5C54A

Crystal structure of a novel n-acetylneuraminic acid lyase from corynebacterium glutamicum
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
310
structure length
310
Chain Sequence
SATFTGVIPPVMTPLHADGSVDVESLRKLVDHLINGGVDGLFALGSSGEAAFLTRAQRKLALTTIIEHTAGRVPVTAGVIETTTARVIELVEDALEAGAEGLVATAPFYTRTHDVEIEEHFRKIHAAAPELPLFAYNIPVSVHSNLNPVMLLTLAKDGVLAGTKDSSGNDGAIRSLIEARDDAGLTEQFKILTGSETTVDFAYLAGADGVVPGLGNVDPAAYAALAKLCLDGKWAEAAALQKRINHLFHIVFVGDTSHMSGSSAGLGGFKTALAHLGIIESNAMAVPHQSLSDEETARIHAIVDEFLYTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a novel N-acetylneuraminic acid lyase from Corynebacterium glutamicum
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase/N-acetylneuraminate lyase
total genus 118
structure length 310
sequence length 310
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c54A00
3LDVA 3GX9A 4FF7A 1WDWA 4U4MA 3I7SA 3TQKA 4DELA 5TQLA 4E38A 2CLHA 2GQAA 1KM3A 1YDVA 4JTHA 4IXHA 2JK2A 3GXTA 5HWMA 3UWUA 2J27A 3RFAA 1OFPA 4UTUA 4Z1CA 5DCDA 1A5BA 2A7NA 1OF8A 3L5LA 2VFDA 3BLIA 1EP1A 3TROA 1F6KA 1H60A 1KFJA 1MEWA 1YTDA 4N02A 4BF9A 1KM2A 5BNKA 5DN1A 1FCUA 2WSRA 3HGRA 4NJIA 2FTPA 4AB4A 2WKJA 3CWOX 2E09A 3M43A 1EP2A 1KW1A 3MO7A 3LI0A 5AYXA 2TMDA 2FPYA 4DF2A 2CZEA 4BI5A 3SECA 3FYOA 1XXXA 3IV3A 3OVPA 1QFEA 3GNDA 1D9EA 4WY0B 2KZHA 4HHPA 2EGZA 3TNOA 1OABA 5A5WA 4UR8A 2E6FA 3NM1A 2H3DA 3LCWA 2CFFA 4LT9A 6ALDA 1H62A 4C1LA 1PCWA 4QJ1A 1SSDA 3HGSA 3TFXA 5C5YA 4UR7A 2F84A 2NUYA 2ZZ3A 3W7QA 1VS1A 1FXQA 5A8GA 3VE9A 3L9CA 3LHUA 1OYAA 5K2ZA 2VXNA 1EUAA 3C2RA 4P2VA 3W1TA 3TE9A 3GR8A 1SO3A 3M47A 3GDKA 4OV4A 1H61A 1VHCA 3E02A 3CPRA 4Q33A 1WAUA 1F73A 4ZQRA 3GR7A 4IGHA 1AK5A 2DU2A 3JR2A 4ORIA 4JYEA 1U5JA 3NM3A 5F2GA 2DJLA 3ELFA 3W2KA 3B06A 4K6AA 3TQVA 3P84A 2CLMA 4IQLA 4UMBA 2QAPA 1LCOA 2V0TA 3PS7A 3QPZA 2C1HA 2YW3A 1W1ZA 3T7VA 5L9FA 2CLIA 4O53A 2V9DA 1ICPA 4N9DA 4GJ1A 3W2NA 4O50A 3UZJA 1KM1A 3EX2A 1T96A 2DZWA 5AHNA 4MFEA 1OFQA 3BV4A 4D2JA 4GFSA 4GUHA 4BWLC 2NXGA 2ABAA 5FEPA 3WJYA 1ICQA 1TPWA 4TU1A 3RK8A 2B7OA 1GYNA 3M5VA 1ME7A 4DBEA 4FNUA 4BWLA 5K9CA 1FXPA 2QDGA 4GE8A 3N14A 3BO9A 3C3NA 1RZMA 2WNQA 2X2GA 3TH6A 4LRTA 3HOJA 4XBKA 3N73A 5F2MA 3C56A 1W5QA 3TIMA 5DXXA 1W5MA 4TR9A 3W22A 3NQDA 2ZZ5A 4JDYA 5HMSA 3LV5A 1Q6LA 4LU0A 3QQ0A 3SI9A 4I7UA 3LTPA 4LS2A 3TW6A 3THAA 4JX4A 1XBVA 5HULA 1SO5A 1V7YA 4O1DA 3LTYA 1TMHA 4JTTA 3IGXA 4R33A 1IXQA 4Y90A 4ZZ9A 3W23A 1EP3A 5C54A 1MXSA 4MVAA 2PE4A 4FXSA 3C8FA 4QAIA 2YYTA 1UUOA 1VHNA 1LZOA 3DU0A 1KBIA 3MHGA 3UNDA 3UY8A 2C19A 3PUEA 3L67A 2NV2A 3P8JA 4WX2A 4DO5A 1TV7A 2ZRVA 4QITA 3NPVA 4NZFA 1TTQA 1GTEA 4FB7A 1MZHA 1XUZA 5D03A 1VPXA 1OK6A 3EKLA 5HUPA 3L21A 5FF0A 1I45A 3T44A 2QR6A 4R34A 4NNCA 3C61A 5I3GA 3F4WA 3CWNA 3RF9A 3WK3A 3DFQA 3TMQA 5HWJA 4UFJA 3G1FA 5AFDA 3W7EA 4UNKA 1IIHA 2VFFA 3V75A 4LWWA 3UXDA 3E96A 2PCQA 4IPJA 1PHQA 4BI6A 5LKYA 3NEVA 3VE7A 3G22A 2BXVA 4ONVA 5CZSA 1I4NA 3PSWA 3W1RA 4JICA 2NXHA 4NUWA 1TTJA 3W2MA 1I2PA 4UFMA 2ZQ0A 2BWGA 3NR0A 4IXXA 2FFCA 2NUWA 1O94A 2A2IA 2C18A 5BOOA 4RJEA 3DHDA 1LM1A 4LC8A 1EIXA 1GZGA 4HIBA 2RFGA 3RMJA 1KFKA 5EL1A 4ZQMA 3PM6A 1ALDA 4ICNA 4MY1A 2ZZ4A 5HWNA 3PVFA 3IGUA 3LLFA 4IUOA 4AWTA 1H7OA 1LOSA 3RLVA 4MZ1A 4Y6GA 1ZNNA 1C29A 4PL2A 3NQGA 4A2RA 1Q6OA 3W7GA 3HJZA 1RQBA 4DBDA 1WYIA 3EWUA 3UQNA 2QCNA 3MJYA 5U4NA 4MIMA 3MBFA 1U83A 2QJHA 3SGUA 3BG9A 3PG9A 4O8RA 3QQ1A 1B4KA 2Z2UA 3G8EA 1JUEA 2C15A 5DLCA 1NVMA 2H3BA 2ZA3A 1TV5A 2NV1A 2ZA1A 2Y7EA 3ABSA 5AC8A 5LZLA 1M5WA 3QFEA 4FX7A 2O7SA 4PTNA 1R2TA 3UPBA 3G1XA 3R8RA 3QYQA 3E0IA 4NXKA 4EWND 2X1TA 4JS3A 5I3FA 1FBAA 4S2BA 4N9CA 5FESA 3IIZA 4RKAA 1OJXA 2NX3A 3S5NA 3TC6A 2VFEA 1KA9F 3NPXA 3QMRA 1TJPA 3BPWA 3PC0A 1FDZA 4JEQA 2R91A 4BI7A 5D30A 2V2CA 3W1MA 3W7IA 4MY9A 3QPYA 3S8HA 4DEFA 2TRSA 4N4PA 3P5ZA 4UCGA 1W54A 4MLJA 4XTDA 5G4WA 2VOMA 5GVJA 4HNTA 3ZWTA 1YADA 3DFPA 3HPSA 5DCEA 1K7FA 4Y8FA 3QMSA 5F1VA 1HL2A 5F2LA 3W1XA 2ALDA 1KFCA 5D2VA 4FXRA 4MUZA 2Y61A 1Y0EA 5CG7A 4WOQA 3PULA 4A22A 1LBFA 2OT1A 3HIJA 3CEPA 5HJLA 2WO5A 1DJNA 3GAKA 3LRMA 4HN4A 4DXVA 3CB8A 3T4CA 2F7FA 1IXPA 3P80A 5BRBA 1LRTA 3PR2A 1AL8A 5F1UA 5C2XA 4ZQCA 1CX9A 4ZMGA 4WOZA 8TIMA 3O06A 4RX0A 3JRKA 4DPQA 2B7NA 3TCEA 4E0CA 2JKEA 4S1FA 4AEOA 4TX9A 4AHQA 1KBJA 4UTMA 3W71A 1C8VA 3H54A 1EWDA 4JTSA 3DFNA 4O54A 4RCXA 2Z6JA 3EX6A 1EWEA 4AAJA 4KFNA 4NJHA 3T55A 1TPDA 2NZLA 3L0KA 3LCXA 1PE1A 1L9WA 1PIIA 5G2WA 1AW1A 2E6AA 3W87A 4HT3A 3EKZA 1LYXA 2A5HA 1A53A 1FDYA 2G95A 5DXYA 4ML9A 4NNBA 3GNNA 4M7SA 4IWWA 3WJZA 1JQXA 4I9AA 2QCDB 1RQEA 2ZZ6A 1KLZA 5F4WA 1G4TA 1SZNA 3M16A 4JIQA 4KFPA 1JCYA 2DZXA 1GVSA 5G1YA 4E2BA 1IXNA 3L68A 4QQ3A 4IOTA 3HPXA 2W6RA 5D2XA 5F4SA 1PVNA 1I2RA 1TQXA 2QF7A 4RV8A 4HNUA 1TYGA 1OFOA 3DAQA 1JJKA 5AHEA 1QMLA 3BVJA 3JS3A 3W7NA 4JTEA 2J9ZA 4Y96A 2FB2A 1ZAIA 3C6CA 4JTUA 5G2HA 2RDUA 3M41A 4AH7A 3C2VA 4HSNA 3G3MA 3LCLA 5KITA 2NLIA 5CKSA 4ADSA 3QRHA 2JKAA 1JRCA 1AMKA 1GOXA 1CI1A 3PBUA 3NDOA 4Q32A 2C0AA 1RD5A 4L4LA 1A50A 2X1UA 5BMWA 1YTKA 4JXCA 3W1NA 2C3ZA 3QSRA 4PL1A 1GJPA 3W70A 4ALDA 3IVUA 4LVGA 3TA6A 1VLIA 3CLMA 1AL7A 4N2YA 2TYSA 1FX6A 3QJAA 3W76A 1QOPA 1HUVA 5LHEA 3ABQA 1R30A 1OFBA 4O12A 