5C54A

Crystal structure of a novel n-acetylneuraminic acid lyase from corynebacterium glutamicum
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
310
structure length
310
Chain Sequence
SATFTGVIPPVMTPLHADGSVDVESLRKLVDHLINGGVDGLFALGSSGEAAFLTRAQRKLALTTIIEHTAGRVPVTAGVIETTTARVIELVEDALEAGAEGLVATAPFYTRTHDVEIEEHFRKIHAAAPELPLFAYNIPVSVHSNLNPVMLLTLAKDGVLAGTKDSSGNDGAIRSLIEARDDAGLTEQFKILTGSETTVDFAYLAGADGVVPGLGNVDPAAYAALAKLCLDGKWAEAAALQKRINHLFHIVFVGDTSHMSGSSAGLGGFKTALAHLGIIESNAMAVPHQSLSDEETARIHAIVDEFLYTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase/N-acetylneuraminate lyase
publication title Crystal structure of a novel N-acetylneuraminic acid lyase from Corynebacterium glutamicum
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Lyase
total genus 118
structure length 310
sequence length 310
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c54A00
4HSOA 4GC4A 4OV4A 4EVZA 3DGRA 4DXVA 1H7OA 2ZRXA 3KAOA 1I45A 3P84A 4O16A 5DBUA 4PH6A 3BLIA 1JQVA 3O6DA 1A5SA 1O60A 1HG3A 2WSYA 3W75A 5D38A 2ZTKA 2TSYA 3W9ZA 1K03A 3M6YA 1AW2A 1KFBA 4Z0JA 5D2TA 2GPTA 4O28A 4YXGA 1QO2A 3IGUA 5F2GA 2X16A 1QOQA 1I2RA 3C4UA 1WBJA 2DZXA 5AN7A 3W86A 5AFDA 2FPYA 1SO3A 1KA9F 3EXTA 1TB3A 3IVSA 5LNVA 5DY2A 4JYDA 3P80A 4K39A 3LCHA 3S5OA 4IUOA 2QEZA 4U4MA 4IXHA 1TPB1 2PC4A 3FA5A 2W79A 4RXFA 5DXYA 2BSLA 5TIMA 4MY1A 4OBTA 3USBA 3C56A 4UTWC 3NEVA 3F4NA 2CLMA 3UWVA 3LXBA 4YCPA 4FF7A 5K7JA 1DV7A 3B8DA 2YDAA 4XKYB 3CWOX 3HG2A 4YCOA 1XI3A 2XN1A 4O1DA 3L68A 2QF7A 3HQ1A 4ZQMA 4LVAA 5I3FA 2GQAA 1O94A 5D30A 3CT7A 4N2YA 2Y89A 3WJXA 1ML1A 4MZYA 4I7VA 5CPMA 4HPXA 5CSRA 1TPDA 2WSRA 2ATSA 1LRNA 1OJXA 3GXPA 3PULA 3MP3A 2ZRZA 3B4UA 3TR2A 4UTKA 3S8HA 3P7YA 1PS9A 2RDWA 1HO4A 4NJGA 4IGHA 4JICA 5DLCA 1OX4B 1VGAA 4Y96A 3BO9A 1IXOA 2G5WA 2VEPA 3M1ZA 2B7NA 3S5ZA 3W1TA 3ZWSA 3TE9A 4H3DA 3HG5A 2ABBA 2ZA2A 1F74A 2WOQA 4TMCA 5BOOA 1QPQA 5G4WA 3ZFHA 2V9DA 1LRTA 1TPEA 5C6MA 1ALDA 4JTIA 4OQVA 3W7RA 2CLLA 1EP3A 1WOBA 3L65A 1EPXA 2DORA 3R12A 3W7IA 1THFD 2A6LA 1QDSA 2P1FA 3G1DA 4FO4A 3W2NA 1LBLA 3TC7A 1S5TA 1NF7A 2GOUA 3BV4A 1EWEA 4ADTA 3CM4A 1AK5A 4XTIA 1J4EA 3LV5A 4BF9A 3ATYA 2ATMA 4CQ8A 4UFJA 3NAVA 3LCGA 1JCLA 1GQNA 1W3IA 3OVPA 1ICPA 3DENA 4PL2A 4E38A 1JCJA 1OABA 4LT9A 5U7SA 4O17A 3C6CA 2CLIA 4O4WA 4NXSA 3IIZA 5LGZA 4IXXA 1RPXA 3M44A 5DBTA 3SIZA 3CLMA 1TCDA 5HUPA 2ISSA 4NXKA 4LNYA 4POCA 4FX7A 2ABAA 2JGYA 3O6YX 1A50A 4EWND 4FNQA 4NZJA 1OX4A 2A7NA 1WYIA 2Y7DA 3PM6A 4UTTC 4UUIA 3TDFA 3QPZA 2QAFA 3CC1A 3DKLA 1AL7A 3STFA 3W1RA 2PRMA 3MBDA 1A5AA 3HGOA 1HUVA 3PG9A 1JRBA 3P61A 4PEKA 1QO5A 3LHUA 1SO4A 3NPXA 1XDLA 5CPOA 3NR0A 2CZDA 1TPFA 2B7QA 2CLFA 5C54A 2OX1A 1KBIA 2VXNA 4LS1A 1S5VA 4CNPA 2BZNA 5KZEA 3M0ZA 2A5HA 3IRDA 5CZJA 4O52A 4O14A 4K6AA 3FOKA 2RKXA 1XL9A 3GDTA 2E5DA 3TMLA 4QNEA 1XUZA 2OJPA 2G97A 3LCLA 3DXIA 1TTQA 1W5QA 1F2JA 3A5FA 3BLEA 4EIVA 1C29A 5HR6A 2NUYA 1XBZA 5FF2A 3MP4A 2EHHA 2FPTA 4UMBA 3ZS4A 5HR7A 2GJLA 3W2LA 5BNKA 1TPC1 3F1QA 4NJJA 5D33A 1K7EA 2R8WA 1JUBA 2BXVA 2Y7GA 4MY9A 1GOXA 2FPVA 2GVJA 4P2VA 1BWKA 1JCNA 1D9EA 2QUVA 4MUZA 1LORA 3MI2A 1XXXA 3E9AA 3UWZA 1VYPX 3WJYA 2ALDA 1VRDA 3IVUA 3BGJA 3MHUA 4M6VA 1OYAA 3P8IA 3U6WA 3MHGA 3NG3A 4A3UA 1TQXA 4M19A 3MWAA 2VENA 3EX6A 4XBSA 5G4EA 3GX9A 3IIVA 3G18A 3H53A 1XUUA 4E2DA 1LOSA 2VFFA 2X30A 1IF2A 4OWGA 2GVLA 2QUTA 1OG0A 3W6YA 1Q3NA 1OYCA 3FJ6A 1K3UA 3QSRA 4EF8A 3W3OA 2C16A 4MLRA 5BMXA 4OE7A 1PHWA 5AHLA 5CZ0A 4ZQPA 4FNPA 5HWNA 1LTDA 1R30A 1Q6RA 1DOSA 3PUDA 4X3ZA 4FHAA 1QFEA 1ICSA 1NF0A 2X1UA 3W73A 4GUIA 2GQ9A 1OK4A 3N14A 4RX0A 4XTDA 3VKJA 4JX6A 1EX5A 3MUXA 2VEIA 3L67A 1GJPA 3NQFA 4BR1A 3PSVA 2C15A 5HNRA 4DF2A 2HMCA 4YMZA 1ZENA 3M9YA 4R7JA 2CWNA 4RZ6A 3TC6A 5D2VA 1FQ0A 3QEZA 4JTHA 5KSWA 3FS2A 3MP5A 3R8RA 1ZY9A 3P74A 2HS8A 3QW4B 3W1MA 4O19A 2E5BA 4CNOA 1WOAA 2E09A 5FEXA 1KV8A 1MEIA 2PE4A 3HPXA 4YL2A 3KVLA 4CCCA 4CCDA 1QPOA 1GPWA 3LBCA 5LNWA 3INPA 1P0NA 3FIGA 3QYQA 4K36A 2DJLA 4A2SA 3NQ7A 5IBXA 3UPBA 2E6DA 1KTNA 2FTPA 3I65A 1YYAA 4IOTA 4Y90A 4AEOA 1JUEA 2ZRVA 2ZYFA 4K7VA 4UTUA 1TIMA 3PB2A 1QCWA 5HQEA 3BARA 1X1ZA 1VYSX 4WZHA 4N4PA 3HIJA 1JCMP 3UXAA 5LNUA 3QQ0A 3KXQA 3H55A 1NVMA 4FNTA 2RDTA 3O1NA 5HMSA 1RD5A 3LHZA 2JKAA 3M41A 3M7WA 3STCA 1DQXA 4IWWA 1MO0A 5HWJA 3U8GA 3DFTA 3S0CA 3EWUA 4CNNA 4JDBA 2DZSA 2VOMA 1SO6A 4DBEA 1GVFA 3HF3A 5KZMA 1K8XA 3PG8A 4WXZA 3TUUA 2Q8ZA 1UUMA 1VZWA 1WDWA 1YXYA 5AC8A 3FLUA 3AO0A 3QJAA 5F1VA 5FEWA 4UFHA 1YPFA 2D73A 2X1RA 2NX9A 3PSWA 2ZZ3A 1WX0A 4NX5A 4LC6A 5D09A 3UD6A 1GZGA 4NU7A 5D2XA 4HNNA 1RZMA 2Y70A 3KFTA 1VLWA 2NV1A 1TJPA 1S3HA 2FB3A 1KM5A 4BWLA 3PF3A 4FNUA 2E6FA 2Q3RA 3YPIA 4JTEA 4MJMA 3R13A 3G8EA 2A7PA 4O8RA 4GXMA 1IIGA 4OU1A 2QCEA 2QR6A 3KRSA 1VLIA 4HHPA 1G4PA 1LBFA 1Q45A 4NZFA 3DFNA 1B4EA 4C1LA 6TIMA 3S6DA 3HGRA 1PCWA 4NNCA 2Q3OA 4S1FA 3P67A 1LZOA 1P1XA 3NPVA 3N19B 5KINA 5K2ZA 1KV5A 1ZALA 2NXHA 1KLYA 3R2GA 2E6AA 5K9DA 4YLWA 1O95A 3TIMA 4K8HA 2E5CA 2YYTA 3KVKA 1TTJA 1EWDA 1JCYA 1PIIA 5DELA 3NQDA 3I6RA 4WJEA 3NGJA 1W56A 4HNUA 2FDSA 4GUJA 1L2UA 2ISVA 3LI1A 1JCXA 2DZVA 3W1AA 2CU0A 3HB9A 4LS0A 3TXVA 4Z1CA 1PE1A 1TMHA 4UMCA 2G95A 2QCHA 1KTBA 2QCFA 1R2RA 