5C55A

Crystal structure of the y138f mutant of c.glutamicum n-acetylneuraminic acid lyase in complex with pyruvate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
307
structure length
307
Chain Sequence
TFTGVIPPVMTPLHADGSVDVESLRKLVDHLINGGVDGLFALGSSGEAAFLTRAQRKLALTTIIEHTAGRVPVTAGVIETTTARVIELVEDALEAGAEGLVATAPFYTRTHDVEIEEHFRKIHAAAPELPLFAFNIPVSVHSNLNPVMLLTLAKDGVLAGTKDSSGNDGAIRSLIEARDDAGLTEQFKILTGSETTVDFAYLAGADGVVPGLGNVDPAAYAALAKLCLDGKWAEAAALQKRINHLFHIVFVGDTSHMSGSSAGLGGFKTALAHLGIIESNAMAVPHQSLSDEETARIHAIVDEFLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase/N-acetylneuraminate lyase
publication title Crystal structure of the Y138F mutant of C.glutamicum N-acetylneuraminic acid lyase in complex with pyruvate
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Lyase
total genus 115
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c55A00
2YW3A 3HBLA 4WY0F 1XBYA 3DHFA 5BRBA 4JTEA 1J5TA 1NFBA 4Y90A 5CKSA 4BI6A 3UWUA 4I7VA 1R2SA 4JYEA 2WSQA 4FNRA 2YPIA 1O4UA 4EWND 1RQEA 1H7OA 3LX9A 3NQCA 2ZRYA 3NXFA 4JYFA 2X1UA 3SR7A 4M7SA 3BG3A 1QR7A 3RLVA 3G1AA 1IF2A 2NX3A 1EUNA 1OG0A 3M1ZA 4IXXA 3R8RA 2B7PA 2EF9A 3M9YA 4GUJA 4GFSA 2DJLA 2G97A 2J9YA 2RH9A 4JX6A 1TQXA 3WJWA 3W7LA 4QQ3A 2Z6JA 3N19B 1K7XA 4UCGA 5LNWA 5F2GA 1A5AA 1EUAA 2VKZG 1WDWA 1YYAA 4IWWA 3NQ6A 3A24A 1G4EA 2QCFA 1N7KA 5AHLA 2Q8LA 2Y7GA 2OJPA 3DKJA 3GDKA 3N2XA 3W1NA 3TJLA 3KFTA 4WXYA 1AL8A 3L0NA 1SW3A 4BFAA 3C8FA 1TV5A 4JGDA 1J4EA 3P5ZA 2ATMA 2Y61A 2HS6A 1YPFA 1BKSA 4CNOA 5DXXA 4FEZA 5FEWA 4NNCA 1W5NA 1C9DA 5HWNA 3N2MA 5LNRA 4NXSA 3JR2A 1K8ZA 2QAPA 3RMJA 2Q8ZA 1NF7A 4E38A 3UPWA 4UTKA 3P74A 5FF4A 4WZHA 3GXNA 3INPA 4WJEA 1ICQA 2J9ZA 3QPZA 3THAA 4K7VA 4RCXA 3M44A 3G1FA 1EB3A 3PY2A 1G7VA 4XKYB 1N8FA 3LM7A 1BEUA 2PC4A 1KLYA 3IGXA 4QIUA 3BG5A 3S5YA 3OVQA 2C15A 4NZJA 1ZENA 3D0CA 4IMDA 1KFLA 2KZHA 2A6NA 5FF2A 1WV2A 1M6JA 1JULA 3WK2A 5LNUA 4FB7A 4HNUA 5HR6A 3NQ8A 5D38A 5LHFA 3NQ7A 1I2PA 3MMTA 1VYSX 3NG3A 3TIMA 3VI2A 3W7GA 3A23A 3MI2A 2J9XA 3S5ZA 1RR2A 2WNNA 5CSSA 1F7BA 1GVRA 1HUVA 3ABRA 1EA0A 2F7FA 1K02A 1PS9A 3LBCA 1UASA 1EIXA 4EOUA 3C2RA 1H1YA 2WSRA 4TMBA 5LNSA 1F76A 4BR1A 3HOJA 1TJPA 3TK7A 4FX8A 4DPPA 3W7IA 3W7DA 4O1DA 1PIIA 3A9IA 3T78A 1KTNA 1Q6QA 3OIXA 3LLDA 1VHCA 2ZA1A 2V5LA 3M0ZA 1WYIA 5CPLA 1TPVA 1ML1A 1PHQA 1ZJIA 3PVFA 3N3MA 3DENA 5CPMA 5AYXA 5G4EA 3KOFA 2V5BA 2ISWA 1DV7A 4AWUA 1EP2A 4ZMGA 1GYNA 3FLUA 4UMAA 3TMQA 4N2YA 1M7PA 