4Z1BA 3STEA 1G4PA 3HG5A 3FKRA 4XBSA 1LTDA 4RXGA 4C1KA 3I68A 3FLUA 2E5DA 3MBDA 1P1XA 3O05A 3VCRA 2UV8G 1H5YA 1OF6A 3A5FA 4ZQPA 3LTSA 2YFOA 4UTLA 4OGZA 1XBYA 4K38A 3R12A 1FCBA 2ISSA 3R13A 3M44A 4DF1A 3MI2A 1G7UA 5LHFA 4UTTC 2H6RA 3N19B 1P5BA 4E2DA 3T40A 3TU9A 3W6YA 5FF3A 4HPXA 1K8ZA 3NQVA 1YDOA 3LCGA 1WA3A 1N8FA 5CPMA 5J5DA 1YTEA 3O63A 2H8XA 3QZEA 1OVDA 3NO5A 4L4MA 2ZCGA 1UUMA 2JGQA 3MUXA 3S5ZA 4A3UA 3NQ7A 3NOEA 1QO5A 3N9SA 2HMCA 5CSRA 1BTMA 2GVJA 3P74A 2CWNA 4ORMA 2ZDRA 3THQA 2V81A 2P0OA 2VFGA 4NZJA 3TJLA 2VEPA 3O1NA 3UWQA 3W7PA 4RZ6A 2ISVA 3MW7A 2E5BA 1TSIA 1SO6A 3W07A 2HTMA 2E68A 1NF0A 3CIXA 1OX5A 1KFLA 2A7PA 1TTIA 3VI2A 2ZBTA 4Z1DA 1SPQA 5EYWA 3ZS4A 3T78A 2WSQA 4RZ4A 1K7XA 2E1DA 3W72A 3W7RA 4X9SA 2A6NA 5LGXA 4JGDA 4G1KA 5K7JA 4N9BA 2QUTA 2DZTA 2Y7FA 5I3JA 5G4EA 3MMTA 4UFHA 3W73A 3H53A 4WUIA 4N6EA 3ANYA 4UTTA 4AHPA 2OMAA 1S3HA 3W9ZA 1MSSA 3PB0A 1TQJA 3HG3A 3FOKA 1EX5A 3GZ3A 1HO1A 3LHZA 2Y63A 3M5ZA 4DPPA 3GYEA 3P5YA 1DOSA 4LVBA 5FEZA 1XBXA 3ZWSA 5AB3A 5EMUA 3MYOA 3C52A 3EXTA 1TO3A 4XUGA 3IIPA 3NGJA 3HG4A 1B9BA 1TPC1 5U7SA 3MP3A 4PC8A 1KM4A 1OK4A 3EB2A 1F7BA 1DQXA 3A24A 4M7TA 2AAMA 3A21A 4LY8A 3S1WA 1FCVA 4UTIA 4UTWC 3MI6A 1TPB1 2C16A 1XC4A 3U6WA 4RZ5A 3ZFHA 1X7FA 4I7VA 3W88A 4IPIA 1M7PA 2G5WA 2C13A 3MP5A 4CCDA 4NVTA 1G67A 3GB6A 2QDHA 4NT0A 3MWAA 1S5WA 1W3IA 4K7VA 3EWWA 1XL9A 3EXSA 3TC7A 3OVRA 5IM51 2OCZA 2QCGA 3MI3A 1PHWA 1VR6A 3L2IA 3W1UA 3QW4B 1THFD 1FWTA 1LOQA 2CU0A 4TMBA 4O14A 4JYDA 1XDMA 3QH2A 2Y88A 1JCNA 3W2JA 2GOUA 5EKYA 3ATZA 3W7JA 1KM5A 4J9JA 2R14A 1KTCA 3O6DA 5BW6A 1X1ZA 1HFBA 3UWZA 2NX1A 4WD0A 4XZ9A 4HNNA 3BW4A 4X22A 2WNNA 1SQ7A 3KRSA 2HS6A 1KM6A 2Q8LA 2EPHA 2EKCA 1E51A 4QM1A 4UFLA 5DBTA 1TPEA 7TIMA 5CPLA 2AGKA 3R89A 1SU5A 3NVTA 3UY7A 4NJKA 2ZRZA 1CW2A 3PF3A 4A29A 4ZQOA 3GKAA 2X16A 4BK9A 4RLIA 1W3NA 3N2MA 4N4QA 2FJKA 2IQTA 4UUIA 4JTLA 4AWUA 1RR2A 1GEQA 5FF2A 3DH7A 1Z42A 3WFAA 5J5RA 2A0NA 3TW7A 3W1PA 5DY2A 4EVZA 2CW6A 3O15A 2Q3RA 4GBUA 2XN0A 1DHPA 1F2JA 2LLEA 4UMAA 3NQ6A 1DJQA 4JNMA 5EA9A 4LS0A 1I2QA 1JVNA 2BX7A 2ZRUA 2J24A 4LUIA 3ZR4A 2YR1A 3HF3A 3USBA 4Z0JA 1ME9A 1VRDA 3STFA 5DY3A 3OEXA 1FWNA 2DP3A 3UYCA 1GQNA 3LXBA 2QCLA 3A22A 3LHVA 5AYYA 1GVOA 1M7OA 1K7EA 1MEHA 2OJPA 3BLFA 1PCKA 1WOBA 3FYPA 4IMGA 4EF8A 2WV8A 3TXVA 4GNJA 4MJZA 3SJ3A 3R5EA 3M5XA 1ADOA 3NXFA 1LORA 4MKNA 3I6RA 1W37A 1FQ0A 4IMEA 1WV2A 4POCA 3P8IA 3CM4A 4FHAA 1XFBA 1QPRA 3UD6A 1FDJA 1T8XA 1IF2A 5EPDA 4ADUA 3CEUA 4O11A 5D33A 3P67A 4K7YA 1KV5A 2Q3OA 3TJXA 4YMZA 4O28A 2I9EA 3O07A 1L2UA 1ZAJA 3DKLA 1EA0A 3S5YA 3VNDA 3GDLA 3KVMA 4M19A 5CGQA 1QCWA 3NQCA 1XDLA 3P60A 1TREA 2CZDA 2ZTJA 3B0VC 2VEIA 3W7LA 4O15A 4FO4A 3LCFA 1JUBA 3E49A 5CPNA 2WOQA 1RV8A 4RR4A 4HNVA 5KZEA 2DORA 1NFBA 5DELA 1OYBA 3EWXA 3F03K 2Z6IA 2RDTA 3PBYA 1VJIA 4UXDA 1RVGA 2R94A 1M6JA 1JUKA 2NUXA 5LNRA 4CQ9A 3S0CA 4RXFA 4XKYB 1P0KA 5D2WA 1AW5A 4P61A 3G1SA 3B0UX 5TBOA 3BG5A 2GUUA 2J9YA 5KINA 3W84A 3CHVA 4CQ8A 2RH9A 3P61A 1UJPA 3OVQA 5D2TA 1R47A 4LRSA 2E77A 5I3IA 4UIOA 3S6DA 1Z48A 1W31A 3R2GA 3BW2A 4UMCA 5K9XA 2EF9A 1H63A 3LOTA 3I7QA 3G0XA 1OFEA 3GLCA 3CQ0A 2YSWA 1VYPX 1SW3A 1OX4A 4LV4A 3PAJA 3OG3A 1XKYA 3C2FA 1OHLA 2W79A 1H7RA 1OX6A 4WXZA 1O60A 4MYXA 4GUGA 2V2DA 3DI1A 2FPTA 1XM3A 2X1SA 5AN7A 3S1VA 3PY2A 1SZGA 1W5OA 5H91A 2EAWA 3KRUA 4NQ1A 3DBPA 1TV8A 1ZENA 2Y85A 4O52A 1QDSA 1Z41A 3FIGA 3LXAA 4O17A 1YPIA 2PRLA 2C14A 3I7RA 1FWRA 2VFIA 4NJGA 3W3OA 2FIQA 3G0SA 1YXDA 3GDRA 1YPFA 4GUFA 4EF9A 1X8FA 2NX9A 2A6LA 3TK7A 1ZAHA 1KM0A 5IBXA 3NL5A 2WJZA 3HG2A 1JCLA 5F4XA 4AF0B 4FNSA 3SSJA 3LRKA 1UBSA 1TRIA 3QW3A 4LUJA 3DFTA 2VENA 1H51A 1QPQA 3HB9A 3TMLA 1FUYA 4FNTA 3TSDA 1K8XA 2ZA2A 3DI0A 4IMCA 4A21A 2ATMA 2B4GA 3Q37A 3CT7A 4UFIA 1IIGA 6TIMA 1H1ZA 1T0OA 1W8SA 2YFNA 4NU7A 3WJXA 1GVQA 4WY0F 1PV8A 1HG3A 1VCFA 1DVJA 1EEPA 1SZFA 1GWJA 2YYUA 1TRDA 1G4EA 1I2OA 4OBTA 2VFHA 1QO2A 2ZRWA 3NQEA 3L66A 1B3OA 3SFKA 2QCHA 3A9IA 3BG3A 3PG8A 3MHUA 1P4CA 3L0NA 1DBTA 4IX2A 1QNVA 1H1YA 4CLMA 1GYLA 2CZ5A 3G24A 4OV9A 1H50A 2QCMA 1IXOA 2P1FA 3U8GA 5F2IA 5LGZA 3GXPA 2I14A 4M5PA 4M6PA 1KTBA 1YXCA 3M9YA 3M5YA 3W7CA 2YDAA 4PA8A 4QIUA 3QSTA 2AQWA 3TV8A 3CC1A 4KWWA 1NSJA 1K02A 1VYRA 4AMAA 3RNDA 1W0MA 4FNPA 1G4SA 3HGJA 3KX6A 4LVFA 1LBMA 2YGYA 1YDNA 3B03A 3LBMA 4O0KA 4JR5A 4X3ZA 2V8ZA 2JKPA 4O19A 3G1YA 2PURA 3EX1A 2WNZA 4EIVA 3KAOA 2GQ9A 3HQ1A 2GJLA 1VLWA 1H7WA 4XTIA 5E0KA 3IIVA 1UB3A 3TKFA 2Y7GA 3TAKA 4DF0A 1DQWA 5EBUA 1S5VA 3SIZA 4QSHA 3O8AA 4OE7A 4IMFA 2ZYFA 1EPXA 1PL9A 3BGJA 4K8HA 4O1CA 5LNUA 1TCDA 4GRSA 2OZ0A 2DZVA 1DV7A 1YXYA 5ABTA 4I7WA 4JIPA 2BSLA 2YPIA 4UTJA 4LV9A 4NJJA 1FWSA 4M6VA 3G8RA 2E5CA 1ZCOA 3C4UA 3W7OA 3N3MA 3EWYA 5CPOA 3M7WA 4O18A 1R46A 3UWYA 3LERA 4PFMA 3NPWA 3FKKA 3NZRA 3LGEA 3DENA 1T99A 4O10A 2JBMA 3N9RA 3B04A 3DHFA 5HINA 3L5AA 2H90A 1I8JA 1D3HA 1Q6RA 2B7QA 3PWAA 3SR7A 2Z0IA 2V5LA 4OU1A 1ZHAA 1R2RA 1TJRA 5AYZA 3WJSA 1L6WA 1BWLA 1C9DA 2BTMA 2CLOA 3KXQA 1A5SA 4UTHA 4WXYA 3WK1A 4NNAA 3EEGA 2GVLA 2WQPA 3BARA 3LX9A 4N9EA 1UASA 1GG0A 4DQWA 4YLWA 3M0ZA 1A5AA 1Q3NA 5C6MA 1QPNA 1XUUA 4LC6A 4LNYA 2GQ8A 4DO6A 4B5NA 1DKWA 1WQ5A 3G18A 5FEXA 1XCFA 5T26A 4TMCA 4OWGA 