5C54A

Crystal structure of a novel n-acetylneuraminic acid lyase from corynebacterium glutamicum
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
310
structure length
310
Chain Sequence
SATFTGVIPPVMTPLHADGSVDVESLRKLVDHLINGGVDGLFALGSSGEAAFLTRAQRKLALTTIIEHTAGRVPVTAGVIETTTARVIELVEDALEAGAEGLVATAPFYTRTHDVEIEEHFRKIHAAAPELPLFAYNIPVSVHSNLNPVMLLTLAKDGVLAGTKDSSGNDGAIRSLIEARDDAGLTEQFKILTGSETTVDFAYLAGADGVVPGLGNVDPAAYAALAKLCLDGKWAEAAALQKRINHLFHIVFVGDTSHMSGSSAGLGGFKTALAHLGIIESNAMAVPHQSLSDEETARIHAIVDEFLYTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a novel N-acetylneuraminic acid lyase from Corynebacterium glutamicum
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase/N-acetylneuraminate lyase
total genus 118
structure length 310
sequence length 310
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c54A00
5D09A 3DBPA 2PC4A 4ONVA 3THQA 3B0PA 3HG4A 3W3OA 4CNNA 1SO3A 4AEOA 3W1LA 3NPWA 4UNKA 1Q3NA 4M6QA 1SO4A 1OFAA 1LBLA 2X30A 3PSWA 3W7IA 2RDWA 3P61A 5GVJA 4DQWA 5DN1A 3TXVA 3NQFA 4KWWA 3U6WA 2CLLA 3SGUA 6ALDA 3FJ6A 3WFAA 5BOOA 3IGXA 1VHNA 2QEZA 3RK8A 3DFSA 1JCJA 5FEZA 3B8DA 3HMJG 2AGKA 3LLFA 1Z42A 2VFFA 3C52A 2Z1BA 2VKZG 3N34A 2VELA 5K9XA 2FB2A 2QJIA 3N19B 4PEKA 5EPDA 2FPTA 3LCLA 3GLCA 5AYXA 3LM7A 3IIZA 1TPB1 3CEPA 2RDUA 2D73A 3M1ZA 1DV7A 1U5JA 2ALDA 3UY8A 4ML9A 4XKYB 1IXNA 3P7YA 2VFIA 3UNDA 2E5BA 4JYDA 2VFGA 3P67A 1H7XA 1F7BA 3TSDA 1LOSA 1LCOA 3KAOA 3MUXA 1GTHA 2ZA1A 3GDKA 3NXFA 4UFJA 4LS0A 5BNKA 5HJLA 2GJNA 3W1MA 2A0NA 4GUJA 4PA8A 2R91A 3PG9A 4IPIA 5CG7A 1HUVA 4MY9A 4TR9A 1TV7A 5DXXA 5HWNA 5FEPA 5HR6A 4GWEA 4HSOA 5LNSA 2QUVA 4GJ1A 1DVJA 1T96A 2GUUA 5C55A 3G1DA 3TC7A 1TYGA 2NXGA 4OT7A 3FYPA 3ZWSA 1KFCA 2VOMA 3QC3A 1JJKA 2VFDA 2GQ9A 4C1KA 4ZL1A 3UWUA 5CGQA 1MEIA 3PSVA 3I7SA 3I7QA 3A5VA 4JDBA 1SU5A 3W7PA 4NXKA 4O12A 5CZJA 3KRSA 3UZJA 1KM5A 1I2NA 1LRNA 1TPFA 1XL9A 3E12A 2BTMA 4DF0A 1OK6A 3WJZA 3QW4B 3F4WA 2OT1A 3SJ3A 1L9WA 3LERA 1W5NA 5D33A 3W76A 3LCHA 1LRQA 4UTHA 3BPWA 2TSYA 3CWOX 1ICSA 1K3UA 3F1QA 3FYOA 4WXZA 1SSDA 2YW4A 4O15A 1RR2A 3O07A 8TIMA 4XBKA 5I3IA 2VFHA 3QSTA 3LCFA 3O1NA 4DELA 3CIXA 3W7MA 3R2GA 2ZRYA 1C9DA 3LOTA 3NZ1A 1B57A 3TSBA 3O6CA 2F7FA 3NNTA 5DBTA 4MJZA 2BWGA 1E51A 3PAJA 1GG1A 3NPXA 1I45A 3W73A 3FJLA 3HQ1A 4DEFA 3W22A 1SPQA 4EWND 4ADUA 3P5YA 3NAVA 1TQXA 5A5WA 5G2HA 1QPOA 3RF9A 5TQLA 5HWJA 3G18A 3AO0A 5C2XA 1X1ZA 3CB8A 3M5ZA 1W5QA 1BKSA 3NQAA 3O16A 3QJAA 2E09A 3TMQA 3TSMA 1F05A 4BK9A 2ZCGA 4WZHA 5A8GA 4KFOA 1JRCA 3GNNA 4MJMA 3KXQA 1YTDA 4NJGA 3C2FA 1ALDA 4LC6A 4X2RA 1EX5A 1AG1O 4PL1A 1RQBA 2PCQA 3ABQA 3LHYA 3UD6A 5AHNA 2ZZ7A 1R46A 3MYPA 4JX4A 2FLIA 1WBJA 4R7JA 3C2OA 2G95A 3JRKA 1KM4A 1H50A 4LVFA 5D38A 5EL1A 4JTEA 3R5EA 1W0MA 1P0KA 3ATZA 3NM1A 3LXCA 3SW6A 4K36A 3SIZA 4O0KA 1S3HA 1TPH1 4XBSA 3I65A 3NQ6A 1NEYA 5D30A 4FX8A 2NX3A 2QCNA 1YXYA 1WOBA 4XQ6A 2X16A 2OJPA 4GRSA 2CZFA 5F4XA 1TSIA 4MUZA 1F2JA 2E77A 1IF2A 3P8JA 2VEKA 1X1OA 4K8EA 1JCXA 2R8WA 4N9DA 4NT0A 3QMRA 1S5WA 1IXQA 1MO0A 2RHGA 4FNQA 3LDVA 5FEXA 1HL2A 3VCRA 4DPPA 2C1HA 2V0TA 2Q8LA 1DQXA 1VPXA 1QDSA 5D2YA 4DBDA 1Z44A 4IX0A 2DZPA 1PVNA 5D37A 3UWZA 5K9CA 4AXKA 2H90A 5EMUA 2EGZA 4UNLA 5H91A 2BZNA 1X6UA 3LV6A 3EWZA 2CLEA 4Z1BA 4BI7A 4JTIA 3S6DA 3ELFA 2B0MA 1FWTA 3O05A 2QCHA 4UTWC 5K2ZA 2O7SA 1SO6A 1FUYA 3L5LA 1HFBA 1XBVA 3G8RA 3FA5A 5F1VA 4S2BA 3SGZA 4PTNA 3Q37A 4K6AA 2EKCA 3NYZA 1QR7A 1W5MA 3ABOA 1F6PA 1ME7A 3NQGA 4H4IA 4IXHA 4EIVA 3VE9A 3GKAA 3C6CA 5BMXA 5AOUA 2A7NA 3DFOA 3L0KA 2ZZ6A 2FDSA 3LX9A 3NL5A 5EBUA 3FKRA 3OIXA 3WK3A 1KFLA 5I3KA 3UWVA 4UTLA 3VE7A 3F03K 1BWLA 3LCGA 3LHZA 2Y7GA 3S9YA 1OK4A 4IOTA 3R8RA 4QQ3A 3BGJA 5DCBA 1WAUA 2DJLA 1TTJA 5HULA 3B04A 3MI6A 1YPIA 4K7YA 3TJXA 4WY0A 4YCPA 3SFKA 3GDTA 1KM6A 1W3IA 3DU0A 1QNVA 1ZAIA 1O4UA 3UPBA 4Z1DA 1AW5A 5G4EA 3NQ8A 3NR0A 1Z41A 2W6RA 1J2WA 4JIQA 3M6YA 2WV8A 1ME8A 2WPBA 3NQVA 2A2IA 4LV4A 4YL2A 4UTIA 2H6RA 2CLOA 2Z6IA 3LV5A 1FCQA 3TK7A 1SR9A 3W7KA 3UWQA 1EWEA 5IBXC 4M19A 2JKEA 1QCWA 3MP4A 3GDRA 1SZEA 1VHCA 1YADA 3IVUA 4NNBA 4K8HA 2Y7DA 3EWUA 1G7VA 1RQEA 3KX6A 3C4UA 1D3HA 3SY5A 5IM51 2QCDA 5AYYA 4FNSA 1CI1A 4LRSA 1DBTA 4W9TA 3W6YA 2V82A 3ZR4A 5KZEA 3GR7A 3NPUA 4WY0B 2WQPA 3EKLA 3W2KA 1LP6A 1Y0EA 1BTMA 2EF9A 2WSRA 3N3MA 4TU1A 4ZQRA 4WXYA 1J4EA 3QYQA 1TPC1 3ATYA 2FTPA 4RZ5A 5LGZA 2H3BA 5T26A 1XFBA 4MOZA 3OG3A 4WD0A 1UB3A 1OX4B 5I3HA 1PHQA 5D32A 3W71A 1K03A 3NL6A 5BRBA 3HGSA 3BARA 3M47A 1K7FA 3L68A 1TTQA 4NUWA 4WOQA 3GB6A 1ZENA 1TPUA 4O1AA 1PS9A 2YPIA 4IMDA 3GX9A 4LU0A 1YPFA 4LNYA 3PBVA 4Y9AA 1HTIA 2YW3A 4MLRA 4FXSA 2A4AA 4MZ1A 1A5SA 4WQ6A 4LW7A 3LXAA 1H7PA 3THAA 2ATSA 5AHFA 3W2UA 2Y85A 1K7XA 3INPA 1EP3A 3NQMA 4LRTA 5LSMA 2Y70A 1TV8A 4TO8A 5CPMA 4FO4A 3DHDA 3SZ8A 1H63A 4IGHA 4N2YA 3PUOA 3V1PA 4LV9A 4XTDA 4CCCA 4EVZA 3MBDA 2FB3A 3IGUA 5EKYA 3L0GA 3EXTA 3W23A 4A22A 2XN2A 3O6YX 3SECA 3W7JA 3TXZA 1XBZA 3C0JA 3W7NA 2DORA 4L4LA 2WKJA 3A24A 4A2RA 4ZQCA 1LTDA 4IPJA 4E2BA 5HNRA 1CX9A 4CLMA 2DJXA 4H6KA 2TMDA 1OYBA 3W83A 1XBYA 2C18A 5L9FA 5DELA 1AMKA 1W3TA 3IIXA 3PM6A 1ZY9A 5HQEA 2F84A 5CPNA 3GIYA 3SSJA 1OYAA 2A6LA 2GVGA 1NF0A 1SZNA 4YCOA 1AL7A 2H8ZA 4NX5A 3S42A 