 1EP2B 1T9GS 2NSJA 3N9IA 1X7ZA 1I30A 1YGBA 1MP0A 1CNEA 1C1XA 1RBYA 1ZI8A 1H6BA 1SBIA 2Q7XA 3DJYA 1BRMA 4BDSA 3EPKA 1ZRHA 3RFVA 1IY1A 3OZEA 5CIWA 2GYYA 2WSYB 5C51B 3OECA 5COAA 3V4PB 1EQAA 4ADSG 4PLFA 5KTYA 4LFBB 3D8BA 1XU7A 4NP6A 3P4UA 3ZUPA 4OP0A 3IP5A 3EIEA 3L8YA 1N6PA 3JS5A 1U3GA 1MAAA 5AXCA 1YR8A 2X0IA 1PKEA 1QRRA 2QRVB 5BSTA 1ECBA 1YQDA 2P9ZA 2Q4RA 2VAMA 2HTFA 5F7ZA 4BNVA 1TYBE 2JJ2D 5CA0F 1DJMA 3I92A 1U3WA 3GF4A 3QX9A 3OEWA 3L3BA 2PVSA 4W5WA 3SAJA 1VL0A 1JIIA 4YMLA 3L5KA 2BT4A 5IJ0B 3LQ2A 4DV4B 1I7LA 1TTQB 4D0RA 3U7IA 5DHAA 1PT7A 3AY0A 4D8WA 2B1RA 1ESZA 4QULA 3FFAA 3ZVKA 4JLVA 5LNK6 1X14A 4LOAA 1NJGA 1FSFA 4LYEA 3B6EA 5CFPA 1L0BA 1XDSA 4YP5A 4JNKA 3I6BA 4DA0A 1H1LB 3PTLA 4NCNA 2XNDA 2JBHA 3KKNA 3RJZA 5CFQA 1YVEI 1A2OA 5J5VA 3K1JA 3MWJA 4HRAA 5EGNA 1C7EA 4G36A 4OB8A 4BGEA 4CM6A 5HYVA 1XTZA 1OBHA 5EWMA 3VQWA 1KPHA 1WMEA 3QRWA 4M0KA 3TUPA 3A9RA 2E6KA 1FNNA 4LRUA 4MO9A 3RWOA 4OHOA 2ZUTA 3W4IA 1YK1A 4X20B 4FMBB 4S1TA 4AYTA 1MD9A 1IM2A 1KZ7B 1ZVQA 4I4TA 4C14A 5IRCD 3IT3A 4CQLB 4R2KA 3L82B 1B00A 1U4SA 1UBNA 2EWNA 2V5VA 5D01A 3MXTA 3NATA 2ODTX 1A5AB 1P7CA 2FN4A 3K6KA 1BRTA 4TV8F 2H2WA 2WJIA 1L9KA 2JBAA 3EBOA 3ROXA 1BMTA 4YONB 3HI6A 4MX8A 1XO1A 1IRXA 3C48A 5H0IA 1Z88A 1K7SN 3A8TA 4D9BA 4O4JB 4NZ9A 5HGXA 3V1KA 2WVGA 1Q6YA 3I7FA 1PD1A 1KO8A 2ISSD 3E1GA 2R1TA 5BPHA 1VKOA 2A57A 2QN8A 3DF7A 3ADCA 1RHJA 5EE0A 2PL1A 5ULLA 1HLDA 3D31A 1OGIA 2QX9A 3BAFA 3OEEA 3O8OA 3A6JA 2P35A 4GIBA 4JELA 1SUAA 3ENKA 4JNCA 4M9ZA 4BNXA 4DWVA 5BUQA 4PLPA 4QWMA 4YCUA 4PAMA 2BH2A 1DJLA 3KAQA 1F9EA 4DILA 4E94A 5EPUA 4RADA 3ETDA 1E94E 1JSXA 4HI0E 3SP1A 4C6RA 1V71A 2VLIA 4IMIB 2E37A 3B13B 4L9AA 1KDVA 5CXQA 4Q3DA 4G4GA 4UOZA 1FVFA 2FOLA 4V1CB 3JQAD 1U9IC 3C5EA 3FX2A 3I32A 3E35A 1E1RD 2IXAA 5KB3A 2CVFA 4Q66C 4C22A 1JWAB 3SIRA 4ZHSA 3B1KA 4QGBA 1RWWA 1W94A 3KX2A 3LYUA 3W7AA 3PKIA 4FHEA 2PJRA 1K2VN 3GAMA 3LBAA 2Q7DA 4MVJI 2PGXA 4EWLA 2Z9CA 2ZSJA 3KQQA 4XU3A 4DDMA 3ROZA 4YCMA 5JNRA 4NK4A 1RYEA 3P4YA 1J56A 1FUUA 2FNAA 4DY6A 9ATCA 2LP4Y 1WNTA 4C2BA 1S5PA 2YV1A 3I9JA 4K5QA 1X0XA 2AJLI 5CDUA 1NNUA 1SHTX 2WILA 2Q9BA 5JMOA 4F8YA 2JF0A 4EIWA 4QRHA 2NQ8A 2Q3LA 1PR4A 2XVAA 4NCIA 4UMFA 4R1UA 2UVPA 2Q0XA 3MEYA 4WDRA 3L18A 2C5LA 1GADO 3A0RB 3OO1A 4BB9A 5IVPA 4I9NA 2ILVA 1OCEA 3O31A 4D56A 2ZYUX 3I5MA 3P5SA 4XTZA 2GFHA 1NQVA 4LCEA 2PWAA 1F2UB 1ATIA 1YF3A 2P9EA 4HLDA 4EA8A 3GMSA 4IV8A 2FGKA 1BJTA 4WQMA 3NIGB 1R8XA 4CLHA 1NE2A 1EZ1A 1I7SB 4C7VA 2QX6A 4IIGA 4NENB 2H92A 3ASZA 3EDCA 3U81A 4C5CA 1VOTA 5DZSA 4WKNA 2R5FA 5IXYA 3DEIA 1UKVY 3L7KA 4DIKA 2WWGA 1DKOA 5K0TA 3GBSA 5CNIA 5JYDA 5KWVA 1Z8HA 4BVFA 1GFWA 3BN3A 3C5CA 3K1ZA 4M88A 1FUYB 3MF1A 2WD9A 3FHTA 3SZ3A 4DAEA 1CIVA 3MYYA 4LSGA 1H3FA 2WWRA 1NKTA 4JLJA 1KYZA 1FFXA 1QHEA 1U0GA 2OSBA 3S70A 1L5KA 2OBFA 3T94A 2O05A 3R0VA 2C3UA 5HRUA 1D8TA 4WZZA 1KXZA 2C9CA 2HREA 4MUNA 4MWTA 4YUZA 2JGEA 1R0YA 3DZBA 1YL6A 4GZ3A 4BV3A 5BURA 2IPLA 2W00A 3HUTA 5JAZA 2CJBA 3JVDA 4BLOA 4ESEA 1RKBA 1W85B 1F8YA 2W2LD 3FHJA 3PC3A 2J7PA 1YKFA 2SKEA 1PSDA 1U9CA 3G8DA 4HFMA 1IN7A 4LHVA 5IBPA 3VNQA 2PE5A 3QY9A 3GARA 5K51A 1O77A 1FXUA 2ODRC 5H59A 1WXGA 2OXTA 1HQKA 4BMPB 2HMTA 3KQPA 3GJ3A 4H7KA 3LUHA 3VVMA 4DADA 2WQ7A 1RLJA 1F2TA 2PYIA 2ECPA 3REQA 3AQ4A 1BU5A 4FFOA 2H1RA 5CH3A 1SO8A 4FNAA 3WO0A 5KTRA 4EKDA 3RIEA 5FYDA 4C4PA 2GPTA 2UXDB 3B3QA 3UJBA 2DEUA 3KT6A 2VP3A 3I2YX 2A5GA 3R5TA 5AH0A 1ENPA 5EIBD 4DLRA 1ZZGA 4R68A 2HJHA 5ERYA 3SHTA 2C2GA 5IBQA 3UGKA 2ZIEA 1DL5A 1VYVA 1MF7A 3IMGA 5CLQA 4RKYA 1EFVA 1U6JA 3O7MA 3WNVA 3AL0C 2B7BA 4X24A 4KR9A 1WUKS 1G5PA 4A5OA 4ACBA 4PO8A 3B78A 4R31A 3NIWA 4NXMB 