1XI3A 3IVTA 4K8EA 5CZ0A 1OG0A 1H7XA 2E6YA 4OQVA 4UTKA 3NPUA 3F1QA 3U2OA 1ZY9A 3W1LA 1F76A 1OFAA 2PRMA 3HMJG 5D05A 2Y7DA 3GKFA 5D38A 4U28A 3B4UA 4MOZA 1JR1A 1VYSX 3NG3A 5AOUA 4YWIA 1KTNA 3SY5A 5D09A 1WOAA 2DZSA 4DO4A 1VCVA 4FNQA 2QAFA 1JQVA 5KZMA 3LM7A 3IEBA 3CIWA 3FA5A 2GPTA 4UC5A 3DKJA 3DZ1A 3GDTA 3ABRA 3F4NA 1OYCA 3LB0A 4NX5A 3SGZA 1BEUA 3INPA 1WX0A 1TPVA 2O7QA 4CQAA 2Y62A 2V2HA 4ADTA 2QCDA 3NNTA 4IJBA 3KRZA 1HO4A 3BK0A 5HNRA 1EUNA 1D3GA 4GUIA 2ZFAA 5G5IA 2PRHA 4JTIA 3UPWA 4O1AA 2OX1A 5TIMA 1JCJA 1GVFA 4CNOA 3KVKA 5FF4A 2V30A 3AO0A 3S1XA 3C0JA 2DZUA 1F6PA 4Z1AA 3W1AA 2W0UA 1WBJA 1SW7A 3OBKA 4O57A 1W5NA 3MYPA 1H7PA 1G7VA 1LLWA 5BMXA 2Y6ZA 3TAOA 4H3DA 3FJLA 3IVSA 4MFDA 4W9TA 5E1QA 3HPZA 3QMTA 5G2IA 3W75A 2Y89A 3NAVA 1O5KA 2E6DA 1O95A 1W56A 4ZVJA 3OIXA 1LBLA 3P62A 5K4ZA 3SZ8A 3UXAA 1J2WA 1VQTA 3OA3A 3SW6A 2NWRA 3PUOA 4NXSA 2D73A 1K8YA 5AHIA 3IRDA 3BLEA 3GXNA 4LVDA 3W7DA 1AW2A 5I3KA 3GAYA 4JTJA 4CCEA 1N55A 5AHMA 3L0GA 4R7JA 1X1OA 3DFSA 2GJNA 3PSVA 4H6KA 1GG1A 2R8WA 4AVFA 4HPJA 2OT0A 2QKFA 4OT7A 3E12A 4LS1A 4Y9AA 3EXRA 2JGYA 5C55A 3E9AA 3G1AA 3UWVA 1ZJIA 1GT8A 3LI1A 4Q4KA 4XWUA 4QNWA 2FLIA 1F5ZA 1UCWA 1X6UA 5HR7A 3G1VA 3WJWA 2RDWA 4O4WA 3P7YA 3P82A 3G0UA 2A1YA 1YLVA 1TIMA 2DJXA 1J5TA 2RKXA 2J88A 3LXCA 3TQ0A 2YZRA 1S5TA 4JD4A 1LRQA 1BWKA 1LOLA 3LHWA 4R53A 4JTFA 3NL3A 1R2SA 4S2CA 4CNPA 2XN1A 3HO8A 3QC3A 2J6XA 4A2SA 1ICSA 3WK0A 2CLKA 3I65A 1O5XA 2PC4A 4AWSA 2X30A 3LHYA 4WZHA 1FCQA 4K36A 3LBCA 4YL2A 3NQ8A 5D32A 5KMYA 5LNVA 4JX6A 4TO8A 1IGSA 2CLFA 4O0ZA 3IIOA 3AJXA 3W85A 4N6FA 5SWUA 2ZZ7A 3A23A 3O6CA 4FIRA 3BGGA 4FNRA 2QCFA 4GWEA 4FEZA 3HGOA 1WBHA 1N7KA 1NEYA 2Q8ZA 4PH6A 3TXZA 5FF7A 1VH7A 1Z44A 2BZNA 1LROA 2VEMA 2B0MA 2H8ZA 3TSBA 2BLEA 1TPUA 1H7NA 4X2RA 1TTPA 5KSWA 1BKSA 3LRLA 2A4AA 1PS9A 3C2OA 3FFSA 2I1OA 4WJEA 3QEZA 4MZYA 3O16A 5DCBA 3NA8A 1NAL1 2XN2A 1QPOA 1DORA 3GDMA 2G96A 1AG1O 2ZRYA 5HQEA 1W3TA 2A21A 2C6QA 3KOFA 4KKXA 2ATSA 4AF0A 4K39A 5K4XA 2NXIA 3TR2A 3B05A 3L65A 1MO0A 2QJIA 5MHBA 3EWZA 1J4EA 3FEMA 3O6YX 2DZPA 2QEZA 5G1TA 4PCFA 2VELA 3RU6A 1K03A 3HBLA 2YCEA 1KV8A 3GK0A 3MP4A 4XKYA 3Q2DA 4TIMA 3PBVA 1KFEA 3KFTA 3L5MA 4JDBA 4QISA 4LVAA 3TX9A 5K3VA 1SSGA 1OX4B 4M6QA 3QF0A 5D04C 3N2XA 3PBWA 3YPIA 3FS2A 3IGSA 2QJGA 3K30A 2J9XA 4GUJA 4Z0SA 3M1ZA 2Y70A 5E93A 2XFWA 3NL2A 1NF7A 5I3HA 2ZZ2A 1Q6QA 3A5VA 2FQIA 5L6UA 3EX3A 1YYAA 4CCCA 3W86A 2YX0A 4JN6A 4JY9A 2ZRXA 3M6YA 4GC4A 1EB3A 1JRBA 4LTSA 3C2EA 1ONRA 3DGRA 5AC6A 3MHFA 3TDFA 3BW3A 5FI8A 1SO4A 3QM3A 1GTHA 2CLEA 4O13A 3S5OA 5D02A 4MYAA 3Q94A 5AHFA 5H2ZA 5LSMA 3DFOA 3TSMA 1SFLA 4AHOA 1HTIA 2V82A 1OFRA 2HSAA 3G1DA 4JTGA 5KTLA 1FWWA 3KHJA 4JY8A 4BFAA 2ISWA 4ZL1A 1F05A 3FJ6A 5D37A 1DL3A 4OHQA 5D2YA 1L6YA 3V1PA 2A7RA 1TB3A 1KFBA 2QCCA 5EY5A 3ATYA 1SW0A 3TFCA 4O16A 5AC7A 1FY6A 1O4UA 4YXGA 3W7HA 4FX8A 4KWVA 4FIQA 2CLLA 4JX5A 4MY8A 3ABOA 3N34A 4CNNA 4O1BA 5LNSA 1VCGA 3P81A 5FEWA 1W5PA 3W1QA 4MPQA 1WXJA 3UWWA 3Q58A 2QCEA 2QUUA 2G97A 4HSOA 2TPSA 2GVGA 3S9YA 4IX0A 3NQMA 4KFOA 1LRNA 3NYZA 2ZZ1A 4HKPA 1F74A 4WY0A 4UTWA 4H4IA 4K37A 5HR6A 2Z1BA 4LOCA 3WK2A 1I2NA 4AXKA 3W7MA 2V5BA 5CSSA 2A85A 1RPXA 2FDSA 1QWGA 1SZEA 2HS8A 4XQ6A 4Z08A 4IMDA 1B4EA 1JCXA 3VFLA 2TSYA 2WPBA 3EWBX 3STCA 3RLUA 1QR7A 4UNLA 1LLZA 1G6CA 4MJMA 3LCHA 5CZTA 5AHLA 5IBXC 5DBUA 1GPWA 4PEKA 3NQFA 4EOUA 1VZWA 1QAPA 1SUXA 4MZ8A 1TPH1 1QOQA 2VC6A 5LNWA 3CU2A 4JYFA 3W74A 1KLYA 4BR1A 1OFDA 3STGA 1K3UA 3TUUA 2QUVA 3D0CA 4QNEA 1MEIA 1B57A 2WSYA 4UFKA 1ZFJA 3H55A 1ZALA 1RQHA 3NQAA 2ZTKA 3NL6A 4YCOA 3W7KA 2P10A 3PB2A 3GIYA 1A5CA 1JCMP 1G69A 4LW7A 3OHIA 3W2UA 2FPVA 3LCIA 3KVLA 1GVRA 3UZ5A 4ZQNA 3LHTA 1ML1A 1XBZA 2VKZG 5HUOA 3W83A 3CTLA 1ME8A 3KVJA 1L6SA 3VKJA 3S42A 2RHGA 1LP6A 4JTKA 3GVGA 4NX0A 3PUDA 4FX6M 3NQ2A 1VGAA 3LV6A 3G3DA 3LLDA 1TPFA 2EHHA 1P0NA 1LDCA 1VC4A 5K9DA 1JULA 4WQ6A 3EX4A 3W2LA 2NWSA 4O4VA 4GXMA 1SR9A 3S1UA 2ABBA 2YXGA 3B8DA 1SFJA 5CZJA 4PODA 2X1RA 2B7PA 3IIXA 1Q45A 2CZFA 4MLRA 3DXIA 4RK8A 2VEKA 3G1HA 1V5XA 3B0PA 5KZDA 2FB3A 4YCPA 3NZ1A 2YW4A
chains in the Genus database with same CATH superfamily
2AQVA 2GK1B 3ID7A 1OCJA 3M46A 2PUZA 2RJGA 3HFTA 1KM3A 4JTHA 1U22A 4P8UA 4IXHA 3SIMA 5HWMA 2NVDA 1OFPA 4FS9A 3N9KA 4Z1CA 3TA9A 4UTUA 1UP3A 4BHYA 4Z2GA 3TROA 2OKTA 1F6KA 1H60A 1LUCB 3V16A 1YTDA 4N02A 5HPOA 4BF9A 3REQB 1FCUA 2WSRA 1PZ0A 3HGRA 1R7OA 4LFYA 5IDIA 1QVBA 4S3KA 1U33A 2J7EA 3CWOX 2VEGA 2TMDA 1B3XA 1JZ8A 3PZVA 4NF7A 4E8CA 3SECA 1E1CA 1UR0A 4U2YA 3NZQA 3OVPA 2PDJA 2PWFA 3QGAC 1OCNA 1XYLA 2P5NA 4EAMA 4C6DA 2WSKA 3LCWA 4LT9A 4ZOAA 3CQJA 1SSDA 3ES7A 3HGSA 3TFXA 3U0HA 5C5YA 4UR7A 4ML4A 3W7QA 4C6EA 1VS1A 5A8GA 3L9CA 4D8ZA 3GVVA 1KO0A 4P2VA 3B9EA 2EJ1A 3HQNA 3E02A 3WDJA 3WLOA 3JR2A 3WDRA 4KIRA 1VD6A 1AD1A 3NM3A 2DJLA 4FOUA 3PJWA 3SB0A 5HAOA 4IQLA 3GRIA 2QAPA 3SCNA 2BOGX 1ELSA 2QDEA 3T7VA 3B0YA 3PZ9A 3TYZA 3RIKA 2PBOA 1CGYA 3LQGA 4DRSA 4DJEC 3AISA 3W2NA 1U1JA 1HKMA 5AHNA 1A5NC 3STPA 4CEUC 4FALA 1KFWA 1Q65A 2GSEA 3EEZA 3NZPA 3U3HA 3EOOA 1TPWA 4DZAA 4DBEA 4FNUA 5K9CA 1UP2A 4PE8A 1K9FA 3C3NA 4TVUA 2X2GA 4I8YA 3PANA 4LRTA 5F2MA 4B91A 2PDNA 2W5FA 1YHTA 1ISWA 1B1YA 3CQHA 4OBRA 1FHDA 