1VYRA 3TQVA 4M7TA 3NZRA 4BK9A 4G1KA 4DF0A 3EXRA 3W87A 2YGYA 4UMAA 1KFEA 3KOFA 4IX0A 4XWUA 4LS2A 4UIOA 2PRLA 1L9WA 3NQVA 3A23A 3HOJA 2Y85A 2C1HA 3IVTA 4DBDA 1QMLA 1QOPA 3CIXA 4GUHA 3DI1A 4QSHA 3OBKA 3W76A 3W22A 4CCEA 1UUOA 4R33A 4WQ6A 1FWNA 4MJZA 3N9RA 3WK3A 2GVGA 5C55A 4AWTA 1YPIA 6ALDA 3GLCA 3ELFA 3LRKA 3SECA 4BI6A 4JDYA 4WOZA 1TV8A 2BTMA 5D02A 4I7UA 4ADUA 4QIUA 2V8ZA 4RCXA 1RQEA 3NO5A 3L0NA 3O16A 2VEMA 3BPWA 1P0KA 1SO5A 4Y6GA 3UWWA 3GK0A 5D2WA 4X9SA 4MVAA 2VEKA 1LBMA 3E49A 2ZDRA 4QITA 2VFDA 1ZNNA 1HTIA 3T44A 3A9IA 3W2UA 1R2TA 5FEZA 3W84A 4Z1AA 5AYXA 3QMSA 3I7SA 1Z48A 3L5MA 1EB3A 4O1CA 1F76A 2YSWA 4WXYA 3UY7A 3RLUA 4M5PA 1FCUA 1EUAA 1G7VA 1JR1A 2EAWA 3BVJA 4AH7A 1VS1A 4MKNA 3OA3A 1UASA 5HULA 3IV3A 1GTEA 2P10A 1N8FA 3UYCA 1W1ZA 3R89A 4DEFA 3LI0A 2V5LA 4LVBA 3PY2A 3M16A 4JNMA 3T7VA 4HN4A 1Z41A 3W7JA 1H7XA 4WD0A 3W7HA 2DZUA 1G6CA 5CZTA 3EWWA 5D32A 2C19A 3WJSA 4TU1A 4O1BA 3I7QA 3SY5A 3T55A 3VE7A 2FJKA 1T96A 3BG5A 5CPLA 4GFSA 3OEXA 4WY0F 2J9ZA 3NL3A 1H50A 1GT8A 4Z0SA 4NJIA 1FWWA 1IIHA 4N4QA 5SWUA 4GJ1A 1DKWA 3W70A 2XN2A 2EF9A 3L2IA 5DCBA 3LV6A 3BG9A 2ZCGA 3M5XA 1AG1O 3GDKA 5I3IA 3IIOA 3FFSA 1VPXA 3IGSA 4A22A 5F1UA 4MYAA 3NQAA 1WXJA 5F2IA 4UNLA 3LLDA 4NNAA 5I3KA 2H90A 4O15A 4ZL1A 3GYEA 2AQWA 2ZTJA 4UTWA 1DVJA 4CQAA 4LOCA 3TFCA 1IXQA 2V82A 2KZHA 4H6KA 3DHDA 1DORA 4AAJA 1GTHA 3BK0A 4JY9A 4FIRA 4QAIA 4GNJA 1H1YA 3TJXA 3DFPA 3LCFA 1CX9A 3KRUA 5I3JA 3Q37A 2PCQA 3G1HA 1OFOA 4N9DA 5F4SA 1FX6A 5DCDA 3R5EA 2VELA 3O63A 1QR7A 2WNQA 3PBWA 1JJKA 3PAJA 3CB8A 3G1AA 1WBHA 1OFQA 4MIMA 4S2BA 3NQGA 4HIBA 3G1SA 5LNSA 3KRZA 4JX4A 4KFNA 4K8EA 3N2MA 3TNOA 2ZBTA 2A21A 3NL6A 1EEPA 2QCDB 1K02A 2CW6A 3DBPA 3MHFA 1ICQA 4WY0B 5AC7A 3QMTA 3TCEA 2WNZA 3TSBA 4WX2A 3W7QA 3PWAA 2ISWA 3NQ6A 1TPUA 3CU2A 3JS3A 3QSTA 2QKFA 4UTIA 3H54A 3B0PA 3JRKA 3MI3A 4RR4A 3VFLA 5AB3A 3WJWA 4DO6A 1YDVA 1L6SA 4HT3A 1OFRA 3VI2A 2RH9A 5FEPA 2V2HA 5ABTA 4MPQA 1B3OA 4IMFA 3TXZA 2QJIA 3TK7A 1SW7A 2NX1A 1FY6A 3N3MA 5EMUA 5G1TA 4Z1BA 1ZAIA 4D2JA 3C2OA 3TW6A 2I9EA 1Q6OA 3HJZA 3GAYA 3PUOA 1SQ7A 5D04C 2FQIA 4Z08A 2A0NA 1JQXA 2WNNA 5EL1A 3TROA 1W31A 1I2OA 1F5ZA 2O7QA 3W1UA 5K4ZA 3V75A 3BW3A 2OT1A 1R47A 4JTJA 1UBSA 1B4KA 3GVGA 1TPWA 2I14A 1OHLA 1G4TA 3PUEA 3W7PA 1K8ZA 3LERA 3GIYA 3C52A 4JTGA 5TQLA 4TO8A 1YTEA 2QCDA 3QQ1A 1EIXA 4FXRA 3EX4A 3DAQA 4WY0A 4FB7A 1SZNA 4JTLA 2QUUA 3W2JA 2VFIA 2OT0A 2B7OA 3TV8A 4K37A 2WSQA 4RZ5A 2QCMA 2F7FA 2H6RA 3STEA 1UCWA 3OVRA 2Y61A 1PL9A 3K30A 4ZQNA 2EGZA 2YPIA 4UTTA 5KMYA 3EKLA 1BEUA 1FXPA 2ZRWA 2NXIA 3L66A 4GE8A 1ZCOA 4PL1A 3EXSA 1KM4A 2BWGA 3VCRA 1PCKA 4JXCA 4QM1A 4HNTA 4HKPA 4RK8A 5J5RA 3LHTA 4A29A 3NZ1A 3TX9A 3UWUA 3E02A 1Y0EA 3P5YA 1U83A 3NDOA 3SGUA 1TSIA 4FX8A 3LXCA 3CTLA 1Z44A 3W23A 5LGXA 4ZQCA 3LRMA 5I3HA 5EPDA 1KM0A 1OK6A 3MYPA 2JKPA 1YXDA 3DFOA 1YTKA 3OHIA 3KVMA 1VCFA 1I2QA 3S5YA 3UWYA 2QJGA 3A24A 2Z2UA 3G24A 4DF1A 1CI1A 4TIMA 4IPJA 1MEWA 1WQ5A 1PVNA 3N2XA 3TH6A 2J6XA 1T99A 1YLVA 3NQ2A 1ME9A 2A7RA 5G1YA 4PFMA 4I9AA 3LCIA 1KFKA 1W5OA 4JEQA 3GR8A 5K9CA 5LNRA 4TMBA 3EWZA 1FDYA 1VQTA 3QPYA 2YFOA 5H2ZA 4ZVJA 3TW7A 3KVJA 4ZQRA 3EWBX 4JIPA 3B05A 3I7RA 2E68A 2R91A 4PTNA 4XUGA 4M7SA 2W0UA 2ZA3A 5GVJA 3ZWTA 1AW5A 3QMRA 3QC3A 1H7RA 1OFDA 3W7KA 4J9JA 5AHFA 1M7PA 4LRSA 4IPIA 4JR5A 1LDCA 3EEGA 2H3BA 1DJNA 1F6KA 1LP6A 1RQBA 3N73A 3T78A 4XBKA 1RQHA 1RV8A 7TIMA 3W7OA 2CLHA 2QCLA 2Z6IA 2ZRUA 2ZZ2A 3TA6A 1GG0A 1D3HA 4O13A 3HGSA 3L5AA 1SZFA 3M5VA 2NUXA 3RMJA 3IEBA 1X8FA 4IMGA 3G0UA 3W71A 3SJ3A 4Y9AA 1OFAA 1SW0A 3G1YA 3W2MA 3MI6A 4PODA 1N7KA 3G3MA 1R46A 2R14A 3S42A 1M7OA 1OFEA 3VE9A 4RJEA 4AVFA 1GYNA 3WK0A 2WPBA 4ZQOA 2WJZA 5U4NA 4MY8A 2EPHA 5LZLA 3S9YA 1NAL1 2CFFA 4LW7A 2C3ZA 4AF0B 2PRHA 3PS7A 3W72A 3PVFA 3NQCA 2B7PA 1GVSA 2JK2A 5I3GA 4KKXA 4E2BA 1P5BA 2Y88A 1AL8A 1ME8A 3N34A 3Q58A 1MSSA 5L9FA 3G1XA 1LM1A 1LLZA 3O06A 4O50A 2QCNA 4PC8A 4CLMA 1K7XA 5F2MA 2V81A 4I7WA 1UJPA 5HUOA 3EWYA 2FLIA 5CZSA 1TYGA 1AW1A 1HO1A 2V2CA 2ZZ4A 3S1UA 1KFLA 8TIMA 1YADA 1OFBA 2VFHA 3PBUA 2QJHA 3F03K 1TTIA 2V2DA 2GQ8A 4NJKA 1KM6A 2NV2A 4NT0A 1QWGA 1FWSA 1EUNA 2ZQ0A 3HBLA 1ZAHA 1PHQA 4FNSA 3LB0A 4XZ9A 3G0SA 2TMDA 3GNDA 3STGA 3SGZA 3NQMA 4Q32A 4JIQA 5D03A 4AXKA 2C14A 1YTDA 3DZ1A 4KWWA 3ZR4A 1TO3A 3C8FA 3S1VA 4FX6M 3GB6A 5J5DA 1KM3A 3NM1A 4AF0A 1O5XA 3M43A 3VNDA 5LHFA 3NM3A 1SZGA 1C8VA 3O6CA 3A22A 1G4SA 1ADOA 3QFEA 3THQA 4HPJA 3WJZA 4N6FA 3QM3A 3W7NA 2OMAA 3W7GA 5KTLA 2ZZ1A 3W85A 3C2FA 1EP2A 5LKYA 5C2XA 4IMEA 4OV9A 4A21A 2I1OA 4NX0A 2QAPA 2CZ5A 3NYZA 5G2HA 4N9EA 3WFAA 5D05A 1O4UA 3SSJA 3AJXA 4OT7A 1XBXA 3FKKA 5KITA 4RZ4A 2J9XA 3HPSA 3QF0A 3P60A 1M5WA 2X1TA 2Z0IA 4HNVA 1G67A 4N02A 5EKYA 1ZAJA 4UFIA 1W5MA 1H61A 5AYYA 4ADSA 2YW4A 2YW3A 3IIPA 1QPRA 1EA0A 1VHNA 3DI0A 2CZFA 4K38A 2TPSA 1XFBA 1LROA 2RFGA 4AHOA 1TTPA 3W1NA 1ONRA 1H7PA 3G3DA 1I2NA 3MMTA 2GUUA 5EY5A 1XM3A 1GVOA 1DQWA 1KBJA 3M47A 2QDHA 1DBTA 4UTLA 3P81A 1QPNA 1B9BA 4JX5A 4UCGA 1FWTA 3NPWA 5CGQA 4LU0A 4E0CA 4AHQA 3LCWA 3P5ZA 4O18A 2WV8A 1OYBA 3DH7A 4MLJA 5HJLA 5HINA 2YZRA 2V30A 3FYOA 3L0GA 4M6PA 4O57A 3CHVA 1SUXA 4EOUA 1I2PA 1A5BA 1OF8A 1W8SA 2C6QA 3FYPA 5AHIA 3ABQA 3B04A 5AOUA 4JTFA 3SR7A 