3W5BA 3WGTA 4RMFA 1NMEA 2W83A 2BKLA 4MPJA 3Q3GE 2DQZA 1ISIA 1MCZA 2Q4DA 4OK5A 4TZTA 5B4TA 3L6DA 2PZKA 1GZ3A 5ELXA 3LV8A 3HNOA 4DHWA 2D2XA 5J2TA 5K09A 1UBTS 3C5VA 2Z30A 3P5BA 4E4YA 3WP0A 4AF7A 2XKJE 4QPNA 3T3HA 3U17A 4C2TA 2F48A 3RTEA 4XEOA 3FMGA 4KQMA 4TN5A 4P4SA 4NEHB 4ZOEA 1PV2A 4YP6A 3Q7EA 2JFXA 1ODFA 4OAPA 3Q10A 3FOZA 5FTWA 4L08A 2JHAA 5SY9A 1J33A 4C7KA 3WC4A 2AF4C 4H2WA 2QK4A 4OSEA 4WNCA 4CR8A 2JGAA 2OENG 2F3QA 2P7IA 3F78A 3DXYA 4W7SA 1DBSA 5DSTA 3NOQA 3FIJA 5LCXA 3NJ8A 3RARA 1WVMA 3C3YA 1I2DA 1R16A 1ZCZA 4DM3A 1Q3TA 4LRSB 1QHHA 5FIUA 2GXAA 3FAKA 2NUBA 3F71A 1U1IA 4YRSA 5EN4A 5F73A 3UUWA 4FGZA 4DQLA 1QTQA 1JIVA 2V54A 3VNRA 2PVCA 3VO9A 5L3SA 4C6TA 1ZVJA 1WVGA 2IV2X 2JATA 4TUYA 4PVCA 5FOUA 3RUFA 5SYNA 2V74B 4F12A 3FDFA 3JWPA 3RD5A 1HF3A 2IRWA 3IG2A 1FVXA 1NDQA 2OB2A 4KWCA 1WXWA 2RKWA 4GOLD 4RZXA 5CIYA 1F6WA 4YP0A 1P75A 1YFZA 2F55A 1G6HA 4RORA 4E46A 3VBCA 5ALVA 5MN6A 2EG9A 4PU0A 1CUDA 3E3MA 5HFAA 5IDVA 3SXUB 2ZRIA 3NDIA 2OD9A 3ULKA 1E9DA 4D4KA 2GBCA 4DYDA 3JVIA 2Z8YA 2Z2JA 1RLTA 2Z83A 4UM9B 4NJMB 3SZMA 2FN8A 2CEAA 3NIFB 3UCXA 4BQNA 3HJBA 1X9HA 4L5BA 1YBMA 2VSXA 4J2TA 3CEJA 1D2MA 3OEED 1XD8A 1S7CA 1A9XB 1U1FA 4XVQA 1YZNA 3TL2A 3EVNA 3O9ZA 3PWZA 4S24A 4XFKA 5ALOA 1T9DA 5EJAA 5FEMA 1FL9A 5B2FA 4IGKA 2CHUA 1F20A 4ALLA 2P9FA 1CDEA 4FHCA 4AFNA 2HGSA 2AUTA 4BWAA 4E4TA 4LG1A 4X7RA 1CR2A 3E8MA 1XZNA 1ZH4A 2GD0A 2CHFA 2PD3A 5IKOA 4EVRA 1MTOA 5CU7A 3ZTWA 2MT9A 3VNSA 2ONCA 1O97C 3A3OA 5LPNA 3T0IA 2D1YA 4GZ6A 4LRYA 2GK6A 4RE6A 4UD6A 5G4KA 3KYCA 3PGJA 2BUBA 3K8QA 1A5ZA 3C45A 3COJA 3GJQA 1MORA 1UPAA 2OHJA 2RAFA 3QWHA 4Q3NA 2PRJA 5DP1A 5TRTA 1NVVR 2R8PA 4OXKA 4BNFA 2HA3A 1MB2A 3Q0IA 3I09A 2GEVA 2Q6IA 1JKJB 4MVWA 4QO7A 5CM8B 3RRBA 3KZKA 4WVFA 1T2AA 1GGFA 2IHZA 2IUTA 5EJIA 4R81A 4EYSA 1ZNXA 1X80B 3NR2A 3E7PA 3R5KA 2QE7D 4BRWA 4OQFA 3DS8A 3MCWA 5IVDA 3V33A 3VX3A 3NHWA 5A5GA 2HU5A 3GLQA 5DCWA 3ZWPA 1DWPA 2GN2A 1LLCA 3SZRA 1VHDA 2Q2OA 2C5BA 1CU1A 1RXWA 2HA7A 1GZDA 1SHJA 4Q7KA 3DE3X 3RS5A 5CB4A 1WE2A 2PX2A 1JFTA 3AX6A 3LO5A 1NXXA 1I13A 3V7YA 3FBTA 1Z36A 2FX5A 2H8GA 4L7QA 4U8HA 3WYDA 1UZLA 1W6RA 4ZCIA 5CX4A 4KBFA 4LGVA 4CLEA 1WZUA 3R8CA 4EA7A 4QQ8A 2H9IA 1O57A 3AHCA 3DEFA 4C0SA 5F52A 1S1MA 4QXOA 5KQSA 2G1KA 3HVKA 5JAMA 5HCNA 1J00A 1TZBA 2YS7A 3BWCA 3QVGB 3AVUA 2O8DB 2HJ9A 2J4DA 4CEJB 3WYGA 4O4LA 3GFSA 3E58A 4TS1A 1C0LA 2O3QA 2G9QA 4LOIA 1I4EB 2IELA 1RU3A 4ZFNA 2QG6A 4EY8A 2XIQA 1UPTA 1NBAA 2CJ9A 2XWSA 2BFCA 3C7CB 4YQFA 5B3LA 1C8KA 5BN1A 3PHGA 4TWRA 3QPCA 2B36A 1D6NA 1K6MA 1UFOA 2GKGA 2OGWA 1SVLA 3PZRA 1L5GB 3ZWDA 1FK8A 1C14A 1E5VA 4GMXA 1APBA 1G8SA 4HXYA 1C3VA 4MVYA 1T1EA 1UKAA 4TMTA 5ALZA 2J85A 5DGHA 5DNVA 1EK6A 3HJRA 5IZCC 3A37A 5L3QB 1QZ3A 1SVWA 2GM3A 3BFKA 1U2QA 3S8EA 3D3JA 4MQLA 4P2GA 1WMDA 1I4WA 1QZUA 5ELMA 2O48X 4PX5A 4I4CA 4EABA 1W76A 2J3HA 3OPVA 3PGA1 1O2DA 1YV9A 2RAPA 4R84A 3QQ5A 1O5OA 2XOXA 2JIMA 2R96A 3RFFA 2ZBPA 1XYYA 1YWGO 1OKKD 3D7RA 4JUFA 4KUHA 5KDOA 3DAGA 1EAYA 3A2MA 4JR1A 4O1IA 4X93A 3V1TC 1CF4A 3EB9A 4I5IA 2NVWA 2GEBA 1PG5A 2RHJA 1BHSA 1XZDA 5E8RA 1YB4A 1RRGA 2JFWA 4LYYA 4NV1A 1SVNA 5K0ZA 2GBPA 3SIXA 3OM9A 4NG4A 4F72A 6Q21A 4C7JA 5EHZA 5EZYA 2IW1A 4A36A 3RIYA 2XNKA 3BF7A 5LZ7A 1WQ4A 3GCGA 1PYSB 3HDQA 3EY4A 5I5GA 3RIHA 3SMQA 5A3RA 4RCYA 3QTLA 2QTNA 4LVNA 1WLYA 1XN1A 1BWQA 5EVJA 4R1TA 1V11B 3C3WA 1K5GA 1ONOA 3TQSA 4BU1A 4C0AC 1K4KA 1OBOA 3PGMA 4PCVA 4G0UA 3ZHOA 3K0HA 2VDWA 3TK1A 2RMKA 5IKPA 4F9EA 1YR7A 3ABRB 3AR3A 5LYJB 1GN8A 1TU0A 2CHGA 2HLDD 3PQCA 3AZOA 3A11A 1GG5A 4MIKA 2DHEA 4G9EA 4MI3A 2ZTGA 1HE8B 2HBRA 3W34A 3ZZNA 1E24A 3S1AA 3HO8A 1HE4A 3H2KA 4PRYA 