3NR0A 4O50A 3WJSA 2VEIA 4N6EA 5CZTA 4XKYA 2E1DA 5GVJA 1C29A 4ZQPA 1GVSA 1R30A 1JUEA 3NDOA 5AHIA 1TIMA 1FXQA 5DLCA 5F2MA 5A5WA 4AWSA 1GVOA 5TBOA 4AAJA 1FUYA 1VR6A 3W7HA 3LTYA 5D09A 3QM3A 3G8EA 3T7VA 3L67A 1FWNA 2FJKA 3G1VA 1L6SA 2VELA 2G95A 4AHOA 4ZQOA 1XFBA 2W0UA 3BW4A 5HUPA 3G3DA 1VJIA 6TIMA 4A22A 1VQTA 4UTHA 4XBKA 5HINA 3W2KA 4LV9A 3STEA 3TDFA 4QNWA 1A53A 3O6CA 1BWKA 3TFXA 1F05A 5FF3A 2DZUA 1X1ZA 5G5IA 4HPJA 1LTDA 1T8XA 1TPDA 3QF0A 4K8HA 3I68A 3T40A 3L21A 2JBMA 2W79A 4RZ5A 2FPVA 3RNDA 2GQ8A 1EP1A 2YFNA 4K36A 3TQKA 3W1MA 3GDLA 1RPXA 4JTIA 2GOUA 2I1OA 4M5PA 4A29A 2OT1A 3O63A 3OA3A 3DHDA 2H90A 3B0PA 3ZWTA 3MP3A 3MYOA 3EKLA 3DFNA 3FA5A 3PULA 4NJIA 2PRHA 1OK4A 4JR5A 2QDHA 4QSHA 5AC6A 2Y7DA 4Q4KA 4O53A 3GLCA 3BARA 1GEQA 1F5ZA 1TPC1 2B7QA 2NV2A 3S8HA 4ZZ9A 1JUKA 1W5OA 4ZL1A 4UTTA 1KW1A 5K7JA 3LCFA 4Y96A 1OFPA 5LGXA 4O57A 4UNLA 3L65A 2ZRUA 1FCBA 1ME7A 2CLLA 3QC3A 2CLMA 3T55A 3CTLA 4NZFA 5C54A 3TW7A 2QCCA 4DBEA 4R33A 2NV1A 5DY3A 3PG9A 4ML9A 3I6RA 1EX5A 4AF0B 3F4NA 4UFLA 3NL5A 4IX2A 4TR9A 4AEOA 5K9CA 1XBXA 3PWAA 5AHFA 4O11A 5D2VA 5DCDA 2ZFAA 3L0GA 1DQXA 3CWOX 4EF9A 3TV8A 4X3ZA 5F4SA 3FEMA 3CEPA 5D32A 3S1XA 3LHZA 2H3DA 1THFD 4FIRA 3FFSA 4CNPA 3LXCA 1GT8A 4CCEA 2B7NA 3MO7A 1SUXA 3QJAA 4DQWA 4O4VA 3CM4A 1GWJA 1ICPA 4MJZA 1TPH1 2WNZA 5H91A 1KFJA 3W84A 1W3TA 3QZEA 3VE9A 1TTPA 3OVRA 1R46A 1T99A 3JRKA 4HSNA 1JCLA 4UTWC 2VFHA 2CFFA 1LORA 1A5BA 4QNEA 3VCRA 5FESA 4JYDA 1QFEA 1JCXA 1D3HA 4MUZA 3G1DA 2WKJA 1OJXA 4R53A 3VNDA 1YXYA 1X8FA 1GOXA 4HPXA 2ZTJA 2ZDRA 3NQMA 3B05A 3IRDA 4IMCA 2R14A 3TSMA 3ATYA 4NT0A 1F6KA 3WK1A 3LCHA 5LSMA 5E0KA 1H50A 2B7OA 4ZVJA 4NX0A 3G18A 3WFAA 4AF0A 3I65A 1FXPA 2ZZ6A 3W74A 2FPYA 3W7PA 3DFPA 1QAPA 4ONVA 3NL2A 1TTJA 1L6YA 3EXTA 5AFDA 4RJEA 4O1CA 1I2RA 3LV5A 3UZ5A 5AB3A 5L6UA 3P61A 4N9BA 5AN7A 3W1PA 1TTIA 2PRMA 4S2CA 3TNOA 2NXIA 3TMLA 3H53A 3NQFA 1TRDA 4UNKA 2J24A 3MP4A 4G1KA 3DFQA 5AC7A 1U5JA 2ZQ0A 4MIMA 3O15A 1EEPA 3PM6A 4OQVA 3DI0A 1VS1A 2C6QA 1TTQA 5J5RA 4HIBA 3TROA 4N02A 1AMKA 3CU2A 5G1TA 4JS3A 4LS1A 1JQVA 1DJNA 5KZMA 1AW5A 4TIMA 2FB2A 5EMUA 4ICNA 1MEIA 1NAL1 3P67A 1P0NA 5FEZA 3C61A 4AHQA 2E68A 1OFAA 4FNPA 3R13A 1LLWA 1SR9A 3P8JA 3W7QA 2QCMA 2YYTA 3W6YA 2H8XA 2DZXA 4UMBA 3PAJA 1M7OA 4BWLC 3O07A 2NLIA 2P10A 5HWMA 4UTMA 5I3FA 1W5PA 4PEKA 4I7WA 3F1QA 4RXFA 3L66A 4LNYA 4TO8A 4UFMA 4PCFA 4XBSA 4DO5A 1Q6RA 3EX1A 1P1XA 3KVLA 1H7PA 1RQHA 4UUIA 3O05A 3S9YA 4LW7A 2J6XA 3KRSA 4LV4A 