2XN1A 1QPRA 3OEXA 3W84A 3O06A 3FS2A 1TV5A 3UPWA 3SR7A 3L9CA 4LWWA 2PE4A 4NJJA 1Q45A 3H53A 5TBOA 3L0NA 2DZTA 3W75A 1I2RA 3N2MA 3PB0A 3W7CA 3TU9A 2ISSA 3W87A 3W70A 4Y6GA 5AHMA 1H1YA 1L6SA 3W88A 4OE7A 3FKKA 1OX5A 1S5TA 2CFFA 2CZEA 5FI8A 4ZQPA 1VH7A 5AYZA 1W54A 3LCIA 2QKFA 3W74A 4X9SA 2PURA 4A2SA 2VFEA 3HOJA 3O6DA 1NVMA 2ISWA 3TR2A 1PL9A 2NZLA 4DO4A 3LXBA 2GVLA 4LVDA 2Y63A 1L6YA 5KTLA 2ZRWA 4NJIA 3W2LA 2CZ5A 3Q94A 4AHOA 3IRDA 3CTLA 3TAKA 4Z0SA 2GQ8A 4QNEA 5F2MA 4O4VA 1T8XA 3CT7A 1TTIA 1JR1A 3RU6A 4O8RA 3B03A 1RPXA 1FBAA 2ZQ0A 3QPZA 1YYAA 1A5AA 2JGYA 3N9SA 1ZAHA 5HUPA 1ZAJA 2PRMA 4O54A 3BG5A 5E0KA 5LNUA 1QWGA 3GDLA 1VYPX 3CPRA 1YDVA 3DHFA 1MEWA 2RKXA 1H7RA 1FDZA 4LY8A 4ZMGA 2J9YA 5D04C 3MJYA 4UTJA 1FXPA 3GDMA 3L5AA 1LBMA 3NL3A 1GQNA 1A53A 3TQ0A 4ORMA 3MBFA 3T40A 3LI0A 1F5ZA 4N9EA 4S2CA 1Q6LA 3TW6A 1VCFA 3DFPA 1X7FA 3E0IA 7TIMA 1TJRA 3TKFA 1L6WA 3GKFA 3I68A 2ISVA 3DFNA 1EA0A 1G6CA 3P62A 5AC6A 3HJZA 4ZVJA 3S5OA 4XTIA 4UC5A 4UFKA 2X1UA 4AHPA 2V5BA 4Y90A 1SZFA 3QEZA 4M6PA 2DU2A 3OA3A 1P1XA 2RH9A 4JXCA 3QPYA 2ZZ1A 2ZRZA 3KVLA 4CQAA 1K7EA 2QJGA 3QF0A 2Y88A 4UMCA 4LT9A 3PBYA 4KWVA 4LVBA 3FOKA 2BLEA 1O5KA 4RR4A 3NQCA 3DENA 4A29A 5F2GA 2Y61A 3MMTA 4JTSA 4XUGA 4FB7A 3LRLA 3EEGA 3LLDA 3N73A 1SFLA 1OFDA 3C8FA 1P5BA 1P0NA 5D2WA 3T44A 4MIMA 3QQ0A 4MYAA 4LS1A 1W8SA 4JTJA 5HWMA 3S1XA 5J5DA 3NQEA 4JEQA 4WJEA 3PUDA 4UTTC 2PRLA 3W1XA 5LHEA 2HTMA 1DL3A 4A21A 1O95A 1KTCA 1QAPA 4NZFA 2R14A 1WXJA 1PCKA 1KTNA 3NZRA 1FDJA 4O1BA 4CNPA 3G3MA 4IMFA 4RCXA 1TJPA 3BW2A 4NNCA 3S1UA 3NQ7A 1XKYA 2ABAA 3GXTA 4IWWA 3ZS4A 3NVTA 1RD5A 2P1FA 1FDYA 4FF7A 3Q2DA 3NPVA 1TPEA 4PCFA 1S5VA 4XKYA 5LGXA 2C16A 5D03A 2ZA2A 2B7PA 4JIPA 2A1YA 4HNVA 1A5BA 3W7EA 4JR5A 1D9EA 3CLMA 3CU2A 1OJXA 2V81A 4I9AA 3B06A 1GG0A 1TTPA 1A50A 4QNWA 4O52A 3SI9A 4ADSA 5DLCA 1U83A 5IBXA 3U8GA 4Z0JA 1SO5A 3G1SA 3JR2A 1JCMP 1CW2A 4BFAA 3HIJA 1KTBA 3S1VA 1ZJIA 4JGDA 5CKSA 5F4SA 1TB3A 4FEZA 3H54A 5CPLA 5K4ZA 4WUIA 3OBKA 3MHFA 2HMCA 1H7OA 5KSWA 3S5ZA 2GQAA 4U4MA 4A3UA 2C6QA 2ZYFA 2A7RA 4MZ8A 1EP2A 3W1NA 1JUKA 1OX6A 1XDLA 4AF0A 2C3ZA 1OVDA 3QH2A 2VXNA 4GC4A 2X1TA 3FFSA 3PR2A 1WX0A 1HO4A 2EAWA 5E93A 3BG9A 1TO3A 2NX9A 5U4NA 4IMEA 1GVFA 5C54A 4QAIA 1O94A 5KMYA 2YYTA 1JCNA 1M6JA 1H51A 3PWAA 3W1RA 1KBIA 3UXAA 4GNJA 4HPJA 1TIMA 3GZ3A 5KINA 1EPXA 1SUXA 1W1ZA 2E1DA 2J6XA 1B4EA 3B0VC 3TCEA 4CCDA 5LNRA 4RZ4A 4G1KA 1GVSA 4UTWA 4O19A 4BR1A 3NGJA 3LHVA 1D3GA 4ZQOA 4WY0F 4GUIA 4NVTA 4RX0A 1HO1A 2JBMA 3W1AA 4UMAA 2Z6JA 2BXVA 1SSGA 1GVRA 1A5CA 4O10A 4IUOA 4BI5A 2ZFAA 4K39A 2QJHA 3HO8A 1ONRA 2H3DA 4GBUA 5HMSA 4O4WA 4QITA 1UJPA 3C61A 1QPQA 2ZTKA 1WBHA 4HPXA 3EB2A 3QM3A 2FJKA 3WJSA 1LOLA 5BW6A 1B9BA 2G5WA 4BWLA 3M43A 3UWWA 4LVGA 1XCFA 2ZRUA 1G4PA 3PUEA 1M7PA 2YFOA 1QFEA 2QUUA 3DAQA 4TMBA 2O7QA 3NM3A 2WOQA 2YDAA 3RLUA 2EHHA 3TIMA 4OBTA 1DJNA 2CLMA 1Q6OA 4YMZA 2QCGA 2C13A 3P8IA 5CSSA 1ZCOA 2NX1A 1SW3A 5K3VA 5F4WA 3W7HA 4E38A 1L2UA 3HG3A 4XZ9A 1VS1A 3O8AA 5LKYA 2E68A 1V5XA 1VLIA 4Q4KA 2WSQA 3KFTA 4O16A 3IIPA 4I7WA 1W31A 2C19A 2A21A 4M7TA 4NJKA 4C1LA 2QCFA 1GJPA 1DORA 2V2CA 4IQLA 1F74A 3L65A 2FFCA 1P4CA 3I7RA 4R33A 2NUYA 3GXNA 2NXHA 2CU0A 1PIIA 2J24A 3PVFA 1NFBA 5HR7A 3QQ1A 4RJEA 1DJQA 3EWXA 5K4XA 3S1WA 1YTEA 1GTEA 4JTTA 4N4PA 1I2QA 3PC0A 2CLFA 3LBCA 4P2VA 2WO5A 3DZ1A 4D2JA 4FIRA 3TROA 3LTYA 4RKAA 4KFPA 1H1ZA 3I6RA 2QCEA 2NXIA 3IVTA 1QO5A 4LOCA 4UIOA 2ZRXA 4NU7A 4FX7A 1KBJA 4GE8A 2B7NA 4KKXA 4Z08A 3G8EA 3RLVA 1EB3A 4UFHA 5D02A 1IGSA 4MLJA 4EOUA 4N6FA 2J9ZA 1KM1A 3MWAA 4FX6M 4AVFA 3TQKA 1F76A 1MSSA 3TH6A 3VFLA 3P81A 3N9RA 3GR8A 4LVAA 1YDNA 1GYNA 2A5HA 2W0UA 1N7KA 4LTSA 1ADOA 5HUOA 4N6EA 5FF7A 3TW7A 5G1YA 4FNRA 3GAKA 3C3NA 5CPOA 5CZ0A 3UQNA 3LB0A 2QAFA 1I4NA 5I3FA 1LROA 4RK8A 3MI3A 3T78A 1OFQA 4GUGA 4ZQMA 1OF6A 4AHQA 2BX7A 1EIXA 4O1CA 2TRSA 4O57A 4UFIA 2YYUA 5J5RA 4UTMA 4IMCA 2I14A 3M5XA 1QOPA 4XWUA 2HS6A 5H2ZA 2YGYA 2ABBA 4HNTA 3HGOA 1VQTA 2QR6A 1JCLA 2CZDA 3N14A 3MHUA 1SQ7A 2NWRA 1TPDA 4NQ1A 1I8JA 5G1TA 4J9JA 1T99A 2ZZ2A 3WK1A 5DXYA 1YDOA 3EX1A 2E5CA 3TV8A 1GYLA 1GZGA 3UY7A 4ORIA 3CQ0A 2ZBTA 1H7WA 3C2VA 3B05A 3E02A 1FCBA 3TX9A 5F2IA 4BF9A 2DZWA 3IIOA 1FQ0A 3T7VA 5EA9A 4JTGA 1G4EA 1ZALA 3LHUA 4RV8A 1OX4A 3IEBA 3TMLA 3L66A 4DF2A 3A22A 3E49A 3OVRA 2TPSA 4UTKA 2RFGA 4MFEA 1M7OA 1B4KA 1XUUA 3BV4A 2V5LA 1MZHA 5DBUA 2G97A 1KFBA 4MY1A 1ICPA 1HG3A 2YXGA 3ANYA 2YSWA 4Q32A 3KVMA 3W7OA 5I3JA 2C14A 5EYWA 3PBUA 4HNUA 5TIMA 2E6YA 4GUHA 1N55A 3M5VA 2VEIA 1EP1A 2QCLA 4AAJA 3TFXA 4JS3A 5D05A 1KM0A 3H55A 4FNTA 4N4QA 4CNOA 1JCYA 2ZZ3A 3ABSA 1W5OA 3DXIA 1BEUA 3L2IA 3S5NA 2QUTA 2OCZA 4RXFA 5C6MA 5DCDA 1RQHA 3C56A 1OYCA 4JNMA 1KLYA 3W1PA 2GVJA 3HB9A 3W1TA 3EWYA 1JULA 3P60A 1JUEA 1JQVA 4DXVA 1XUZA 2GJLA 2P0OA 3C2EA 3GXPA 1PCWA 2YCEA 2V2DA 4UMBA 2QDHA 1MXSA 5LZLA 4GUFA 3G1VA 3EX2A 3M5YA 3NQDA 3DKLA 5AN7A 5E1QA 3LHWA 1PV8A 4HHPA 4OV9A 3UYCA 2C0AA 2X1SA 4HT3A 3DKJA 3PBWA 3P84A 2W79A 5I3GA 1GT8A 5AHLA 5K9DA 1SZGA 2V30A 1R2TA 3DFTA 1VR6A 2PRHA 1AW2A 1QPNA 1JRBA 1VC4A 2WSYA 1NAL1 1NF7A 4JDYA 5FESA 4LUJA 1VJIA 3W1QA 3W7RA 3W1UA 2Y7FA 3W86A 4FNUA 2QDGA 3CWNA 4M5PA 3KVJA 1RVGA 2NUWA 4AH7A 2E6DA 