3DV9A 3UWMA 2O8EB 2HNIA 4H2XB 3HKBB 3KT8A 3C3DA 1JQJC 1SBZA 3W5IA 2QW0X 1XPRA 3URKA 3ISJA 1OGYA 2AK3A 3T5TA 2R6FA 1MGOA 2AFHE 1E5DA 2YDYA 1I6MA 4HTFB 1GDHA 2F2TA 4P93A 4XW2A 5F1PA 3OOWA 2NXCA 2Y1KA 3O84A 4DJJA 3HHPA 3O6VA 4Q9AA 4XVHA 5JARA 2D54A 4FEEA 5F78A 3M6MD 2EU8A 5REQA 4DQVA 2X42A 3A2LA 4EG5A 4ENPA 2HY7A 3AHDA 4YFVA 4LNUA 2FHPA 4X8MA 5AM1A 4NAHA 4Q12A 4Q4JA 1YDEA 2KLHA 2ZBFA 3GGPA 2O3SA 4RENA 2BI4A 5AKJA 1UWLA 1X3LA 2ZUWA 3PXCX 3TOCA 2VCHA 2V7PA 3EGEA 1SHUX 4CKEA 2DXTA 4XYLA 2AKWA 1SEVA 3QZUA 4LGYA 1KJQA 3ND5A 4LBYA 5FA8A 1CB7A 1IH8A 1R4ZA 3IE1A 2RGDA 4FZ5A 4A8HA 3VNUA 5B36A 3P2YA 4WY8A 4UVGA 2FMUA 1UANA 4I46A 2NU6B 1EE9A 1U3TA 2ESRA 5JSHA 5KYNA 4ZOBA 4RIEA 2HNAA 5B4VA 1QAQA 1MABA 5HGQA 3AK4A 5BXYA 1WCYA 4FCVA 4BQFA 2YKGA 1ZMRA 3OCXA 2VNSA 2C5HA 3IPCA 1AZSC 2VQSA 3TIIA 3NMUF 3LKDA 2R8OA 5IDWA 3O2QB 2QYSA 4CCWA 2H57A 3L0ZA 3LM8A 4HB3A 2G0AA 3Q5DA 2HRBA 4JHLA 4LXQA 1SKYE 5HRCA 2ODBA 2YVQA 1EX1A 3ONFA 1R0WA 3PENA 3EH2A 5IPFA 1VCMA 5LQUA 2GVZC 4FZRA 4FDLA 4ROTA 1LUAA 2H4HA 4QE3A 3E2IA 1ZIXA 1RXEA 1BKYA 1F5SA 4P83A 1BQ4A 2NV0A 2XYQA 1GSIA 1RHQA 4TKUA 2GPAA 3AHHA 4EHHA 5BSHA 1SOUA 4PRKA 2H31A 4LCBA 2ARSA 3Q9LA 5JASA 3QPBA 4TKZA 3M1YA 5EUQB 3ERRA 2ST1A 4N54A 1V8PA 3ZGYA 1AX9A 2Z43A 1LSJA 5J2UA 1DQZA 1Z0SA 3FYSA 1ZITA 2JI7A 3QUSA 3RJMA 2PBFA 3LLUA 3NELA 5FLYA 1RLIA 3W4KA 2MSWA 4DYHA 5KTMA 1A5TA 3HBLA 1FB5A 1FFCA 1AN0A 1U63A 1XAJA 1XK7A 2RGCA 1NATA 3W5HA 1LK0A 5EJ9A 4QXPA 2WSBA 2QV7A 4ON9A 5FO1A 2ZJ2A 5H82A 5B1DA 2WUVA 3R77A 3U4QA 1JHMA 2WJWA 3E4CA 5AW0A 1KAHA 5DHSA 1WRBA 4U0KA 3VU0A 2O8CA 3WOHA 3IPAA 3I2GA 2VT7A 4YJ2B 3NNDA 1NNSA 1XQ6A 3KB2A 1A2BA 5BQOA 3RF7A 3RUHA 3QEJA 4Q00A 4QPCA 1XKLA 4KODA 4HGZA 4JB8A 2X6QA 4OMUA 2JLZA 1D1PA 4RZ2A 4B44A 3E84A 4L2IB 2XMZA 4KQHA 5D1HA 2WTEA 4AAYA 1X1SA 1XSEA 4QYXA 4KWTA 3A4YA 2FXIA 1XRPA 1RI3A 3O8BA 4B7UA 4RESA 4BMVA 1RM0A 2B8EA 5FDFA 1ZINA 5AKIA 2XNCA 2I8LA 4M7PA 2A0FA 3EMVA 3BJMA 4GC5A 2C97A 1AUXA 4G01B 1ZGJA 3STTA 5M5BA 5FI3A 4GOXA 3JYQA 3PF9A 4QYSA 3ZZ1A 2ZGWA 3SFVA 1ZIPA 4LJAA 3Q8KA 4AN4A 5FPKA 2J0QA 1WPXA 5G41A 3RV3A 4AY4A 3TRHA 2XE6A 2BFNA 2QNRA 1J6UA 4C30A 1ZHOA 3GJSA 1M2VB 1ZGBA 3GLVA 4LVKA 2VS1A 3T7CA 3PX3A 3OX3A 3VU8A 4DCUA 1HL7A 1PK9A 1TVEA 1OH6A 5E1OA 1FP6A 4ETNA 1KI3A 1T43A 1H9AA 1P1FA 3WK6A 2YWRA 3JQGB 1I36A 3U7GA 4ER3A 2HMYB 2Y66A 1R5NA 1T10A 1EVEA 3CA8A 4MDYA 5DYYA 3VR0A 2D7DA 2W22A 4XEUA 2Y0PA 3IIJA 2OYSA 1SUFA 3WSWA 4AMUA 3RAEC 4G5GA 1FDUA 2Q62A 3VMFA 1N3IA 2Z98A 5DBGA 4EAQA 2FW8A 2H4YA 2EAUA 2HF7A 4HYYA 3WBFA 1BE0A 4KX5A 3HI4A 4LZOA 3RWBA 3DP9A 5A4KA 2Y0EA 2R8ZA 4EFLA 4F7DA 1E2KA 1Z0JA 3DTVB 2FGJA 3L6UA 2O57A 4GYWA 1QIGA 3WWDA 4MUEA 4RS3A 1VP9A 3IPYA 5M3BA 5H9WA 3BHMA 1WWKA 3AT1A 3GDHA 2B7CA 5AMXA 3T4UA 5IARA 2EJBA 4EO7A 3M3HA 3QV2A 4X66B 4KDEA 5FJIA 2GJ9A 3CEHA 5DM2A 3R41A 5C3MA 1QYXA 1RYHA 2Z5FA 3ZE9A 3M49A 5KPJA 4MEAA 5JQGB 3H2JA 5P8WA 3VQVA 2V7QD 5FBWB 3UK1A 1PKXA 5L4SA 4RKQA 2EFHB 5A3SA 3T5MA 5I45A 2CJPA 2FJPA 2BFFA 4FMCB 4IDNA 4MUHA 1BIFA 1SKQA 3RH0A 1QB8A 3PEWA 2X0NA 1CBUA 4XSGA 3T3MB 1B6TA 4DDUA 1JFFA 1WR8A 4F71A 5IJWA 5K6TA 1YB5A 2G5TA 3G2OA 1XDWA 1E9BA 3BB1A 3FCXA 2AFRA 1QJ4A 3HB0A 4Z86A 2XWBF 2C83A 3I9OA 1QCCA 2PO5A 2MTBA 3KJGA 4U7GA 5BYJA 4BNWA 4O2AA 2PBLA 4S0ZA 1ISFA 5HCIA 2CWWA 1T4DA 1H3EA 4WGGA 2W2KB 1E3WA 1EG2A 1NFRA 2GEDA 1DAMA 3D4NA 3Q11A 5F2KA 3ZCTA 5CG2A 3A4VA 1UL1X 2PEYA 1PJAA 3BRQA 4UEKA 1QPBA 1A8SA 2D0IA 3PRKE 5IN4A 4NFHA 3KQHA 2GN4A 4WECA 1PCXA 3HXOA 1A3CA 2GARA 4X91A 4CH3A 1DEKA 1SELA 2JJMA 3O0DA 3C85A 2ZYDA 1ZNYA 1JVNA 2ZWIA 1ZQ1A 4X94A 1JG2A 3DV2A 2FWIA 3EVAA 1X80A 1KIFA 3QLTA 