2A1YA 2Y62A 4O1AA 3DFQA 4ORIA 4NJHA 4WUIA 2NWSA 3UPWA 1I4NA 3I68A 4N9BA 4LRTA 3W1PA 2XFWA 2FIQA 1TV5A 2W6RA 1X6UA 1G69A 2X1SA 4X2RA 1JVNA 3E96A 1TJRA 1OF6A 3LOTA 1ZFJA 2Y63A 4NVTA 3PB0A 3QZEA 1IXPA 2NXGA 4N9CA 3NPUA 1TQJA 3BW4A 3M5YA 4LV4A 3C2EA 5G2WA 3N9SA 5F4WA 5K4XA 1HFBA 4JTTA 3W74A 1GYLA 4ICNA 2ZRYA 1MZHA 3UQNA 2O7SA 4GUGA 3TMQA 4LY8A 3NOEA 1F6PA 1GG1A 1ZHAA 1GEQA 3TAOA 5AC6A 3OG3A 4O10A 3G8RA 3A5VA 5T26A 1SZEA 3RLVA 3W7LA 3T4CA 3G1VA 3L9CA 2YR1A 4C1KA 3FKRA 3ABOA 5E0KA 4LV9A 2C0AA 1FCBA 3HMJG 3GNNA 3UZJA 1D3GA 3UZ5A 5BW6A 4AWUA 4MZ1A 1A53A 1W3TA 3S5NA 5G2IA 2DZPA 1ME7A 4KFPA 2YCEA 2BX7A 2LLEA 4ONVA 3HGJA 1KLZA 4LTSA 5K3VA 1W54A 2OCZA 3IGXA 3OVQA 2V5BA 1JUKA 1H62A 3NL5A 4IMCA 3UY8A 5FI8A 1GWJA 3BLFA 1DJQA 3IIXA 4LUIA 3TU9A 3EX3A 4BFAA 4N6EA 3NQEA 4XKYA 2DJXA 3PR2A 4DELA 2RHGA 1H7WA 1DL3A 4LVFA 2TRSA 3NL2A 4BI5A 3L5LA 3UWQA 4UTJA 5MHBA 3W1XA 2F84A 1LOLA 2ZFAA 1WV2A 1OX6A 1FCVA 4JYFA 2Q8LA 1OFPA 3TKFA 2VFGA 3QH2A 1FCQA 1KTCA 3G1FA 1OX5A 1BKSA 2A85A 3TFXA 5HWMA 3DFSA 4GWEA 3RF9A 4O11A 1NEYA 5FF7A 3GKFA 2AGKA 2WKJA 1VH7A 1H51A 1SU5A 2YYUA 2VC6A 3CEPA 1LLWA 3GXNA 3O05A 3B0VC 1SSGA 1AMKA 1SFLA 2YX0A 4TX9A 3HPZA 1SSDA 1V7YA 4EF9A 3E0IA 1J5TA 4K7YA 4GBUA 1G4EA 4AHPA 3W88A 1S5WA 1TV7A 5E93A 4OHQA 3ATZA 2CZEA 2WQPA 3C3NA 5AHEA 1W5PA 3Q94A 4NQ1A 1R2SA 3NNTA 3WK2A 4FNRA 3MBFA 3THAA 5CPNA 4L4LA 3RFAA 3LGEA 1W5NA 2QDGA 1C9DA 3QW3A 3T40A 4S2CA 5CSSA 3C61A 1A5CA 5A8GA 4U28A 3LXAA 4JY8A 4UR7A 3M5ZA 4PA8A 3SFKA 1KFCA 1SW3A 2Y7EA 2Z1BA 3GAKA 1KW1A 1J2WA 4DPPA 2AAMA 2XN0A 5FF3A 1M6JA 5K9XA 3EKZA 3B0UX 4UR8A 2QCGA 5EYWA 3GR7A 2B4GA 4NNBA 3V1PA 1PV8A 1L6YA 2NZLA 3B03A 5DXXA 5EA9A 4AB4A 3LTSA 4RXGA 5FESA 2DZTA 2H8ZA 3GXTA 1GVQA 1W37A 3HG3A 4GUFA 4UNKA 4UXDA 4QJ1A 3S1XA 1IXNA 3P8JA 2A6NA 2V0TA 1ZJIA 3W1QA 2DU2A 1Q6LA 2JKEA 4UTHA 1MEHA 2R94A 2CLOA 4L4MA 3Q2DA 3B06A 2B0MA 3RK8A 1MXSA 4P61A 2ZZ5A 3KX6A 3TJLA 3P62A 4JYEA 5C5YA 3NVTA 2H3DA 1YDNA 2JBMA 3W7CA 4OGZA 3F4WA 3KHJA 3LBMA 1NSJA 3MO7A 4RLIA 4NUWA 1VCVA 3S1WA 1H5YA 5IBXC 1SFJA 5DCEA 1V5XA 2DZWA 2Y6ZA 4IX2A 5L6UA 1GVRA 3ABSA 3D0CA 3UXDA 3ABRA 4PCFA 2ZZ7A 5IM51 3G22A 2JGQA 3O15A 3NQ8A 3W07A 4DQWA 3C0JA 3CQ0A 2Z6JA 4JTKA 2EKCA 4IQLA 4XQ6A 2C18A 4RV8A 4O0KA 2RDUA 1KFJA 4JGDA 4QISA 3TQKA 2BLEA 4QQ3A 1F05A 3LLFA 4IJBA 3LDVA 4MOZA 3CWNA 3MYOA 1X1OA 3MW7A 1FBAA 1VCGA 2NLIA 3NXFA 2A4AA 1TPVA 2ZA1A 1RVGA 1FWRA 5H91A 4O12A 3BW2A 4M6QA 3EB2A 3O8AA 1K8YA 1WA3A 4RKAA 2IQTA 1L6WA 2HSAA 1DHPA 1G7UA 4R53A 3SZ8A 3LM7A 4O53A 1YDOA 1JULA 4ORMA 2GJNA 5AHMA 1XBVA 1LYXA 2PURA 1TPH1 4JN6A 5FF4A 4BI7A 1HL2A 2ZZ6A 1CW2A 1XBYA 3MJYA 5DY3A 4JTUA 1K7FA 3LCXA 1XCFA 1XKYA 4BWLC 4UC5A 5KZDA 3BGGA 3G0XA 4O54A 4H4IA 1TREA 5DN1A 5BRBA 4CQ9A 2VFEA 1FUYA 4UFLA 1VC4A 4DO5A 3GZ3A 2NWRA 1SR9A 4LVGA 3NA8A 4R34A 3EX2A 1LOQA 4FXSA 3W7MA 2QCCA 4LC8A 1H7NA 4GRSA 2A2IA 3GDLA 3GDMA 3OIXA 5AYZA 3W1LA 3GKAA 5EBUA 2J27A 3A21A 1F73A 5CKSA 3EX1A 1T8XA 1T0OA 2TYSA 3U2OA 3RNDA 1I8JA 1NFBA 1N55A 1H63A 2J9YA 4O0ZA 4Y8FA 4Q4KA 5LSMA 1BWLA 4JTSA 2NUWA 3PBVA 1VJIA 3CIWA 3WK1A 2CLKA 4LVDA 3QRHA 1BTMA 3EWXA 1QNVA 3C2RA 4Z1DA 1UB3A 2YXGA 3SW6A 4MYXA 1FDZA 3CPRA 2G96A 4DPQA 1P4CA 1U5JA 1H60A 1KM1A 4FEZA 5A5WA 1RR2A 5TBOA 4ZMGA 4LUJA 3TQ0A 1WAUA 4JD4A 2E6YA 4X22A 3LTPA 4MZ8A 1O5KA 2C13A 4IMDA 3W83A 1FXQA 2E77A 5D37A 3L21A 5D2YA 3HG4A 1TRDA 4TR9A 4Q33A 3LHWA 3W7DA 4MFEA 2X2GA 1TRIA 3CEUA 3LTYA 1FDJA 4HSNA 2E1DA 4LWWA 5AHNA 3L0KA 2WO5A 2FFCA 3TSMA 1JRCA 4ZZ9A 1KM2A 2VKZG 2FB2A 3O07A 4A2RA 1YXCA 2J24A 4W9TA 4KWVA 3W7EA 4O4VA 2YFNA 4FIQA 3P82A 4DO4A 5LHEA 5F4XA 1EP1A 1XDMA 2P0OA 3BG3A 2HTMA 1W3NA 4AWSA 5F2LA 4ALDA 1QAPA 1W0MA 4ML9A 3W2KA 3DHFA 4UTMA 3ANYA 1OVDA 1E51A 2NX3A 3FJLA 1VR6A 2Y7FA 4MFDA 5E1QA 2UV8G 5CG7A 3UNDA 4KFOA 3DU0A 3E12A 4JS3A 1IGSA 1XC4A 2H8XA 2DP3A 2CLEA 5FF0A 3TAKA 3LX9A 4YWIA 3JR2A 3DKJA 4WOQA 1SPQA 3GDRA 1H1ZA 3PC0A 4AMAA 1LRQA 3PBYA 4UFMA 2HS6A 3RU6A 2J88A 1LCOA 5BMWA 4UFKA 3TSDA 1Z42A 3C2VA 3LHVA 4B5NA 1X7FA 5G5IA 1B57A 3LHYA 1Q6QA 3LRLA 4QNWA 3HO8A 1VHCA 2OZ0A 1F7BA 3FEMA 3SI9A
chains in the Genus database with same CATH superfamily
3LA4A 5HPCA 2VRQA 2OQLA 3UJRA 3W81A 4DXVA 2X1IA 2CITA 3KAOA 3VZXA 4O16A 5DBUA 3B9EA 1JG9A 2DW6A 4ATDA 1LUCB 3W75A 4CU8A 1ECEA 5C9RA 4PUDA 4R9OA 4Z0JA 2W67A 2IPGA 5F2GA 1H3GA 2ZX7A 3AMGA 3T6CA 4JN8A 2W92A 2DZXA 2Y8UA 2UBPC 3EXTA 3WDQA 1VEPA 3IVSA 5LNVA 5DY2A 3P80A 1CXEA 4JFSA 4HCHA 1J9YA 3HV8A 2PD5A 1E6NA 1REQA 4GD0A 5BWFA 4S3GA 2W79A 1F3TA 2R1NA 4RXFA 1P7TA 2BSLA 3MZNA 5E0CA 5C9XA 1R87A 3WLHA 1XH2A 4OBTA 4IH3A 5FJTA 2CLPA 4Y9MA 3MTWA 4U5IA 3C56A 3V16A 2EQDA 2VDIA 2YDAA 3VVGA 1XSIA 1J0ZA 3MCMA 2XN1A 3B0YA 3LD5A 3HQ1A 4ZQMA 2PD9A 5I3FA 2OSWA 3H2MA 1O94A 3CT7A 4N2YA 1UD4A 2FVKA 1GOWA 5CSRA 2ZUWA 1KKRA 3IJIA 3K4AA 3BGAA 2NW0A 3PULA 4HZ6A 3B4UA 3GFZA 1R9XA 4UTKA 3P7YA 1FH9A 1ESWA 1HO4A 3WUFA 3APTA 3VGGA 4UQ9A 5DLCA 1VGAA 2YB4A 4AZ5A 4AUBA 1IXOA 4WKHA 5HJYA 3GIQA 4PUNA 1V51A 4ZENA 4J3XA 3W1TA 2YZ5A 2PP3A 4L80A 3OYXA 3TE9A 1GQIA 3HG5A 4O8AA 4TMCA 4Q8PA 3WNKA 5G4WA 4J1OA 2YA1A 5TNVA 3NQBA 3WQDA 3SEPA 2CLLA 2VURA 2VOTA 1THFD 4FO4A 2OYMA 3TC7A 4B4HA 1NF7A 