3TXVA 3F4WA 1LBMA 1XXXA 3KVJA 3C52A 1H61A 1HTIA 2A6LA 3B04A 3NPUA 5AHNA 4A2SA 2GQ9A 1PL9A 3ELFA 4GWEA 2Y63A 3UPBA 4DEFA 1ZALA 2V8ZA 4M6PA 4YWIA 1W37A 3UQNA 3NOEA 3MUXA 5G1YA 1MXSA 3TSBA 3M16A 2BXVA 4N4PA 1HO1A 1TQJA 2YXGA 4JTKA 4MPQA 2RDTA 4ORMA 5CPOA 2FIQA 3UXDA 3GKAA 1A5SA 4O10A 1CI1A 1XCFA 3LERA 4O13A 3GDTA 5DBUA 2WQPA 3S1UA 1TO3A 3S42A 3IIPA 2JGQA 3P81A 1EWDA 3G8RA 2QUUA 2FDSA 3PBVA 4FX7A 4DPQA 3CEUA 2WPBA 1GTEA 1TJRA 5D2TA 1GJPA 5K2ZA 1ZAHA 3EX3A 2AQWA 1TMHA 2CZDA 2ZZ4A 3LHYA 1YDNA 2E77A 2A1YA 1LOSA 3TA6A 3IGUA 5C55A 2ALDA 4JTJA 1O5KA 3STGA 1NVMA 1IXPA 3IGSA 1YDVA 1X7FA 4TU1A 4DO4A 4RKAA 1JRBA 1JCYA 4UTWA 2RDUA 3GKFA 3UYCA 1TV8A 3LBMA 2YX0A 2NWSA 3F03K 1OF8A 3GB6A 2VC6A 2CLIA 3IIXA 2FQIA 4HKPA 3W1AA 4MKNA 4GE8A 3FJ6A 2CW6A 2A21A 4IMGA 3UD6A 1KBIA 4MFDA 3W22A 5D02A 4RLIA 1R47A 2QJHA 1TB3A 5K3VA 4JIQA 1QCWA 3DZ1A 4P61A 2RKXA 1YLVA 3EX6A 2XN2A 1UUMA 5SWUA 4PTNA 4GJ1A 1PCKA 4OBTA 3LTSA 1OX4B 5DCBA 1H62A 4CNNA 3MHGA 1TPEA 4UTLA 3PC0A 1D9EA 1G4TA 4XZ9A 1XKYA 3ZS4A 1SO4A 4OE7A 2V81A 5D03A 3DFTA 2PURA 1QDSA 3DAQA 2CLFA 1G6CA 4MY9A 5AOUA 4BI5A 4N6FA 3B0VC 2C3ZA 4ZQRA 4L4LA 3Q2DA 3UY8A 1GVFA 4CCDA 3IVSA 3R12A 2Y70A 1XBVA 3M5ZA 1I2OA 1SO5A 1IXOA 3ABOA 2WV8A 3N9RA 1H7NA 3WJYA 1N55A 4ADUA 3TR2A 1VHNA 4UTTC 3HO8A 4UIOA 1GG1A 2EPHA 2NWRA 3PB2A 1OFBA 4OHQA 1Z42A 1G7UA 2YW4A 5AHEA 1RD5A 4BWLA 3TQVA 2CLKA 3PUEA 3QMSA 3S1VA 1AW2A 2QCDB 4JX4A 3W2LA 1OYAA 3P80A 3RFAA 1MO0A 1W54A 4NVTA 5CZJA 2VFDA 4MZYA 2V9DA 4LC6A 2B4GA 2HSAA 3LCGA 2HS8A 3C2VA 1O94A 5FEPA 1FQ0A 2I14A 3G0SA 3OEXA 1J2WA 2ZA2A 5BMWA 1LCOA 2C13A 1I4NA 2NX9A 2CLEA 3FJLA 4P2VA 1B57A 3IV3A 4AWTA 2C16A 3E49A 1P0KA 1H7WA 1OX4A 1SW0A 2Z0IA 1KV5A 1F6PA 3IIOA 2WO5A 1GPWA 3NVTA 5FEXA 5I3JA 4PL2A 5H2ZA 4IUOA 1JCNA 4GUGA 3UY7A 4WOZA 1T96A 1X1OA 2ABBA 1LBLA 1OVDA 4K37A 5K9XA 4OV4A 2X1SA 4XWUA 1Z41A 2VEKA 4DELA 3PS7A 3IIZA 1RQBA 4H4IA 3M5YA 4GC4A 5F2LA 4N4QA 1QNVA 5HR7A 3DXIA 3HF3A 4FF7A 4MFEA 4CQAA 3HPZA 5D2YA 3B0UX 3SW6A 4ADTA 3SI9A 2XFWA 4J9JA 3C56A 1NSJA 3HJZA 1I8JA 1IXNA 2EHHA 4KWWA 5K9DA 1YPIA 4QAIA 2E5DA 1GTHA 2FFCA 1TV7A 4UR8A 4WOQA 3AJXA 1ICSA 3HQ1A 4Y6GA 4YCPA 2QCDA 4UTJA 3QEZA 4EVZA 3UWVA 2Y62A 4GNJA 3B4UA 1PE1A 2V82A 1DVJA 1CW2A 3B8DA 1KV8A 4O8RA 2C18A 3UWYA 2YSWA 1MSSA 3CIWA 2V2DA 3ZR4A 4RX0A 3PG8A 3HGOA 4IQLA 5D37A 3W2NA 2WSYA 3G0XA 3DFOA 1UBSA 2A4AA 2NUYA 3LI0A 3FKRA 3H55A 4RZ4A 4EIVA 5E93A 4JIPA 3DGRA 3LOTA 3P8IA 3Q58A 2YR1A 1OX5A 