1R1DA 4YRQA 4UHHA 4XIIA 4LQLA 4GPZA 1NDHA 4ZWNA 3DKIA 4E1BA 5KYWB 2CUKA 4AM8A 4DG8A 4GI5A 4L2IA 3Q8LA 4TV9F 4WZAA 5H80A 2WZQA 2I9KA 1VP3A 3M4PA 2ZBQA 1LB1B 3TOZA 3X1XA 2IV7A 2N0SA 1KJNA 3Q88A 5ISMA 1BDJA 1JDNA 1XDDA 3E5RA 5IJZA 4V0SA 4E2YA 2GBGA 4IKEA 1U0HC 1FSPA 3OUTA 3AYZB 3I0MA 2YY5A 3IQWA 2F3PA 3LUDA 4UHFA 3ZHUA 5CA0A 4MH0R 1WUJS 3R5JA 3GGJA 5DW0A 2JZCA 3G2HA 2B35A 3QJYA 4AY5A 4E21A 3I6ZA 3DHVA 2WF8A 5EJ6A 1KTIA 3KJQA 1MO4A 5I7RA 4OM8A 3LLCA 4EEZA 5FFNA 4KLRA 1OT3A 3LT5A 1E5TA 1G6OA 2R6DA 3MUNA 3THRA 4DLTA 4WEQA 1A27A 1FMFA 2XA9A 3ZWQA 3TYXA 4D2IA 1CY4A 2WP0A 5CHEA 5HZGA 4JASB 3TPFA 5LQJA 1RE0A 1G3UA 1X8KA 2GNPA 5LKAA 1ONBA 2GYWA 1JS1X 3DTYA 3OPYA 4N3NA 1F3LA 5I6DA 2ZYRA 1JJ7A 2PKQP 2VTEA 4ANFA 4CKCA 1ODCA 1P44A 1CVRA 3UOGA 3P9KA 1HDIA 3LCVB 4GECA 4Y67A 3U4CA 3VGPA 10MHA 5AVTA 1RM5A 4O4IF 2NN3C 5BWMA 1IHPA 4FGKA 3OIWA 3KOYA 2J3MA 2NO4A 1UQUA 4FVTA 5HTKA 1NNHA 2ZR9A 1HV8A 3EOBI 1U0TA 4DLUA 2F1HA 2XGJA 3I6QA 3FTQA 4G4SO 5DI3A 5K0CA 1E6UA 2JNWA 3ER9A 1OROA 5BSVA 4P32A 2Q27A 4TWIA 3UY4A 5JD4A 3CZAA 3L49A 5A0VA 2O2DA 4GSLA 4LVOA 1NBME 1XUOA 2EX1A 2F3UA 1ID8A 4E11A 1M75A 3BFJA 3BCSA 2ZZNA 5JJCA 1DXYA 3NWEA 5AO9A 5TVKA 3CLVA 3SSOA 4CUJA 1E7WA 3LUFA 3CZPA 2NZVG 3ND7A 4EMTA 3ONDA 4CMBA 4J16A 4PS0A 4A73A 2XR1A 1Z73A 2ACEA 1V43A 3DR5A 3KJIA 3VYVA 4A9AA 1Y6JA 2P2SA 3OCZA 4FMCF 4UE2A 1EIYB 4DC0A 4HDCA 2DWPA 2P0EA 2YDXA 1KI1A 3ZLJA 2VQEB 2NYVA 3Q2OA 4EUKA 3I5YA 2JGNA 3E0XA 1V3VA 1K7FB 3SC2A 1Y8QB 4YV2A 3EF3A 2GD2A 3JQAB 4FFRA 4PAOA 5DYWA 3GIDA 3RROA 3PPXA 3TL3A 1W9HA 1Y3CE 2WC1A 4HWRA 2H4ZA 3RK4A 3WGVA 1HNNA 3L4BA 4GM1A 5AJTA 3R3WA 1NUHA 4MYTA 4FONA 2RGEA 4EDHA 4P74C 1BE1A 3BE6A 4OIFA 1C4KA 4UUQA 1NR1A 2W7TA 2ZRFA 5LJIA 3KOXA 1UZMA 1EWTA 3I01A 4GICA 3RRMA 5C8YF 3W7BA 3RACA 1E6MA 1K7EB 1ZSVA 1G7CA 4U2KA 3QJGA 2C5GA 1ZJZA 3BYZA 1I6WA 3AWDA 1ITZA 2FPPB 3W77A 3RKSA 3UAGA 3V2UA 2WJ4A 2EJ9A 3EWIA 4P7JA 3ZX4A 2EP5A 1DRWA 2E64A 1JLMA 2VJOA 3MBIA 3ZWYA 3GMIA 4F6LA 3IBTA 3VKVA 4Z4QA 1A1VA 3QBTA 1TDJA 3PXXA 4AW9A 3MYRA 5CHYA 2XGOA 1GAJA 3PCRB 3T52A 5JU6A 3F73A 2OCYC 5EXSA 1E1YA 4YMWA 3SCZA 3U3ZA 5SV2A 4QELA 3LDAA 3WQQA 4N0EA 1YI8A 2ADFA 5T6BA 2OXIA 1TAQA 3QF7A 4JSYA 4OXYA 2PKXA 3G1TA 3RYHA 4DIMA 4TVSA 1Z4IA 2VCYA 4WI1A 1OLXA 1EBUA 4F84A 2O14A 4F3KA 3RVSA 5H70A 3FOBA 1AGRA 4C0KA 5CX1A 4ZT4A 5ALHA 1EFAA 4CM8B 3KOUA 4ATNA 2AOUB 5HW0A 3HWX1 4US1R 4W5TA 1JI0A 4YHHB 5T4HA 2PUHA 1JR3E 1XG5A 1B73A 2J41A 3EUFA 3LCUA 2HK8A 4N5HX 4CG0A 2C7RA 3TMAA 2GCPA 4RE5A 3OMWA 3SDBA 4CIAA 3BJEA 3KEMA 2PUJA 4J1NA 4NBTA 3HFVA 4TM8A 1TLLA 1CE8A 4N5NA 4BQPA 2FMIA 3A9CA 1U0BB 1Z0IA 1JHUA 3A1DA 3PICA 4JLPA 4WDQA 1NWHA 4EJFA 2CXQA 2ZSHA 1Z83A 4GRDA 4EBFA 2CFOA 1S2IA 4MTLA 5IFKA 3B1FA 1FXWF 5K3CA 3B52X 4HV4A 4WOBA 1CRZA 3RIMA 3HU3A 1Y1TA 3EASA 1JDSA 3EPPA 1H9CA 8ADHA 4PG7A 2WIGA 3E5NA 5U1PA 1TC1A 4ZDIA 3MMNA 4JCOA 3HM2A 1GAWA 4H6XA 4IFTA 1PZEA 3DQQA 4ZCSA 1YTUA 2A7XA 2V59A 4ID9A 4HVCA 1D7AA 3I42A 1YACA 2NV6A 3CRQA 4GLBA 4EA6A 1EVJA 3KPVA 5L40A 4KEAA 2O8VA 3R2JA 3RC8A 1J5PA 2GUWA 3FVWA 2BM9A 3PNVA 3D7KA 5IW8A 1K88A 3HJNA 2QRHA 3WBBA 4CL0A 2W11A 1JSZA 2VZ8A 3JQQA 5EEGA 3AH8A 3EY9A 4S3MA 4EO4A 1YXMA 2P4EA 3G3EA 4WBNB 1N9ZA 1OWNA 4C7OB 1PG2A 1Z63A 3AERB 4PRZA 1RVV1 3NBMA 3WWOA 4X63A 1EU1A 1QF6A 2O07A 4TM7A 1Q7CA 3G5UA 5ED4A 1VE1A 1MQ9A 2PGOA 2XX3A 5BYKA 2BEVA 3RT7A 4B3SB 5AK4A 2J09A 1W7AA 1F06A 2XB6A 4TQGA 5KSPA 1ECJA 4DMUB 2O4CA 1TI7A 1BDIA 4W7HA 1A9RA 2HQOA 3VU9A 2BCJQ 4RGVA 1Z62A 4G0ZA 4TSRA 4BVJA 3WSVA 1C2TA 1KVRA 2AF3C 2ONYA 4E6EA 1T4BA 2BFBA 1G291 4KPFC 2C31A 3DE4X 3DWEX 4IH4A 1K4YA 1T6XA 4JB2A 5DGIA 