3TIMA 1W5MA 1ZU8A 3ICJA 1AH0A 3IAPA 5HMSA 1XRTA 3LV5A 3SO7A 2PDKA 4MTVA 3SI9A 4LS2A 3DFHA 2Z24A 4S23A 1XBVA 2C79A 3AMLA 2F8QA 1V7YA 4DUXA 4O1DA 3RN6A 2VRKA 3GR4A 3VX1A 4JTTA 3WLPA 4ZZ9A 3W23A 2D2JA 3A4WA 4MVAA 2PE4A 4EE9A 3MDUA 5E9XA 4FXSA 1V6VA 4XZNX 3MCOA 1V3KA 3VKBA 3CASA 3L67A 4DJED 1WZLA 1TV7A 3N25A 2ZRVA 4W84A 2E25A 4XVDA 4QITA 3WKZA 4J5NA 4MSSA 2V3FA 1H0IA 2OLSA 4CD6A 4IGMA 4LF1A 1OT1A 2X1IA 4R34A 3H4GA 3KRBA 5CPQA 1Q8AA 3TN6A 2OO0A 4R5EA 3RF9A 1A49A 4JQ2A 1EDGA 2YZ5A 3UCDA 5HWJA 1J0ZA 5AFDA 3W7EA 3V75A 2YDQA 1QI5A 2GL5A 4H8HA 3OGRA 1LT7A 2EBNA 2I7GA 4B9YA 4BQ2A 4HMNA 5LKYA 1AZ2A 3NEVA 2BXVA 4LUTA 5GQBA 3GNXA 2PC8A 4JICA 3W2MA 1KGWA 4JL1A 2GGHA 2BWGA 2J78A 2NQJA 2FFCA 5HBFA 4QJ4B 1JNDA 1B5TA 2WYSA 3SY1A 4HIBA 2RFGA 4IIGA 3RMJA 1HGYA 1E6XM 2WZEA 1U5VA 4ZQMA 3PM6A 4AC1X 3LLFA 3TN5A 4W88A 5JIWA 4B3ZA 1ZNNA 1ONEA 4PL2A 4A2RA 3MU7A 1Q6OA 3OZMA 4LX4A 3HJZA 1RQBA 4Q7NA 1XLLA 3EMZA 1WYIA 3EWUA 3UQNA 3P2VA 1D7KA 3CHCA 2QVHA 4J1OA 3WQ6A 2OOFA 3PG9A 4O8RA 3QQ1A 3WFLA 1ADDA 2HISA 1BPLB 1B4KA 2Z2UA 4IG2B 1V0NA 1JUEA 1Q66A 3RPMA 1NVMA 4MJ2A 4E2OA 2NV1A 5HMFA 2QHAA 5AC8A 4QG8A 1R2TA 3VM7A 4HMCA 2X0SA 1MNZA 1U5HA 3CYJA 1FBAA 2QJMA 1F4HA 4IZGA 5FESA 5EMMA 2FKPA 3CK5A 2NX3A 3S5NA 3SN1A 3WF1A 3IJQA 1JPIA 3U7BA 3VILA 3B8TA 3WBWA 1GQJA 3TN4A 3OODA 2BVTA 2R91A 4O1FA 3W7IA 4MY9A 1E6ZA 1FRBA 3B0XA 4DEFA 5MF5A 3AROA 2GSHA 3T9PA 3AWNA 1N8IA 4MLJA 4B2DD 4XTDA 2VOMA 5HNNA 3W1XA 1XRSA 3RYSA 3B40A 2FHBA 4LAUA 1VFSA 4DVOA 3MO4A 3PULA 3KBJA 4A22A 2OSXA 3BUVA 2WO5A 1M68A 4HCLA 4HN4A 2F7FA 1IXPA 3PR2A 1B90A 4NHVA 1C92A 1XYCA 5ECUA 2OPJA 5FD0A 1Z7AA 4XZMX 2VGBA 4UTMA 2OYMA 2PDGA 4I9JA 5HJXA 1CIUA 1P0EA 1NOWA 2Z6JA 1W1TA 3EX6A 1EWEA 4Z2LA 4AAJA 1WUFA 4KFNA 4NJHA 3T55A 1XINA 2NZLA 1MI3A 1OBAA 5CBIA 4HHLA 5G2WA 1EJTC 4HT3A 4JTQA 5DXYA 2QVNA 2GLKA 1P0BA 1OIFA 1FWAC 1MW0A 4PMYA 3CUHA 3IJ6A 3R25A 4PCPA 1RQEA 3CZKA 4S3FA 2P0IA 1SZNA 4JIQA 2DZXA 1GVSA 4D72A 5M2FX 3ZO9A 2OEKA 1PVNA 1VBHA 2D0GA 1CGXA 1JJKA 1QMLA 3GFYA 4JTEA 2FB2A 3C6CA 2WM1A 1HJSA 3AXMA 2RDUA 1XSKA 4HSNA 1FOBA 3G3MA 3LCLA 1XD1A 4JEJA 4H83A 1JRCA 3QN3A 1UZ1A 5M3WA 1WXYA 3PBUA 4P7LA 4Q32A 2C0AA 4GISA 2BY0A 2O0TA 3NUKA 1A50A 1QI4A 1YTKA 1N8WA 3H22A 4PL1A 3GXIA 4K1GA 1OFBA 4Z1BA 4J4KA 1ITQA 1R9ZA 1VPQA 2JFEX 3STEA 2UY2A 2HXUA 1ODUA 1K9EA 2PBGA 2IKGA 3WUBA 4ZBCA 5AY7A 1XP3A 4K38A 2Z2BA 3R13A 3M44A 4DF1A 3MI2A 5REQA 3W25A 3ITYA 3SURA 3FY1A 1UPMB 3CAQA 4YTTA 4FOJA 1GGOA 4LUYA 2OG9A 2OELA 1YDOA 4PTVA 2IKJA 5LXEA 2YCJA 3ZT6A 2H8XA 1OVDA 1EHAA 1E70M 2ZCGA 3S5ZA 3U4FA 3UG5A 1QNPA 4ERAA 3VIGA 2HMCA 1ZRQA 2HBXA 5HDRA 4INFA 1X6NA 4IL0A 2AL1A 4LAZA 3BSHA 2W91A 4MHBA 4LB3A 3W7PA 3KLKA 3BH4A 3AQUA 1CXEA 1TSIA 3W07A 2HTMA 5DMMA 1NF0A 4E3VA 1Y65A 2YXOA 2A7PA 5E09A 1F3TA 4L1GA 1PKLA 2FZ8A 5EYWA 4P7QA 3ZS4A 3T78A 2CLPA 2WSQA 4FMVA 1K7XA 3QLLA 3W7RA 2IUZA 1QHPA 4JGDA 2HPIA 4A6GA 2GJXA 4UFHA 1V6YA 1BG9A 4K3ZA 4CVWA 3W9ZA 1H09A 4V28A 4LAOA 2KX9A 4Z42C 4TTGA 5EGRA 1IE7C 3FOKA 2PPGA 1V0LA 4QLKA 4DJFA 2CHOA 3P5YA 2WWCA 4L5ZA 3M0XA 2BGNE 1XWYA 4UBPC 1Q63A 5AB3A 2BHUA 5EMUA 3C52A 4GX9A 1J0JA 1B9BA 4HP5A 4BEQA 2I16A 1XLAA 2QQ6A 3FVDA 4PC8A 1OK4A 3SCQA 2OKOA 4M7TA 2AAMA 2AGTA 4KMQA 3S1WA 1FCVA 2OX4A 2C16A 2E3ZA 1XC4A 4HOZA 3WEOA 1J6OA 4WDXA 3ZFHA 1X7FA 4IPIA 2C13A 2YDSA 3RAOA 2WK2A 4R9XA 1S2TA 4C1NB 3E38A 5IRPA 3ONCA 3MWAA 2VRJA 4QDWA 3EWWA 3EXSA 3TC7A 3OVRA 5IM51 2QCGA 2PLKA 2V5CA 4J3UA 4W8BA 4GH3A 5C8BB 4CU7A 3W1UA 2QW5A 5D4YA 1THFD 1UMYA 1PBGA 2CU0A 1I9CB 4TMBA 3BMWA 4KCVA 3AAMA 2WC3A 3ATZA 3W7JA 1LG1A 4D71A 2NX1A 3BAXA 3GH5A 2Q02A 4X22A 3KZPA 3SEPA 3KRSA 1KM6A 4KIEA 4M81A 4QM1A 4W85A 5CLWA 1K1DA 5CPLA 5CGTA 2FGLA 1L6FA 3NVTA 4NJKA 3PF3A 4ZQOA 2X16A 4BK9A 3FNDA 1E40A 3VNLA 2FJKA 2VHLA 4GIRA 2HJPA 3ARVA 4CUCA 4AWUA 1UIPA 3AXIA 3ALGA 2A0NA 4LGXA 5DY2A 4Q4RA 2CW6A 5E70A 3E0WA 2XN0A 1DJQA 1MQPA 1YRRA 2E9BA 4KT2A 4LYQA 1I2QA 2ZRUA 4DB7A 3ZR4A 2YR1A 3ITGA 1ME9A 1VRDA 2XVLA 1FWNA 4HSHA 3LXBA 3M0KA 2DT2A 3S83A 3BXWA 3LHVA 4KRUA 1TJ1A 4XD5A 3BCJA 2WKLA 3AI0A 4MJZA 2PDUA 3M5XA 4PEEA 4IMEA 4H7CA 1XFBA 3EB4A 1ZSXA 1T8XA 3GO2A 4RNFA 5EPDA 1G9HA 3IGHX 3QR0A 4ADUA 3M07A 1UWAA 4O11A 2QXWA 2PDLA 2WZIA 4YMZA 3O07A 5CAHA 2OQLA 1L2UA 3S5YA 4EPBC 1E56A 4AXNA 3CT2A 3S9IA 1ONXA 1TREA 2VEIA 3W7LA 4AWEA 1ZZMA 2GDVA 2WOQA 3BOXA 3I3BA 3OGVA 4KF1A 3M4HA 1PKYA 4HNVA 3UJEA 3NYDA 3WQGA 2YIHA 3VK5A 5KZEA 4KEVA 5DELA 1OYBA 3EWXA 4EANA 6A3HA 2Z6IA 4EK7A 1M65A 3AIRA 3WELA 4TVDA 2ZUSA 2YB4A 2VX7A 4RXFA 3T0CA 3PPCA 5D2WA 4A8RA 1AW5A 1P7TB 3CUFA 5TBOA 3R0KA 3WH9A 1UJPA 5D2TA 5I3IA 3S6DA 1LLOA 5K9XA 2EF9A 3GUWA 1S2AA 1CECA 3QGVA 1OFEA 3GLCA 3WMLA 2YSWA 2VD8A 3PAJA 1YKWA 3WN6A 4YVXA 1NQ6A 4WXZA 2O9RA 1OC5A 1O12A 4GUGA 4HU4A 3TYDA 4GYKA 3DI1A 2O9TA 1J5SA 3BTNA 1SZGA 4GQQA 1Q13A 2W63A 4NQ1A 1BF6A 4J7RA 4J28A 1TV8A 2G50A 2Y85A 4DJDC 1Z41A 3POHA 4L65A 4MAZA 1DIKA 1PYMA 1KRBC 3MCNA 2ZVIA 3WO8A 2YDRA 3KCLA 1JDAA 4NSBA 1GOMA 2ZOXA 2C14A 1KRAC 4NP7A 3I7RA 2VFIA 2PDPA 4D6IA 2J25A 1E73M 3AXKA 4GUFA 4LYKA 4B9ZA 5CH9A 4C6OA 4HA1A 1E9LA 4QDMA 3HG2A 3ARZA 3TJIA 2WZMA 5BOFA 3H2FA 1HW6A 1H51A 3TMLA 4FNTA 2X7VA 3UXLA 