2FPYA 4HKPA 4I7UA 4CQ8A 5L6UA 1R2RA 1LLZA 3IIVA 4JTHA 4MYXA 2HS8A 3W7QA 1VCVA 3M0ZA 4I7VA 4MFDA 4JY9A 2QCCA 2FPVA 3EX4A 1GVOA 1KFJA 1AL8A 2Q8ZA 4O50A 3D0CA 3PY2A 3LCXA 1WDWA 3L5MA 3NDOA 3NL2A 1DHPA 4FXRA 3LGEA 3KOFA 3OHIA 4DPQA 4JTKA 2KZHA 4IJBA 3PS7A 2XFWA 4IMGA 4E2DA 3STGA 3PG8A 1WQ5A 4BI6A 2ATMA 3G1AA 2Z0IA 4MY8A 2H8XA 1K8ZA 3L67A 3QSRA 6TIMA 3G1FA 4YLWA 1JQXA 3HPSA 4QIUA 3A21A 3CM4A 5AC7A 3UXDA 4DBEA 1OFEA 4PH6A 1G7UA 3M9YA 2I1OA 1R47A 1RZMA 1EEPA 5CSRA 1KFEA 1YTKA 2WNNA 3TUUA 2NV1A 2AAMA 3KRZA 1B3OA 1WOAA 3UZ5A 1SFJA 3P82A 4TIMA 2G96A 3IGSA 5ABTA 1OFBA 1W56A 3DI0A 3TNOA 1UCWA 5AFDA 3K30A 4PFMA 4E0CA 3G3DA 4X3ZA 4CCEA 5K7JA 3TE9A 3R89A 1W37A 4TX9A 2OMAA 3G0XA 2CWNA 4MKNA 4S1FA 1LZOA 1ICQA 3WK0A 3MYOA 2QCDB 4OU1A 4O28A 1EWDA 2Y7EA 4AF0B 4H3DA 3STFA 1TREA 2J88A 5DY3A 1UUOA 1IXOA 3E96A 2YR1A 4JN6A 4UCGA 3WJXA 1AK5A 1VLWA 3LTSA 3CHVA 1WA3A 1EUNA 4IX2A 2VEPA 5AHIA 4NZJA 1H61A 3PF3A 2Z2UA 3BVJA 1VYSX 2JKPA 2DZSA 4IXXA 2E5DA 2V8ZA 4N9BA 4RLIA 4QM1A 5DY2A 4NXSA 3EX3A 2Y89A 1Q6QA 1FCUA 3O15A 1TPWA 1KFKA 3BW3A 3FIGA 1JVNA 2NV2A 5KZDA 1I2PA 4RXGA 1OHLA 1QMLA 1V7YA 2YFNA 4JYEA 3WJWA 4FHAA 3FEMA 2WJZA 3W72A 5KZMA 3ZWTA 3BW4A 4JTLA 5F1UA 2R94A 3G1HA 5U7SA 4K38A 3EWBX 1OFPA 2LLEA 4LC8A 1JUBA 2NUXA 5BMWA 4O11A 3A9IA 3DH7A 4U28A 3HG5A 3M7WA 4EF8A 1OFOA 3KRUA 4B5NA 1EUAA 1N8FA 2V2HA 1SW0A 2VEMA 3VI2A 1ZHAA 1LRTA 4O1DA 1R2SA 1OABA 2QF7A 5G4WA 2IQTA 2OT0A 1TPVA 1OFRA 3EXRA 2P10A 4M7SA 3NA8A 1RV8A 3WJYA 3EKZA 3GAYA 4JYFA 3TJLA 1OG0A 3STEA 3EX6A 5AC8A 3HPZA 4ICNA 4L4MA 3LBMA 2CLKA 5SWUA 3RMJA 3LTPA 5FF2A 2VC6A 3BGGA 2WNZA 4GXMA 3GVGA 4AB4A 3W7GA 3G24A 3CIWA 1BWKA 1XC4A 3EXSA 2X2GA 3NO5A 4R34A 1TRIA 1LM1A 3W2NA 3A23A 1VCGA 1DKWA 4P61A 3W07A 1X8FA 1WV2A 3W85A 3M41A 3G1XA 2ZRVA 3HGJA 3M44A 3E9AA 4MPQA 3A5FA 4UTTA 1ML1A 2E6FA 3MI2A 4UTUA 1FXQA 4O18A 1WYIA 3LCWA 3DI1A 1M5WA 3TFCA 2B4GA 4AMAA 2J9XA 1C8VA 3HG2A 1KV5A 4TMCA 3STCA 2ZTJA 4YWIA 3TA6A 2A7PA 3P74A 1YXDA 4PL2A 2DZXA 4GFSA 3VNDA 1FX6A 4ZQNA 5LNVA 3R12A 3Q58A 4O14A 4QISA 3NQ2A 3QMSA 3G22A 2FIQA 2VENA 3W2JA 4DO5A 3W7LA 3N2XA 4Z1AA 4K37A 1R30A 3QRHA 3TQVA 3U2OA 3BG3A 3LRMA 1VZWA 1YXCA 1OF8A 3CC1A 3F4NA 1ZFJA 1KM2A 3B4UA 1TRDA 2J27A 4LUIA 4QSHA 2CW6A 3PB2A 3HGRA 2ZZ4A 4JTUA 3MHGA 3TDFA 2DZUA 4WOZA 1GEQA 2OX1A 3BK0A 4OGZA 1FWNA 4NJHA 4Y8FA 5FF0A 5CZSA 4Q33A 3OVQA 2UV8G 2JK2A 1XM3A 3MP3A 4PODA 2QAPA 1XI3A 1NSJA 1UBSA 3YPIA 3MW7A 5FF3A 3BLIA 1LOQA 1Z48A 3GK0A 1W3NA 4ZZ9A 4PC8A 3C2RA 3HBLA 3T55A 1FWSA 1F73A 2ZZ5A 1FWRA 2YX0A 1LDCA 4UFLA 1KM3A 1O60A 3DFQA 3LHTA 3UWYA 4CQ9A 2V9DA 3EWWA 3W9ZA 1PE1A 1KA9F 4Y96A 5G2IA 3IVSA 4DO6A 3T4CA 5DCEA 1G67A 1F6KA 1W5PA 1DOSA 3LI1A 5KITA 4ALDA 2Q3OA 4UR8A 2Q3RA 3R13A 3FLUA 3ABRA 3QZEA 5D2XA 3O63A 1G4TA 1UASA 1AW1A 1IXPA 1TCDA 1XDMA 3NOEA 1THFD 2A6NA 1ME9A 2B7OA 3JS3A 2CLHA 1IIHA 1UUMA 4UR7A 3ZFHA 3HPXA 1GOXA 1XXXA 4JY8A 2Y6ZA 1H5YA 3QMTA 1LORA 3M16A 1T0OA 2JKAA 4M6VA 5G2WA 3USBA 5G5IA 1VGAA 5MHBA 3DGRA 1LBFA 3V75A 4ADTA 2EPHA 1ZNNA 4N9CA 4R53A 3NEVA 1VYRA 4JX6A 4AWSA 4YXGA 4O0ZA 2NLIA 1QOQA 3BO9A 1Q6RA 1XBXA 1GVQA 4O17A 1VRDA 1K8YA 3MO7A 1IIGA 1K8XA 3B0UX 3P5ZA 1G4SA 5D2TA 4MZYA 1H62A 4UUIA 2NWSA 3W7DA 4QJ1A 4HN4A 4AWTA 5FEWA 3S0CA 3PULA 2JGQA 4FNPA 2ZA3A 3KVKA 4DF1A 2B7QA 3G0SA 1FY6A 4MVAA 1I2OA 4JICA 1FCVA 2E6AA 2CLIA 5LHFA 1DQWA 4OWGA 3RFAA 3OVPA 2HSAA 1J5TA 1H7NA 1H60A 3TAOA 2C15A 2X1RA 3G0UA 3KHJA 3S5YA 5HINA 2XN0A 1PHWA 5CZTA 1YLVA 4O53A 3VKJA 2YZRA 4OV4A 3HF3A 3MP5A 4OQVA 3QW3A 4HSNA 2TYSA 1TQJA 2Y62A 4HNNA 1C29A 4N02A 2BSLA 3G1YA 1KLZA 3WK2A 1O5XA 3BLEA 3QFEA 3NG3A 2QCMA 5FF4A 3RNDA 4O13A 5C5YA 3P80A 2DP3A 4UFMA 3BLFA 1KW1A 1GWJA 3TC6A 1LLWA 5D2VA 2OZ0A 4X22A 1LYXA 2ZDRA 4HIBA 4JX5A 3W2MA 4JD4A 4LS2A 4Z1CA 5AHEA 2FQIA 5F2LA 1TMHA 2I9EA 5AB3A 4NX0A 4JTFA 1SW7A 3S8HA 4KFNA 1GPWA 4FIQA 1G69A 1QO2A 4K7VA 3GNDA 4WX2A 3AJXA 4OHQA 4POCA 4RZ6A 2GOUA 4NNAA 3GYEA 4EF9A 4AWUA 3LRKA 2WNQA 2DZVA 2A85A 3CEUA 1MEHA 4UXDA 4BWLC 1K02A 3L21A 1FWWA 2GPTA 2RDTA 1KV8A 3IV3A 5EY5A 2AQWA 5LNWA
chains in the Genus database with same CATH superfamily
1E6QM 3FHQA 1FH7A 2PC4A 4KWOA 4PMVA 3ITYA 3B0PA 4QFUA 3W3OA 3EMQA 3NPWA 4IQDA 1R9XA 4UNKA 3AAMA 4M6QA 4XVEA 1BXNA 3QTGA 1JZ6A 4HHHA 4GACA 3P61A 3OTRA 3CAQA 3ZYZA 3KTXA 5FIPA 1KGXA 5BZAA 4DJEC 5I0DA 3B9NA 5JUVA 3U48A 1UW9A 3W26A 5AVHA 1R9ZA 5FEZA 2VFFA 4XAYA 3VIIA 1UR8A 2DSKA 2FB2A 1B5TA 5FJUA 4OKDA 5EPDA 1VEMA 3V3WA 3UG3A 2RDUA 2QLYA 1UD4A 3M0JA 3RAOA 1U5JA 4BF5A 2OEKA 2DIEA 2J13A 4JYDA 3L4VA 3HFTA 1E1EA 1F7BA 3BAWA 3MUXA 1J2BA 1NWTA 2ZA1A 1O66A 3WH6A 4UFJA 1PB0A 2D2GA 2ZXBA 5HJLA 2A0NA 4IPIA 3PG9A 1BYCA 5E09A 2CHNA 4HSOA 4RNHA 4GJ1A 1J5SA 1T96A 1HKVA 2HDJA 1TYGA 4ZENA 2ZUNA 4MG4A 5GJNA 1K77A 3QC3A 2J78A 2GQ9A 4C1KA 3VD4A 4ZL1A 4Q8UA 3RGTA 2D22A 3PSVA 4YTRA 4EPBC 3CBWA 3MPGA 3KRSA 1G5AA 2I57A 4LYRA 3FNDA 3U4AA 1RBAA 3M4HA 2NSOA 4DF0A 3F4WA 2EPOA 3W76A 1E72M 1RJRA 4UTHA 3GH4A 4F40A 5H8MA 4H2HA 3CWOX 4UZUA 3WLIA 1PX4A 1K3UA 2WHMA 1WAWA 3CQKA 3FYOA 1SSDA 2YW4A 1H41A 2GQ3A 8TIMA 3L2MA 1BRLA 1TE6A 5I3IA 2VFHA 1JZ5A 3O1NA 1HX0A 1UWAA 3VU2A 1OGSA 3TZFA 3W7MA 2ZRYA 3AMKA 3OW1A 3LOTA 