3BV4A 1EWEA 4NZCA 4Z2LA 1J4EA 4BF9A 3ATYA 3WDPP 4UFJA 1GQNA 1ICPA 5EMKA 3DENA 4PL2A 3AUJA 3HQPA 3M0MA 3QGAC 4O17A 2CLIA 2CETA 3I6EA 4NXSA 2XM1A 5LGZA 4HA1A 1RPXA 3TOYA 3M44A 1WDPA 3IAQA 1BGGA 4LNYA 3CO8A 4AZ7A 1NDWA 4FX7A 2JGYA 1A50A 1DJIA 1JD7A 2A7NA 3RGTA 1NWRA 1WYIA 2C1GA 3SCQA 3BZGA 2XFFA 4O1FA 1JF6A 1JAEA 4H8UA 1AL7A 1KRAC 3W1RA 2GGJA 3FJNA 2OXNA 4S23A 1HUVA 2GWNA 4WSJA 3THDA 3KEHA 1BQGA 3RMEA 3MMDA 3V1HA 2P76A 5CPOA 4IMAA 1XFCA 2EG6A 4GI4A 5B80A 3VGFA 2CLFA 1Z3NA 2OX1A 2VXNA 4GCAA 4CNPA 2BZNA 3WCZA 5KZEA 2A5HA 3GUWA 4MHBA 2QMJA 2RKXA 4KESA 2E5DA 4QNEA 3BMXA 4W7VA 4FP1A 1W5QA 4NILA 2Z24A 1LQ2A 2E9BA 5I03A 1XIDA 4GYKA 4H9UA 3C2YA 4U33A 5HR7A 4F40A 1TPC1 3K8MA 2R8WA 4MY9A 3QGVA 2YL5A 2GVJA 1DWAM 5DQPA 3VO0A 2QUVA 5HJXA 3VA8A 4MUZA 3TW9A 3E9AA 1IZKA 4MKSA 2ALDA 4M6VA 3MHUA 4E2OA 4ACZA 3PZNA 2J47A 4ZE4A 1LQAA 3NG3A 4RV3A 2VENA 3EX6A 3DC8A 3U2ZA 1UC5A 1PZ1A 1UR1A 2YCIX 3GX9A 4JNYA 2PDYA 3G18A 5DF0A 4F2TA 4E2DA 3ZT7A 3EDKA 2X30A 1IF2A 1WZMA 2VCCA 4MB5A 4X2PA 3FVDA 3WMBA 1WNOA 3WLIA 1K3UA 3W3OA 4MLRA 3SB0A 5CZ0A 1FVPA 2DIEA 5HWNA 2XVNA 4E3TA 1DTNA 1R30A 1Q6RA 1DOSA 4FHAA 9XIAA 1QFEA 3AROA 3NGFA 1NF0A 2A79A 2GQ9A 3BCJA 3N25A 2IPJA 2NVAA 3CQHA 2WBKA 4I9TA 1QBBA 1G9HA 3ITXA 3I3BA 1LL6A 1J11A 4GFIA 1ZENA 2X05A 3FVMA 2VR5A 2REQB 1UUQA 3TC6A 2OX4A 1FQ0A 1LL4A 3K4WA 1CXHA 3GS6A 1ZY9A 3GVRA 3FA3A 4CQDA 4MTVA 3K1DA 1VFUA 4UOZA 1QOXA 1WOAA 5FEXA 1XD1A 1ISZA 2PE4A 1LL7A 2YDRA 3GNRA 3RHGA 1J0HA 5LNWA 1B1YA 2F6KA 1K77A 3UPBA 1A3XA 2E6DA 5BXTA 2FTPA 4RE3A 3I65A 4Y90A 4F0MA 4AEOA 1QCWA 5HQEA 3QPEA 3UXAA 3UF9A 3K8KA 2DSKA 2OKTA 3H55A 3DYPA 3EZ4A 4QXIA 4W84A 2G3JA 3B8SA 3CUJA 3M41A 4S3AA 3VM5A 5A6BA 3STCA 2PODA 1JZ7A 3CS2A 2FZBA 3U8GA 3HTWA 3S0CA 1PKYA 4JDBA 1E56A 1SO6A 3ENLA 4DBEA 3O0KA 4S3CA 4PMVA 3PG8A 4WXZA 3AXXA 4L1GA 1TUFA 2G50A 3TUUA 5CAKA 1W2VA 2XH2A 1VZWA 1DIKA 6TAAA 3VIIA 3KTSA 1E1CA 5F1VA 3WMCA 5FEWA 1UR3M 3U4AA 3SJNA 1TWIA 2NX9A 1UZDA 1IYXA 3ZSTA 3SCSA 4C6PA 2ZZ3A 1WX0A 3P0XA 4GISA 4NX5A 3KFTA 2GJPA 4QG9A 3S1GA 1PEZA 3E5BA 3BL3A 4BWLA 2VR2A 4JTQA 3WG6A 2INZA 3R13A 2ASHA 4O8RA 4Z2HA 2QR6A 4HHPA 1LBFA 1RY8A 3IRSA 4C1LA 4UQCA 1UH3A 3HGRA 1PCWA 1POJA 3C3UA 3PBMA 4H9XA 4TVCA 5JIPA 2Z4GA 2GL5A 1Q85A 1RLCL 3O3RA 3UXKA 3NPVA 8XIAA 2Y5JA 4GYPC 3N19B 5K2ZA 3MWCA 1KCLA 1KLYA 3GD6A 3R2GA 1X38A 4YLWA 1MW3A 3WQ6A 3OOQA 1MFVA 4JQ1A 3C86A 1KR1A 4G9PA 1PIIA 4AIUA 3NQDA 3I6RA 4JTRA 4RDWA 3CV1A 4WJEA 3T0AA 2FDSA 1Q65A 1LWIA 3UVAA 2VC5A 2VMFA 3GYCA 4LS0A 1PE1A 4R5EA 1PO9A 4GABA 2QCFA 5EMYA 4ZGYA 1JYXA 2O4QA 2A3CA 4DF0A 3EXRA 1PKLA 5AC4A 4ZOAA 3Q67A 2DT1A 4UMAA 3VC6A 1F4AA 3AI0A 1PUDA 3AXKA 4UIOA 3MSYA 3IVTA 1I60A 4KT2A 3IUDA 2OB3A 4QSHA 3UR2A 3FHQA 4BQ2A 4CCEA 4U2ZA 4R33A 2YL6A 1K6WA 3GHUA 3A4WA 3N9RA 2PLCA 3R79A 1ODUA 1Z69A 5C55A 4GX8A 2WVTA 3QOMA 6ALDA 3LRKA 1KGXA 3SECA 4BI6A 4JDYA 3JZEA 4WOZA 2BTMA 1PXGA 3B4YA 3OGVA 4DI9A 4QIUA 3NO5A 3L0NA 3O16A 3BPWA 2VEMA 1SO5A 3MVIA 3SQLA 4X9SA 3P2VA 5CXPA 1KC7A 4RE0A 3E49A 2BHUA 4QITA 4PBFA 3TN3A 3ZXWA 1HTIA 3A9IA 4I5UA 3GG1A 1R2TA 4CU7A 4WGHA 3PJWA 4PMNA 3W84A 2J77A 1A5OC 4FSAA 4W87A 1ZGDA 3CUZA 2YSWA 3IJQA 5GJPA 4KIRA 4ROQA 4XD5A 3ARPA 1JR1A 1VD6A 1AJZA 3PPHA 3LZ5A 1QHZA 8RUCA 1W1B1 2CHRA 3WLQA 2ADAA 3IV3A 1S2VA 2Q02A 1W1ZA 4DEFA 3LI0A 1UR4A 5IFPA 1RBOB 3T42A 3AIWA 3OPSA 6CGTA 2WK2A 2PBGA 4GA8A 4W85A 1DWGM 3I7QA 2YLLA 3SY5A 3R58A 4FXFA 3FXGA 4E4UA 4IGSA 2J9ZA 4QTGA 1QT1A 4J3TA 4NJIA 4P7NA 4EX4A 3WNLA 2DPEA 3W70A 1BF2A 3LZ3A 3VD5A 3O7UA 3IIOA 3PZ9A 2XHYA 4GC3A 5D9NA 1R8LA 4QJ4B 5I3KA 2GJXA 4RDZA 1CECA 4ZL1A 3AIRA 3U57A 4DAIA 4ILSA 3DHDA 4ZO9A 2WYSA 4AAJA 3AIQA 4FIRA 4DJDA 2IKGA 3EEZA 3TJXA 4H8VA 3GDBA 2HQAA 1BFNA 4LY4A 2A3EA 3VC5A 3AS0A 3O63A 1QR7A 4ZO8A 4C6DA 4RDYA 1RA5A 1JGMA 4HIBA 1UJQA 1V02E 2PGWA 5LNSA 1PTAA 1O68A 3KRZA 1A5KC 3CAWA 4A35A 1QI2A 3N2MA 3TNOA 3WBXA 2ZBTA 3NL6A 3WLOA 1EEPA 2QCDB 3UGVA 1K02A 4IIFA 5JH2A 3B9DA 4KEZA 3QMTA 2WNZA 4WX2A 3REQB 3QSTA 2QKFA 3H54A 3NURA 3MY9A 4BHYA 4RR4A 3VFLA 4U2YA 3WJWA 2ACUA 3N1AA 5FEPA 5HANA 3MT1A 4MPQA 1B3OA 3AS1A 2QJIA 5HATA 2JEQA 4IFOA 2NX1A 3ITOA 9RUBA 3V5CA 4YYCA 1ZAIA 1P43A 2Y24A 4Q8WA 4D2JA 2CCRA 3TW6A 4ACYA 3GHSA 3HJZA 4PTWA 1H09A 4GO9A 2PUZA 1RAKA 3GXIA 5K4ZA 3KS5A 3GC2A 3WL0A 2ZVRA 3CAVA 3GVGA 1G4TA 4C1NA 3EPNA 4JTGA 1ZS2A 3KOXA 4IIHA 4TO8A 1E6QM 1YTEA 5A6SA 3EX4A 4WY0A 1GQLA 2VFIA 2B7OA 3TV8A 2F7FA 2FZ8A 1J0IA 2H6RA 4XZBA 1PL9A 2EGZA 3WFZA 1FXPA 2XGZA 3VNKA 3L66A 4YS1A 2CXGA 4PL1A 3VPLA 1VJZA 3LGGA 4AISA 1OIMA 1PCKA 4MMWA 4QM1A 4HNTA 4ICMA 3NTYA 4RK8A 3FCPA 4A29A 2BODX 3UWUA 3E02A 3P5YA 4D6DA 3NDOA 3AIUA 3H4WA 4IISA 3OTRA 4FX8A 3LXCA 2EJ1A 3WNNA 3W23A 5HNUA 2HEJA 4B2DD 5DMLA 1BRLA 1GW9A 3WX7A 8A3HA 4H7CA 3TYEA 4J4KA 3OHIA 4EP8C 2QJGA 3A4XA 3IS4A 3TWBA 3VMPA 3NQ2A 5GQBA 4B4FA 1S2AA 4H2CA 4LAMA 4PFMA 4I9AA 3LCIA 1KFKA 2XGBA 4P8UA 5LNRA 4Z2KA 1VQTA 3QPYA 2QPUA 2VZUA 3WLMA 3OZYA 5H2ZA 1V3KA 4ZVJA 1E6XM 2BVYA 3QBUA 4ZQRA 3RN6A 2WPGA 3KUMA 3O9NA 4GI9A 3R94A 4XUGA 5GVJA 3ZWTA 3SCTA 3BDKA 3WQVA 4YHEA 4J9JA 1ISYA 5AHFA 3UG4A 4JR5A 4MAVA 1LP6A 5AZ0A 4XBKA 4MSSA 4US5D 7TIMA 1UH4A 1NOFA 2CLHA 2ZRUA 4GVIA 3PBGA 