4QKQA 3N3AC 2K87A 1JILA 4UXJA 3L05A 3PBKA 2DRIA 4UU8A 1T34A 3AUJB 3TQHA 4WLFA 3ND8A 3GGGA 4G8DA 4QPPA 1E77A 1RJWA 2ATEA 2WMOB 4OJTA 5TIIA 5K1PA 2V6IA 3LWBA 5TQ0B 3RB8A 3PA8A 1MH1A 1T3SA 4LOJA 3JX9A 1HY3A 4CDNA 1TYEB 4DA4A 3SHOA 1X01A 1V1RB 4BNIA 1GGEA 4C9BA 2ACWA 2NU8B 5CNKA 2JGKA 1MRSA 4WV3A 2VYVD 4UPAA 4FHGA 1C9EA 5HIMA 2I6GA 1T3GA 3A6HA 1Q50A 3REOA 1NJFA 4EHAA 3FDXA 4B6PA 2JFOA 5BSFA 2NGRA 1M10A 4AI6A 5LDDC 3KPJA 1ZC4A 2GZDA 1YJCA 5JCZA 4YJ3A 2GR9A 2XYVA 1Y3FE 2QMUA 1TGYA 4G56A 3R1IA 4EGSA 2Q99A 4U7TB 1SZDA 2CFCA 1CUZA 4OKIA 4PF1A 1UBEA 1UMDB 1EP1B 4IJKA 4MWOA 4A8JC 1XNQB 3DCYA 4DLZA 2Q45A 4QXQA 3WKBA 1FRFS 4KXUA 2I7TA 5BN5A 1FUEA 1X8JA 5IKEA 4CF7A 1QF9A 1PHPA 2FEXA 2YWBA 3S7TA 4BNNA 4LISA 1PNRA 3R07A 4IVNA 2XWJI 5J3JA 3P9YA 2CJAA 3VR3A 3OH8A 4IIXA 2XA1A 5BPFA 4JGGA 3HL0A 4LJ5A 2OHIA 3L0CA 2OZLA 4ESVA 1YR6A 2X22A 3GRYA 5AOVA 2WSLA 2RHOA 3R7DA 1CZRA 3RBZA 5EHXA 4AO6A 1T26A 3FFTA 4ZHQA 1JU9A 5K0FA 2IYXA 2N47A 4UJ5A 4FIZA 4UHJA 3N7TA 4Q3KA 4OB6A 4ZV9A 3CNQS 4TL9A 5NLLA 1BFUA 5AW8A 4HEJA 3CLSC 2L19A 5BV2P 5MN4A 2D8AA 3FSGD 3HKDB 2PSDA 4KXWA 4LWOA 5B37A 1TPYA 3PE4A 4W5JA 1FP4B 4G5FA 2QJWA 3E9ZA 3DL7A 1GPAA 4JENA 3ZY6A 4BFSA 2YYSA 1KK3A 5JC8A 3WFIA 1RM3A 3FGNA 3VQYA 5JNUA 2QN7A 1TC2A 4AKTA 3E0QA 4HWPA 1WXIA 1V16A 2V3WA 1RZ3A 3GH3A 4GFDA 4W6QA 2MCFA 4TYWA 1RKVA 4WADA 4WFIA 4YACA 2Q4EA 3W2FA 1CY7A 3HS3A 4CWAA 4J29A 4I50A 4K3VA 4WZAE 1KEZA 2R79A 4I19A 5CGZA 2DZDA 1DQSA 3U3KA 5K7SA 1O95C 3OZTA 3DAHA 1M1ZA 5AJVB 2DU5A 1TO1E 3T06B 1SULA 3KKZA 3KZCA 4NZOA 4ZZ1A 2G77B 4KRFA 5JWOA 2AUMA 3SS9X 4PTYA 3TEHB 4QG7A 4MS1A 2OVFA 3MIIA 4U3JB 5G4LA 4XCQA 3UHAA 1BD4A 2EZUA 2X9LA 3H5AA 3I23A 1LTKA 4HWGA 3UKDA 5C7LO 4ER6A 1MENA 1Y81A 4GZLA 2MOKA 4COOA 3T1QA 3K73O 2YN4A 5U4QA 1YDWA 4XVCA 2R6ZA 2J5BA 1OA1A 4FSXA 4TTJA 3SVTA 1F48A 2ZM6B 2ZIXB 5FWXA 5BSEA 4B3GA 1P0CA 2XJ9A 3DBLA 1Q44A 4RFVA 1U5AA 4IO1A 4NAVA 5B2EA 1HOXA 2ZI4A 5F23A 4N03A 1E2UA 4A6EA 3FPFA 5IYZA 3UIEA 2DE0X 2QD2A 3D8UA 2L0XA 4FW8A 4KPGA 3DLTA 2VYQA 1DWOA 3TTSA 5TXGA 4ZYZA 1GVNB 3REXA 4KSCA 3RS0A 3DF9A 4Y7DA 4LVMA 3KQTA 4PYQA 4UDOA 5CEFA 1U2GC 1QCYA 1OTYA 2ZULA 4F2GA 5CEEA 4Q3BA 5DTRA 3O7WA 1B74A 4EYOA 1FYFA 1NHGA 2C2ZA 3C8UA 3UT5A 4F86A 2WBLC 2CNKA 3ID6C 5FQNA 4BNGA 2HAEA 3C15C 3QWBA 2ZB8A 4ZP1A 4KQGA 5DTIA 5FBZA 4DABA 2G25A 3UGQA 5J43A 2YV3A 3UG6A 4LRQA 2AB0A 5DXJA 3G0CA 4KVAA 1PDWA 3L8EA 3KUUA 2QN2A 1L8XA 3GJ5A 2WTNA 2VLBA 1VHWA 1XGKA 2ATCA 2PPLA 4G8CA 4RGYA 3U16A 4JI1B 3WK5A 2R66A 1RXYA 3GA7A 3ZWBA 1WABA 3TSCA 4XPIA 3C3AA 4O33A 5D1NA 2FE1A 2DQSA 4NSNA 2WNSA 4JVSB 2ORWA 3UJ6A 1K8ZB 1ZIOA 1OZAA 2VN8A 2YHUA 5EI5A 3WNZA 4DA7A 3SIWA 1KSHA 1H94A 2XZTA 4HDNB 1IWPB 1HGXA 4YQEA 3GJTA 2FRVA 3OM0A 1C7RA 2QB5A 3KXPA 3OKPA 3Q72A 4RA6A 2J9GA 3C43A 2GK7A 2YWXA 3AB3A 4GE3A 4H3SA 1WUYA 2XSZD 4CS2A 3FOCA 2AMCA 2XBUA 4OGGA 2NTEA 4TVAA 2YC4C 4RD1A 4RZ3A 3L7DA 1HK7A 4EF6A 3JARA 2HI0A 1EE1A 2YIMA 3P4XA 3Q3IA 1YRQA 1OY1A 3SE0A 3HY0A 3IPLA 4RHUA 4EMBA 3X1KA 1U81A 3GJXC 3U6KA 1ZH0A 1JEEA 3RKYA 2XGTA 5C8XA 3QW2A 4ZMBA 4Z2AA 3BILA 4NJMA 1JG4A 2P9YA 4M3NA 3VX4A 2PFKA 1PNOA 3AP1A 3ORYA 2I6XA 5BOVA 4B2PA 1BHJA 2C9ZA 1EH5A 1JHAA 4PZEA 4ZCQA 4QTZA 1RM4A 1FU7A 3JSXA 1XXHA 1AK1A 3FTCA 3PE3A 1CR4A 2CLOB 2IUYA 2EFYA 3CIOA 1M1YE 1KZGB 4KOEC 4DB2A 4ZVTA 5F12A 1EBBA 4X3PA 1TMKA 5J1SB 3C3EA 4QTUB 2GCGA 1E60A 2GJ8A 3A28A 3AUKA 3H9EO 1JALA 2HD4A 4MCJA 5F76A 4J7UA 3TO5A 5ELLA 1AXEA 3PUWA 1Z37A 1REQB 1MJFA 1C0EA 1P60A 2PX0A 3KOOA 1E2NA 1TIKA 4G0WA 1Y98A 3AZPA 3F1LA 2NO0A 4NCHA 1KYVA 3V7FA 4AYWA 3I9KA 3ODGA 1ZN7A 1GDDA 1LW6E 3R0IA 1XLVA 1SCNE 2FN9A 2TMDA 