4W4QA 1B57A 4ZO7A 1JZ2A 4WJXA 3TJIA 3NNTA 3IJ9A 2BWGA 1LG2A 4B4FA 1RAKA 4FR1A 4PBEA 4DEFA 4UR9A 3PPFA 4ZO6A 3P5YA 3NAVA 2ZOXA 3RPMA 1CXEA 4DUOA 3G18A 3AO0A 4PUMA 2ZICA 3M0YA 1PYFA 3M5ZA 5C2XA 3TN4A 3VILA 3NQBA 2DIJA 1O12A 2YL5A 2ZCGA 1HGWA 1Y5WA 3VC6A 4H8VA 4KFOA 3S5SA 4L9YA 1PTGA 4O8AA 4P8XA 4MJMA 3LG3A 4AZCA 4NJGA 3C2FA 1ALDA 3RN6A 1H5VA 2C79A 3PZ9A 2GJPA 3UG4A 4W88A 1FKWA 3GIPA 3C2OA 2G95A 3JRKA 4LVFA 1ZP4A 1NH6A 1Z6KA 1NFPA 1NWUA 1P0KA 3ATZA 3LPOA 1CGWA 3K4AA 4F0LA 4H9MA 4K36A 3SIZA 1KQYA 1PZ2A 4P8UA 1ONEA 5IHSA 4L6HA 2NX3A 2RUSA 3U3HA 2BVDA 3AISA 1YXYA 1IWAA 4XQ6A 1O68A 4IQJA 4GRSA 2AQVA 2CZFA 3UG5A 3SY1A 4E2OA 4FI4A 4HZ8A 2E77A 1OC5A 1B31A 1IF2A 4GXWA 2VX6A 3FW6A 2PU1A 5JBEA 4NT0A 1MZRA 2VR2A 1S5WA 3C2YA 3PZMA 2RHGA 3CAWA 1HL2A 1BVZA 2C1HA 3ARUA 3APTA 2Q8LA 3VAVA 3UGVA 1YIXA 4GZIA 1VPXA 1QDSA 1RHCA 2R1MA 1H2JA 2Z4GA 2O9PA 4IX0A 2DZPA 1PVNA 3UWZA 2WC7A 2KAUC 3E6EA 4X9YA 2EPNA 2BZNA 2PDQA 2CLEA 4PGLA 3UU0A 1A0DA 5BXTA 1CNVA 3TP4A 3ELFA 2B0MA 1FWTA 2NQ9A 3MSRA 3O05A 3ARSA 4H00A 1E15A 4DBUA 4D6IA 3SO7A 4S2BA 5BOEA 3Q37A 1E6SM 3TYCA 4HVXA 3F4DA 3AHVA 4HK5A 4PMXA 3NQGA 1FWHC 3GM8A 5DFAA 3DFOA 1QWKA 2JIEA 4ZTXA 4NAEB 4P7OA 1R0MA 4IZGA 4N42A 1ZZMA 1W1IE 4ROQA 3UWVA 4UTLA 2OXNA 1BWLA 5HJYA 1J79A 4PULA 5DCBA 5FAGA 4HYRA 2IPWA 1PBGA 1GONA 3B04A 3LM3A 4L64A 1YPIA 3T07A 4RZBA 3AXXA 4J7RA 2XSXA 5I02A 2V5CA 3NQ8A 1F9CA 5G4HC 2BGNE 2ZDSA 3QHMA 3M6YA 2WCAA 5IDIA 1S38A 3A3WA 3NQVA 1V8EA 4LV4A 3LUTA 3LV5A 2CLOA 4I9TA 3GNXA 4IHCA 4JQ2A 2BMBA 3WNKA 3WLRA 1QCWA 2OYLA 3T4WA 1A0CA 3MP4A 1OB0A 1VHCA 2YBTA 1UR3M 4PMJA 2PDIA 3C4UA 4LUSA 4ZOCA 1D3HA 1E6ZA 3DESA 3SY5A 2QCDA 3NGFA 2OZTA 3KWSA 4WDWA 3W6YA 2VVNA 3NPUA 3WMCA 1Y0EA 4FLOA 3MB9A 4LEFA 4ZQRA 1J4EA 3ATYA 4OUIA 3ZIZA 2H3BA 5T26A 2VT0A 2CBIA 3IUIA 5BRPA 3H6OA 3W71A 3HJEA 3PJWA 4J3VA 2DPEA 4DYKA 3HGSA 2X05A 4TUFA 4WOQA 3ZVHB 1ZENA 2HXUA 4PCNA 4IMDA 1IYXA 3PBVA 2XGIA 4MLRA 1IGWA 2D0FA 1A5SA 1OGGA 4IJRA 4LW7A 2NQZA 2QPUA 2ATSA 1AFSA 3GU1A 1S5NA 3W2UA 4DJFA 5BWFA 3NQMA 4LRTA 4J4KA 1V02E 4HA4A 4LEQA 3SZ8A 2MANA 1PPIA 4IGHA 4N2YA 3B9EA 1BLIA 3WF0A 4IH3A 2W27A 1FWBC 3W7JA 4UQAA 1XBZA 3C0JA 2WVSA 2DORA 3W7NA 3VOJA 3IJ8A 4A2RA 4AD2A 1LTDA 2GLKA 3FDGA 2ZWZA 1CX9A 3QHOA 3AUJA 2TMDA 3EWDA 1GKPA 3WMLA 2C18A 3QV7A 4B9ZA 5HQEA 5CPNA 3GIYA 3ID7A 3LPFA 2GDQA 2GVGA 1AL7A 2XVPA 1WZKA 2BHUA 3W84A 3SR7A 4LWWA 2CPUA 1Q45A 1X98A 4GO8A 3W75A 3PB0A 2ZUMA 3W7CA 4YU1A 3CZ8A 5AHMA 4CU6A 3AIEA 4G56A 2NQ5A 2CFFA 4ZQPA 1MQQA 5DX7A 3M0LA 2FZDA 3RPTA 2VC9A 2QKFA 1QI5A 3W74A 4YWSA 2I7GA 1NVMA 1CDGA 3JU2A 3HA1A 4C6EA 1CCWB 4Q4PA 3FXGA 3SCQA 2CERA 3WNMA 2BXYA 3IRDA 1E3XA 2Y24A 4J35A 5E6YA 2FYMA 3BH4A 1RK5A 1ELSA 4QNEA 4YVVA 1S1RA 1T8XA 4OIFA 2YXOA 3VDBA 3QTPA 3M46A 2Q8XA 1QI4A 1RPXA 1YYAA 2ZKMX 2G4FA 2QVNA 5HPCA 2JGYA 1A4LA 4BZYA 1ZAHA 5MKGA 1QWGA 1SMDA 1VYPX 1Q2RA 1X97A 4LAKA 1QATA 1MEWA 3O7UA 5D04C 3MJYA 4UTJA 3H22A 3WDQA 1UMLA 3V5OA 3T40A 3TONA 1Q6LA 1VCFA 3DFPA 3NZQA 1X7FA 3NIYA 3E0IA 4G1NA 4AYGA 1EA0A 1G6CA 4PN2A 3HJZA 3S5OA 4GIYA 3IRSA 1P0BA 1PTAA 4AHPA 1MQPA 1MW1A 2DU2A 4JXCA 4L4OA 2ZRZA 3AIRA 2QJGA 3QF0A 1VFFA 4LT9A 1XRFA 2CKSA 3VYLA 4KWVA 4URIA 2BG5A 1O5RA 2QMKA 3RLGA 4A29A 3R1ZA 2Y61A 1T5AA 5ABGA 3LENA 4XUGA 2XFFA 3UFYA 1BRLB 3LLDA 4ERIA 1RBOB 3S9IA 2BP1A 4KRUA 3ARPA 3GG7A 1Y7VA 1J01A 1C91A 3A13A 1GQJA 1RK6A 2Z00A 3S1XA 3N11A 3NQEA 1XD0A 6TAAA 4AZHA 3DEQA 2J8GA 3WFLA 2WHKA 4B3ZA 1XH1A 3R0DA 3NZRA 3G3MA 9CGTA 2WM1A 1W1TA 3BW2A 1US3A 4WSHA 2VMFA 3GXTA 3LPPA 3IJIA 3WF1A 6CGTA 1E6RA 4PCFA 4LNCA 3TNBA 2HE5A 2ZA2A 1DP0A 3U5UA 5JQ9A 2A1YA 1KXQA 1NDWA 3VABA 4LUSB 2R1KA 1TWZA 3NDYA 4S3AA 2HPIA 3CU2A 3LU2A 1CB7B 5XINA 1OT1A 3B06A 1TTPA 2QULA 5B7YA 2XH0A 3BL3A 4YPJA 4PB5A 3SI9A 4KEUA 1E6XM 1YRRA 3GFYA 1U83A 1SO5A 1E5JA 1GK8A 2FZ8A 1ZJIA 5CKSA 5CGTA 3PK7A 1TB3A 4FEZA 1LQ2A 3WEZA 5K4ZA 4WUIA 3S5ZA 2XISA 4A3UA 3W1NA 2ZYFA 4IGSA 3CL8A 4NZ1A 4X0NA 4IQEA 2XHYA 1OVDA 1OD8A 3FFSA 1TA3A 1XICA 1XSIA 1EF2A 2PPGA 4AVOA 3AIWA 3KM8A 2JEPA 1RCOB 3A6OA 1TO3A 5HMFA 2PTWA 3WQPA 4H7CA 1S5MA 2YYTA 3W1RA 1EC7A 2QPXA 1K9TA 5KINA 1SUXA 3UXLA 1W1ZA 2E1DA 3QVQA 1GW1A 5CGMA 1EC8A 2J6XA 3UVIA 1KGUA 1ONWA 1DIEA 3WBYA 4B5TA 4G1KA 1GVSA 4KERA 3MSYA 3NZPA 3LHVA 4P7RA 1EEXA 1VEPA 1ITCA 1KKOA 4GUIA 4WY0F 1HO1A 2JBMA 4UMAA 1SSGA 1CYGA 3CUHA 4IUOA 2QJHA 3N2TA 4GBUA 4QITA 1XCWA 4DNMA 1UJPA 3SDOA 3BQ6A 3R43A 3W00A 4HPXA 3H2AA 3FVMA 3NEHA 4C6FA 1B9BA 4M1RA 2INZA 4DI9A 4LVGA 4XSLA 1ISVA 1M7PA 3DAQA 3PZNA 2QJJA 2WLZA 3UA4A 2O7QA 1WZLA 3CIVA 4V28A 5A8PA 2EHHA 3OP2A 4OBTA 1DJNA 2CLMA 1G9HA 4F2BA 4DJFC 1EZ2A 1Z89A 4GO9A 5DEZA 1M3UA 1WKFA 3GWQA 3W4RA 2WSQA 2YL9A 3IIPA 1M41A 4NJKA 3VIGA 2I5QA 4TVDA 2V2CA 4IQLA 1F74A 3UJSA 2FFCA 1P4CA 3WQOA 4TX6A 3GXNA 4PSPA 2FGZA 1JDCA 4V1YA 1UJQA 1TWDA 3H70A 3AU6A 5K4XA 4GQ0A 5CAHA 1YTEA 1DIKA 3AZTA 4F4RA 1UH4A 1I2QA 2CLFA 4WLCA 4P2VA 4W7WA 4HMEA 4D2JA 1IR1A 2PLKA 5XIAA 3CUIA 4BQ4A 4RKAA 1XG4A 3IVTA 4QJ5B 3KCJA 3CJPA 3T08A 1WKEA 1XHGA 1JXJA 1LLOA 4NU7A 2FKPA 4EANA 2G4JA 4H6EA 2XIJA 4PTVA 3Q65A 1C7TA 5D02A 1Q85A 2ZXAA 4TTUA 4EOUA 3AICA 2MNRA 2J9ZA 2P8BA 2W67A 3SQMA 1MW2A 1MSSA 