1X97A 1W2VA 2ATMA 2B4GA 3Q37A 4EX4A 2W66A 4UFIA 1T0OA 3HURA 1W8SA 2AL2B 3GG1A 4WY0F 1PV8A 1HG3A 1OY0A 2OWXA 1DVJA 3PZTA 2YYUA 3DHPA 4YTRA 1A0CA 2Y4SA 2PF8A 2QCHA 3BG3A 2V63A 4NI3A 3MY9A 1W1A1 3DESA 1DBTA 1Q7MA 1D8WA 4W5UA 4IX2A 1QNVA 1H1YA 2VGFA 4LY4A 3EB3A 1GYLA 1V77A 4C7GA 1ZPTA 1M9HA 2XGIA 5F2IA 3GXPA 4H9XA 4M6PA 2O4QA 4C65A 1YXCA 3HPFA 3FA4A 3OBEA 3IS4A 3BQ5A 1NSJA 1HP5A 1VYRA 1XQLA 3PFRA 4C6LA 2JEQA 1I60A 1YDNA 3B03A 3B9OA 3A3WA 3EA3A 3M0HA 2D23A 2JKPA 1BG4A 2PURA 4LCRA 2W3ZA 4JQ1A 2BBFA 2OR2A 2XFRA 4IP5A 2HXTA 2QLYA 4AEFA 3IIVA 2QPUA 3E6EA 1UB3A 4DF0A 1DQWA 4UOJA 3SIZA 2WMJA 4ZR8A 1DIDA 2ZYFA 1EPXA 1REQB 2FVLA 5LIXX 2YBTA 3BGJA 1EGVA 2DDXA 3N17A 2OZ0A 2OEMA 3TONA 4FAMA 5ABTA 4I7WA 2PI6A 2YPIA 4E6MA 4QFUA 4M6VA 3IK2A 3W7OA 1PX8A 2FGZA 4QQUA 4R88A 3UWYA 5FJIA 4D6CA 3DENA 3V35A 3UVIA 2JBMA 3B04A 1XGZA 2H90A 3H2CA 2XIQA 2B7QA 3B9DA 5I7GA 4AY7A 4LSBA 3IUHA 2EJAA 3CPGA 4C6MA 2NQHA 2XYLA 3WJSA 1BWLA 1POKA 2BTMA 2CLOA 3QY8A 1GK8A 2GVLA 2WQPA 1JGIA 2R1LA 1CXIA 4N9EA 3TTYA 3B4YA 4NZ5A 2Z1WA 4RPQA 3M0ZA 1Q3NA 2DQWA 4LCQA 1AQFA 4C7FA 3QPEA 3VGFA 3GXFA 3FW6A 1JFHA 1DKWA 1WQ5A 5FEXA 1XCFA 2ZUWA 3GNOA 5CZ0A 1Y5WA 2E6YA 4V15A 4OQVA 3F1QA 4O0QA 3U2OA 1VJSA 3GS6A 1K6WA 1DWJM 1OFAA 3IJLA 1SJDA 1R7AA 1H49A 1UD3A 1IWPA 1KXHA 3VGHA 1MXGA 5AOUA 1SJCA 4YWIA 4XVEA 1KTNA 3SY5A 5D09A 1WOAA 1NDVA 4DO4A 2GWGA 4Q4SA 2XGZA 2PDYA 5DANA 1JQVA 1IT8A 3BOFA 1A5OC 3IEBA 3NTYA 3CIWA 4MB3A 3FA5A 4EACA 4UC5A 4WKFA 1EJUC 1J79A 1UR1A 1KQYA 1A4MA 1GHRA 1GKPA 3NNTA 1XF0A 1X98A 1EUNA 2ZFAA 3PZOA 4A05A 1XX1A 2AMXA 1W17A 2PDQA 4Z1AA 1YX1A 2HWGA 3CMJA 4I9TA 1IT0A 2W0UA 5TD4A 3MYPA 1H7PA 5BMXA 2F6UA 1QI2A 1OD0A 3IVSA 3PJUA 5E1QA 1PPIA 3PJTA 5G2IA 4REQA 1AD4A 1W56A 3THDA 3OIXA 4IIDA 2UY5A 2OQYA 3UXAA 3II1A 5GJNA 1EGZA 5BU6A 1W3JA 3BLEA 4LVDA 3F2BA 1AW2A 3GAYA 3C0QA 3UEQA 1PZ3A 3DFSA 4FK9A 3CO4A 3OLGA 3NO3A 3V36A 4IJCA 4LPCA 3AS1A 2R8WA 2ZDSA 3MS8A 3E12A 3G1AA 1Q85A 3KOYA 3NOYA 2OLHA 1GORA 3LI1A 2P8BA 3H4WA 4QNWA 3OYXA 4LAMA 4D9PA 2RDWA 1DWHM 1YLVA 4XZBA 2DJXA 1GKRA 2J6VA 2RKXA 1EPVA 1V6UA 2J88A 1JGMA 3CHFA 4CNUA 1RJRA 1TR1A 1BWKA 2Z2AA 1LOLA 3QV7A 3NL3A 1UHVA 4QEEA 1R2SA 4S2CA 1PIFA 5M17A 3VOIA 4XD6A 3I65A 3VIOA 2XG9A 3N6QA 2X30A 4WZHA 3D47A 1IGWA 4YL2A 4YS1A 4A35A 3LSCA 5A8PA 1JAKA 5SWUA 3A23A 3O6CA 4M3PA 4Q8QA 4B3LA 3AHTA 1W1IE 1RSCA 1EO5A 1SVDA 4G5DA 3GIQA 4MWAC 3V5FA 3VXGA 2CYGA 2QV5A 1WBHA 1JPHA 2WMHA 4IHCA 4F0LA 3TXZA 3IARA 5FF7A 4GINA 2BZNA 1J12A 1TV2A 3WLRA 1LROA 3VIPA 2BLEA 1NTHA 4DLMA 2AKMA 1JXKA 2A4AA 4ZB0A 1DP0A 3FFSA 3BV7A 3O16A 5CZKA 1SFSA 4L4OA 3USZA 2QYGA 3GDMA 2X40A 3TYBA 1AG1O 1RLCL 2ZRYA 4DJDD 4GQGA 3KOFA 3NURA 3WLHA 3B9AA 1AUSL 5MHBA 3EWZA 2J7DA 2DZPA 5G1TA 1XH1A 3F5LA 3AYRA 3K4AA 3MP4A 4DWSD 2DEPA 3Q2DA 3M6DA 4F66A 1FWBC 1KFEA 1AMYA 3L5MA 1H11A 3AIBA 1CT5A 3VZYA 1SSGA 2YA2A 3IJ8A 2DSKA 4Y9MA 4HU8A 3O7UA 3AHZA 3GW3A 2G4FA 3YPIA 1LT8A 1ZBWA 3RM4A 2JIEA 3VZXA 4GUJA 4RNHA 2HVNA 4JHOA 2XFWA 5E93A 2ZUVA 3GG8A 4YNGA 2FQIA 4CNSA 3EX3A 1EIBA 1YYAA 2OO6A 5T91A 3W86A 3WLTA 3CV1A 1S3TC 1NDZA 3WNLA 3QYSA 1ONRA 3RG6A 1DJIA 2AMGA 1SO4A 2CNCA 1GTHA 5B80A 2CLEA 2DIEA 3PAOA 5JBDA 1UP0A 5D02A 3Q94A 8RUCA 1F3EA 2WCAA 4M80A 3F4VA 1ZBVA 4MWAE 1JDDA 5JH1A 1EC8A 3A4XA 4D1JA 3KHJA 4BFAA 5IOBA 2Z7GA 1F05A 3UT0A 2ZADA 2ISDA 3JZUA 2B81A 3SQSA 2QCCA 4DJFC 2H9AB 1J0YA 3H2AA 2J7BA 1ENUA 4FIQA 2C7FA 1QTWA 3R58A 4MY8A 3ABOA 4O1BA 5LNSA 1M3UA 3AS3A 5M5DA 3Q58A 3VD5A 3S9YA 1XYZA 4LUSB 4C1NA 2J13A 1LRNA 1Q2SA 2ZZ1A 2FVMA 1UD2A 2BS9A 4LOCA 1I2NA 1XIEA 2GVYA 2A85A 2A3HA 2FDSA 4ICCX 5J04A 2OLAA 2PGEA 2TSYA 2WPBA 2PB1A 3STCA 3RLUA 4YJ5A 1LLZA 1PZ2A 5CZTA 3U9IA 5DBUA 4PEKA 5AVNA 1C9WA 1P43A 4RL3A 4PTXA 3VIIA 1SUXA 5CC5A 3HA1A 1Q4NX 1QOQA 4GNKB 2VC6A 3W26A 3AHXA 3CU2A 4AEEA 5LNWA 4BR1A 2F2HA 3STGA 1Y5VA 3TUUA 4ZOCA 4QNEA 2JIWA 3WQ4A 1ZFJA 3PPHA 3DBNA 2NQ9A 2DZBA 3KBMA 3NQAA 2ZTKA 1BAGA 4YCOA 2QDDA 4PUMA 2BOFX 3WEMA 3WD0A 1EOMA 1TCMA 3W2UA 4L1XA 3CUIA 3KVLA 1GVRA 2R1PA 4AMCA 1VFLA 3UZ5A 4CEXC 2WVSA 4NY2A 1XBZA 5HUOA 4G2DA 2YCLB 1YEYA 4GACA 4GMEA 2WVVB 1MQRA 4GA8A 3VKJA 3AUJA 4J3SA 4NX0A 3PUDA 3NQ2A 1VGAA 2QIIA 3UG4A 4BF7A 1TPFA 1P0NA 2IKIA 3CZJA 3H2OA 6REQB 1JL8A 2BOEX 3M0MA 3WF0A 1UWTA 3CV2A 3CXOA 8XIAA 4O4VA 3S1UA 2GZXA 1XGDA 1E6PA 1BVZA 3IIXA 4XSMA 2VEKA 2Z26A 5KZDA 5A8OA 4FF7A 1B2YA 4DELA 4EAYA 3E0VA 2ZX7A 3AC0A 3UWUA 2HQAA 3GU1A 3RFAA 1A80A 4QLJA 1UR8A 1A5BA 2A7NA 1OF8A 5CC6A 1V3JA 2VFDA 1EP1A 1KFJA 1PWMA 5BWAA 1KM2A 1DJWA 3AIUA 4DM1A 2PP1A 4HYVA 1RJPA 4AB4A 1ECEA 2WKJA 3MO7A 2Y2WA 3LI0A 4W7WA 3ZSTA 3QKZA 1J0IA 4DF2A 1TX0A 2ZC1A 3CNYA 4BI5A 4PRWA 4DI9A 1QFEA 2QMKA 3IANA 4XZWA 1JI2A 4MKVA 3UFYA 1IR2A 2PWUA 4QSFA 3IJ9A 4S39A 5A5WA 2E6FA 4AIBA 4EXBA 2PLCA 6ALDA 3RJYA 4QJ1A 4F0KA 2NUYA 3B8VA 4IISA 4OBSA 1UWSA 3LMYA 2ZWYA 1OYAA 4J40A 2VXNA 1GONA 3C2RA 3W1TA 3TE9A 3GR8A 1SO3A 4W7VA 2QPSA 3K5XA 4OV4A 5IHRA 1H61A 1VHCA 1GVEA 1F73A 3T6CA 1DWAM 4IGHA 3QXBA 3F5JA 3WBXA 1Q8JA 4JYEA 3S5SA 5F2GA 3ELFA 3OU8A 1UW9A 4BA0A 3LU2A 3W2KA 4H19A 4WSKA 3RM8A 4H7VA 3BJFA 2CLMA 2RGLA 2D3NA 1HZYA 2GYIA 2VO5A 2V0TA 3APGA 3PS7A 1GVIA 4OFCA 3KBSA 3T8QA 