3LUCA 4MVCA 5HK8A 3O2NA 3WL7A 4F3YA 4PINA 3L8DA 1ASZA 5DNUA 4O3MA 4MVJM 1B8NA 4CIYA 2FOXA 4JC8A 4DRXB 2F43B 2EXXA 2RG7A 4LF5B 1V96A 1UPCA 2OB1A 4FFBA 2Q1WA 3MUOA 3GEIA 2DPMA 1C9JA 3OG9A 2Q6TA 3F3SA 1HURA 3GMDA 4IDGA 4JBLA 4GLOA 2H48A 4LE0A 2B2XA 1UP6A 3HSYA 2WYWA 3PITA 1Y82A 3GZNA 4J15A 4DSAA 2YICA 1U7ZA 2FKNA 4HLUA 4G84A 1O9HA 2AOWA 2GCOB 3UTCA 5L6MB 4DR3B 4M22A 1OBVA 1RZUA 3JZDA 3PRYA 3TIFA 3GVIA 4DEYA 2POCA 4PBSA 1XNGA 4J0FA 4M9QA 4TV9B 4YPOA 3UBMA 3E9QA 2N1BA 4UU0A 2XD4A 4G67A 1QORA 3F8SA 2FMFA 4ER0A 3CF2A 1PWZA 2X7JA 3DKKA 2NSHA 4RVDA 2X1MA 4H9GA 1EXWA 2C2HA 1EUCA 1UJ6A 2PRIA 4GT1A 4F1KA 3ZDDA 3C2QA 1DKLA 5JATA 1IVSA 1V1RA 1Z8NA 3O74A 3L40A 3IQDB 2G17A 4MI1A 2NU8A 2UUCB 4PAWA 3EIWA 1BWSA 2XUDA 3CWQA 1HUQA 3B7PA 1W5TA 4RPJA 3UPTA 1AMNA 1MZPA 1Z34A 3EC2A 4JJ6A 5I9LA 3WICA 2QSZA 5I9IA 4LF8B 2UXCB 1A50B 5C1OA 2IA5A 3NB0A 4I5EA 3DCJA 4TLLB 2ZUEA 3KG2A 5FOSA 2Y1EA 4ZT6A 3JD2A 3A04A 3T1VA 2R1VB 5ALDA 3GEEA 4EHKA 2V55B 1DNPA 2YVKA 3V7RA 1O94A 4GU5A 1ORDA 4K8OA 4O4IB 2FWJA 3UAWA 5G3YA 4CQMA 3JQPA 1PR3A 4YRRA 4RLHA 5AUNB 1ZXLA 1ZJJA 2DVMA 2RHLA 3JAKA 4FB4A 3K05A 4B6OA 1PNTA 2HHCA 1KMHB 1SB8A 1G2OA 4ARZB 4ESOA 3N5CA 4QJBA 2V65A 3EW9A 1X87A 5A7GA 3ZHBA 4TTVA 4D3ZA 4XVUA 4PXYA 5FUVA 4LOLA 3KT3A 4ND8A 1ADFA 1PZNA 2B0CA 2FOIA 4N40A 1K6EA 3VRHA 4A5SA 3CSDA 1GAQA 1V6SA 2N75A 1T2EA 1XXHB 2V0CA 3BWBA 1YCGA 1N0UA 4HFNA 3MCTA 2XRZA 1IBLB 3FZNA 3OFSA 4TZ6A 4EQZA 3BG5A 4WJLA 3EGVA 1TT5A 3RANA 2IYEA 2C59A 2EBHX 3F49S 2QQFA 4B35A 1TD9A 2P9TA 1IEVA 4LMPA 2X2PA 4QYIB 3TJZA 3JD1A 4F5ZA 2CL5A 4OKNA 5GOZA 3TJMA 2BLLA 1MBZA 1AUQA 4R2IA 2JLAA 1J25A 2YHIA 4ENSA 3EGXA 3DMPA 1SR8A 2ZRMA 4POAA 4DBZA 1QK3A 2VJLA 5CTAA 3I5AA 1J9GA 1R4NB 2FUG1 4UPEA 1L4BA 3FPEA 3SY8A 4B6SA 1G4AE 3JY6A 4IP0A 3ZNOA 1NW9B 4MWDA 4QUGA 2ZAOA 3OE7A 4Y0VA 1A96A 1Z47A 5CTJA 5D3MB 2JB9A 4GR4A 3DUFA 3KQYA 2DH6A 3N75A 4WXMA 4NFLA 1PEDA 2Z5LA 3DW3X 3WVNA 3LXRA 3ORHA 2AYXA 4H60A 4TV8B 4XLLA 1YQXA 4UNRA 2QVGA 2LUOA 3IMFA 5ELOA 2QVXX 3B48A 3IEKA 1NT4A 5JZ9A 4X6UA 3MT7A 1MTZA 1Y9JA 2FWMX 2ZRBA 3I9V1 1X1BA 3NZEA 3PT9A 4Q01A 3TD6A 1L4KA 1PFWA 1SU8A 3GELA 2RH8A 2X3UA 1G20E 1JEQB 2POQX 3X2FA 4JR2A 4Y2GA 4BTLA 1DIBA 5AHWA 4CEHA 3QUBA 2RJNA 1QP8A 1FQJA 4UFPA 1MOZA 5CRIA 4B8ZA 1NN1A 1LX6A 4NV3A 4UUNA 5LOVB 1DAOA 4EKGA 2DTXA 2DTDA 2Y9MB 4CG3A 2QVLA 1PGQA 1UFQA 1WDKA 1OTXA 4D4GA 5AIBA 3DNMA 2J7KA 2P9BA 1D2AA 3ITKA 3PIIA 1M2KA 4HAWA 1WCIA 4DV5B 1MNAA 1QU2A 4WCDA 1EZ4A 2NUAA 4ZVPA 1TYDE 4M6WB 4DIEA 1CZOA 3GFQA 4ILEA 11ASA 1ZIDA 3NKVA 4LE2A 4UU7A 2HIMA 3I9FA 3VJLA 4DMGA 1Z0ZA 3FMFA 5LZ5A 3VKWA 3GVCA 5H68A 5FUMA 1FP2A 4OUDA 1C0IA 1E2QA 1R0CA 1J07A 2LBPA 1CUWA 1SK8A 1B8OA 3AI7A 4QDKA 1NG1A 2YZGA 4DDTA 3PUIA 3KQUA 1XKQA 2RGAA 5CURA 4R7ZA 3E23A 3FDZB 3OU7A 5IBRA 4FILA 4U9HS 3GYBA 4X8OA 4JQCA 1NIJA 4DLXA 5AM0A 2YWFA 2FAXA 4A6XA 1IMJA 1E7MA 2IVZA 3R9XB 2C58A 4ZI5A 1XBTA 1PFGA 2XTZA 2XVXA 2G8NA 5CYOA 2V9PA 1XQYA 2IBTA 2B8WA 2KMLA 1IN4A 3ZZ0A 3ESDA 2IWRA 4DREA 3HWSA 4URHA 1IXKA 2FMXA 4TZKA 1A9SA 1L1QA 2XCLA 3CPJB 2CXNA 2EWVA 3H42B 3N2YA 1G41A 3GDFA 3E27A 3OLWA 3AESB 3NRJA 4Q9LA 1H0RA 1WBBA 2QT9A 2VRCA 2ZATA 4HEQA 4NENA 2R62A 4D3YA 2Q1XA 3BGIA 2H4XA 2DVEA 4LXGA 2EC5A 3S7ZA 1W8DA 5TT1A 1CQJB 2NTVA 5KC8A 3W2GA 4FE4A 4UQOA 3IO3A 5CCDA 1OC2A 1WDLA 3HFJA 1NUPA 4K26A 4BO0A 4TTIA 5EJ7A 4IQ8A 1XA0A 2ERCA 2ANCA 1I8TA 3NO4A 1KYYA 2K6GA 5JBQA 2BFCB 3N07A 4OP1A 2QP4A 1A2KC 1FDTA 2WFAA 4UM5A 1XFDA 2QPAA 3ABSB 1KIAA 2K2WA 3SI7A 2WNIA 1W87A 4LXTA 1Q7BA 3BBLA 4G37A 5HBGA 5JS2A 1ULHA 4C3UA 4G25A 1S2DA 1DUSA 4A0GA 3QTTA 2FZKA 4M1MA 5D00A 5E95A 4Z99A 2VWGA 