1L8PA 3TH6A 3P81A 3MUCA 3RJXA 3N6QA 5I7GA 2PB1A 3ZQ9A 3LA4A 2W0UA 3LYEA 2XVNA 4K8GA 1VFOA 4C5ZA 1UC4A 2QAFA 3RITA 4JTQA 1WDSA 4RK8A 3GBDA 4F48A 4AHQA 3VGFA 3UJRA 1EIXA 4O1CA 2TRSA 4M56A 4C7DA 1QNRA 1SFTA 3MSDA 4JIIX 1VFSA 3AQUA 2YGYA 2ABBA 3HGOA 1Z3NA 3H4GA 2NQJA 3GHTA 1TPDA 4LAOA 1T99A 2ZZ2A 3S2MA 1QXLA 6XIAA 2GVEA 1JEZA 2VRQA 3BCFA 3PFMA 2X40A 3CQ0A 1H1NA 3GUWA 3RRAA 3RR1A 1T6MA 5IFTA 3C2VA 3E02A 2DZWA 2IKGA 4ZE4A 1HKIA 3I6TA 1EH9A 1OX4A 3IEBA 2O56A 3L66A 3A22A 2DSWA 3OVRA 4AEFA 1E4NA 3ARZA 4ERGA 4MFEA 3O0FA 3S46A 3WD0A 3M6DA 3AI0A 5DBUA 2I17A 3SRDA 3S6OA 4ROPA 5FJOA 6A3HA 3TQPA 1HG3A 3K8LA 5C71A 2YSWA 3KVMA 2J62A 4H8UA 5DQPA 4QLLA 4DWSC 4PCTA 2WVVA 1A5KC 1EP1A 1LWIA 2QCLA 4AAJA 2OO6A 3K46A 1UIPA 1V3MA 3GO2A 3MKKA 4LUTA 2OPJA 4JS3A 1UPPA 1ZBVA 3B8TA 2AL2A 3ABSA 3L2IA 4WRHA 4B90A 3K5XA 1UD6A 1SJBA 4J27A 3DFYA 1RQHA 3C56A 3SQSA 4CGTA 3W1PA 3IWPA 3EWYA 1JULA 3P60A 2DQWA 3EB4A 4PMZA 3PZOA 1OADA 3FK4A 3VOIA 1CLVA 3B9AA 2V2DA 1MXSA 5LZLA 3THUA 3EX2A 4DWSB 4Y7EA 4HHPA 3QY6A 2RAGA 3P84A 5I3GA 3B9OA 2VO5A 1GT8A 4S3KA 4O1FA 3NSXA 1CGTA 1R2TA 4CNSA 4K2SA 3WL1A 1VC4A 2XZ9A 1ISXA 1B30A 2WSYA 2WMGA 2GGHA 3GHSA 3W7RA 2O9TA 1V0LA 3BAJA 2WMIB 4NZ5A 4WIWA 1RVGA 4AH7A 2WMKA 3R79A 4CQ8A 1E5NA 3EDKA 3LY0A 4JKLA 3I4EA 1JPIA 4Q4QA 1Q7QA 4XG1A 4CEUC 3EX4A 1GVOA 1ECEA 3NOYA 3L5MA 3NDOA 2CXEA 4FXRA 3UESA 3VNJA 3BJTA 5M5DA 2KZHA 4IF2A 3PS7A 3ZLFA 3PG8A 2QJMA 1Q6FA 1K8ZA 3J7HA 6TIMA 3CM4A 5AC7A 3RRXA 3UXDA 1OFEA 1G7UA 4MWAB 1R47A 3VMNA 4E4UA 4M3PA 1RZMA 1TV4A 1RH9A 2GJXB 3TTYA 4HCHA 4DM1A 3KRZA 1WOAA 5JBDA 5LA2A 4TIMA 3UZWA 1W56A 3F5KA 3TNOA 2W62A 4MMWA 4E0CA 4P7NA 5CBJA 1M04A 1AQMA 1W37A 3T8LA 1GCYA 1ISYA 1LZOA 3VD3A 1ICQA 4TV6A 4IFKA 4AF0B 3UCCA 3FGCB 5CH9A 1UUOA 1R6WA 1EF3A 2YR1A 3KUMA 3UXIA 5I77A 4UCGA 2NW0A 2NV9A 1H11A 4AX6A 4B2DA 2VEPA 5AHIA 4KWSA 2JKPA 2DZSA 4QM1A 5DY2A 3OGVA 4D6EA 2WZEA 3BCDA 1Q6QA 3CV7A 1PDYA 1GORA 3E38A 2NV2A 2Z28A 5KZDA 3EA1A 1TJ1A 2YFNA 1UWRA 3ZJ6A 3GTNA 4AUBA 1XRSA 5BCAA 3KL0A 3ZWTA 5U7SA 3URNA 1KCKA 2FTWA 1UKOA 1O7AA 2HXTA 3BOLA 4PEEA 3MKVA 2PLJA 3OVGA 3DH7A 3XISA 4Q8MA 4U28A 3HG5A 3CQJA 5FJIA 4WKFA 1EUAA 2PAJA 4UQEA 4WJ8A 2QIWA 1W2PA 2DZBA 3BSMA 4DWDA 4JYFA 3WNLA 3TJLA 2CLKA 2YCIX 3AWOA 2VCBA 4AIBA 5HA7A 3ZR5A 3SQLA 4AB4A 1PJ9A 2BHZA 1IZJA 2RJGA 4H9XA 4FLSA 2J7BA 3CIWA 3EXSA 1Q4NX 4Q8QA 3NO5A 2V5DA 4QLKA 4ZEPA 1VCGA 3WQDA 4HTBA 3QGAC 5A6BA 4J5NA 1X8FA 3LNMA 2YKKA 3AZSA 4H01A 4U2YA 3W85A 3G1XA 2BASA 3HGJA 4HJFA 1UR9A 4W7UA 3SBFA 1I1WA 3A5FA 4HU3A 3U2ZA 4UTUA 1FXQA 4O18A 4HGXA 1C9WA 1M5WA 1CXKA 3G1RA 3ITXA 5AC5A 1C92A 1OEPA 4M6UA 3STCA 2J7CA 3N4FA 1E3ZA 2ZX5A 4JQ4A 4F8XA 3H24A 3U9IA 2DW6A 4ZQNA 5LNVA 3N25A 4UBPC 3O3RA 2ZXDA 1GVEA 2V3GA 3ABXA 4G8TA 3VMOA 3G22A 2FIQA 3AOFA 1KXVA 1TWIA 4DO5A 3W7LA 3N2XA 3ZJKA 4K37A 1R30A 3U2OA 4C6BA 4W86A 2P3EA 1JXKA 4JQAA 5BOFA 2DH2A 3BWWA 4ZOBA 4LF1A 1XSKA 4QBXA 3PZTA 2IW0A 4PUDA 2OX1A 2EQDA 1F4HA 5ECUA 1JGIA 2JE8A 4RE4A 3G6LA 2XVGA 2QF8A 3LGDA 4PODA 3YPIA 3BLIA 4YVXA 2VX7A 1W3NA 4JQ3A 3C2RA 1F73A 2ZZ5A 4UFLA 1XQKA 4DNHA 1KM3A 3UWYA 3EWWA 3W9ZA 1PE1A 2OYKA 1W9PA 4DO6A 3T4CA 4KRTA 1G67A 3LI1A 4ALDA 1ZP3A 2Q3OA 4ENLA 4V1XA 4WKHA 2VVSA 4OOZA 1QBBA 3TN5A 2EG8A 2OX4A 1RLCL 4UQCA 1NDZA 2VDHA 3VNYA 3JS3A 3F4VA 2QHAA 3MMDA 1IIHA 1UUMA 2HK1A 3BDKA 1XIBA 5A6MA 4JFVA 1QUMA 4GH1A 1C7SA 4G9PA 1B9ZA 2VEFA 3M16A 3WLSA 4QCFA 1D3CA 5I00A 2Z27A 1E9ZB 1HKJA 2JKAA 4M6VA 3BOFA 5G5IA 3AALA 4PFHA 2J79A 1IEVA 4QAWA 5MHBA 4E3VA 3MUY1 4PUEA 2WWDA 3GTIA 3V75A 4ADTA 5D8ZA 4QG8A 4R53A 2O55A 1QOQA 1KRBC 1IIGA 2F2HA 4I5RA 4UUIA 1DQUA 5FEWA 3IV8A 3RX3A 7TAAA 4FNPA 2QJNA 3FDKA 4A8NA 2B7QA 1FY6A 3FAWA 2DSUA 2YB1A 3T0AA 1BVWA 2HWGA 1JDAA 2E6AA 2CLIA 2FZMA 3IJQA 4W8AA 4GYJA 3PZQA 3HQOA 3BAXA 1ISZA 2X1RA 1PHWA 4ZCWA 4O53A 1U1JA 4L80A 4OQVA 3GVQA 3UJ2A 1J0KA 1C29A 3N15A 4N02A 2BSLA 1BSLA 2C7FA 3G1YA 5LIYX 4JFSA 1KLZA 3VGDA 3WK2A 4BKNA 1KRCC 4V33A 3AC0A 2E28A 5C5YA 1ZL1A 3LQGA 3WDHA 3HM7A 5D9PA 2H9AA 2R9RA 4H83A 3GD6A 2OZ0A 1F8IA 2ZDRA 3H2FA 3WH8A 3NUKA 1R8LA 1GW9A 4RNJA 3W2MA 1PWMA 2WCGA 1VIWA 4LS2A 1UROA 2OLSA 3Q4DA 5DT5A 1J10A 2FQIA 2TAAA 3PJUA 4I9MA 4NX0A 3N29A 1JF5A 4JTFA 1M65A 1SJCA 3S8HA 3IPWA 4PMDA 4FIQA 3RX4A 2BV9A 3EB3A 2WNWA 4WX2A 4POCA 1XGZA 4RZ6A 4W89A 3VPLA 3CV1A 3CH9A 3EPMA 4UXDA 3CXOA 3BLOA 1ZGDA 2G3NA 5LNWA 1TVPA 5BU9A 3DBPA 3V5CA 1GOQA 4CNNA 4MWAC 3W1LA 2Z25A 4E8CA 1SO4A 3MV11 3TYBA 2X30A 5FACA 4DB7A 3VKDA 2DSZA 4DHGA 5GVJA 3AXMA 3CB3A 4DQWA 5DN1A 3TXVA 3NQFA 3ERPA 4KWWA 3U6WA 4H6RA 3SGUA 5BOOA 4B5WA 2VTFA 4H9VA 1ZLPA 3B8DA 1R85A 2Z1BA 4CCZA 2W91A 3N34A 2VELA 2QJIA 6XIMA 1CLKA 2DT1A 3WEMA 1E4MM 1S2TA 2QQ6A 1DV7A 3OLEA 2ALDA 3OLIA 4ML9A 4XKYB 1IXNA 1XLMA 3UNDA 3PN8A 2BOEX 1QOXA 1MXGA 3FN9A 1BFNA 2J7FA 1LCOA 1CGYA 2Q71A 3OLGA 3W27A 3TVAA 4BHYA 4LS0A 2QPSA 4FR6A 3N2BA 2GJNA 1ODZA 3MT1A 4PCPA 4M24A 4PA8A 2Z1XA 4TR9A 1TV7A 1MDLA 5HWNA 5LNSA 3MUZ1 1AODA 2UY2A 3VKKA 1DVJA 4NF7A 5AYBA 5C55A 1KFWA 2HZGA 2YL6A 2P8CA 4ZB0A 1XRVA 4OT7A 3E74A 4HD5A 3ZWSA 1KFCA 1JJKA 3POHA 3MVTA 4ZOEA 5CGQA 1MEIA 2X09A 3I7SA 3A5VA 3TTEA 3W7PA 5I07A 2PFHA 3G2GA 2G50A 2BODX 4MTVA 