4ATWA 4DIAA 3M5VA 2NUXA 2HROA 3CV2A 3MCNA 2EJAA 3EOUA 4IMGA 3VD9A 3G1YA 3MI6A 1N7KA 1FFQA 3GU1A 4BCEA 3S42A 1KBLA 4UCFA 3WNOA 5DEZA 3RCMA 3CGTA 3VE9A 3GXDA 4AVFA 4WIWA 3WK0A 2WPBA 1O5QA 3XINA 2WJZA 5U4NA 4D1JA 2PGRA 1KXQA 3FDGA 3PS7A 2VNCA 3QOKA 4MB4A 3A4JA 4KERA 3TYBA 2B7PA 1U1HA 1GVSA 4JIEA 1ME8A 3B8VA 5L9FA 4LEQA 4FXJA 3AMDA 3BICA 3O06A 2J7FA 3WEOA 4C6IA 4NAFB 1UJPA 2FLIA 4QEEA 2ZZ4A 4HOWA 3S1UA 4L4OA 3N6QA 1XLHA 2VFHA 3R7MA 3WQ8A 2V2DA 2GQ8A 1CGUA 1KM6A 2NV2A 1QWKA 4MJ4A 2WKLA 1FWSA 1EUNA 3I3DA 3AZRA 1FHVA 1HJVA 2Q8XA 1ZQ5A 1GJUA 1XRVA 3LB0A 4XZ9A 2XIJA 4US6A 3RRXA 3SGZA 1CZ1A 2C14A 4KWWA 3ZR4A 1TO3A 4FX6M 3GB6A 4GQRA 3VKBA 1O5XA 3M43A 2QVHA 3WQFA 2XH7A 4G7FA 3E2SA 4GINA 3PZOA 4DHGA 3WJZA 1V6TA 3F5LA 1XIFA 2OMAA 2HE5A 3C2FA 1EP2A 2EPOA 5FKYA 4A21A 5G2HA 1OCBA 3AC0A 3WFAA 3UR8A 2XJ7A 2DSWA 5CC5A 3SSJA 3AJXA 3QY6A 4OT7A 2FHCA 4R9XA 8CGTA 1BG9A 4JIRA 3E0LA 6PTDA 3EMZA 1M5WA 4WCJA 2Z0IA 5EKYA 3M0YA 2QGHA 1UKQA 4JQAA 3DI0A 4K38A 3ANVA 3D3FA 4WEVX 2TPSA 1XFBA 2ZE0A 1UP3A 5LIUX 3FW6A 3K5XA 3U4FA 3RPDA 7ENLA 1ONRA 3TTOA 2XIBA 3HFTA 1I2NA 5EY5A 1J8VA 2OGYA 2ZXQA 3M47A 3MUZ1 1DBTA 2XPKA 4KCWA 1B30A 1HGWA 2GQ3A 3UZZA 3AWOA 1B9BA 4JX5A 4HZMA 4I9JA 4F9JA 5BXPA 3TYCA 2VGFA 1PB0A 3DH7A 3ZVHB 4MLJA 5HINA 1GZ1A 3MCOA 4FK9A 1ONXA 1VIZA 4DBSA 3UJFA 5M1TA 1XCWA 3PPGA 4PUEA 1I2PA 1W8SA 3NYDA 3W37A 3SFWA 3HN3A 1C92A 1UP0A 3ABQA 1MQPA 5AOUA 5HMFA 2Y62A 3CH0A 4OJYA 3AIBA 2C79A 3M4HA 1I4NA 2FZDA 1TV5A 1X6UA 2E25A 3LOTA 4XIAA 3EAUA 4CD7A 2J8TA 4REQB 3PB0A 4M8UA 4AW7A 4ATLA 4N9CA 1R0MA 3FSUA 4LV4A 5G2WA 1TX2A 1SFTA 4JTTA 1BYAA 1XGDA 1JNEA 3KOYA 3ZMRA 2O7SA 4LY8A 1F6PA 1GEQA 4ZXLA 5HQMA 3COTA 4O10A 2F61A 1S2CA 3AXHA 3PZQA 5CBIA 3G8RA 2OELA 3THCA 4PSRA 5T26A 1SZEA 3DN5A 4QS6A 1AZ2A 2QXWA 4D9PA 4CGTA 3S2LA 3G1VA 2YR1A 2OG9A 4C1KA 1FCBA 3HMJG 4L9ZA 3AALA 3RITA 4AWUA 3GFXA 4Q8VA 3PFRA 1W3TA 3VIFA 1QHOA 5G2IA 5T9BG 3WQ5A 4KFPA 2BX7A 4ZSUA 1E15A 4ONVA 1W54A 4WR3A 2OCZA 3OZMA 4GNVA 4D6CA 4D8AA 2I56A 4Y7EA 1OGSA 4KWUA 1WKDA 1QNPA 3UY8A 2D20A 4MJ2A 1BGAA 4N6EA 1UD3A 3URBA 1RALA 1H7WA 2TRSA 4BI5A 3L5LA 3N11A 2D3LA 4PYSA 4Q6JA 1QI4A 3W1XA 1LOLA 1Q6GA 2OSYA 2Q8LA 4CEUC 3MVTA 4JTDA 5DMMA 1TZ7A 1FCQA 1QW9A 2RGMA 3G1FA 5A2AA 3AZSA 5CC3A 3RF9A 4O11A 1YNPA 4HHLA 5HXMA 3GKFA 1CLXA 2Z7KA 1H51A 3O05A 3GXNA 1SSGA 1AMKA 1SFLA 3TZFA 4HU8A 4EF9A 1QTWA 1J5TA 3II1A 4AHPA 1G4EA 4JEJA 3W88A 1S5WA 1S5MA 2P53A 2XSXA 5CLTA 1R5YA 5E93A 3ATZA 2PDHA 3C3NA 5AHEA 4F8XA 3GTHA 4OZOA 1V93A 4DZAA 4AIOA 2W3ZA 4KW2A 1R2SA 3NNTA 3RPTA 4FNRA 3THAA 4AQLA 3AOFA 3AZTA 1JEZA 4AD0A 1W5NA 4I8YA 3QW3A 2OTDA 3PZVA 4W5UA 5CSSA 3C61A 4UNIA 2HRWA 2WSPA 1A5CA 2PZNA 3TTYA 3M5ZA 3V3WA 2FVLA 2XSBA 3N2OA 4Q7IA 3SFKA 3GAKA 5ABHA 2Z2AA 1X1NA 2QHAA 4J3ZA 3B0UX 2VX6A 3VIPA 4FI4A 4NNBA 3GR4A 4OECA 1PV8A 3B03A 1L2QA 4H9YA 4AB4A 3LGDA 2DZTA 4QR6A 1LLOA 3GXTA 4JHZA 1LT7A 2I9UA 4GUFA 4UNKA 1W1PA 4LXFA 1ZJIA 2DU2A 2JKEA 3GUGA 1MEHA 2D2GA 1HF6A 2R1LA 4D72A 1ZJHA 2CLOA 2B0MA 3RK8A 1TV4A 4HTBA 4AZIA 5C5YA 2H3DA 2R1PA 1WDSA 3Q45A 4Q3MA 3KHJA 3LBMA 1DIOA 1MZRA 1VCVA 1H5YA 3CXOA 4LPCA 1XLEA 4NZ4A 1CT5A 3E5PA 3V5OA 1B0IA 1PIGA 2Y6ZA 2UY3A 3LPPA 4JKLA 3QTGA 2IKHA 4C6NA 2R82A 4PCFA 3G22A 4DYEA 3NQ8A 1EJRC 3W07A 3W28A 4DQWA 1EPVA 2Z6JA 2OOFA 2EKCA 1NWUA 1LT8A 1CGWA 1RH9A 1Q2SA 2MUCA 2RDUA 4PB4A 2VX7A 1UA3A 1KFJA 2NQ9A 5CPQA 3P3BA 3LLFA 1EF3A 3CL7A 3MYOA 1VBJA 1FBAA 3NXFA 1YX1A 4JKMA 2ACRA 1RVGA 2R6OA 4M6QA 3GH4A 4RKAA 1G7UA 1XICA 3LM7A 4RUBA 2XIMA 4RNJA 1YDOA 1JULA 1YKWA 2GJNA 4ORMA 4GZIA 3SUWA 2WWDA 1TPH1 3GNPA 4BI7A 2ZZ6A 5I00A 2AMGA 4UQDA 2XIQA 1P6CA 1K7FA 4YTTA 4RL3A 4MM1A 5KZDA 1OCNA 4H4IA 5DN1A 5A1AA 2VFEA 1DTUA 1OBAA 1X96A 4ZR8A 1VC4A 4S3KA 1CGTA 4DO5A 1EOKA 2GGIA 4LVGA 3S2CA 4U3AA 4R34A 3EX2A 5DMNA 1LOQA 2PDKA 3W7MA 5JXQA 4DUVA 4LC8A 4A3YA 2A2IA 1N8IA 3GDMA 3OIXA 3W1LA 5EBUA 2WHKA 1V02A 3A21A 1F73A 5CKSA 3EX1A 2WKGA 1VJSA 3RNDA 1I8JA 1HJQA 1H63A 1EEXA 4O0ZA 1JAKA 5CC7A 1BWLA 4AZ6A 2VC9A 4YHGA 2CLKA 1NOUA 1QNVA 5I24A 2SFPA 2WZIA 2YXGA 3SW6A 1V6VA 1UKPA 2F2HA 1FDZA 2NQ5A 1P4CA 1C93A 3APGA 2DEPA 5A5WA 3ONBA 2F38A 3GBDA 2X2YA 1FWBC 3P0WA 4X22A 3CQIA 4MZ8A 1GOOA 3PZUA 3W83A 1XLAA 1KGUA 4XK2A 2IXVA 5D2YA 1IWBA 1TRDA 2CBUA 3W7DA 1E1FA 2X2GA 3BOFA 5KETA 1JZ3A 1EDGA 2DZAA 1WKYA 4IP7A 2E1DA 1R9YA 1U30A 3L0KA 3H12A 2FFCA 3K13A 2FB2A 2UY4A 4A2RA 1YXCA 1H0GA 4H9VA 1NM9A 2XUCA 2PWDA 1EP1A 1XDMA 4HU4A 3L4TA 2OODA 2ZOXA 4L56A 4M24A 4CNSA 2UY5A 4H6QA 1E51A 4GYJA 1VR6A 2Y7FA 2I7GA 2UV8G 4GGBA 1EH9A 1UKOA 2DP3A 4Q8OA 2BASA 2VUNA 1GPFA 3N29A 4QHRA 1A80A 1SPQA 1J5SA 1TELA 3EA2A 3DG7A 2XINA 4UFKA 4MWAB 3TSDA 2J8FA 3C2VA 2JIEA 3SDOA 1EJWC 5G5IA 1NOWA 2VRKA 3KP0A 4QNWA 3CUHA 1UMLA 2DW7A 3ZQ9A 1EF2A 2O56A 3EDDA 5A8MA 3DGRA 4EVZA 3M0IA 1VBUA 1I45A 1DJGA 3P84A 1P1MA 2Z2BA 1FP8A 3VGDA 4D8LA 1OCJA 2ZTKA 1KFBA 3VGEA 1W1YA 4YNGA 3O2LA 1QO2A 1E72M 3IGUA 4AY8A 4LUTB 2X16A 3T08A 3C4UA 4LAZA 1WBJA 3GNOA 3MQTA 1XYMA 3W86A 2FPYA 1J6PA 2QPSA 4JYDA 5I02A 2GFTA 3S5OA 4IUOA 2QEZA 2J4GA 3AAMA 1OADA 4Q4PA 4U4MA 1XGEA 4IXHA 1TPB1 3B97A 2PC4A 4H01A 2PU0A 3L7RA 3AMKA 4HU3A 5TIMA 4MY1A 4FOUA 3NEVA 3N2BA 3LXBA 