4JTSA 1ALDA 3E0IA 4LY8A 5HJLA 3S0CA 2OCZA 2XN1A 4NUWA 4O19A 2OT0A 3QQ0A 2W6RA 5IBXC 4RZ6A 3S5NA 3W3OA 1KM4A 1O60A 3MHFA 4IJBA 5BMXA 1I45A 3H54A 1K03A 2QF7A 1DOSA 4CCCA 5EA9A 3NNTA 5AC8A 5LKYA 1LP6A 5G2WA 3NL6A 1LLZA 3W2JA 2QCEA 3C2FA 3NPXA 3NM1A 3Q37A 1QPNA 4JICA 3BK0A 5U4NA 1RV8A 5LNVA 1WOBA 3W7EA 1KM3A 4JEQA 1U83A 1A5CA 3NQ2A 2C0AA 3DBPA 5I3GA 3LCXA 4MLJA 3BGGA 4MYXA 2WOQA 3W1UA 3EEGA 3TAKA 1ZFJA 4GUIA 2DZTA 5EBUA 3SY5A 4I9AA 3FKKA 2X2GA 4LVFA 2ZCGA 1PHWA 4M6QA 1XC4A 1VPXA 3V75A 1ADOA 1LRQA 1F2JA 3UWZA 4FNSA 2ZRXA 3HIJA 1SW7A 4PODA 1DL3A 5HWJA 3M43A 3LLFA 5FF7A 3KVMA 1XUZA 2YZRA 2PRLA 1ZCOA 3KXQA 3G1XA 1VLWA 3LXAA 4HSOA 4KKXA 1V5XA 3CWNA 3U6WA 3W7OA 3LHVA 4DF1A 3BLIA 2Y88A 1B4EA 4WD0A 1S5VA 2ZRZA 3TCEA 5DXYA 1Q6LA 3TC7A 3W75A 4Y9AA 2CZEA 3NEVA 2JKEA 4AMAA 3LCIA 3A22A 4IXHA 4UFIA 2QUTA 3TAOA 4MJMA 2QCGA 2YCEA 2RDWA 1YADA 3LHTA 4Z1CA 5FI8A 3GK0A 1GQNA 3PBYA 4JD4A 4L4MA 3WJZA 4PA8A 3NQVA 3W76A 1VH7A 3OBKA 1LRTA 3TQ0A 3E9AA 2ZA3A 3EXSA 2DORA 3VFLA 3KHJA 2E6DA 4YCOA 3EWYA 3RK8A 5E1QA 4LS0A 3TKFA 3W1TA 1W8SA 1KM2A 5KZEA 1CX9A 4POCA 3TW6A 1KFEA 4KFNA 3JS3A 4Z1AA 3QW3A 2VFEA 3HB9A 3CHVA 2NXGA 5TIMA 4XUGA 1EWEA 1IGSA 1C8VA 3BV4A 4XQ6A 3GYEA 3O6YX 1TPUA 3W9ZA 2CU0A 3NPWA 3KRZA 5HQEA 3W23A 3HGRA 1ME9A 3NQAA 4JDYA 1JQXA 3BW3A 4A2RA 1S5WA 1O95A 3L0KA 3P5YA 1QMLA 1OYCA 5FF0A 1IXQA 3G0UA 4JTFA 4C1KA 3CT7A 1P5BA 2FLIA 4NU7A 4O0KA 1ME8A 1QPRA 4LC8A 2ATSA 3LDVA 4QISA 3HPSA 2VENA 3SECA 4OU1A 4AVFA 1WXJA 4GXMA 3P60A 4PL1A 3T4CA 5U7SA 4MOZA 1HFBA 4MZ8A 2Q3OA 2QUVA 3S5OA 5I3IA 2VXNA 5IBXA 2Z2UA 1PV8A 3HG4A 3O6DA 2BZNA 4RV8A 5C2XA 4U28A 3W72A 4BF9A 4NJHA 1R2TA 1LOLA 2R91A 1OF6A 2FPTA 1VZWA 3BVJA 1W0MA 3LGEA 4LWWA 4WY0B 1TPFA 3NGJA 4LU0A 2Y89A 3C2EA 4HT3A 3DFSA 5AYZA 2VEPA 3L5AA 2O7SA 3EB2A 3M5VA 2ABAA 3SFKA 2CZ5A 4O17A 3M5XA 2Q3RA 1SO3A 4HNVA 1P4CA 5BW6A 3MBDA 4MZ1A 3G24A 1HG3A 1QPOA 3NZRA 5LHEA 3SSJA 3IIVA 2GJNA 3E12A 1WA3A 4UMCA 1KFCA 5BNKA 3G3MA 2TMDA 2ISVA 3EWZA 1ZNNA 3QPYA 3RF9A 4UTIA 1KA9F 4HN4A 1SQ7A 2FB3A 1QO2A 3K30A 2R94A 5I3KA 3U2OA 2HMCA 3STFA 3W71A 5G2HA 2J27A 3L2IA 5AYYA 4FHAA 4LVDA 3V1PA 4FO4A 1IIHA 3WJXA 2VEMA 2ZZ1A 4JTHA 1XDLA 1RZMA 4BI7A 1HO4A 3KX6A 3TC6A 4NNBA 3PSWA 4S1FA 2B0MA 2JK2A 5TQLA 4DBDA 2VFIA 3C6CA 4LVBA 4RK8A 4HHPA 4W9TA 4U4MA 5HULA 2AGKA 3NQDA 4LVGA 2IQTA 2DZWA 2DU2A 4WY0A 2Z1BA 4NJGA 2AAMA 2DJXA 1SPQA 1L6WA 1NEYA 1TREA 2TSYA 4R34A 4X9SA 3HGSA 3A5FA 3NYZA 4UC5A 2ISSA 