4K1WA 4QE1A 4EKJA 1OK6A 3WJZA 1L9WA 1U22A 3LCHA 3MANA 2PWFA 4AZGA 3F1QA 4PUNA 1XYFA 1PO9A 5I24A 1WZMA 1OINA 1S2UA 4FLQA 2CHRA 4GY1A 2F61A 4ZO9A 4D6JA 1XIFA 4LBUA 3E0WA 5XIMA 1Q63A 3DC8A 4OTKA 3KEHA 5C9ZA 3NZ1A 3TSBA 2DEPA 3O6CA 3AFBA 3IGHX 1DJYA 1MW0A 2F7FA 2ZIDA 1E71M 2HVNA 1EJTC 3EOOA 2INEA 2QZRA 1F3TA 1E6PA 1I45A 3L4XA 3TEVA 5LXEA 2OB3A 4YYFA 1GOIA 1SPQA 5A5WA 3R58A 1DJXA 1AZ1A 5HWJA 3KDNA 3S2CA 3GNPA 3CB8A 3WIJA 2FH6A 3TMQA 1JYWA 3CQHA 3TSMA 2DV0A 3WBXA 1KGWA 1YBQB 1J6PA 3GNNA 3KXQA 4Y2WA 1EYWA 1XGEA 3UJEA 4HCDA 2BY0A 1X7IA 4PL1A 3GXDA 4LQ1A 3DIPA 2PCQA 3UD6A 5LIWX 5AHNA 2J77A 1WBJA 3EA2A 1KM4A 1A5MC 1C3FA 1H50A 3MUIA 5D38A 3TA9A 3CZJA 1NJJA 3R5EA 3OPSA 3GSMA 4U31A 1XR2A 3CK5A 4MF4A 1HP4A 1XLHA 1EOMA 4O0KA 1S3HA 2IXUA 3VD7A 1O1ZA 3EGJA 1IWPA 1TPH1 4XBSA 3S2NA 1NEYA 1A3WA 1K9FA 5D30A 2FJUB 3VX0A 3RO8A 2OJPA 4ZXOA 1V51A 4CD4A 4MHBA 1TSIA 2VGFA 1BG9A 2WWCA 4XIAA 2G3IA 4LUYA 3P8JA 4EK7A 1X1OA 4K8EA 1XLJA 1JL8A 1XH0A 3ECQA 4REQA 1QHOA 1MO0A 3GH7A 3LDVA 5FEXA 2EXOA 3VCRA 4AIOA 1ISWA 3F5JA 3SCSA 1T41A 2V0TA 2J8FA 1ZB5A 4PUWA 5D2YA 1J9YA 1XSJA 3MCOA 4DJEA 5K9CA 2Z1WA 5I5RA 1CTNA 1TELA 3OGRA 5EMUA 1J0HA 3UP8A 4AVNA 1UOZA 3NYDA 3WEOA 3PJXA 3LV6A 4BI7A 4Z1BA 3OYZA 2F6UA 4E3TA 2QCHA 2AMGA 4UTWC 2OR2A 3KOYA 1UR2A 1ITQA 3UZYA 1SO6A 3L5LA 3N04A 3HV8A 1HFBA 3T8QA 4EACA 3UG8A 3T09A 3FA5A 5F1VA 3SGZA 4PTNA 2EKCA 4Q7IA 1W5MA 1EL3A 3WZ0E 1Z69A 4IXHA 4Z2KA 1J96A 4Z17A 5IOBA 2HVMA 3L0KA 3D47A 2FDSA 4AW7A 4KEVA 1YEYA 3FKRA 4ZODA 3WD4A 3VE7A 3VDHA 4EXBA 4J3UA 3CL7A 3LHZA 4LGXA 3S9YA 4IOTA 1CT5A 3R8RA 4QQ3A 3WELA 3PFRA 1WAUA 3SCWA 1VBJA 5JH2A 2GGEA 3MI6A 4L1WA 4K7YA 2JF7A 3VC5A 5LXXA 1W3IA 3DU0A 1QNVA 1OZQA 1JFXA 3CHEA 2E3ZA 4XD4A 3MMUA 5IXEA 2GFTA 5A6TC 4YTSA 3NR0A 2W6RA 3PJTA 1C8XA 1EJVC 7XIMA 4JIQA 1ME8A 1W1A1 4HYVA 3VIPA 2A2IA 4AZCB 4UTIA 2H6RA 4P7QA 4GZJA 3TK7A 1ZS2A 1EWEA 4M19A 3ES7A 2A3LA 3VM5A 4FSAA 3GDRA 4NNBA 4K8HA 4OJYA 3GDBA 2I16A 1PUDA 4C6JA 5AYYA 4GINA 1D7KA 4Y9OA 5I03A 2J8TA 2GSEA 1IHIA 4Z1YA 4U5KA 1XJBA 5EMJA 2ALRA 4HPHA 2WQPA 3EKLA 3W2KA 2WSPA 1LP6A 1NTHA 2EF9A 1TUXA 1W8GA 4WXYA 1UA3A 4NZ4A 4KCTA 4RZ5A 5C9UA 1XFBA 4G5DA 1UB3A 2AAAA 1K03A 5BRBA 4BQ5A 2R1PA 1OQFA 3L68A 4GQQA 3CUZA 1TTQA 5JU6A 3I3BA 3S9ZA 1TPUA 1PS9A 3BLDA 4PRRA 4E5TA 2IKJA 4DJDD 5AY7A 4HBKA 4C5YA 2QVHA 7ODCA 1HTIA 1ZBCA 2G3JA 2A4AA 1KD0A 1UD8A 3LXAA 1R3RA 2D2JA 2PDJA 3THAA 3UETA 2BBFA 1YX1A 4MKVA 4TO8A 3PUGA 4XAGA 7CGTA 1DJIA 3V1PA 4LV9A 4XTDA 4CCCA 1H0GA 3MBDA 3IGUA 5EKYA 3R11A 4H2CA 4IICA 3L0GA 2PTXA 5C0QA 3EXTA 5DMMA 2WZTA 2XN2A 4A22A 1QHZA 4AU0A 1JI1A 3SECA 4D6DA 3NXLA 2XSAA 3LS9A 3QLDA 4L4LA 3A24A 2C8NA 1EDGA 4Q7BA 4E2BA 4CLMA 1OYBA 3LBOA 3U4FA 2B31A 2Y0FA 3CO4A 5DELA 3IIXA 3PM6A 5HNTA 1JZ4A 1ZTVA 1ZY9A 2F84A 1UPMB 1I6NA 3BSGA 4TXEA 3DC0A 1NU5A 1X1NA 1FTXA 1UP3A 2XN1A 1QPRA 3E2SA 1ODUA 1B3ZA 3EYPA 3GC5A 3SCNA 3DHUA 2BOFX 3GNRA 2DZTA 3N2MA 3TU9A 3FA4A 5C2CA 2O9OA 4QX4A 1IZKA 1OSEA 1XYBA 4J3XA 2YDQA 4GCXA 3AIQA 3H7RA 3W82A 3UZZA 2CZEA 1PZ0A 2XGZA 1XLGA 4L9ZA 3H4XA 3ICJA 3FA3A 1QT1A 2X8RA 5IHRA 2VFEA 3RU8X 3O6DA 3TR2A 3S2LA 3AIUA 2NZLA 5HNNA 2GOKA 2V3DA 1BWVA 3V18A 1L6YA 2CZ5A 3Q94A 1BYBA 1Q8JA 4LUTB 1FWGC 4CNUA 3Q67A 3AHTA 4QXIA 1YPXA 4C6KA 4S3JA 2YL8A 1UD3A 4K1GA 1Z32X 4LY4A 3W81A 4O8RA 4RE2A 3ANUA 3Q45A 4XZBA 3TOPA 3F2DA 1XLCA 1TVLA 4O0QA 1K1DA 4NIRA 2C1IA 2VCCA 1YDVA 3DHFA 4GK8A 1ADSA 4B16A 4UOQA 1EKOA 3GTHA 3U5YA 3L5AA 3NL3A 2YA2A 3TQ0A 4E2VA 4GVIA 5ABHA 2PWVA 1WUFA 4HNOA 3TW6A 5A8OA 4JHMA 1EJWC 3GH5A 3DGBA 2PBGA 1TJRA 3TKFA 3GKFA 3I68A 5ENLA 3DFNA 2D69A 1FH8A 4QG9A 3KOWA 2X1UA 2V5BA 3QN3A 4GHRA 3MVIA 1IQ8A 5MF5A 2YCLA 5CPQA 4NAEA 4CQAA 4L7ZA 1ESWA 1H09A 1MRQA 1PIGA 1E6NA 3P0XA 4MADA 4LVBA 4DRSA 3FOKA 4Z2GA 1XINA 1O5KA 3NQCA 4NI8A 4P8VA 3DENA 1QNQA 5A3HA 4WHBA 4WF7A 3ARVA 4FB7A 1M1BA 3EEGA 3WQGA 1E4IA 1S39A 3WSUA 8XIAA 1SFLA 2W5FA 1Z8AA 4MJ4A 1P0NA 4XO7A 3IUHA 3P0WA 3LEPA 1WUEA 4KW2A 4MYAA 4LS1A 2PP1A 2XH7A 1KWGA 5A8QA 2D2OA 1XP3A 1XWYA 5J5DA 3PUDA 4UTTC 2PRLA 2HTMA 3GZAA 2BNJA 3W53A 2QV5A 3OBAA 4A21A 5FCZA 3CUJA 2J6VA 3II1A 1WPCA 4IMFA 4RCXA 1TJPA 3KLLA 1V6VA 4NNCA 2QIIA 3NQ7A 1RD5A 1EJUC 3L4YA 2P1FA 1FDYA 3ITGA 4FF7A 3CT2A 1AA1B 1TPEA 3NPVA 1GVYA 3Q2DA 1W9VA 4XKYA 5LGXA 1R38A 3KS6A 1D2KA 1G94A 1MDRA 3EOEA 4JIPA 2PTZA 1V0NA 5FJPA 4DM2A 4IFRA 2CYGA 1BVNP 3CUXA 4GH3A 3MKCA 3U2EA 3EA3A 1FA2A 1EBHA 3IJ6A 4DXXA 1AUSL 3WLHA 4YYCA 3G1SA 4AD1A 4EWJA 1JCMP 4MDOA 1NARA 4BFAA 3HIJA 4IISA 1XIEA 3S1VA 3T2PA 5F4SA 4DLFA 5JBFA 4ZR8A 3OBKA 1I75A 3MHFA 1HQTA 1BGAA 1H7OA 1MXDA 1QTWA 2C6QA 2A7RA 3P6LA 1EP2A 5I06A 1OX6A 1HJSA 1XDLA 1VRXA 2Y8UA 2XH4A 4UNIA 2E0PA 3PR2A 4GISA 3GXMA 1HO4A 3N18A 1IEQA 5TF0A 4YNGA 3SCUA 5E93A 3BG9A 5C9WA 2NX9A 5U4NA 5REQA 5KMYA 1O94A 3OIHA 4A6GA 1H51A 3PWAA 4PRTA 4KPLA 2VZVA 3KBSA 1IT8A 4XD3A 1QW8A 4HPJA 1EPXA 4I9JA 3VXGA 4CCDA 2OELA 5H8UA 4RZ4A 1Y65A 1US2A 4O19A 2GYIA 3SB0A 3NGJA 4ZQOA 2ZADA 4XVDA 4RX0A 4I6VA 1A5OC 2BXVA 4Q8VA 4IIGA 3IJDA 1A5CA 4DBSA 4O10A 4DYEA 4AY7A 2ZUUA 5EU9A 4BI5A 4K39A 3T0TA 2P88A 3APYA 3WQ6A 4O4WA 3W01A 5DANA 4U5IA 5A95A 4CKQA 3C61A 3DDMA 3ARTA 1QPQA 4AQLA 