2WUWE 1VQZA 4MV9A 3TSAA 3IKTA 5HOEA 2W4MA 5ADUS 1SKAA 2HXYA 1GEEA 1CB0A 2NO1A 3IDQA 2BZSA 4ZCPA 3ED5A 3RE1A 3WQRA 2BE7A 1N2XA 3X1JA 4GKAA 1A4RA 3CR7A 5CG1A 2DHRA 2QR2A 4GX5A 3BERA 5G0TA 1Z18A 3T1TA 3I72A 3UUGA 3WDLA 3QVWA 4LJLA 1JHYA 3K8OE 4D97A 2G1AA 2FUKA 3GFVA 4L3OA 4X84A 3DFKA 4KMOA 1VG8A 5D7NA 3C14C 1GL3A 2BELA 1DOZA 4MMXB 3JQBC 1X7YA 1H8HD 1N5OX 3LW7A 3O75A 4RAQA 1UR5A 4ZQEA 4KR7A 3ZK8A 3U1VA 3W8DA 4F2WA 1S0UA 1CP3A 1PNQA 2XMRA 1P5HA 1Z39A 4BQIA 5IABA 1LZLA 2Q7GA 1EMDA 4OG2A 1UXHA 2ERXA 3ADKA 1WZCA 2PLRA 3IVCA 1I1NA 5H3HA 3WRXA 4HVTA 4LMRA 4POOA 3OJWA 4DNFA 4R7TA 3GLGA 4CM5A 1YBAA 2I1QA 2ZRPA 4PQEA 1U02A 4MV8A 1U6IA 3FZEA 2I3DA 5H3LA 2W2PA 1D9XA 3GPCA 4FXPA 4NJOA 4QU5A 4J0EA 1ZH2A 3ED1A 4KDFA 4MB0A 4X92A 3RSQA 2BGGA 4RTMA 2HDOA 1DARA 4TLEA 1EFRA 2W2TA 3J81k 2CGHA 2QY9A 4LTDA 5KTPA 4DPMA 1PR6A 2EJFA 2ZJ6A 2XXJA 1JEOA 4YJKA 3W06A 4ZTZB 1R64A 1RCFA 1ZY2A 1DKQA 2WB2A 1YB3A 3KE9A 2XQGA 1ICEA 3TXYA 1X92A 1Z3IX 3F7MA 4D9CA 3QVGA 3OTOB 2HQSA 2JA2A 1JSCA 1OD6A 2IS6A 4HAYA 5AVOA 1JECA 2V7TA 2VZ0A 4W9NA 2W2VA 4LMAA 3OAAA 5JAQA 2AXNA 2OOKA 1SOWA 1T36B 4P8RA 4BKMA 4I7EA 2W98A 3BGOS 4CDMA 2QROA 5FBLB 1RWBA 1AG9A 1JYEA 1M1YA 2VJQA 5REQB 1F1JA 2DFTA 4B2IA 3CN7A 3FDIA 1Q1AA 2IKSA 5DX1A 1P1IA 4ZDJA 1XF9A 2BW0A 1ZUD1 1XHEA 2D74A 4BQSA 3NNNA 3NDBB 3K9BA 3KEFA 1MC4A 1OYYA 4RTJA 1BE8A 1S8FA 3A7DA 3G0IA 3G7NA 2Q1TA 4I9FA 2XLCA 1M0TA 4C06A 5H7XA 4HZIA 3JYOA 3OCWA 4IJ6A 4IH1A 3W1VA 4EJ0A 3KSBC 3PEUA 2PFSA 3FOEC 1DWUA 4HB4A 3MVEA 2O6HA 3NBZC 4L51A 3C16C 4K03A 3OEHD 2VSFA 2FETA 2HV8A 2OAQ1 5BNZA 2EBUA 3OE7D 1S2MA 4IF4A 1UBUS 2ZKIA 4MW9A 3EFSA 3OBBA 4L87A 3PUZA 3R76A 4QHYA 1KE2A 4B32A 1UXKA 2B8JA 1QRDA 2BWJA 2QM8A 3HG7A 1OHHA 3IOMA 1NT2A 3VJMA 5B7PA 1JJCB 2OWDA 2PKEA 3AVQA 3UPDA 6REQA 5EJFA 3SNKA 2UZIR 4RDIA 4RIHA 4L5YA 4MW5A 4CW7A 1YIOA 3RHZA 5K8VA 1L5VA 1I4OA 3TE6A 4Z7QB 3ZWOA 3T1YB 1XZPA 3LUJA 3AUYA 4YJ3F 4PSUA 2NO5A 4PZAA 4UDXX 3D3EA 3OJFA 1ZD8A 3F3KA 4WBNF 1Q2XA 2WM2A 5IEBA 3PR1A 3VHXA 2XMCA 3QA9A 2B1IA 1V11A 3L0BA 4P0TA 1K08A 4EPXA 2FFAA 3AYXB 1XN4A 3CLRD 4BNUA 3OT1B 5F4ZA 2R60A 2VHQA 1J09A 2VH1A 3I2JA 1XP8A 5DTJA 1XYGA 5CYFA 4XGRA 4KHPB 4UBLA 2WFLA 5B58T 2IU4A 1AT1A 3OLVA 2JLCA 4HLQB 3N8IA 4ARCA 4KV7A 2VK8A 2IUSA 3HCBA 2DSNA 4LY9A 3OQOA 1E1OA 4YC7A 3WB2A 3RSCA 2B34A 3CNNA 2ZCEA 2EW8A 3IUEA 2AK2A 2WJPA 4KU4A 3JAMA 4LXIA 4N0PA 4CMCA 5ALGA 4LJRA 1V39A 1VSQA 2FDRA 4EI8A 1WCWA 1LI7A 3ZD9A 4NPCA 3LOUA 5FOQA 1UMCA 4M1ZA 3OY2A 2O7SA 1BIBA 3MS4A 4BW9A 2FEAA 5ESDA 5IAJA 2VXCA 4A92A 3VSCA 4F1JA 2W6NA 5GJWC 3EEFA 3ZQ4A 3V1MA 1NLFA 1QTNA 1TIBA 2YN0A 1W0JD 1FLNA 2AN3A 1P2DA 4TUYF 2JLWA 4FS8A 1EI9A 3ZHYA 1D2GA 1E6LA 3DVSX 1KBOA 5AJYA 1QIIA 2HQ1A 4F04A 3DEHA 5JC1A 1HT1E 4GYYA 4QUKA 3RRXA 5CLJA 4GYJA 1Z2DA 4M99A 1E1TA 3TUZC 1E0JA 1QK5A 1YCHA 3MCZA 4ZA2A 3QNWA 3TIXB 1UOPA 3ZG6A 1WCXA 2CYAA 3P9XA 1H6CA 4V0MA 3TS1A 3UWOA 4U2FA 1IQPA 2JA1A 1N5KA 2FJ0A 1NVMB 2IE8A 3A0UA 3T3EA 1VRCA 1EDBA 2V7BA 4CCYB 3IPRA 4YEDA 5D85A 2ZFUA 5LVAA 3UHPA 1GNLA 3I39X 1J4AA 1ZL2A 1OA0A 4U39A 3O4FA 3OOEA 4X00A 4PRLA 1T5BA 2QLTA 4PYJA 4JI4B 3ZD7A 1FCJA 3LIPA 3DEAA 1L5WA 1C9KA 2EDCA 3KL2A 5K4GA 4HY3A 1KO7A 3QKRB 4YP9A 2WAMA 1GGKA 2BY4A 3DE6X 4OU5A 4PYMA 3JQDA 5IC5A 3N74A 4GUDA 4XE5A 2WHPA 1RW4A 2VSNA 4HNSA 3SLKA 1NVEA 1NPTO 4H08A 4R9VA 5BSUA 4HQ0A 5BRAA 5LXTA 1CX9B 1IDOA 2AJBA 5DNAA 5F1OA 4P3KA 5JCPA 4JP1A 4X45A 2R87A 4NV0A 4LY6A 2E85A 2ET6A 3IC5A 3FNRA 3UWKA 2ZITA 4S1PA 4D25A 3GA5A 3AILA 4J0KA 3P9NA 4JLBA 1C3EA 4LVLA 1ADBA 1R4AA 4F4DA 1G4UR 4YREA 3BWDD 4M2LA 3H6GA 1E5LA 1JBQA 5DIFA 2AOVA 3E18A 1HEUA 1J2UA 1MPXA 1O96A 