4YCPA 4FF7A 4INFA 1DV7A 5GPRA 2QUNA 4CN4A 3EDEA 4DJED 1J6OA 2AQOA 3T09A 1UW9A 2DY3A 4YCOA 1XI3A 4O1DA 3L68A 1MQQA 1LUCA 4DJFD 3ABZA 2GQAA 3HURA 4W8AA 3MSGA 2BDQA 4E3VA 4D6HA 1V08A 4HP5A 3ID7A 3WJXA 1K9EA 4WRHA 4I7VA 2X41A 7CGTA 4HPXA 1Q2RA 3UP8A 3VINA 2HBXA 2QJMA 4F66A 1IEQA 1E9YB 3GXPA 1BWVA 1MNSA 4L6DA 4I6VA 3N2TA 3VUPA 3TJIA 4NJGA 1T40A 3BANA 4JICA 2FHBA 5IDIA 5DMYA 1UZ4A 2G5WA 1WO2A 4HSHA 4GI6A 2B7NA 1FP9A 3G6MA 2ABBA 2WOQA 4NYUA 1HP5A 5BOOA 3GY1A 1XYZA 3CYJA 2V9DA 3SCOA 1LRTA 4WK9A 3T8LA 4FPSA 5C6MA 4JTIA 4OQVA 3W7RA 4A3RA 2ZICA 3VIOA 2QJJA 1EP3A 3R12A 1D8WA 1EPXA 2DORA 2V38A 3CQKA 3ITYA 3W7IA 2A6LA 1QDSA 5G4HC 1LBLA 3NIYA 3U5UA 4KWOA 4HMEA 3CM4A 2DT0A 1DPMA 3LV5A 1QNSA 2ATMA 2DT3A 3NAVA 2DGAA 1JCLA 3OVPA 1JCJA 5U7SA 3M07A 4QDWA 4IXXA 4BQ4A 5HUPA 2ISSA 1R3RA 3NXLA 2ABAA 3O6YX 3HPFA 4FNQA 4NZJA 5A2BA 2Y7DA 3PM6A 3QPZA 2MANA 5B7ZA 1F3XA 4GY7A 1ITXA 3STFA 2PRMA 4Z2IA 1ZJAA 5H1WA 5PTDA 3P61A 4H00A 5BXRA 1QO5A 1SO4A 4HJWA 3NWRA 3NPXA 4ZA0A 2VHLA 2CZDA 3WO8A 1BXCA 1LWHA 3B8IA 5A2CA 4LS1A 3CWHA 3CYVA 3M0ZA 5CZJA 4K6AA 2HNHA 3FA4A 3S2MA 2ZX9A 4MWAD 2G97A 5HNNA 3LCLA 3XIMA 1F2JA 4WLCA 4G7EA 3CZLA 5FD0A 3BLEA 3EKGA 1C29A 1EC7A 1ZRQA 3MP4A 2EHHA 1QNRA 2GJLA 4PZVA 5BNKA 3T8QA 4NJJA 2BXVA 4R27A 2Y7GA 4IHCA 2FPVA 4YVXA 1RCQA 1ZBVA 4DNMA 1JCNA 3WL1A 2HXTA 3C0QA 1ZBKA 1UWQA 3BQ6A 4LEFA 3SN0A 4OUEA 1US3A 3K1GA 3IVUA 3BGJA 1LQ0A 4GY0A 3MHGA 1RCOB 4A3UA 1TQXA 1XDJA 4M19A 2ZUSA 1GVIA 1MXDA 1YW1A 5G4EA 3PZGA 3BSGA 4HGXA 4Q4RA 1XUUA 3UZXA 1JDDA 4C5ZA 1FWCC 4OWGA 2ZX6A 3AIEA 1DXFA 1UR9A 3LMZA 5BOEA 1OYCA 3MSRA 3VNYA 5BMXA 3IJDA 4OE7A 1F6YA 5AHLA 3E0WA 4ZQPA 2O9PA 2WLYA 4K3ZA 4OFCA 2PFHA 7ODCA 1DJZA 4IIDA 5C9ZA 5I7GA 2PGFA 3PUDA 4LSBA 2D2OA 1RSCA 4FMVA 2FTWA 2W61A 5LA1A 2EG7A 3E0FA 4GUIA 4C6KA 4RX0A 3OBAA 1MVYA 1EX5A 5I79A 3OZOA 1QPKA 1OCQA 2C15A 1JPMA 4F0LA 5D9OA 1L8NA 1QRQA 4FLRA 3U7VA 4DF2A 2HMCA 4YMZA 1FHDA 2PDFA 4JBRA 2OZ3A 1W9DM 4HMDA 4R7JA 2CWNA 1HJWA 4HN8A 3ZIZA 4GIEA 4TV5A 2CNCA 1YNYA 4B5UA 1TZ9A 3QEZA 4D8ZA 2FKPA 3FS2A 2HS8A 3QW4B 3W1MA 1WP6A 4CNOA 2E09A 2P8CA 4WF7A 1KV8A 1MEIA 2I5GA 4YL2A 2WVVB 1GPWA 3LBCA 3QYQA 5IBXA 4K68A 1JUEA 4LANA 2EPMX 1A4MA 4K7VA 3LK6A 1TIMA 2BB0A 3PB2A 3T0BA 1E1EA 2J7DA 1H0IA 3QQ0A 4TV6A 5HQLA 1NVMA 4FNTA 5AVNA 3LHZA 5CPTA 2EPLX 4IWWA 5E6ZA 2X7WA 4GIYA 4DNHA 3KCJA 1ECQA 2REQA 4UZUA 1GVFA 4Q8NA 3HF3A 3IACA 3CH9A 2BY2A 4W93A 1C8YA 5JIWA 2NVDA 1UWUA 3AO0A 3QJAA 6XIAA 1YPFA 4V33A 3LQGA 3B8UA 1Q4NX 4F0HA 1WZLA 4LC6A 1GZGA 5A8NA 5D2XA 3RCYA 1RZMA 2Y70A 2E40A 4EPKA 2NV1A 1OD8A 3YPIA 4MJMA 2G3IA 1FWEC 2A7PA 3HQNA 1MMFA 4MDPA 1UD2A 4YN5A 4CVWA 3KRSA 1VLIA 3ICJA 1G4PA 1Q45A 3KE0A 2VC7A 6TIMA 1RJRA 2I16A 1UH2A 2YDSA 3P67A 1LZOA 1YBQB 3B9OA 2GSHA 3S9ZA 5M03A 5KINA 1K4GA 2AMXA 2XH4A 3WH6A 2NXHA 3DG6A 2E6AA 5I06A 5K9DA 4DWSC 1V79A 1A0EA 4K8HA 3HPAA 1US0A 4W86A 4AZHA 2YYTA 1U1JA 3VXGA 1TTJA 1EWDA 1JCYA 5DELA 5LXXA 3QZ6A 3FEQA 1J79A 1I75A 4XSMA 4HNUA 1UQZA 2AOSA 3L4UA 2DQXA 2E28A 1REQB 3W1AA 2CU0A 5EFDA 4Z1CA 1VFFA 4P8WA 4Z2JA 5HA7A 1TMHA 3IPWA 1XLGA 5IOBA 2QCHA 3UNTA 4QFUA 1DE6A 3L4XA 4M7TA 3NZRA 4BK9A 1O7AA 4G1KA 2WVSA 3PTKA 3V0SA 3W87A 1PTDA 4AX6A 4C6MA 4IX0A 2PRLA 3DFHA 4QLLA 1L9WA 3NQVA 4MNJA 4JAWA 3HOJA 1TA3B 3BWWA 4DBDA 3R43A 2PDMA 4GUHA 1MXGA 4PULA 4QE1A 3OBKA 4XUYA 3W76A 3W22A 1R7OA 4AWTA 3ELFA 2FYMA 1RUSA 3KHDA 3U0HA 1Y5WA 2X42A 2V8ZA 1RQEA 4G2DA 2HPMA 1JDCA 1XRSA 1P0KA 2B31A 2QJNA 2D1ZA 3SCUA 1LBMA 4YVVA 2VFDA 3ZJ8A 1UPPA 3DCPA 1GONA 1IT8A 2Z7GA 3KOZA 5H8MA 2HCVA 4RE2A 4FR1A 3QMSA 1WKFA 1Z48A 3OGSA 1F76A 4FZIA 4MADA 5FJOA 1UP2A 3UY7A 3RLUA 3M0KA 1QVBA 4N7QA 2JEPA 1EXBA 1G7VA 1MNZA 4F2BA 4PN2A 5FA5A 2VGGA 2WB5A 3IJ6A 1GTEA 3H70A 2VX4A 4M81A 3R89A 1MUCA 2V5LA 4LVBA 3PY2A 4HN4A 1Z41A 3W7JA 2DZUA 1G6CA 5CZTA 3EWWA 5D32A 2C19A 3T0TA 2FJKA 2CIPA 2F9RA 5CPLA 2ONEA 4PMRA 1PTGA 4Z0SA 4CD5A 2PDNA 4OBSA 2HBVA 2BXYA 3R4IA 1FWWA 4BZYA 3ZJKA 1JZ6A 4XD3A 1GEHA 3LV6A 3BG9A 1H1NA 3WF3A 5JUVA 3FFSA 3GRIA 3UR5A 3IGSA 4A22A 5F1UA 4ZOBA 3BAIA 1N8WA 2P5NA 1SGJA 5F2IA 1UKSA 3E6EA 3T4WA 4YTSA 4MNKA 5T8GA 1K9DA 3R25A 4JQ2A 5CCZA 3MDWA 4UTWA 4CQAA 3MMUA 2V82A 2ALRA 4Q8QA 5TAOA 4EPDC 4ERAA 3LCFA 3UVIA 3KRUA 3Q37A 2XIOA 1RK6A 1OT2A 1V3JA 2NV9A 3KDOA 5DCDA 3R5EA 3EPMA 1TWWA 3PBWA 3CB8A 5CEWA 2ZADA 1DXEA 4MIMA 3SY8A 3PPFA 4ERIA 4KFNA 3UPMA 3PANA 2OOGA 2A21A 2E67A 3EYPA 2CW6A 4Q4MA 4H7ZA 5GNZA 2V5KA 3ARTA 3ARQA 5AC7A 3KW3A 3TSBA 1WDRA 1DJYA 3GG7A 2ISWA 4DN1A 5FL0A 5I0DA 3TVAA 2WCGA 4US5A 1OFRA 3VI2A 5ABTA 3TXZA 3AYRA 2CKRA 2WHJA 1QBAA 1TV3A 2VX5A 4HB7A 5EMUA 5G1TA 1HKKA 4UR9A 1CGVA 4YTRA 4LYQA 2F2KA 1B3XA 3GTIA 1SQ7A 3PUOA 4J2MA 1IQ8A 2WC4A 5EL1A 3TROA 1F5ZA 3VYLA 1ZP3A 4OBRA 5DT5A 3VMOA 4FALA 4YU1A 4JTJA 1UBSA 4QCEA 1K4HA 3BV7A 1B90A 2BGSA 3RLGA 2HJPA 3DIPA 4PTMA 1TIWA 4E4FA 3PN8A 3W7PA 1NY1A 2WZEA 1MYRA 5TQLA 2QCDA 1EIXA 3BJTA 4IQJA 4F2UA 4FB7A 2YXOA 4JTLA 2QUUA 3PK7A 3REQA 1PZ0A 4XD6A 4K37A 4RZ5A 1K9FA 4GIAA 4I3GA 4C90A 4ZQNA 3ERPA 4UTTA 4F0RA 1BEUA 1UQYA 2PDCA 2ZRWA 3SUTA 4K1GA 3NJ3A 1ZCOA 4AXNA 1FA2A 3TOPA 2GYIA 1P48A 4W7WA 7PTDA 3NZ1A 3ORWA 3TX9A 3TP4A 1JI1A 1Y0EA 1PJ9A 3BMVA 