3EDJA 4J3TA 3WJSA 1LOLA 1GPFA 4BWLA 3UWWA 2IQDA 2ZRUA 5PTDA 4MAVA 4PUJA 2PDHA 4ACYA 2P5NA 3WDIA 1TVNA 3NM3A 3RCMA 2DH3A 4GX9A 4ZE5A 3TIMA 4L65A 1VPQA 4YMZA 2C13A 3F2BA 5CSSA 1ZCOA 4XZIA 5K3VA 4EX4A 3W7HA 1VS1A 1FFRA 1HJQA 3UWEA 2CITA 1UHVA 2C19A 2A21A 1NELA 4D6GA 4PE8A 3WDRA 4GVHA 3HPAA 1DORA 3L65A 2HBVA 3LZ5A 3WQEA 2NXHA 2J24A 3PVFA 1W3KA 2YDSA 2YA1A 2PA6A 4E8GA 1GTEA 4AZIA 1MMFA 2F6KA 2VQUA 3PC0A 1YW1A 3DZ1A 2YA0A 4PSRA 3VIKA 3TROA 3LTYA 1H1ZA 3KZSA 3TN6A 2OGYA 3NSNA 3ZXWA 1QO5A 3VIHA 1OCNA 1WDDA 4W5ZA 4L56A 3D3AA 1KBJA 2BGSA 4OOUA 5D9NA 4M80A 3XIMA 1KO0A 1Q6EA 1EGVA 4R7WA 1IGSA 1OM0A 4GQBA 1BXBA 3VO0A 3HQNA 2YDRA 3UA3A 1KM1A 2O4QA 3MWAA 2QDDA 3RG6A 4AVFA 2WAGA 1P7TB 4JL2A 2ACUA 4LVAA 1YDNA 3FSUA 2A5HA 4HZ7A 3KBMA 4IGNA 4LTSA 3W25A 5HUOA 3ZJ8A 5FF7A 1W17A 4DWSD 3B8IA 5G1YA 4FNRA 5EMLA 3ZZ1A 3NCOA 3LB0A 4OZOA 5I3FA 1UD5A 3EPNA 3QV8A 4ILSA 4GUGA 4C6LA 4QEHA 4ZQMA 4AY8A 2WYSA 4UTMA 1VFHA 4FAMA 4RE3A 3M5XA 1SR0A 2HS6A 2OVLA 2OYMA 1VQTA 1SQ7A 4NQ1A 5G1TA 1HL8A 2QYGA 2QUNA 1Z7AA 2VD8A 5CEWA 2E5CA 4MM1A 1GZGA 3V0UA 3R4IA 2ZBTA 1CXLA 3PBGA 3B05A 1FCBA 4BF9A 1BQGA 4HQVA 4FA3A 3T7VA 2HNHA 3KLKA 4PMQA 3TJ4A 3LHUA 4RV8A 4DF2A 3SSZA 3E49A 2TPSA 4WDXA 1IR2A 1V0MA 2RFGA 3MA8A 4UTKA 2XTKA 3BV4A 3CV6A 1MZHA 1W3LA 3EKGA 5LIKX 3QZ6A 4WKAA 4MY1A 4DUWA 4QP0A 1GOWA 1HKWA 2YXGA 3ANYA 5I3JA 4FMVA 4HNUA 2AKZA 3LQLA 3UF9A 4Q8WA 4GUHA 1ITXA 2VI0A 3M5VA 2VEIA 5J8LA 3C5QA 3JZUA 1S3TC 3LPGA 3KOXA 5D05A 1DWHM 3PZGA 4N4QA 1JCYA 5ECVA 3DXIA 1NDYA 1LQAA 4I5XA 1EXPA 1OWQA 1R5YA 5C6MA 3WLQA 4AD5A 1KXHA 1A0EA 4F0KA 1OYCA 4TX8A 5HAOA 1KLYA 1RALA 3LMYA 1UWIA 1JQVA 2E1WA 1QW9A 2VCAA 4DXVA 2PD9A 1XUZA 2GJLA 3C2EA 4BEUA 1KC7A 2YCEA 3ZVHA 3WF4A 3URBA 1E55A 1US0A 2AOSA 3DKLA 4PB4A 3PTKA 1VD6A 4OV9A 2X1SA 4HT3A 5CLWA 1RY0A 3DYPA 1R3YA 2W79A 3GY1A 4RL3A 2V30A 1VR6A 4JHOA 4L1GA 1QPNA 4PMUA 2WCSA 5FESA 3W1QA 4REQB 2Y7FA 1HT6A 4FNUA 2QDGA 1E9YB 1UG6A 4PRWA 4P7LA 1JYXA 3IK2A 1LLZA 3CH0A 4Y8EA 3WUGA 3IIVA 3PPHA 3QC0A 4RW3A 1W3HA 1J0YA 3QR3A 2Z26A 4MFDA 4JY9A 3A4WA 1V3KA 4O50A 1KRMA 3D0CA 2DT0A 1WDWA 3NL2A 3KOFA 5CSYA 4CD8A 4JTKA 4IJBA 3OB8A 4CD5A 4GI8A 2GDVA 3STGA 4BI6A 4B3KA 2ZUSA 1BYDA 2Z0IA 2H8XA 4HU0A 4YLWA 1BD0A 2RJHA 4QIUA 2Z2AA 3O6AA 1EO5A 1K4HA 1E56A 3M9YA 4DVOA 1DJHA 1PIFA 1XX1A 5CSRA 1YTKA 1OC6A 1KR0A 3CAVA 5C8BB 4U3CA 1TX0A 3UZ5A 4XZNX 3N4EA 2G96A 5I6SA 2X0SA 1TIWA 1UCWA 3K30A 4G7EA 4PFMA 2Y8KA 3G3DA 1K6WA 4CCEA 1C8QA 1U2YA 2Y4SA 2R1NA 5I09A 1JYNA 2OMAA 2CWNA 4NAFA 1HJXA 2PDUA 4D8ZA 4O28A 2Y7EA 4H3DA 4CN4A 3STFA 2PTYA 4E6MA 1ZRQA 5ABFB 4ZA0A 4XD6A 4G7FA 4IGMA 4JZ5A 2E67A 1B3WA 1KKRA 1ECQA 4MWAD 3DERA 1AK5A 3SFWA 1VLWA 4Q6JA 3NWRA 1UMYA 2Z2UA 4CN6A 3WLOA 4KEMA 4WDTA 4NXSA 4MNJA 4B9YA 3EX3A 3BJFA 1J0IA 3BW3A 1JVNA 2WANA 4D72A 3WJWA 4FHAA 2WXDM 2FMOA 3W72A 5F1UA 2QV4A 2R94A 3G1HA 4K38A 1FOBA 3EWBX 1SZRA 3ITCA 5BMWA 4CQBA 1WKYA 4LB4A 1ONXA 3L4UA 2IQ0A 1KR1A 4JIEA 2VC7A 9RUBA 4HHMA 3E2RA 4BF7A 5FAJA 4GLEA 3V36A 1N8FA 1SW0A 4L5ZA 1LRTA 4DJDA 4IIBA 1R2SA 3FJNA 2QF7A 3UW6A 3WBEA 3QPEA 3EXRA 4M7SA 5D9MA 1W91A 4Q4RA 3WJYA 3EKZA 3GAYA 3STEA 4IPPA 3EX6A 3HPZA 5SWUA 4JKKA 5EMMA 2TODA 1V6UA 5FF2A 2VC6A 2XGBA 4ACZA 3ZT5A 4H6QA 4QE5A 3G24A 1XC4A 2X2GA 2HVOA 4R34A 1LM1A 3A23A 3HPFA 3PZIA 2HISA 1DKWA 1WV2A 2ZRVA 3HV9A 1RBLA 2X42A 3M44A 4MPQA 2GGGA 3N6HA 1Y5VA 3VIOA 2E6FA 3LZ3A 3E5PA 2PDKA 2Y2WA 3LCWA 2ZX7A 3QYSA 3KBWA 1DPMA 2B4GA 2J9XA 1NP0A 2FDMA 3W28A 2PGFA 1BYAA 1RY8A 2A7PA 4PL2A 2DZXA 3VNDA 3WNOA 4XZHA 4KETA 2YJQA 4OECA 4F9DA 3L12A 5M1TA 4DO7A 4Z1AA 3TQVA 3BG3A 3OHMB 3KZPA 4A35A 1E40A 5E0FA 1KM2A 3VGEA 3B4UA 1TRDA 2V3FA 2UWFA 3PTDA 4IP5A 4JNYA 4F0MA 2V5JA 2DZUA 2XFYA 1AVAA 1W2VA 3WH5A 1GEQA 3M0IA 1EGZA 1OC7A 4KQNA 3S1GA 4MWAE 4OGZA 5I2UA 2HE8A 1TV3A 1FWNA 4Y8FA 2EJAA 2POZA 1CENA 5FF0A 2ISFA 3OVQA 3ALFA 1XM3A 3MP3A 2QAPA 2BY1A 3MW7A 3VNKA 4ZZ9A 4A05A 1LDCA 3DFQA 4ATDA 3DX5A 3V1HA 4WGHA 4DLMA 4Y96A 5G2IA 5DF0A 3IVSA 3SEPA 5DCEA 1E0UA 5E9XA 1F6KA 3RUBL 3AUOA 1W5PA 1DOSA 1IT7A 4EPEC 2Q3RA 3R13A 3SCRA 3I10A 1QNSA 4GZ7A 4A8IA 4FOKA 1VFTA 1IXPA 4Z42C 1QI2A 3G6MA 2CBUA 1THFD 3WLPA 3WQFA 2CLHA 3VX1A 4UR7A 3HPXA 1GOXA 1XXXA 2EPLX 1M7XA 3RM4A 2Y5SA 1LORA 4HJWA 2FHBA 8XIMA 5G2WA 2YCJA 2B81A 2Q6ZA 1EBGA 3W37A 1VGAA 1WXZA 3SADA 4AWSA 4YXGA 1LUCA 2GJXA 1XBXA 1GVQA 4O17A 3MMWA 1VRDA 2CNCA 4JIHA 2BHYA 1K8YA 4XSMA 1EQPA 2YCLB 3CZGA 3B0UX 1OIMA 3P5ZA 5D2TA 4MZYA 2NWSA 5A8NA 3W7DA 1QVBA 3AMLA 2OQYA 4HN4A 3S0CA 3EOSA 2VGBA 3PULA 4B91A 4QQUA 4AIEA 4C90A 1QHPA 4MVAA 4JICA 1K9EA 3MZ2A 5CCZA 1H7NA 1H60A 3TAOA 1HJVA 3V0TA 4G7EB 2WZMA 2C91A 4FLRA 3S5YA 1T7LA 4IFOA 3URAA 3VKJA 1PDZA 3PPGA 4LCQA 2R82A 2CBVA 3HF3A 3MP5A 1X96A 2BXZA 4AD0A 4HSNA 1WP6A 1M7JA 2OLAA 2PDLA 4GXPA 4M1BA 2CCRA 5C9RA 2DVTA 1O5XA 3BLEA 3CO8A 3IAQA 3QFEA 4US5D 2XU2A 2QCMA 3RNDA 4O13A 2DP3A 3GQYA 3BLFA 4UFMA 3MDWA 1UQYA 1V08A 3TC6A 1LLWA 4J40A 5D2VA 3C3UA 4C6QA 3QV6A 3CS2A 5I3DA 1JPMA 3UCDA 3H21A 2J25A 1WXYA 2GSHA 1AJ0A 4AFYA 1RVKA 1PX8A 1UKTA 2OG9A 2XVKA 2Z1SA 3GBEA 4V27A 2ZVRA 1UZHA 5F2LA 4W8BA 1YHTA 3NO3A 1GOMA 1SW7A 4JN7A 1GPWA 1VBUA 2PDXA 1MWOA 3EWCA 2NLYA 1IE7C 1WO2A 