1LUCA 5FAGA 2BNJA 2CLIA 1UKQA 1YDYA 2V9DA 1BGGA 1ICPA 4N9DA 1A5LC 4GJ1A 4O50A 4PMRA 3UZJA 4WK9A 6CGTA 2WCGA 1WKFA 3IACA 2W61A 3ISIX 3CZ8A 1OFQA 1BD0A 3BV4A 4GFSA 4IJRA 3SCRA 1NP0A 1RALA 3DG7A 5FEPA 2W67A 4A3HA 2HEJA 4Y9OA 1WNOA 4RDYA 1AVAA 4XZHA 3UJSA 2QDGA 4B3KA 1TELA 4CQBA 3BO9A 4C6FA 2D0FA 2WNQA 2IXUA 4L9XA 3KE0A 3HOJA 3KW3A 3C56A 1W5QA 3W22A 3MC5A 3ZM8A 3P0XA 4UQEA 1DEDA 3OGSA 1KWGA 4PRTA 2QJNA 3QQ0A 3LTPA 1CGWA 2PDWA 4ZB5A 3CL7A 5HULA 4J3VA 1SO5A 1V6TA 3QV9A 3H2NA 3LTYA 3L4WA 2CZVA 5KETA 4R33A 3V4BA 5D9MA 1MXSA 3FHQA 4AU0A 1N2VA 1NWRA 3V0TA 3DU0A 4EWJA 2VWSA 1TWWA 3ERPA 1ZLPA 4WX2A 4DO5A 2D69A 1B3WA 3ZLGA 1HVQA 1TTQA 1CENA 1RK5A 1HNYA 4V2XA 2DH2A 3GHTA 3AHYA 3AZRA 3L21A 3CL6A 1K8CA 2QNEA 3U7VA 1GHSA 1XYFA 3CWNA 3WK3A 4WSHA 4UFJA 4TTUA 3G1FA 3UXDA 3CLWA 1GVYA 4QS6A 3VD3A 5H8UA 4PTDA 3DOPA 1I4NA 1OG6A 4XD3A 1TVLA 1PAMA 1WB0A 4UFMA 3VINA 2QULA 4AYSA 3OLEA 1O94A 2A2IA 4YVVA 2F6KA 1LM1A 4HNOA 1EIXA 4ZE4A 1W8GA 3CAVA 4I6KA 1KFKA 5EL1A 5DT5A 2Z25A 2ZUNA 5E6ZA 1H7OA 3RLVA 4Y6GA 3SQMA 2A79A 3UJRA 5AZ1A 2ZC8A 4HK7A 2I17A 1FHVA 3O9NA 3SGUA 5ABFA 2VJXA 1I1WA 1BYCA 3BQ6A 4HCHA 2C15A 3AIEA 4MUPA 5I03A 2FJUB 1TV5A 4I9MA 3LG3A 2CIPA 2Y7EA 3AXXA 5LZLA 1M5WA 1PEZA 5B7YA 3GDBA 1WZKA 4KW2A 1MNSA 3L2LA 5I3FA 4S2BA 1B9ZA 1XSIA 4GKTA 3K8LA 2OGJA 3ITLA 4RKAA 1OJXA 3FA3A 3QMRA 1LJYA 4ZB2A 1UR3M 1QNSA 2OWWA 1FDZA 4BI7A 5D30A 2IQ0A 1R0MA 2VCAA 3C5QA 5G4HC 3ZYZA 3S8HA 3TR9A 4LUSA 2VRQA 4NAEB 2TRSA 2OZ3A 3HU7A 4N4PA 4GJIA 3W6LA 3P5ZA 4UCGA 2DZAA 1W54A 2XVNA 2XZ7A 5G4WA 3DFPA 3CL8A 1WKEA 3QMSA 4H9ZA 5F2LA 3NWRA 4FXRA 5BXRA 3LGGA 4MUZA 4B5SA 4LF2A 4IQDA 3RLHA 5DFAA 5HJLA 4F4RA 3GAKA 4GX8A 3T4CA 3VA8A 4A8LA 1EJXC 2BP1A 4ZOBA 1CX9A 4ZMGA 3BLPX 4DPQA 2B7NA 3WMBA 4IG2A 4TX9A 2PEVA 2PLJA 3EDJA 2ALRA 2DVUA 2X41A 1C8VA 1EWDA 2BASA 1UG6A 1ITXA 2O9OA 1XPYA 3TEVA 2ZIDA 1HXJA 3TVAA 3VNKA 4Q8WA 1LQ2A 1PIIA 4H9MA 2PGFA 2E6AA 3W87A 3EKZA 4PMUA 1IT7A 2XSAA 2WVVA 1H4PA 5I79A 4ML9A 2QJJA 1JQXA 4I9AA 2V3DA 2CC0A 1JCYA 2ZX5A 3MANA 4IIBA 5F4SA 2VYOA 1VEPA 1TQXA 2EEXA 1FH9A 1KWKA 4RV8A 4HNUA 3EOLA 3VOHA 1LL6A 3W7NA 2J9ZA 4Y96A 1R85A 4JTUA 1REQA 3TJ4A 3VU2A 4RE0A 1PTGA 4AH7A 2YL9A 4AD5A 3C0SA 4NILA 3WQVA 1OC7A 3WENA 2UWFA 2CKRA 2L5HA 3R11A 2MNRA 1KGXA 3BCDA 1RLDA 4RNIA 1IHIA 2YA1A 4PULA 5BMWA 3NCOA 1MUWA 3WLLA 3W1NA 4F2UA 1A47A 4ALDA 3IVUA 3TA6A 3CLMA 4N2YA 2AOSA 3QJAA 3W76A 1J8VA 4O12A 3FKRA 2PD9A 1LTDA 1WDSA 3PPGA 4C1KA 3FLUA 4GYPA 3MBDA 5RUBA 3VCRA 3A5FA 3LTSA 4QX4A 2YFOA 1ZTVA 4OGZA 1XBYA 1FCBA 5B7ZA 3G6MA 4MMWA 2J77A 1ZCCA 2PTZA 4UTTC 3RCMA 4DUVA 1X1NA 3N19B 4DXKA 1P5BA 3T40A 2BVWA 3W6YA 4AD4A 5FF3A 3B9NA 4XD4A 1E1FA 3RX3A 2GWNA 3NQVA 2G41A 4QBXA 1UKSA 3VIMA 1N8FA 5CPMA 1CXHA 4AIUA 5J5DA 3TCSA 3ARUA 2TAAA 4GXPA 3H7RA 3GIPA 3GZAA 1E72M 1TJ2A 1UUMA 3MUXA 5C9ZA 3NQ7A 4PGLA 3N9SA 2HV5A 2R6OA 3F2CA 1BTMA 1B31A 3P14A 3QV6A 5DRIA 3P74A 2ZDRA 4CNTA 4WSJA 1D3CA 4M56A 2V81A 3TJLA 2VQTA 3N15A 4RV3A 4RZ6A 3GSMA 4YHGA 2V5DA 2E68A 4UQ9A 3P6LA 3QGKC 4B16A 1IZKA 2Z27A 3S2MA 1OX5A 2R1KA 1K6AA 4AX7A 3MV01 1HX0A 4H7ZA 1JF6A 4NL1A 2F38A 3WL0A 3L4ZA 1NWSA 1RY0A 2A6NA 5LGXA 5I02A 4GVHA 5K7JA 2Y7FA 3H12A 5G4EA 3MMTA 4Q4PA 3RR4A 4D8AA 4OECA 4G9PA 1XH0A 3ANYA 4JKLA 1FHLA 1D8CA 1NDWA 1MSSA 1Z69A 1AJZA 3PB0A 1TQJA 1TFVA 2PMQA 1EX5A 1XW8A 1WZAA 1EF2A 2Y63A 3H21A 4DPPA 1W9VA 1WAWA 1JCTA 1DWIM 2XH0A 3LBOA 3WQWA 1OB0A 3EXTA 4PUJA 3NGJA 3V5OA 3I3DA 2YCLA 1TPC1 1VP5A 1E4MM 3EAUA 2V5KA 1JG9A 2J66A 5ABGA 3UXKA 1OGSA 1TPB1 5JBEA 3U6WA 4RZ5A 3WUGA 1XH2A 1JIBA 4I7VA 4I5UA 3HV8A 2ZWZA 1M7PA 2G5WA 3PZIA 1E0VA 4NVTA 2IPGA 5BZAA 1DJZA 2QDHA 4NT0A 4K7VA 3MZ2A 2OCZA 3EMQA 2XPKA 1VPYA 1PHWA 3QW4B 3CV7A 3MWCA 4DM2A 4QXIA 1LOQA 4RE2A 2YKKA 4JYDA 3TN3A 1XDMA 4KRZA 2Y88A 1JCNA 4PR4A 3W2JA 5EKYA 3SBFA 3OA5A 2J8FA 4DUWA 2YJQA 3CZLA 2R14A 3WFZA 1PKNA 1GKQA 3BW4A 3IJDA 4ZGYA 2WNNA 4WKAA 4C6JA 3L7RA 3L4XA 1TPEA 4FR1A 4CQDA 3R89A 1KCZA 1SU5A 2CHNA 2RDXA 1CW2A 1JD9A 4RLIA 1S2UA 3N2MA 3EDKA 2IQTA 4HU0A 4UUIA 1T5AA 4PUEA 4IIEA 4J3ZA 1GEQA 4WGHA 3S2JA 1E4IA 1Z42A 5J5RA 4UNIA 4JNZA 1MUCA 4DJDA 3HTWA 2BDQA 4GBUA 1YW1A 3MSYA 3T0AA 3KOXA 4P8VA 1V7AA 2LLEA 1Z3NA 4JNMA 4D6DA 1BXNA 4BF5A 3UXIA 2J24A 3USBA 2P3EA 1EXPA 2A3AA 4M82A 3OEXA 2WMGA 3MJMA 3UYCA 2QCLA 2P76A 3OW1A 5AYYA 1GVOA 1F8IA 3MKVA 1K7EA 3MMWA 3BLFA 1PCKA 1WOBA 4JTDA 4EF8A 1IWAA 1FHUA 2WV8A 3WIJA 3SJ3A 3R5EA 1KKOA 3CPUA 3DC8A 3P8IA 3GG0A 1FDJA 3URNA 3QTPA 3AIVA 4GY7A 5D33A 1JZ4A 3P67A 4O8AA 1S38A 4K7YA 5ABHA 3LY0A 1E9IA 4OUEA 4PN2A 4O28A 4IQJA 2PZNA 3DKLA 4QGCA 3E2RA 1IEVA 3VNDA 3PPFA 3GDLA 1V93A 4F40A 1XQKA 5EBAA 4MNKA 1P1MA 1S2WA 3NSNA 1E43A 4O15A 4FO4A 5A8QA 1ZS2A 3GBDA 2CPUA 1EJSC 4NAFB 3F03K 1CEOA 2RDTA 1ISXA 2R94A 5REQB 3RMEA 4CQ9A 3ZOAA 2HZGA 4XKYB 3GM8A 2I5QA 2DFAA 4P61A 3G1SA 3NXLA 5A3HA 3VUPA 3P61A 1JPKA 4R3UA 3OVQA 4LRSA 3UCQA 2E77A 4AVOA 1Z48A 1W31A 1CLVA 4H6RA 3BW2A 3IUIA 3PTKA 5LA2A 2PTYA 3CQ0A 3K4DA 2ZVRA 1GZJA 2WZTA 3A47A 4FLSA 1OHLA 1NU5A 1KKRA 4MYXA 2XINA 5JXQA 2V2DA 4DYJA 1X7IA 3KLLA 3S1VA 1GNXA 1MW3A 5H91A 1W3KA 4FLOA 2EAWA 1ZP3A 4GQBA 1WZMA 2VUNA 3DG6A 3COTA 1ZENA 3LZ3A 4PBGA 1IYXA 