2TPSA 3HPXA 5D2WA 4C1LA 1OHLA 1XBZA 4WXZA 5D05A 4RXGA 5ABTA 4WX2A 2GPTA 3PBUA 4N9CA 1JRCA 3QSTA 1XUUA 3E96A 1LOQA 1Q6OA 3C0JA 1KM6A 4O54A 4O0ZA 4S2BA 2NX1A 3QQ1A 4NNAA 2A7NA 1LBFA 3NL3A 3W1RA 1SZFA 3MP5A 2GVJA 1SSDA 3N9SA 1VCFA 1KTBA 3M6YA 3GNDA 3LI1A 8TIMA 3MYPA 1FDZA 5KINA 2JKAA 1FBAA 2YYUA 3CB8A 1Q45A 4UTUA 2A85A 4GRSA 2QAFA 1G67A 2RFGA 1FCUA 1JCMP 4Z0JA 3M41A 1S5TA 2CWNA 2QDGA 3CQ0A 3QH2A 4KFOA 2QR6A 5HUOA 1XL9A 3UWWA 4CQ8A 1DQWA 1ONRA 4JTUA 1KFBA 4LS2A 4ADSA 3BGJA 4OWGA 5CSRA 5F4XA 4M7TA 3LCLA 4K39A 4GBUA 3L9CA 3N14A 5CPNA 1TSIA 5J5DA 1W5QA 4JY9A 2QCHA 2PE4A 1B3OA 4TMCA 1FWWA 2Z6IA 3N73A 4O14A 4N9EA 2WJZA 4O1BA 1WBJA 5MHBA 1K7EA 1YTDA 4O1AA 4UXDA 3C3NA 1OFQA 1OX6A 1OYBA 3ABQA 3GX9A 3QMTA 4IPJA 3EX2A 2QJIA 3RU6A 4FIQA 7TIMA 1H51A 3NQEA 2UV8G 3GVGA 4M6VA 4X2RA 1LROA 1W5MA 3LRLA 1PVNA 2E5BA 3B06A 2FTPA 3VKJA 2C19A 4MYAA 3ATZA 2TRSA 3SJ3A 4TX9A 1SSGA 2BSLA 3KAOA 2F84A 5KITA 3GIYA 1H7RA 3W1QA 3FYOA 3TE9A 5CGQA 3G22A 3W2UA 5HMSA 1WX0A 5EPDA 2E09A 3THQA 1KM0A 4O12A 4M19A 4WUIA 4H3DA 1EPXA 4GUFA 1F74A 1MEHA 1KM5A 1WOAA 3O1NA 4MY1A 4AHPA 1BTMA 2E6FA 3LXBA 2ZRVA 4O16A 3HGJA 1DBTA 2G96A 2CLHA 1VCGA 2BLEA 2EGZA 3P82A 2ZTKA 2P0OA 2YGYA 3NM3A 4KWVA 1W3IA 1FDJA 1OK6A 4XTDA 2E6YA 3GXPA 1TPWA 4O28A 2GJLA 3BLFA 3M7WA 2YDAA 3BO9A 2BTMA 3NPVA 3AO0A 4GUHA 2NUXA 3RLUA 5K4ZA 2DZSA 6ALDA 2V0TA 1IIGA 3KRUA 5D30A 3EWWA 4K8EA 2WNQA 3OHIA 4LVAA 4A3UA 3EWUA 3UWQA 1R2RA 2A5HA 3DH7A 3W83A 3WK3A 4Q33A 1JJKA 1Z44A 2H8ZA 3TH6A 4ALDA 1VGAA 3DI1A 3QFEA 2VFGA 4UFHA 2CLOA 5DN1A 3FIGA 3TXZA 4ZQCA 3O8AA 3GAKA 3QSRA 1QOPA 3GAYA 1QO5A 5F2IA 4Z1DA 3R5EA 1GZGA 2X1RA 4EF8A 2BX7A 4YLWA 4ORIA 5G4WA 4D2JA 2RHGA 3W1XA 1VLIA 2H3BA 1QPQA 3MJYA 3O06A 3QYQA 4E0CA 1DHPA 5DY2A 3FOKA 2D73A 5CZSA 4I7UA 3ANYA 4NJKA 3PR2A 3W73A 4CQ9A 4O4WA 3SIZA 3L5LA 4RR4A 3C4UA 1OFOA 3IEBA 5EYWA 4FNTA 5T26A 3ZWSA 1GYLA 2LLEA 1KLZA 3M47A 3USBA 1FWRA 4O18A 3NO5A 1YXCA 3TU9A 4LRTA 5EKYA 3HMJG 3G1YA 4JN6A 4CLMA 5D04C 2I9EA 1B4KA 1H1ZA 3DU0A 4XTIA 3S1WA 3W7RA 1VYRA 3NAVA 3NQGA 1ZY9A 4Q32A 3N34A 1X6UA 3W7NA 3PUOA 3W87A 2P1FA 2VOMA 2C14A 4FNUA 1JVNA 3P7YA 2GVGA 2Y7EA 3L68A 3TX9A 2A7RA 1WQ5A 2QCNA 3B03A 4O15A 3HG2A 4PH6A 1OABA 4WQ6A 1G4SA 4OGZA 5F1UA 1UCWA 1ZHAA 2QCLA 5DBTA 1S3HA 3MI3A 4IGHA 1XI3A 4FXSA 4N9DA 5CG7A 1BWLA 5A8GA 1JCJA 2V2CA 1KBJA 3GR8A 3W7JA 1MZHA 2QKFA 4MVAA 1SU5A 1V7YA 1EP3A 3GNNA 3FS2A 4DXVA 3LB0A 2E6AA 1FX6A 4NQ1A 1YDOA 3W88A 4ZQNA 4AXKA 