2WQDA 1OZMA 4B5XA 4PUUA 2J7DA 4NNAA 4EF9A 2WNQA 2DZVA 4J3SA 1UIOA 3CEUA 5HXMA 3QZAA 1HIZA 3UZXA 2GPTA 4R27A 4UOJA 1EPVA 4L1XA 1VKFA 1D8CA 1RP9A 1H49A 1W3JA 5D09A 4WGXA 4ONVA 3HG4A 1SO3A 4YTTA 5BYWA 3USZA 1Q3NA 4H19A 4FALA 1OFAA 1LBLA 3PSWA 2VUNA 3A3HA 3VCCA 1LL6A 2AQOA 4DBWA 3H2NA 3GC2A 2CLLA 2WVTA 6ALDA 1WNOA 4R5EA 3FJ6A 1K70A 3GTXA 4ZSUA 1RSCA 1VHNA 2QEZA 4AZ5A 1POJA 3QLLA 3DFSA 1TR9A 2R1LA 1JCJA 2AGKA 3LLFA 5REQB 3TTOA 1Z42A 3C52A 2VKZG 3B8WA 1CB2A 3N19B 2PDPA 2W66A 1TZZA 2FPTA 3LCLA 3GLCA 5AYXA 5IFPA 4Y9MA 1GGOA 3CEPA 3GVWA 7A3HA 2QDEA 2D73A 2V6AA 2QW5A 3URQA 4Z2HA 3EOLA 1GUVA 3DYMA 3MV01 2OSYA 2VFIA 1CPUA 2ANUA 1HF6A 3P67A 4TVCA 2YIHA 1RCXB 3GDKA 1NM9A 3NXFA 4Z2LA 4GABA 2PGEA 1I60A 1FKXA 2VRKA 3W1MA 3WH7A 3QXBA 4GUJA 1V93A 2R91A 3PZVA 5T9CE 2WHJA 4GQGA 5CJNA 5DXXA 3W6MA 5HR6A 4DWSA 2IMRA 3QGKC 2VD9A 4NZ3A 1K8CA 2J7HA 3G1DA 3BURA 5HK4A 3TC7A 2NXGA 4XUYA 3SCOA 3FYPA 1CXHA 2VOMA 2PWUA 4ZB5A 7REQB 1XLEA 4C7GA 2EBNA 1GQLA 5CJ5A 1HKMA 3UWUA 1MFVA 4GIEA 3I7QA 4JDBA 1SU5A 4O12A 3UZJA 1Q7ZA 3JZEA 3TOYA 1W6TA 1I2NA 1LRNA 1LT7A 1L8NA 1TPFA 1XL9A 3E12A 4HMNA 3S83A 4KCVA 1YQ2A 2F8QA 2VWSA 3LERA 3SJ3A 4AZBA 1JI2A 5D33A 2GVYA 3K13A 2TSYA 5HMDA 4U10A 1ICSA 4WXZA 3CZLA 4O15A 2PC8A 1RR2A 3O07A 4XBKA 2WJDA 3R2GA 1D8WA 5A6KA 3NSMA 3ONCA 4WK9A 3FEQA 4MJZA 1E51A 1UWSA 3PAJA 3WF3A 4A3RA 1UR1A 5M03A 3BAIA 3TLLA 5H6HA 3VOGA 3W73A 2OO0A 3FJLA 4X63A 3W22A 1JZ3A 2JALA 4DZHA 4ADUA 2WZIA 1UP0A 4WVXA 3RF9A 4D71A 3V7PA 3VUPA 4LF2A 4RW5A 1X1ZA 2BFGA 1YNYA 4NZCA 1BKSA 3NQAA 3O16A 3QJAA 2E09A 1YE6A 4XAFA 4XAPA 4MNLA 3R8HA 1UZDA 3WYZA 2ZWYA 1LL4A 1MNZA 3WBAA 1YTDA 3RXZA 4X2RA 5JIPA 2ZX8A 5CQ1A 3E3HA 3MYPA 2FLIA 2NVCA 1DE6A 3WG6A 3TZNA 4R7JA 4HA0A 2GL5A 1DTNA 4W7VA 3WQCA 1J11A 2VM8A 5EL1A 4JTEA 1EJRC 1W0MA 2PP0A 4H9ZA 5IDZA 1JG9A 5EMYA 4LCSA 4F66A 2DSVA 4KEZA 2Z24A 3I65A 3NQ6A 3CMGA 5C7HA 1ZBWA 1FWDC 4FX8A 2ZC1A 1WOBA 4CVUA 2X16A 4NRSA 2Z2BA 1V02A 2OSWA 1XH2A 4MUZA 1F2JA 4R9OA 4IIFA 3UR8A 4CVWA 1UKPA 1HW6A 4F2UA 2VEKA 1L6FA 2J7EA 4BA0A 2CEQA 1JCXA 5J04A 1KBLA 2FVMA 3ALGA 3KP0A 3QMRA 2Y5EA 3QKZA 3ZSTA 1GQIA 6REQB 4C7FA 1NWRA 1SJAA 5FL1A 3FX4A 4DPPA 1P0DA 3W02A 3E0VA 3IACA 3VIJA 1DQXA 2QGYA 3CASA 1I1XA 2FTYA 3WL0A 1ZJAA 5D37A 4AXKA 1BF2A 2EGZA 3I3DA 5H91A 3EWZA 1XV8A 3SN4A 1V79A 4S3BA 3S6DA 4OFCA 1UP2A 3WLLA 3TYDA 2WMIA 1VFMA 3B4YA 4HNLA 1VP5A 1XBVA 3G8RA 1VPYA 3WLKX 3CWHA 1U30A 1F6PA 4HU8A 4EIVA 4DUVA 1TV2A 5AOUA 5BMXA 4QTGA 1EQCA 1DWAM 1OIFA 3VZYA 5EBUA 3PNUA 4ZO8A 5H1WA 2WMFA 4CUCA 2Q01A 2WKLA 1EO7A 3BGJA 4OBSA 4EAYA 3QFWA 3WMSA 1VJSA 3U7BA 1Q8AA 2PTDA 3GDTA 1KM6A 3B0YA 4IPNB 3S3GA 5D8WA 2QS8A 4JNZA 1S2VA 3WQ4A 4W84A 5G4EA 1Z41A 1J2WA 2PDYA 2PGRA 4LX4A 3R25A 2WV8A 4UCFA 1MNSA 4YL2A 2Z6IA 3GHUA 3W7KA 3UWQA 4RPPA 1W32A 1OCBA 2BVWA 2JKEA 3QR1A 1P6WA 1U1UA 4WR3A 2V69A 3NJ3A 5TNVA 3IVUA 2Y7DA 1XLLA 1G7VA 1LG1A 3KX6A 4QSFA 2YXXA 1IV8A 2XIBA 3ZR6A 4LRSA 1DBTA 4FK9A 4W9TA 2XVLA 2V82A 3CHDA 5KZEA 1M03A 3GR7A 3S47A 1N8WA 2WSRA 3UCQA 2WB5A 3N3MA 3KS5A 3B8SA 1AQ0A 1TPC1 4HOXA 4MOZA 3OG3A 1FWEC 2HPMA 5MKGB 3TN3A 5D32A 2W92A 3NL6A 3ZM8A 3M47A 1K7FA 3LLXA 1MVYA 1X38A 4AD3A 3TWAA 4GJIA 1TWSA 4JL1A 4O1AA 3K1GA 2OZ3A 5FA5A 2YPIA 1FHVA 1TR1A 1YPFA 4V15A 3WH9A 1WE5A 3WQVA 4Y9AA 2YW3A 4FXSA 4WQ6A 1H7PA 1HKKA 4RDVA 2ZX9A 3GS6A 3INPA 1OGBA 1EP3A 1JF6A 4JEJA 5LSMA 1ENUA 5A69A 1TV8A 5CPMA 4FO4A 2V63A 1T8QA 3DHDA 3PZUA 4PTWA 2FB3A 3G5EA 5A6SA 3MO4A 1J93A 2DT3A 3O6YX 2YLLA 4QDMA 3MU7A 3VKAA 2WJFA 4US5A 1UKSA 1P0EA 1RJQA 3FHAA 1XBYA 5L9FA 1AMKA 1W3TA 4GNKB 4XZMX 4MB1A 3ZT7A 1XRTA 1XLIA 1SZNA 4YCOA 2ZVIA 2IS7A 3AS2A 1UKQA 1V7AA 3AWNA 3D6NA 2Z1VA 3GU9A 3OEXA 3UPWA 5FJRA 1TMQA 4MUPA 2PE4A 1RCQA 4DX3A 4RDWA 5TBOA 2GZXA 1L6GA 4GKLA 3V0SA 2ISSA 4Y6GA 1H1YA 3QY8A 2VZUA 1L6SA 3VKBA 1F6YA 1I9CB 1SJDA 4H9YA 1E70M 4DUXA 1OX5A 1S5TA 1ZBKA 1VH7A 1Y8BA 6PTDA 3H2OA 1W54A 1MQRA 3LCIA 4TVUA 4BY3A 3TR9A 4A2SA 3HOJA 4GZEA 2ISWA 3VDGA 3H12A 4DO4A 2GVLA 4LVDA 3OJGA 4NJIA 3ARQA 3W2LA 1EX1A 2DVXA 4AHOA 1E1FA 4GCAA 1JYVA 2GQ8A 3VCNA 3PAOA 4RNFA 1G01A 5F2MA 4O4VA 3CT7A 1TTIA 3RPDA 1EGMA 1JR1A 3RU6A 2PD5A 3VD9A 1FBAA 2ZQ0A 1A5AA 4O54A 3BG5A 3RIKA 3N6JA 5LNUA 1W1VA 1H7RA 1FDZA 3TWBA 3BOXA 1V4YA 4ZFCA 3GDMA 1GQNA 1A53A 4ORMA 2EO7A 3MBFA 4S2CA 4N9EA 3QKEA 5CLTA 4RDYA 1KB3A 4YS1A 1TJ0A 2D0GA 4A4AA 3P62A 5AC6A 4ZVJA 4XTIA 4Y90A 1SZFA 3QBUA 3OA3A 1XISA 2OOGA 4BCEA 3QPYA 2ZZ1A 3KVLA 5ABFA 2OKTA 2Y88A 2IKIA 1Q6GA 1NOWA 4KIEA 1GJWA 4G2DA 2FVKA 1R87A 5F2GA 4U3AA 3MMTA 3ORWA 3LRLA 2HQAA 3VVGA 3N73A 2VWTA 3ENLA 1KWKA 5D2WA 1X6NA 4RPQA 4S3DA 4PMNA 3QQ0A 3O2LA 2VYOA 5AYIA 5M17A 3VZXA 3CPGA 4XKMA 5JIWA 4H7ZA 2G0WA 4Q4SA 1W8SA 4X0VA 5HWMA 5GNXA 2O92A 3TYEA 2VZOA 3V35A 1M53A 4JEQA 5EFFA 5BRQA 3W1XA 2UZ9A 1DIDA 1DL3A 3K1DA 1HVQA 1O95A 1KTCA 1QAPA 1V6WA 3AYVA 4MJ2A 2DZAA 2WSKA 2EPMX 4NZFA 3GG1A 1PCKA 1KTNA 2G3FA 1FDJA 4CNPA 1XS2A 3WBWA 2VP8A 2ABAA 4J2PA 4IWWA 3SRFA 1A5NC 4IUGA 3KBVA 1S5VA 2C16A 3BLPX 4DN1A 4OVXA 2O0TA 2B7PA 2IXVA 1CXFA 3HMCA 1A5BA 3W7EA 4Z2JA 3WUFA 4JQ1A 3F4CA 2PI6A 1D9EA 2OWXA 5HATA 3H8AA 2PDGA 3CLMA 1OJXA 4I9AA 2WVUA 4M8UA 4QNWA 4O52A 4ADSA 3U8GA <