2VQ3A 5JTUA 2D3TA 2VDPB 2WFZA 4UARA 4Z51A 1CEYA 3DFMA 3QUTA 4RF2A 5E9QA 4B3JA 4LCJA 3ADBA 2QQ5A 4XJXA 3ZUGA 3MBKA 1D07A 4FOLA 4Y2XA 2IOHA 2DX7A 5D3MA 5I9MA 4UATA 4MKZA 1DPFA 5FKJA 2SBTA 1WAMA 4UHDA 1RI1A 4D4MA 3IR6A 2CXUA 2YYYA 3OLCX 1P4AA 3RS9A 3TZEA 5DASA 3N05A 4LPKA 2HO4A 5DBIA 4HDQB 2GLTA 4BBPA 3O1LA 1GY8A 4ZVOA 1FDRA 2OESA 1LF5A 3AWIA 5C81A 3GG9A 4RVNA 3CEAA 3LT0A 5AI4A 1M5UA 4XTCS 5DT9A 2C4NA 1N6OA 3OE5A 5COQA 1L4HA 5IVKA 1UAAA 5TGDA 3QH4A 1C4XA 1BHQ1 1B15A 1JNXX 4IXDA 2NIPA 3UMBA 1BMQA 4AKGA 4I36A 4RK1A 4KVZA 3I01M 1LPAB 1O3YA 1HX7A 1BXKA 3AM4A 4FKMA 2C03A 5K3SA 1CFJA 1EJ6A 2JHGA 2RHTA 1LRLA 5GINE 3OFVA 3HYLA 1U99A 4HC4A 1QHXA 1UMCB 1W4CA 4JJZA 3WRYA 5B5SA 1W2WB 5B7NA 3QXJA 5EZ6B 3ZQJA 1UQRA 3D59A 5KOIA 3BB3A 4HBGA 4WIAA 4DUGA 2X0EA 1L5MA 1OE0A 4KR3A 1V5GA 2K4MA 3MJSA 1GCIA 2D1RA 5TQJA 1UKBA 3VOSA 4FC6A 1N92A 4OYLA 1U3DA 3TPCA 5E4JA 4DANA 4IRXA 3VC1A 1J70A 2Q4BA 2VK1A 4JC5A 4CDRA 4UQLA 3T5PA 4NCAA 2O8FB 2J32A 2QVCA 4KDCA 4FM9A 3HZRA 2WTXA 3N8GA 4DYVA 3BPSA 4W1SA 2X13A 2I1WA 3BD6A 2QPLA 1IN6A 3HXLA 3LNTA 2ZDQA 3URMA 1AO0A 2CMDA 4FFSA 3WLIA 4XM1A 2ZIOA 1K68A 4KQ6A 5FLXA 1MAWA 2ASVA 3ELUA 1Y5LA 4TSKA 5GZ1A 2XZPA 4PEVA 3KT0A 2BGLA 3L0DA 4ZT2A 12ASA 1IJFA 4MHTA 1KAQA 2FHSA 4A8JB 1NVKA 3PNYA 5IAAA 2UYCA 4H7EA 1P39A 1RWMA 2IDZA 3GUZA 3PXDA 4IW3B 4N8DA 1Z4QA 5KVCA 2EBFX 2IDJA 2BGKA 3BFPA 3BZUA 2G70A 1E9EA 3M1AA 1RC1A 4QQFA 5KNDD 4K6OA 3L2ZA 4EYEA 1NURA 4Y9TA 1VL1A 2HWUA 5SY4A 3EQ2A 3INRA 4LTMA 2NUPB 2OZKA 1N9KA 4ODIA 5I9SA 2D0DA 2ZYVX 1TCAA 3WDMA 2DLDA 4PV7A 1WZ2A 3EUWA 1CHDA 1CSEE 2D1SA 2DUNA 4ZZ0A 4Q1FA 3RL6A 4JLWA 1UADA 2ZJZA 4ZVLA 3GLIE 1ADYA 3DLBA 3BKWA 2WSSD 4EB6A 1HYHA 5E2AA 4EFMA 1U5BA 4WFKA 2PYZA 4EZEA 2PX6A 4KFRA 4TQDA 1Q17A 1UK9A 1VBKA 1L5FA 4H7FA 5AHOA 3TSOA 3HN7A 2W6JA 1DO2A 4L07A 1W59A 3C1OA 4LY0A 5TPWA 3A06A 1NJ6A 3Q9UA 4QOGA 2BI8A 2O2ZA 3MZ0A 4F0JA 4PO3X 3EUAA 4QEDA 1ZPDA 2ENWA 2JCSA 1W1UA 5E0OA 4K9PA 3RRJA 2I71A 3PG5A 4U7FA 1AQIA 1Z6PA 3FKJA 4ZAZA 1Z2AA 5KNCH 2CLLB 4J6FA 1W88A 3OMXA 1U0NA 4DVJA 3OIUA 1Q11A 4ZO4A 3DBRB 5TQ2B 4LZNA 4O2AB 1JHXA 4K28A 3QLJA 4OHFA 1XEAA 3G8CA 1PWHA 1YFSA 4WACA 3IP8A 3IAXA 4UM8B 2Y0CA 3TTTA 3GNQA 1Z3CA 4M53A 2PQ2A 1Z22A 3GLHB 2XE7A 4BE9A 3CLUC 1JJVA 2OL4A 3GCZA 2YWJA 1IBCA 1DZIA 2FUEA 4TQAA 2HWKA 2QI9F 1T4GA 1WW8A 521PA 2EL7A 2O0JA 1DIGA 4R2WA 3QNMA 1I4TD 3TKLA 4EGJA 5TMPA 1F2TB 5ECWA 3ET5A 4I1VA 2XNDD 1REQA 2ZSFA 3D7LA 3VH4A 3IV6A 4H4CA 2WOJA 1X7XA 3V6LA 1L5HB 4EEXA 5M04A 1JIQA 2M6RA 2K7ZA 2WVAA 3BHIA 3ND9A 2BEUA 3R7WB 3J80A 1A8QA 3S68A 3KYCB 5DYNA 1CULC 4FK8A 1XYVA 3AUUA 3J7TA 4I1SA 5EKUA 3L4KA 3E53A 1LJUA 5BORA 3IE0A 1QDLB 2AMLA 3CONA 2OFFA 3MJCA 1UP4A 3PD7A 1WDMA 4R6XA 1XHLA 5TF4A 3RFUA 4UTRA 2IU3A 5D86A 4YXFA 1XMJA 2QS9A 2Y4NA 1U7UA 4HYQA 5DN6A 3TNJA 1SESA 3JXEA 5AW2A 1OLOA 3TEMA 5JO0A 1J5EB 2I1VB 2QAGB 4HSEA 1Y5NA 2IXFA 3HXKA 5T7BA 2CV2A 3UF0A 1WHSA 4Q16A 1RPAA 1CVLA 2EBWA 3OQHA 5E6UA 3VXKA 3L0OA 4QG3A 1BXGA 3F6BX 1OIWA 1G8KA 3A1CA 1CJKC 4UZSA 3TN7A 3BMNA 4BMXA 1SXJA 5FT9A 4EL5A 3AP2A 3QMVA 3F98A 1IRIA 2X1HA 2ZYSA 2QZ9A 5I8WA 2JVJA 5AI5A 3LSYA 4X6YA 3TLGA 4G1UC 4XTUA 4G5XA 3B1ZA 4FUTA 3P1JA 3DAYA 4D3DA 3OD1A 1T36A 1Z0FA 1CY2A 5ALPA 5I7AA 5M7EA 2I3BA 1RLUA 1TM7E 2O8BA 3OKFA 3CN9A 5ALUA 3RWMB 3AKZA 1I9CA 4D26A 3W1EA 1B16A 1J0AA 1I0IA 4H2TA 4WW0A 3L4JA 2FP4A 3MTJA 1SZPA 4EB0A 3HEBA 2PD4A 4W63A 3KYBA 2FDCA 1TTHA 1J2TA 1PVDA 2FSUA 2MR6A 5A0TA 4K46A 3HU1A 3ZDEA 1JQDA 1E6CA 1IBRA 1TX4B 2VA9A 2R47A 3FH0A 2LKDA 2PL5A 2Q4OA 1UWVA 2VWQA 1TJ3A 3F4BA 4MPRA 4NMXB 5CB0A 3AF5A 4AICA 4NYMQ 3SQXA 1IXYA 1XZFA 3KQKA 4ENQA