3TJXA 3W7MA 1FWTA 2A0NA 3R89A 1TCDA 3UZJA 1SZGA 1XDMA 2Y85A 3EWBX 4H6KA 1JR1A 2PCQA 2DZPA 1L2UA 1FCQA 1VCVA 3U8GA 5L9FA 3PSVA 2GQAA 3UXAA 5CZ0A 2C1HA 3GDRA 4HNNA 3MHUA 5LGZA 5K4XA 1UJPA 2OMAA 4JDBA 1G4PA 3GXTA 2DZVA 3R2GA 1DKWA 3W07A 1Q3NA 3QMRA 1T0OA 3BLEA 1W56A 4AB4A 1W31A 3CLMA 4NJJA 1K8YA 4YXGA 1AL7A 4Z1BA 4DO6A 4LUJA 3GDMA 3OVPA 1K7FA 5F4WA 2TYSA 3I7SA 1W3NA 3CPRA 1FY6A 2BWGA 2NUWA 1ZAJA 1PCWA 2CZFA 4UR7A 4FXRA 3PF3A 1TYGA 3EXRA 2JGYA 1SO6A 2ZYFA 4K7YA 2Y6ZA 3A21A 3IVTA 3ZFHA 1O5XA 1F73A 2DP3A 5I3HA 3Q94A 4PFMA 4NXKA 3NA8A 1FDYA 1L9WA 5G2IA 3T44A 4A21A 5KZDA 2ZBTA 5KSWA 1G69A 2ZZ3A 3LTPA 4LT9A 4PC8A 3VE7A 3FYPA 4UFJA 3I7QA 4JXCA 2R8WA 1SFJA 3LRKA 1I2QA 3MBFA 1I2NA 1SFLA 1H63A 4FNQA 4B5NA 1M5WA 5KTLA 2VFFA 3S6DA 2J88A 4ZQMA 1AK5A 4QJ1A 1UUOA 2XN0A 2A2IA 3G1HA 3SGZA 3QRHA 3HG3A 4K6AA 1AG1O 4MLRA 3BG9A 1UB3A 3G1SA 4DF2A 2E5CA 4LUIA 1ZAIA 1K8XA 4OV9A 2YFOA 2QEZA 2Y7FA 4JTLA 4KFPA 3P84A 3DKLA 1TPB1 1GVQA 3LRMA 4IMFA 1DJQA 4E2DA 2X16A 1LM1A 2OZ0A 1E51A 3P62A 1LYXA 5BOOA 1LZOA 4JX5A 3UNDA 4QITA 4UFKA 3EWXA 3KVKA 1LRNA 5EY5A 1GG0A 2ZZ5A 2OX1A 3E02A 1OFRA 3LCWA 3SGUA 3LV6A 3EX4A 2ZZ2A 2GUUA 3GR7A 1Z48A 2NXHA 3LHUA 5D33A 3L5MA 1FWSA 1NF0A 1YTKA 1JUBA 2ZZ7A 3HG5A 3C2OA 1DORA 1H5YA 4IX0A 1D3GA 1H7XA 3MWAA 4NX5A 1MEWA 2V2HA 1SZNA 3QW4B 1TRIA 3WK0A 1AW1A 1H60A 5HNRA 3STCA 1WBHA 2X1TA 1KTCA 3TUUA 1B9BA 1XM3A 2GVLA 3W70A 3PB0A 1K3UA 4JNMA 1YTEA 4IOTA 1A50A 3I7RA 3PBWA 4IMEA 4LTSA 2EAWA 3W2MA 5IM51 1OFEA 4E2BA 1VRDA 5DCEA 4MY8A 4LRSA 3TFCA 3W1LA 3MI6A 2NZLA 5EL1A 3NZ1A 3BPWA 4K38A 4LOCA 3W86A 3W7CA 3TSDA 1KFKA 5LZLA 3A5VA 5C6MA 2ZRWA 4Y8FA 3YPIA 4AH7A 3GZ3A 2EKCA 3CIXA 4BK9A 4Z0SA 1WAUA 2H6RA 1HL2A 4X22A 1SZEA 4OT7A 3ABSA 3IVUA 4QM1A 5C5YA 1RVGA 5F1VA 1FCVA 1Y0EA 1QWGA 2A7PA 3EKZA 3MW7A 1VYPX 4JY8A 4YMZA 4HNTA 3OG3A 5AHMA 3O16A 3SZ8A 1W1ZA 4O52A 2G5WA 4YL2A 1KM1A 4R7JA 1QOQA 4JTGA 4JTTA 2X30A 1LDCA 4IPIA 3W7KA 1YXDA 5KMYA 2JKPA 5DELA 2HTMA 4FX6M 1VC4A 3W85A 5D2XA 2O7QA 4Z08A 4DF0A 3LHWA 3BW2A 2V30A 1OFDA 3CC1A 3PUDA 2QJGA
chains in the Genus database with same CATH superfamily