5FJPA 3KZSA 4QDPA 1SFSA 3SGUA 2C8NA 4ZSTA 1SJDA 2FZNA 1HKMA 3CTLA 5AZ1A 1Z44A 4KF1A 3TLQA 3DHUA 3MYPA 2QGYA 3DFOA 4KIEA 1OGBA 3KVMA 1VCFA 3S5YA 3A24A 4A8LA 4AYSA 2Z2UA 5D8WA 2FDMA 2EPKX 1CI1A 3G24A 4DF1A 4TIMA 4IPJA 4WSHA 3CMGA 1E0XA 3CUXA 3CV7A 3VDCA 3WLSA 3VOIA 2A7RA 2O4MA 3F4CA 4HMNA 1GOKA 1W5OA 3H24A 3GR8A 5K9CA 3MC5A 4XO7A 3EWZA 3T81A 3SCPA 2YFOA 3ABXA 3EA3A 4HZ7A 2BGQA 4DM1A 2V68A 1D2KA 4W7UA 4PTNA 1E55A 2GDVA 2W0UA 4M7SA 4MWAE 5TD4A 4HNOA 2YCLA 1AW5A 1B3VA 2Z1XA 3HFYA 3QMRA 4XSLA 3QC3A 1H7RA 3O0FA 1RJQA 4B15A 1LDCA 2H3BA 3S6OA 2XSAA 4Y8EA 4M0XA 1RV8A 4ECLA 3W7OA 4HBKA 3TA6A 1RA0A 3A3HA 1D3HA 3DFYA 3ARWA 1M7XA 5EU9A 1YE6A 3N3TA 3DUGA 5T9CE 1R7AA 3W71A 1ADDA 3UJEA 4Y9AA 3FJ4A 1QNQA 3G3MA 2R14A 1M7OA 3VKKA 4L61A 2P50A 3VMNA 3OG2A 3K2GA 4LYKA 2BG5A 2XDFA 2FTYA 3VNLA 3VX1A 3M0VA 2CFFA 3OW1A 3LNMA 1PDYA 4AF0B 3W72A 3SAZA 4C6EA 4JL2A 2H9AB 5I3GA 3PTDA 4KKXA 4E2BA 2Y88A 2HE8A 1AL8A 3N34A 4S39A 5CGTA 3BJFA 3WQGA 3G1XA 1LLZA 2VZVA 4PC8A 4CLMA 3VD3A 3JVAA 2V81A 4I7WA 5CZSA 1TYGA 3EBVA 2V2CA 1UZHA 1HNYA 5M5DA 4PMUA 3D5HA 1YADA 1HJSA 2VCAA 3PBUA 1EYWA 4AD2A 2F8QA 1S2WA 1XIGA 1TE1A 1ZAHA 1PHQA 4DB7A 4DLMA 4FNSA 1AD4A 3MV01 5CSUA 3GNDA 3DC0A 2IQ0A 1XYLA 4Q32A 3GM8A 4V2XA 2PDQA 1OC5A 3NM1A 3E2VA 4PUWA 2YBTA 1VBHA 2WXDM 5I78A 1Q7QA 3NM3A 1SZGA 4GXPA 3B9AA 5DT7A 3QFEA 3DERA 1KNWA 3VUSA 4BQ5A 3QM3A 3L4WA 3W7NA 4NZ5A 1PZ2A 4BKNA 4NAFA 1GKRA 2HVNA 2ZKMX 2I1OA 2VP8A 4IPNB 4NX0A 2QAPA 3NYZA 1VFSA 3GTNA 5LYRA 3GU9A 2WMGA 1S3TC 1QW8A 2A3AA 2X1TA 5A8PA 4UFIA 3IGHX 1W5MA 2IKJA 4MPKA 3GC4A 4L9XA 1QPRA 1VHNA 1UWAA 2CZFA 3R11A 1ZUAX 3WQWA 5CBBA 3L4VA 1DWFM 4FLQA 4QGCA 1LROA 4TVDA 3B8WA 1E6SM 1H4PA 1PAMA 1XM3A 2C7FA 2G3MA 3QGKC 3DYOA 1B5TA 3NO3A 2OWXA 5JBEA 4E0CA 3LCWA 3P5ZA 1S46A 2YZRA 3FYOA 1JPIA 1G5AA 2XH0A 4O57A 2D0HA 1SUXA 3AU6A 1J2BA 3KWSA 2C6QA 2VRJA 1JDFA 3FYPA 3VIMA 5AHIA 1EDTA 4JTFA 1UA7A 2A1YA 3ALGA 3IV8A 4O1AA 4ORIA 4WUIA 2NWSA 3UPWA 3WF4A 3ZJ7A 1BYBA 1Q8JA 4LRTA 2XFWA 4QS5A 1G69A 1JVNA 3CAKA 1T41A 1HGYA 3SCRA 3EOEA 4NVTA 2ANUA 3QZEA 3V7PA 3NPUA 3GE7A 3BW4A 2ZE3A 1Q8AA 4L64A 4ICNA 1M03A 3GWQA 4QRNA 3TMQA 3DBNA 9CGTA 4TOQA 1NELA 3ZVHA 3L4ZA 1WB0A 3W7LA 3RLVA 3L9CA 4KETA 5E0KA 3SIMA 3GNNA 2UY2A 1PWLA 1ZLPA 3KM8A 4FAMA 3LLXA 3RO8A 3S5NA 2PP0A 1DJWA 3HGJA 2X7VA 4LTSA 3ARYA 2FGZA 2O92A 4B92A 3RG6A 5LIKX 1JUKA 2QNEA 3NL5A 4IMCA 5FI8A 1XLJA 3IIXA 7A3HA 3EX3A 2YKKA 4BFAA 4REQA 1IWAA 4XZLX 4XKYA 3UG3A 3PR2A 4DELA 3SUSA 2DT2A 2VR4A 1T8QA 3JZUA 3KBSA 3UWQA 3OQ8A 2UWFA 5MHBA 1ZBWA 2BXZA 1FCVA 3TJ4A 4JYFA 1AJ0A 1NP0A 3TN5A 3S9IA 2E4TA 5ECVA 5MKGA 3QH2A 3GXFA 1Q6EA 4A6GA 3TFXA 1BKSA 5HWMA 1I1WA 4JN7A 1V0LA 2XVGA 2AGKA 1CEOA 2YYUA 3B0VC 1LLWA 3SQSA 2HISA 4HOXA 1GYMA 3VOJA 1FWAC 1EL3A 4OHQA 5IHRA 3BE7A 3CPGA 2DSVA 1MRQA 5CPSA 3NUKA 3MBFA 4NRSA 3TLLA 1O66A 4L4LA 3RFAA 2XZ7A 1XPGA 3WLJA 1MQRA 4HJFA 7REQB 1C9DA 3KZPA 3T40A 4S2CA 2BOGX 2J13A 2QW5A 2QV4A 4NI3A 3MSDA 4PTDA 3LXAA 4U28A 3TN6A 4UR7A 1M3UA 5BXSA 1VKFA 4J7RA 1IWPA 1J2WA 4DPPA 4GKTA 4F0SA 2XN0A 1E40A 3EKZA 3DX5A 1D7FA 2PU1A 3CZGA 2VD9A 2QCGA 1GORA 5EYWA 3GR7A 2B4GA 3UJ2A 4PMJA 3S47A 2J6VA 2NZLA 1NTHA 4I5XA 4B3LA 4Q4QA 2WMFA 3F7JA 3MUCA 1M01A 2H8ZA 4Y9PA 1KR0A 3HG3A 4UWMA 3BCFA 2V0TA 3AHTA 1CB7B 3WLKX 1SMDA 3ZR5A 4GI8A 4L4MA 3B06A 3KCOA 1A3WA 1MWOA 4P61A 2ZZ5A 3KX6A 3OQEA 3UESA 3NVTA 3PNUA 3WLNA 1YDNA 4OGZA 1CTNA 3MO7A 2QF8A 5FJUA 2KX9A 1SFJA 4TXEA 1EHNA 3WBYA 1V5XA 8XIMA 4NYYA 1T6MA 4DJDD 5L6UA 2VEFA 5REQB 4EAYA 4IZGA 2G37A 3QVQA 2ZZ7A 3PAOA 3LQLA 4HPNA 3MUAA 1VENA 2VYOA 3C0JA 4JTKA 4KEVA 2VQTA 2J7GA 3GVWA 4XQ6A 4O0KA 1NP2A 3TQKA 1AVAA 3GXMA 4QQ3A 1F05A 2QS8A 3I10A 4MOZA 2IXUA 5C0QA 5CH9A 3CWNA 5BRPA 1X1OA 1VCGA 2NLIA 2A4AA 1KKOA 3L23A 1FWJC 2VTFA 1Q66A 4JIHA 3BW2A 3EB2A 5MF5A 1M53A 4RNIA 2VO5A 2HSAA 3A4AA 4R53A 1OQFA 2OR2A 2WHLA 2D23A 3UETA 4O53A 1E0VA 1V3IA 4JN6A 1GNXA 1FTXA 5FF4A 3A47A 1EJSC 4CU6A 1XBYA 4XIMA 1Y8BA 5DY3A 3WLLA 2AL2B 4O1EA 3WKZA 3UWEA 2G8ZA 1XKYA 2PLKA 1CPUA 4BWLC 4UC5A 1ITCA 4IFRA 3VIHA 4CCZA 1Q7MA 4XKMA 3EGJA 4E8CA 3UCQA 3JW7A 3TTEA 3ZZ1A 4H19A 4C91A 4B3ZA 6REQB 2NWRA 3DDMA 4WHBA 3FAXA 3RM8A 3FHAA 4HOZA 3HM7A 1R86A 3H2FA 4AD5A 4LX4A 4F48A 3AHVA 4GRSA 4CD4A 4GIRA 1KRBC 2I17A 1FWDC 1HKVA 4F9DA 2J27A 3W29A 1UKTA 1T8XA 4PFHA 3KL0A 1N55A 4WDWA 1GOMA 5LSMA 4JTSA 1KWGA 1VJIA 3BLLA 3QRHA 2Y1HA 4IP5A 2DV0A 4F3HA 1C91A 4Z1DA 1KCKA 1AQ0A 1UB3A 2QIWA 1Q6DA 3H22A 4OKDA 3LBOA 4AVOA 4DJEA 4DPQA 4AC1X 5HK4A 4DJFA 3UA3A 1WAUA 4JD4A 1TJ0A 4BA0A 2Y5SA 2PEVA 1O5KA 3VDGA 2C13A 4IMDA 2E77A 4OOZA 3L21A 3LHWA 1BHGA 3OVGA 1HIZA 1WZKA 4ZTYA 4GKLA 1D8CA 4HSNA 2VM8A 1JRCA 4ZZ9A 4WJ8A 1VAHA 2VKZG 3PFMA 5I3DA 3EWDA 5E0FA 1G94A 4KWVA 4O4VA 2YFNA 3S4TA 4B5SA 3M64A 3V5FA 4DO4A 3AISA 4ZODA 2VZSA 4AWSA 1QAPA 3W2KA 2PI6A 1OVDA 2C0HA 2WMIB 4XZMX 3GZAA 5CG7A 3UGRA 3UNDA 5EMLA 3E12A 4UBPC 1PWMA 1WXZA 1C7TA 3AYVA 1IGSA 5HPOA 1B54A 2H8XA 1H5VA 1Q5MA 2BBFA 2CLEA 1UWIA 1XLIA 3T0CA 3JR2A 2VGIA 4URIA 3A13A 1AODA 3ZLFA 1S38A 5A6MA 1JGIA 2HV5A 1VPQA 4AMAA 1LRQA 2VVNA 3SY1A 4UFMA 2HS6A 3RU6A 4PMOA 2J88A 1YNQA 1P0EA 1FHLA 1B57A 1Q6QA 3LRLA 3HO8A 1F7BA 1VFHA 3M7SA 3SI9A 