4FP1A 1QDSA 3FIGA 4UQCA 3LXAA 4F0MA 3GC2A 4O17A 2WAGA 1YPIA 2OU4A 3SDOA 3W3OA 2RGMA 3G0SA 1YXDA 9XIAA 5I77A 2G3FA 4WEVX 3NL5A 1C8XA 1IEIA 2WJZA 1JCLA 5GNXA 2ZUUA 3LRKA 2ASHA 2NVAA 2P88A 1F6YA 8CGTA 4PB4A 3SJNA 2WHMA 1QPQA 1FUYA 4GZEA 3DCPA 4H2HA 1K8XA 4YTUA 4IMCA 1W3HA 3URBA 3ITXA 3M0JA 3S2CA 1E0WA 4OZOA 3CT7A 2YFNA 4NU7A 3WJXA 3SUVA 2X0YA 3T42A 1EEPA 1HKIA 1UKPA 1OSEA 3QZ6A 3OQ8A 2VD9A 2ANUA 4XUYA 3CQIA 2DPEA 3SFKA 3PG8A 3MHUA 3K8KA 2ESCA 1HN1A 4CLMA 6REQA 3FK4A 4XISA 3G24A 2QS8A 2V69A 3U8GA 4RZBA 2I5IA 3M9YA 3ME3A 3W7CA 3WNOA 2YDAA 4JCLA 5FJRA 4QIUA 4DJEA 3VNYA 3TV8A 3ZJ8A 2BY3A 1IEXA 1K02A 1DJHA 3RNDA 4CCZA 4QJ5B 1G4SA 2VZVA 2YGYA 4GZ7A 4O0KA 4JR5A 2V8ZA 3BAYA 5CLTA 4J2MA 4UQDA 4NASA 3KAOA 3HQ1A 5I5RA 1P7TA 1LQ0A 4XTIA 2J79A 5E0KA 7ENLA 2Y5JA 4GIEA 2Y7GA 1RH9A 2DW7A 3H70A 4FXFA 4D6HA 4CVUA 4OE7A 3MB9A 2HPMA 3S2NA 1CPUA 1QW9A 5LNUA 3EDDA 3CAKA 3WEZA 4JIPA 4NG3A 4QE4A 4HPGA 3VNIA 2J75A 1EHNA 1ZCOA 4DJFD 4TX8A 1XC6A 1XR2A 3M7WA 1R46A 2ZICA 3LERA 4PFMA 3FKKA 1PTDA 2FGBA 1IV8A 1E0TA 2G3MA 1T99A 4Z17A 2CBVA 4L9YA 1I8JA 4XB3A 1D3HA 1Q6RA 8XIMA 1ZHAA 4FA3A 1DIEA 1TJRA 4Q8TA 3K1DA 3FXYA 3Q4DA 4HBKA 3SSZA 4UTHA 1V6XA 1EC7A 4WXYA 3VNZA 3EEGA 4V27A 2NW0A 2FMNA 4GO9A 2OEJA 4Q6JA 1C8QA 1UASA 1QPKA 2XU2A 4EPEC 1RCOB 3LYEA 4IPNB 2E8ZA 3E3HA 5C6MA 1QPNA 2W4XA 4LNCA 4LNYA 1NARA 4DO6A 3QLDA 4RW3A 1O6IA 3G18A 5T26A 4TMCA 1H0GA 1PKMA 1XI3A 3IVTA 4K8EA 3WQFA 1YMYA 5CCZA 2E8YA 5FJTA 3N4AA 2PRMA 4F9JA 3ARPA 3ZT5A 3CZGA 2HCVA 4GOAA 4KRTA 4MOZA 1KRMA 2FHFA 5KZMA 3UU0A 3MUZ1 4DXXA 4YVPA 3LM7A 1D2KA 1Q7QA 1IQ8A 3DKJA 5I09A 1GZ1A 1TR9A 4HN8A 4J3XA 3INPA 3OLDA 1WDPA 3R4IA 2O7QA 4P7NA 1XLGA 2Y62A 3VX0A 4CQAA 1E55A 4TUFA 4IJBA 3WLMA 3KRZA 1UZ4A 3BK0A 5HNRA 1D3GA 1HJVA 4PBFA 2PRHA 5A2CA 1GVFA 4NZCA 1BRLB 4Y8EA 1FWFC 4JN7A 1ZQ5A 5EMKA 4H6QA 2V30A 3S1XA 2DZUA 1R86A 1IZJA 2QF8A 3DC0A 4V33A 4BCEA 2UY3A 1SW7A 4O57A 1XLCA 1J11A 1LLWA 5CQ1A 4WIWA 1QK0A 3VGDA 4C5ZA 4N7QA 3QKEA 4W9TA 4J3WA 1OC6A 3W75A 2KAUC 2XH7A 2FTWA 4ZVJA 3P62A 5K4ZA 5LIUX 1J2WA 1VQTA 3OA3A 2NWRA 1EA9C 4NXSA 3E5BA 3SM0A 1K8YA 2C1GA 3GXNA 3W7DA 3ITOA 5I3KA 1XLJA 1N55A 1TG7A 4HNLA 2GJNA 4MNMA 4H6KA 1VKFA 1WO2A 3WD3A 1GG1A 3ORWA 3ZLHA 4AVFA 4HPJA 1RY8A 2OT0A 3VABA 2G8ZA 3MMDA 3DYPA 3NDZA 4G7FA 4Y9AA 4S3DA 1A0EA 1KXTA 3E9AA 4H41A 5CC7A 1ZJIA 1GT8A 3ZZ1A 1NOUA 2EPNA 2XH4A 2NT0A 1F5ZA 4PMNA 5ECVA 3P7YA 3P82A 3T0BA 3G0UA 4GYFA 4F0SA 4Q7BA 2NQZA 4JHMA 4ES4A 3BC9A 1RD6A 2BY1A 1LRQA 4R53A 1F9CA 1RVKA 2XN1A 4WCJA 4WJXA 1HVXA 4AWSA 3FAXA 3H7UA 3LHYA 1FCQA 4I5RA 4BKNA 5T9CE 1OZMA 5KMYA 3NQ8A 4YIWA 2V3GA 3QV8A 1JAEA 4IQEA 1LWJA 1HL9A 3W85A 2D20A 3WDHA 4N6FA 4BQ4A 1B3YA 4JIEA 3UP8A 4FNRA 3A3XA 2B31A 3FJ4A 3GNRA 4UCFA 3HGOA 2D2HA 1N7KA 1W9DM 4PH6A 1XIMA 1VH7A 1V8EA 1E3ZA 7REQB 1TPUA 5C9UA 4X2RA 3V5CA 5KSWA 1Z9AA 3OVGA 3WBAA 3SCVA 2YLAA 3WUFA 4GYPC 2XTKA 4XO7A 3C2OA 4C6KA 2I1OA 4WJEA 3QEZA 3CHDA 3C8NA 1FVPA 1NAL1 1JZ5A 2XN2A 1JPDX 4ZSUA 3QBUA 1F3WA 3WDQA 2NXIA 3TR2A 3B05A 2VC7A 3ARWA 3O6YX 4JQAA 1MFUA 1FFRA 3RRXA 1ZJAA 3QR1A 4XKYA 3W02A 3PWIA 4IUGA 5DT7A 2RJHA 4QISA 4S3AA 3TX9A 5K3VA 4GCAA 3QF0A 4ATDA 1QXLA 5AYBA 1US2A 3WLIA 1FWDC 4Z0SA 3W01A 2Y70A 2DUAA 1NF7A 5I3HA 4C6QA 1LQAA 3A5VA 3N2CA 4BEUA 5I78A 1RA0A 1UWQA 1GUVA 3ZJ6A 3WQPA 2ZRXA 2I57A 1JRBA 4LTSA 3T0TA 4UTFA 5HQLA 3DGRA 4HTYA 2DVTA 1Z32X 5CGMA 2Q8XA 4W5ZA 5TNVA 3QM3A 2YA0A 3N29A 4IFOA 4LYPA 4O13A 4AZIA 4Q8OA 3URAA 4XSLA 3LA4A 4EXAA 5LSMA 3TSMA 3WSUA 3SCOA 4JTRA 2J8TA 2HSAA 4JTGA 3QTGA 4QG6A 1GOQA 1DL3A 1VBUA 2O9PA 5D2YA 1L6YA 3V1PA 2A7RA 3ES8A 3S6OA 1DTNA 5C9WA 4GLEA 3WF2A 2GDUA 1MRQA 3GTXA 2R1MA 1W91A 4DNMA 1R3VA 3W7HA 4KWVA 3D5HA 5A95A 4W7UA 2OGYA 3G6LA 3VOGA 1CLKA 1U30A 3V18A 4MPQA 3ARXA 2PA6A 3BCFA 1K9DA 3M0IA 4HSOA 3GY1A 2TPSA 4L1WA 1EGMA 2GVGA 2ZX8A 4IX0A 4E3TA 4KFOA 2O92A 3SAZA 1NFPA 1CXKA 3NYZA 4WY0A 1F74A 3MPGA 3N18A 4H4IA 4XZLX 5BOEA 3W7MA 3C86A 2V5BA 2XWDA 3AXHA 4MNLA 4GG9A 1VFOA 1QWGA 2AKZA 4H8VA 4Z08A 1J93A 4KEMA 2Z7KA 3EWBX 4DYEA 1G6CA 4GH1A 4H9UA 5IBXC 1JI1A 1GPWA 3NQFA 1US3A 2XWEA 1QAPA 1UH3A 2EG8A 2G37A 3OBAA 4GNVA 4JYFA 4NYUA 3W74A 1JEZA 3RO6A 1OFDA 1K3UA 3D0CA 4GGHA 1B57A 3K46A 2H9AA 2PSNA 2OYKA 1NOFA 1EZWA 2INEA 2P10A 3PB2A 3GIYA 1XS2A 1A5CA 1JCMP 4M6UA 4KCUA 2FPVA 3LN3A 4ZQNA 3LHTA 2EPKX 1HKJA 4ROQA 2WMIB 1ME8A 4BJHA 2IMRA 2JEPA 3KVJA 4F2BA 4DAIA 2RAGA 2WZHA 3LLDA 5I0DA 4H8UA 2WB5A 4ICMA 4X60A 1IWBA 3GH7A 1UR9A 2D1ZA 4C6BA 4WQ6A 2PU0A 1BVWA 1I0BA 3UA3A 3ONBA 2NWSA 2WLZA 2V6AA 4GXMA 4JKMA 4JNYA 2F2KA 3F5KA 5CZJA 4G6CA 2B7PA 5A2BA 4QJ3B 4MLRA 1R9XA 2VX5A 3SY8A 5H6HA 1V5XA 1I1XA 3GVQA 2YW4A 3M0VA 3GX9A 4U4MA 3I7SA 2ZUTA 5A6KA 5TQLA 1QT1A 4E38A 2CLHA 1YDVA 2VQUA 4W8LA 1G5AA 2J27A 1AH3A 5CJNA 4M1RA 4BQ5A 2ZXQA 5F7UA 1SFTA 5A6JA 4HMEA 1TJ0A 4KESA 5M1TA 3M64A 5D9OA 2X7WA 3GFXA 2D2OA 2WJDA 4TX6A 4NJIA 2FTPA 3GWQA 3WDIA 3M43A 1EP2A 1KW1A 4HHMA 3S2LA 5AYXA 2FPYA 3GG7A 3RR1A 2CZEA 1XYAA 3RXZA 1OEPA 3A4JA 1DXFA 3FYOA 2ZX6A 1XXXA 3IV3A 4D6FA 5LA1A 3KBNA 1D9EA 4MB4A 1W3LA 4HHPA 2EGZA 3TNOA 4CN6A 3VC5A 2REQB 1RUSA 3NM1A 2H3DA 2CFFA 4C6PA 4TXEA 1H62A 1PCWA 1UZHA 3A9BA 2F84A 2O55A 2GFTA 