2PODA 2YW3A 4FXJA 3RO8A 4JIHA 4WY0F 1XBYA 3DHFA 3VTRA 4Y90A 5CKSA 5A2CA 3UWUA 1B2YA 4JYEA 1BVWA 1BFNA 4PTWA 1VFHA 1CZ1A 1O4UA 1UZ1A 4JNYA 2ZKMX 1Z69A 1JZ2A 1S38A 4MB5A 3TYBA 3G1AA 2V3GA 1OG0A 3M1ZA 3R8RA 4IFKA 3REQB 1E6SM 2RH9A 4JX6A 5TNVA 1EX1A 4C7GA 3WJWA 1N8IA 2FTWA 3TYAA 5F2GA 1EUAA 4KF1A 2HPIA 1WDWA 3VDCA 4IPNB 3KTCA 1J6OA 2QCFA 2Q8LA 3QKZA 3DKJA 4NHVA 4JTQA 2YB1A 1YW1A 3GXIA 1AL8A 1Y7VA 1ZJAA 4JGDA 3TLLA 3T09A 2ATMA 2HS6A 4AIUA 5FEWA 4NNCA 1W5NA 3G5EA 5HWNA 4D6FA 3VIHA 5LNRA 4I9JA 1K8ZA 1JYWA 1UUQA 5H6HA 3VIOA 4IPLA 2ACQA 3W00A 4UTKA 1IZCA 5FF4A 3GXNA 1ICQA 1VD6A 5BXSA 3AROA 4LYPA 3TW9A 4C91A 3LM7A 2VCBA 4F79A 1KLYA 2YDQA 4GO9A 1EJWC 1AQFA 4J3UA 3H26A 4QIUA 5DRIA 3BG5A 3S5YA 3OVQA 2C15A 2VWTA 4NZJA 4WK9A 1UD4A 1KFLA 2KZHA 1T40A 3R1ZA 4Q4PA 3U0HA 1XIMA 3G6MA 5BWFA 1BYDA 5FF2A 1WV2A 2Y5EA 4BF7A 1F3WA 3CHDA 5D38A 3TIMA 4IJCA 3A23A 4Z2GA 3B9AA 1A5OC 2F9RA 1QI3A 3E0LA 4E4FA 2F7FA 3IUDA 2JFEX 3RG6A 1DE5A 3AUOA 1GEHA 3H6OA 4HBKA 4IQDA 2OU4A 1KO0A 3RX2A 3LBCA 3BURA 1J18A 3CV7A 3M07A 4H19A 4LYQA 1H1YA 2J7EA 2WSRA 1F76A 3VGBA 4BR1A 1TJPA 3TK7A 4DPPA 3W7IA 4O1DA 3T78A 1Q6QA 1E1CB 1UKSA 4GNKB 4MWAA 2Y1HA 1TPVA 1ML1A 1PHQA 3N3MA 2OQHA 3VZXA 5CPMA 5AYXA 2X2YA 2V5BA 2ISWA 4EPEC 1ITXA 2CHOA 1M7PA 2DT2A 3ZSTA 1UROA 1NH6A 1HP5A 1R30A 2V6AA 1FXQA 5DLCA 3WDJA 3MKVA 3H22A 1FUYA 5D09A 3QM3A 2QUMA 3PZMA 4IIEA 1XLAA 2GJXA 4AHOA 3CNYA 3AFBA 4MADA 5JU6A 3TC3A 3WBXA 1BWKA 3OYXA 1RP8A 3SDOA 3T07A 4ZOAA 5G5IA 2GGIA 1A4LA 1XLFA 3HU7A 1T8XA 4GCXA 3VIPA 3MCOA 3SQMA 1J79A 1M1BA 4MJ4A 4B16A 1V02E 2OTDA 1QBAA 1TUXA 3RNDA 2GQ8A 1EP1A 4ZOEA 3Q65A 4U3AA 3W1MA 4EACA 2QW5A 3OA3A 4GA8A 3IJQA 5ABFB 3GTHA 2O9OA 3VK5A 3IAPA 2QDHA 1JGMA 4B5SA 1V3IA 4Q4KA 3GLCA 4LFYA 3RXZA 3VNMA 4HOZA 4CNSA 3CO8A 1BD0A 5IDZA 4S23A 4ZBCA 2Z24A 1W5OA 3UBPC 2E4TA 4BY3A 1GPFA 3QR3A 5CG0A 5LGXA 1XICA 4IM4A 4MUPA 3L65A 3BLDA 3L4XA 3T55A 4TVUA 1SZRA 4M56A 1Y5VA 3P0WA 1V3KA 3I6RA 3JZUA 1XIEA 3PNZA 3VKCA 4DRSA 3F4NA 4GVFA 1AJZA 5K9CA 4QP0A 1NFGA 3PWAA 2PDXA 5AHFA 4O11A 3RGTA 2R1LA 3OJGA 2ZFAA 3D46A 4IMAA 1G0CA 4FAMA 3L0GA 4EF9A 3IARA 1OGSA 2C1IA 3TV8A 3H70A 4V1XA 5E9XA 4X2PA 1OD0A 4NZ1A 3FFSA 1HF6A 3RN6A 4CNPA 4F0RA 4JL1A 3VIKA 3C0LA 1SUXA 4JFUA 3CM4A 3S5SA 5C9ZA 3OGRA 1LG2A 5GNZA 2IPJA 3W84A 3I3EA 3VE9A 4W5ZA 2A3CA 1TTPA 2G0WA 2XH2A 3W01A 5DMNA 1DTUA 1A0EA 2VM8A 1R46A 4GK8A 4HSNA 1JCLA 4UTWC 1HZYA 2DVUA 4LUSB 1NQ6A 1V0NA 2CFFA 4P7LA 1DIEA 2WANA 3SCVA 5JVLA 3GR4A 2VWSA 2FGLA 1QFEA 1S2UA 1E71M 2WKJA 2OSWA 1LWJA 2X42A 3VNDA 3GO2A 1X8FA 5IFPA 2DEPA 2ZDRA 3EOEA 3NQMA 5J8LA 3U57A 7REQB 3IRDA 2R14A 3N04A 4L4OA 4DWSC 1D8WA 3VC6A 5T9BG 3WFAA 3I65A 1FXPA 2AL2A 3W7PA 4ONVA 3NL2A 4GYPC 2Z7KA 3ITGA 4HYWA 3UZ5A 5ABEA 1X96A 3TYUA 4QDMA 2I5QA 3P6LA 4WVXA 3E6EA 2PRMA 3TNOA 3TMLA 