1AH4A 4HSOA 4GC4A 3KS6A 2WSKA 3VOCA 1J10A 3BLIA 1JQVA 1A5SA 1VRXA 1PKMA 1HG3A 2O9OA 3PJXA 1QI0A 5D38A 1BTCA 3W9ZA 1K03A 5D2TA 1M65A 1JIBA 4B3KA 3IJ8A 1HVXA 2V3FA 5JBFA 3HJEA 1JPKA 1YHTA 2QMKA 3K46A 5AN7A 2WC3A 3R8HA 5AFDA 1KA9F 3W01A 3AICA 4E6MA 4Z2GA 2WM0A 5A6LA 1OWQA 3LCHA 1TR1A 4Q7NA 1XG3A 1OG6A 3WQEA 1OM0A 3MDUA 1KRMA 3R10A 4UTFA 4MWAA 2XVLA 4P7OA 4BF7A 2AQVA 3L2MA 4JHMA 4ZE5A 1X98A 3F4NA 3BSMA 3UWVA 1LG1A 4AD3A 3B8DA 4MKVA 3QV6A 4DJDC 4L6OA 2PDPA 3CWOX 2PC8A 3HG2A 3WD2A 2HZGA 1TMQA 2QF7A 4M29A 1JZ2A 5E6YA 2J78A 5D30A 1S5NA 3CO4A 2VQUA 3FK4A 4LUTA 1ML1A 4FOKA 1QUMA 4MZYA 1M04A 1R85A 2WSRA 2ATSA 2GSJA 1V4YA 1A4LA 4P7QA 1MI3A 4XBJA 4NZ3A 1OJXA 1EHAA 2Q71A 3MP3A 1HX0A 4A3QA 3TR2A 3S8HA 4EXBA 1P6WA 1PS9A 1ONEA 3Q65A 4IGHA 5ABFB 3CPUA 1W1IE 1OX4B 1XRFA 1Q13A 1W32A 5CLWA 4Y96A 4X61A 4XAYA 3WLTA 3VTRA 2OQHA 3M1ZA 2D0GA 1QK0A 3S5ZA 1X8CA 1Z9AA 2PAJA 4H3DA 2ZA2A 3F5KA 4V1YA 3PUGA 1GZJA 3U48A 1XIHA 4AG0A 3ZFHA 3WIJA 1NDYA 1VPYA 4K8GA 4Y9NA 1ALDA 2A3BA 3QZAA 4XZNX 1OEPA 2XFYA 1DIDA 1S5TA 2GOUA 1XX1A 3QYSA 1J0JA 5T91A 2WCSA 1MDRA 4HYWA 3T2PA 4CQ8A 2C1IA 4LT9A 1BXBA 1WKEA 3UXLA 5XINA 3IIZA 3VAVA 3RM9A 2E9LA 1XCXA 1TCDA 1NU5A 3LG3A 4J40A 1VF8A 1V77A 2R1KA 4EWND 2W4XA 3TDFA 2NT0A 4JNZA 3DKLA 5I2UA 1RPKA 4NIRA 1XLCA 1GCYA 3MBDA 4QAWA 2Z1VA 5D8ZA 3BAXA 3PG9A 5AKQA 4PEKA 3S83A 4AIBA 1XDLA 3NR0A 3BTNA 1TPFA 2Y8KA 2B7QA 4B16A 5C54A 4WDUA 3ITGA 3VZYA 1KB3A 1XS2A 4O14A 3FOKA 1XL9A 3NZGA 1W1TA 1AH0A 3SQMA 2WVUA 3TMLA 4W88A 1J96A 2OJPA 3ZT5A 3DXIA 1TTQA 4WGXA 3BMWA 5E09A 4CQCA 2PDWA 3A5FA 5HR6A 2NUYA 5FF2A 4UMBA 1IR2A 4U31A 3F1QA 1RP9A 1K7EA 1JUBA 1GOXA 4P2VA 6ENLA 1D9EA 2F6UA 7TAAA 1LORA 1XXXA 4CNTA 3UWZA 3WLPA 1VRDA 1WDDA 4DUXA 4IFKB 3P8IA 1CXIA 3DESA 3WBEA 3MWAA 3AUOA 4I90A 2WBGA 1M9HA 1R3VA 3IIVA 2OKOA 2BFGA 3K4DA 1W3KA 3EA1A 2PDGA 2GVLA 2QUTA 1OG0A 1Q3NA 1SM9A 3KP1A 4EF8A 2C16A 2G3FA 3S5SA 4P7LA 4AFYA 3AYTA 4LGXA 3AQUA 1KRCC 4ZXOA 1LTDA 4BJHA 1Q4WA 2PLJA 4X3ZA 3NZPA 2PDBA 1TX0A 2IUZA 3RX4A 2J75A 5FIPA 2X1UA 3W73A 3N14A 4H9ZA 4XTDA 3VKJA 4JX6A 3IJ9A 3NQFA 2XVKA 4BR1A 9XIMA 3PSVA 5HNRA 4M56A 3NSXA 2ACSA 4KPLA 1Q7ZA 3M9YA 4RZ6A 4R7OA 1HKJA 5CG0A 5D2VA 4KRTA 3WD0A 5JMUA 1PX8A 5KSWA 3R8RA 4W5ZA 2ZUUA 2E5BA 1K9TA 3SADA 4CCDA 1QPOA 1MFUA 3VOFA 3CT2A 2V6AA 3INPA 1P0NA 4XZHA 2EBNA 2J7HA 2DJLA 3LUTA 4HZ8A 1YPXA 3H2AA 2Z26A 4PUJA 3QLLA 2ZRVA 4HYVA 1BVNP 2ZYFA 3ZR6A 1XLLA 4HK5A 3UBPC 2J8GA 3QHMA 1AA1B 1VBGA 1V3HA 3T2QA 4WZHA 1JCMP 1LWJA 1US2A 3AU2A 3S6TA 4UB9A 2PWEA 1ENUA 1CGYA 4Z1YA 1BVZA 3CZKA 1GKQA 1FOBA 1RD5A 1HT6A 3SO7A 1OIFA 2GK1B 3M7WA 3CNYA 2FZMA 1MO0A 1A0DA 3DFTA 1GVYA 1W91A 2GVEA 4CNNA 3CASA 1JYNA 3MKVA 1XP3A 3BC9A 3KBMA 4JQ3A 4XISA 3ITVA 4PMZA 2WVVA 1HN1A 4CVUA 4UFHA 1EGMA 4UQEA 4AVNA 2X1RA 1E43A 3PSWA 4B9YA 5D09A 3UD6A 4NU7A 2W5FA 3MMWA 1TJPA 4FNUA 5JVLA 3TZNA 2VL4A 2J7BA 1W1A1 1UOZA 1NIUA 3G8EA 2VCBA 2JIWA 3TTQA 1E9ZB 1IIGA 4OU1A 1Y7VA 2QCEA 4RPPA 4QJ5B 1SZRA 3IUHA 4Q7BA 4NZFA 4ASTA 2WAGA 3LPOA 2Q3OA 4IIEA 1UWRA 1AQMA 1V0KA 2GDQA 3RX2A 4HPHA 1KV5A 1W1VA 1E4IA 1O95A 3TIMA 2O0TA 2E5CA 1XSJA 3KVKA 4MDOA 3D47A 4KEUA 4DY1A 2PF0A 3OLEA 2HWGA 5GNYA 1XIEA 3NGJA 1W56A 5DRIA 1L2UA 1SJBA 3M0LA 3LI1A 2VVSA 2PDLA 1FFRA 1W3LA 2DZVA 3HB9A 1JXKA 4D6IA 1CIUA 1SYTA 3EOLA 4UMCA 5JQ9A 1KTBA 1VFMA 2A3HA 2QV5A 1R2RA 1VYRA 3TQVA 3H7VA 3EOSA 3QV9A 4PB3A 1L8PA 2BY0A 3AMLA 2XWEA 3H2CA 2YGYA 3PTQA 4L5ZA 1XQLA 1EO7A 4XWUA 1Z8AA 4LS2A 3C8NA 1Z7AA 2C1HA 1QMLA 3CIXA 4B91A 2PTZA 3DI1A 1GJWA 4LAUA 1YBQA 2RDXA 1U22A 1TJ2A 4D6EA 4WVXA 4WQ6A 5JH1A 1H2JA 3MA8A 5FSEC 2Q01A 2GVGA 1E0TA 3GLCA 1TV8A 5GJMA 4I7UA 4RCXA 1IGWA 3E74A 3N4EA 3UWWA 4KGJA 4MVAA 1K70A 2ZDRA 3T44A 1XIJA 2DSUA 3CBWA 1J18A 4CD6A 5FEZA 2DUXA 1PBGA 4GJIA 4Z1AA 1A5LC 3I7SA 3L5MA 1XYBA 4RNHA 1TA3A 2RUSA 4M5PA 3RJYA 1EUAA 3BVJA 4C6BA 4LYPA 4XD4A 4AH7A 1VS1A 3AIVA 1SMAA 4LALA 3QKEA 4MG4A 2P10A 1N8FA 2NQJA 1ODZA 4DXXA 3WF1A 4WD0A 3W7HA 2Y5EA 3RR4A 4LNCA 3T55A 3VE7A 3WSUA 4GJJA 3WBWA 1T96A 4GFSA 3BOLA 1L0PA 4WY0F 3NL3A 1H50A 2E0PA 4N4QA 4E5TA 4QQUA 2XN2A 2BV9A 3M5XA 1AG1O 5I3IA 1VPXA 4QG6A 4MYAA 1WUFA 3NQAA 4UNLA 3LLDA 4NNAA 4O15A 6A3HA 3GYEA 3WELA 1GOIA 2AQWA 3C0SA 2PWVA 3CZJA 3FDKA 4LOCA 1IXQA 2CYGA 3TFCA 1AD1A 2KZHA 3CTTA 1DORA 3RUBL 3WEZA 2WWCA 1GTHA 3BK0A 4JY9A 4QAIA 2ICSA 1PIFA 3KWXA 2VWSA 3WN6A 4GQGA 3N15A 2PCQA 5XIMA 1QK2A 5AYIA 5F4SA 1FX6A 2DFAA 4G7EB 4R88A 4DZHA 1KXTA 1ZU8A 3P14A 3PAJA 1WBHA 4PUKA 3NQGA 5TF0A 1EXPA 4JX4A 4JCLA 4K8EA 4JCMA 1C7SA 2MNRA 4V1XA 1P0BA 3ARZA 4QROA 1QU4A 1F61A 3MHFA 2V67A 1FKWA 1MW2A 3PNZA 2YL9A 3Q4DA 4A05A 3W26A 1TPUA 5BCAA 3CU2A 4R7WA 1IT7A 3H26A 3B0PA 5EFFA 3JRKA 3UZYA 4S3EA 1YDVA 2V3EA 5HAOA 2RH9A 2WM1A 2V2HA 4IMFA 2OLAA 3FY1A 3TK7A 1SW7A 1PPIA 1FY6A 1EGVA 3N3MA 3H21A 1UIOA 4Z1BA 1RXOB 4XAGA 2EO7A 1EA9C 2OLSA 4GYFA 5CGMA 2E1WA 4Z08A 1G01A 1CWYA 1JQXA 2WNNA 3TYZA 2JALA 4PRWA 4K2SA 3GFYA 3V75A 3BW3A 2OT1A 3EWCA 2Z29A 1R47A 1UIPA 4J27A 1TPWA 4DVOA 2I14A 4GK8A 1OHLA 3QHNA 4TVUA 4M51A 4AZCB 3PUEA 1K8ZA 5M3WA 4LF1A 3B3DA 3GIYA 4BY3A 2OWCA 1UD5A 1X6NA 4X60A 1XG4A 4FXRA 2VDGA 4GZEA 3DAQA 5AYBA 3TR9A 3MKCA 3KBJA 2OT0A 3A3XA 2ZIDA