2BVDA 5K2ZA 2WPGA 1XIHA 5I00A 3BGAA 2XUCA 3M47A 5A1AA 3FCPA 2WSPA 3CAWA 4XV0A 1JPMA 4ZO7A 3CPRA 4GQ0A 4ZQRA 3U48A 4EXQA 1AK5A 3MQTA 1E6RA 3DN5A 3FX4A 1UC5A 3CH9A 4Q3MA 2Q71A 1WKYA 3BDKA 1M53A 3PUGA 4K6AA 3VPLA 3P84A 2FMOA 6XIMA 1YNQA 4Y9PA 5L9FA 2WVTA 4O53A 1SJBA 1XG3A 4UWMA 1XLEA 3EX2A 1A5UA 2QZRA 4A3QA 4MFEA 3AHVA 4D2JA 1J9YA 2QT3A 4BWLC 1ICQA 1UH2A 2B7OA 2NQLA 1UA3A 3W28A 1ME7A 1NP2A 4BWLA 1PX4A 1L8NA 2Y8UA 1KC7A 1OQFA 2PGRA 3LPFA 1RZMA 3TH6A 3AU2A 4XBKA 3N73A 1CTNA 5DXXA 2ZZ5A 4PBEA 1JYNA 3FJNA 5CBBA 1F4AA 1Q6LA 4GK8A 4LU0A 3WD2A 1YPXA 3IRSA 4AZBA 2J7FA 4F79A 4D8LA 3THAA 4JX4A 2XHYA 1C93A 3W0KA 2Z1XA 2D0HA 1TMHA 1E1EA 2VCCA 4Y90A 1IXQA 2W62A 3EPMA 2IKHA 3DECA 3WNMA 1LZOA 1KBIA 3UNDA 5FJUA 3N1AA 3UY8A 3VZZA 3SCWA 2C19A 4U5KA 2XGBA 3PUEA 2NV2A 4NYYA 3P8JA 3UJFA 4B4FA 4L61A 3NPVA 2E1WA 1MZHA 1VPXA 1OK6A 5HUPA 4F9DA 2PDIA 2QR6A 1EDTA 4NNCA 3F4WA 2OZTA 1SM9A 4ECLA 1MUMA 1KRCC 1IIHA 2VFFA 7ODCA 4RE4A 3E96A 1TZZA 2PCQA 2V5JA 4IPJA 1PHQA 4BI6A 3VE7A 3G22A 3PSWA 4Z2IA 2NQ5A 2NXHA 3EOEA 1TTJA 1BYAA 2BHYA 1I2PA 4DNHA 4LUTB 3VIFA 1HP4A 3NR0A 2NUWA 4B5UA 3PWGA 4X0VA 4WKHA 3TTOA 4RJEA 3BICA 3N2OA 4H9VA 4LC8A 4CN4A 1P6BA 3OTRA 1ALDA 2R82A 1RXOB 3PVFA 3RCYA 3DDMA 1X38A 4L6DA 4AWTA 2ZXBA 2J7CA 3FYYA 1JZ6A 1H41A 3NQGA 4ZE5A 3VDAA 2GGGA 3W7GA 1RA5A 4PMJA 3MJYA 5U4NA 1S1PA 3MBFA 2WHJA 2QPXA 1I75A 4B5XA 3SRDA 4HU3A 3G8EA 3W27A 1Z6KA 3EA2A 4QLLA 4QE5A 4H8NA 1VBGA 3ABSA 3QFEA 4JHZA 4R7WA 4FX7A 3OLIA 4PTNA 4ZTXA 4Z1YA 2HNEA 3E0IA 3LUTA 4NXKA 2VZSA 4JS3A 2E28A 4DUOA 4N9CA 1W32A 4GI4A 4ZO9A 3FEQA 1EJ7L 3WBEA 5KEZA 1KA9F 1HJUA 3VMOA 2DSUA 5CC3A 1E3XA 4JCMA 1HKVA 2YCIX 1AJ2A 3PC0A 4AX6A 3WQDA 3MSDA 3FDGA 2V2CA 3W1MA 1A5KC 1KBBA 3VIHA 4F2TA 4YTSA 1BQGA 3UR7A 2PWEA 5JUVA 4YYCA 2VVSA 3GTFA 4JZ5A 3L4TA 5GVJA 3ZWTA 3HPSA 5DCEA 1K7FA 1PO9A 4Y8FA 1HL2A 5EMYA 4I5XA 2ALDA 1KFCA 3OZPA 3RO8A 3PTMA 2MUCA 2WXDM 4WOQA 2DQXA 3VTRA 1E4NA 1LBFA 5GJMA 3PFMA 4A4AA 1EDQA 3CEPA 3LLXA 1DJNA 3CB8A 3VD4A 2OVLA 1S5MA 3P80A 3KP1A 5HMDA 5BRBA 2XVGA 3RUBL 2PWHA 4ZQCA 4PTMA 4WOZA 5A2AA 3O06A 2CXGA 3JRKA 4RX0A 3WD1A 2DUXA 4Y7EA 5A69A 2VC9A 3R10A 4AHQA 4XAPA 3ANVA 5I6SA 4MJ4A 3W71A 3H54A 1E0XA 4M24A 2XVPA 4O54A 4LANA 3GXDA 1HL8A 3L0KA 1X96A 3VDCA 3N11A 5C70A 5LIWX 2XJ7A 1JYWA 1HJQA 4G7EA 3JVAA 3RPTA 2A5HA 1A53A 1FDYA 1DJXA 3RM9A 4HOXA 3GNNA 3KP0A 3K13A 4IWWA 3KZSA 3KCOA 1LF1A 1KNWA 1UYQA 4OOUA 1QBBA 4KFPA 4E2BA 1IXNA 4B5VA 3L68A 5E5CA 4P7RA 3HPXA 3AMCA 3V3WA 1I2RA 4L56A 2J47A 2PODA 2VDIA 4U2ZA 1OFOA 3DAQA 2ADAA 1QUMA 3JS3A 3CZEA 1J2BA 4U10A 3FV9A 3W29A 2JF7A 2CHRA 3HN3A 4AFYA 1D7FA 3C2VA 2DUZA 5CKSA 4ERGA 5BXSA 3QRHA 3VFCA 4E8DA 5AVHA 1AMKA 1JNEA 1G1YA 4AZCB 3WDPP 1CI1A 4MF4A 3KTSA 3NDOA 4L6HA 4W4QA 3EKGA 3EMCA 4L4LA 2X1UA 5D8ZA 4JXCA 2V68A 2C3ZA 2VZUA 3W70A 4LVGA 3SUWA 1VLIA 1AL7A 1QOPA 1HUVA 1R8LA 3ABQA 5LHEA 6PTDA 1G4PA 9RUBA 4AD1A 3A12A 4A8IA 4XBSA 4GBDA 3WLKX 3I68A 4HJFA 2E5DA 3W24A 1P1XA 4ZEPA 3O05A 1TVNA 1WPCA 3T4WA 1M1BA 1DTUA 4ACYA 2ACSA 4WF7A 1VB9A 1EBGA 1HF6A 5LHFA 4X61A 3SCTA 1PUDA 2WJEA 1OT2A 1TUXA 5GNZA 3ZJ7A 2HK0A 3DG3A 1YTEA 3QZEA 3NO5A 4IFKA 4L4MA 3MUCA 4I90A 5XIAA 2JGQA 4L9ZA 4A3UA 3NOEA 2PTWA 5CSRA 3NSMA 3J7HA 3BLOA 2GVJA 1B0IA 5CBJA 3PHAA 1WDDA 1XLKA 1CB2A 2GGJA 2CWNA 3ZVIA 3AWOA 4R27A 2BV9A 3THQA 2XFFA 2VFGA 4Q7IA 2Z4GA 2VEPA 3O1NA 3UWQA 3S4TA 4O1EA 3MW7A 1VEMA 2ISVA 2F61A 1JDFA 2E5BA 2FH6A 3D3FA 1SO6A 4IPLA 1HIZA 3NJ3A 3CUGA 3AU6A 4IF2A 1KFLA 4N42A 4NIRA 4MWAB 3VI2A 4QG9A 2ZBTA 1ZL1A 3ARQA 4Z1DA 2PTDA 4RW5A 3UR5A 4J2PA 4JTAA 2E1DA 3PK7A 3W72A 4X9SA 2O56A 2J8GA 4F48A 1ZBCA 1QU4A 4HZ7A 3TW9A 3EWDA 4GZJA 4HHHA 5HJYA 2DZTA 5I3JA 1PYFA 3B8SA 2XIJA 5DX7A 3NEHA 1V0MA 1EJRC 3VKKA 4HZ8A 2YCKX 3W73A 3H53A 4N6EA 2BODX 4AHPA 3JU2A 4DN1A 2OB3A 1MDLA 3V7PA 4QCEA 3I6EA 4B5WA 3SCUA 2XIMA 3L4UA 3M5ZA 1Q6DA 5FACA 3GYEA 2DW6A 2W9MA 5FEZA 1XBXA 1NH6A 1Q4WA 1HKWA 5CXPA 1TO3A 4XUGA 3IIPA 5GNYA 4ZOEA 2WMIA 4PB5A 3ZVHA 1V02A 4HNCA 5U7SA 5A6TC 3MP3A 1VFFA 3PZQA 1F7BA 1DQXA 3A24A 2OQHA 4UTWC 1YBQB 3GC5A 2FHCA 3MP5A 4CCDA 1G67A 1S2VA 1S1RA 1OINA 1F8MA 4YU1A 1YE6A 1Y5XA 1M03A 1XL9A 2PDMA 4KS0A 3THUA 3VDBA 2PF0A 3MI3A 4W86A 3VGEA 3WMCA 3V1HA 2X0HA 3QR3A 1J6PA 4EP8C 3LZ5A 2IPWA 2HE8A 4M0XA 1G94A 3N6JA 2Z29A 4O14A 3PNUA 2VDGA 2GOUA 1L2QA 1TV4A 1PB0A 4J9JA 1KTCA 3O6DA 3UWZA 4WD0A 4XZ9A 4IP4A 3R0DA 5HMEA 1SQ7A 3FHAA 2HS6A 4NZ1A 2PGWA 3ZLFA 3FGCB 2EPHA 4UFLA 2WC7A 1XYBA 1JD7A 2AGKA 3LQLA 3UY7A 5FAJA 3GKAA 1GW9A 1W3NA 4N4QA 3W38A 2BGQA 1OZQA 2W27A 3T07A 1RR2A 1T8QA 5FF2A 3DH7A 3WFAA 4L6OA 3UGVA 7REQA 3TW7A 3W53A 3GU9A 5CSUA 3GHSA 4KWUA 5H8PA 3P0WA 1DHPA 1F2JA 5EA9A 4LS0A 2Y1HA 2OWCA 3GVWA 2BX7A 4LUIA 4PCTA 4QAWA 4Z0JA 3URQA 3ABXA 4K8GA 2QMJA 5LXXA 2GGIA 1GQNA 3A22A 1PDZA 1M04A 5IXEA 3MZNA 1MEHA 3T0DA 3BWWA 2OJPA 2QUMA 4ATWA 4IMGA 3GC4A 3HMCA 1R3QA 2HRWA 3TXVA 3TTSA 4GNJA 2C71A 3WMSA 1W9BM 1ADOA 3R79A 4HMDA 3NXFA 1LORA 4MKNA 3I6RA 1W37A 2WHLA 4FOKA 1FQ0A 1UPPA 1WV2A 4POCA 4PYSA 5FL1A 5JIPA 3CM4A 3P93A 3UD6A 4F3HA 4US6A 1IF2A 3O0FA 3MVTA 2ODOA 3CEUA 2WMFA 3TJXA 4WGXA 2XSBA 4MADA 2I9EA 1Z89A 1ZAJA 1EA0A 3WQ8A 1CXFA 1H1NA 1UWIA 1GCYA <