2J24A 3MP4A 3WLIA 4ROQA 3UYIA 5C2CA 5F7UA 5G1TA 5KZMA 1JNEA 5EMUA 4QDWA 3VILA 1EIBA 1P0NA 5FEZA 3C61A 2B81A 4AHQA 2E68A 5ECUA 1OFAA 4P8UA 3P8JA 5EGRA 2QCMA 3W6YA 3KWXA 3PZUA 2P10A 1SJBA 1UKTA 5HWMA 4PUKA 2VOTA 3E0VA 2J74A 5HJYA 2ZX8A 4TO8A 4PCFA 1Q6RA 4FSAA 5CC7A 3CQKA 3O05A 4LW7A 1MQPA 3KRSA 1FWBC 3F4WA 1PYMA 4LANA 1OBAA 1UP3A 3ARVA 1QRQA 2W27A 1ZPTA 3CZLA 1JPKA 2VMFA 2XVKA 4A2SA 2GQ9A 2V8ZA 1FWJC 3CHFA 4B90A 3CHEA 9RUBA 1HO1A 4JTKA 2YZ5A 5CPOA 4ORMA 2FIQA 3GKAA 2CCRA 1A5SA 1ZS2A 3OODA 3EPOA 3FJ4A 3MMDA 1JDAA 2ZXQA 3S42A 4KERA 2JGQA 4EXQA 1EWDA 3GXDA 3CAQA 1C8YA 1XF0A 2FDSA 3PBVA 1ISYA 1GTEA 3U2EA 3CZGA 3B0XA 3S9IA 3QQWA 5JIWA 2QULA 2AQWA 1TMHA 2CZDA 2ZZ4A 4XAPA 2E77A 4H8UA 1ADDA 1LOSA 4GJJA 1JIBA 5C55A 4KGJA 2WYSA 1O5KA 4JFWA 1IXPA 1LQ0A 1DWIM 4DO4A 2QGHA 1BYAA 3CUJA 4RKAA 3ANVA 1JCYA 4U33A 3PZVA 4E2VA 4CU6A 3SN1A 3E5BA 2NWSA 1A5MC 4J1OA 1KNWA 2NQ5A 4GE8A 2O9TA 3L7RA 2WXDM 2A21A 1X6LA 2PC8A 1TE1A 3NOYA 1UWIA 4OIFA 4B9ZA 3CQHA 3DG3A 4RLIA 4Y7EA 3EB3A 5B7ZA 4GCAA 5K3VA 1NWSA 1RALA 4JHZA 3EX6A 1BWVA 1FWIC 3JVAA 4M82A 1U2YA 4GZ7A 2ZUSA 4PTNA 4GJ1A 2F8QA 2J6VA 1RAKA 3WDPP 1OX4B 2ZVRA 3RRAA 3TTSA 2MUCA 2DZBA 2BOEX 4QE5A 3KE0A 1WE5A 1PX3A 4HNOA 2E3ZA 3ZYZA 3W25A 3B8VA 1AZ1A 3AYTA 1O66A 1G6CA 3L12A 1OB0A 2EG6A 1KXHA 4PUEA 5GPRA 4AZCA 3B0VC 1FHUA 4L4LA 3N4AA 1AJ2A 3R12A 3B8SA 1SO5A 2D3LA 3EA2A 1U1HA 5B7YA 5A6BD 3VYLA 1VHNA 3HO8A 2D1ZA 3UG8A 2NWRA 3S1GA 1OFBA 4J5NA 1K70A 3ICJA 1G7UA 5AHEA 1RD5A 1UOKA 3TQVA 2CLKA 1E6PA 3R0KA 4FR6A 2QCDB 4JX4A 3FSTA 1MDRA 4UQDA 3OZOA 2WSPA 1MO0A 1A49A 5CZJA 2VFDA 4J3WA 1C92A 4V28A 4LC6A 1ZZMA 3C2VA 4GH1A 2I14A 1XRVA 3OEXA 1J2WA 4ECLA 3QV8A 1IYXA 4CVUA 2NX9A 2YCLB 1P0KA 4YN5A 3FXYA 1OT1A 5T8GA 2DH3A 1GZ1A 2YIHA 4XD3A 2R1PA 4QX4A 5H2ZA 1V0LA 2BB0A 2NSXA 4GUGA 3UY7A 1X1OA 4QLJA 1TV4A 2PBGA 4ACYA 5K9XA 3DDMA 4FOKA 3NYDA 3IJ8A 3IIZA 3EDDA 3M0HA 2XVPA 1JPMA 1Q4NX 3M5YA 1QNVA 1Q8JA 3HF3A 3HPZA 3AZTA 4XZWA 4ADTA 1RH9A 4J9JA 1NSJA 3HJZA 3KDOA 3AYVA 1YPIA 2DVXA 3GM8A 2E5DA 1OT2A 4RE3A 1OGGA 3HQ1A 4F0MA 3MUZ1 2Z25A 2WMHA 4JOMA 1I6NA 4K1GA 4KMQA 2Y62A 2W66A 3B4UA 2V82A 1DVJA 1CW2A 1KV8A 3WUBA 1FHLA 4O8RA 1MSSA 3CIWA 2V2DA 1W9VA 3RM8A 1KXTA 1GCYA 3WDRA 4JTDA 3H55A 1QPKA 4EIVA 4BHYA 1OQFA 4ERIA 5FA5A 1AODA 1H1NA 3LOTA 5XIAA 3N9KA 2PWFA 1BQCA 4DB7A 2YR1A 3MSGA 3THCA 3ZMRA 2O4MA 1OX5A 2J79A 3BZJA 4D71A 2X0HA 4LAKA 2WC4A 3TWAA 1ODZA 3QN3A 5IBXC 3O0KA 4UB9A 1OINA 5AY7A 1NJJA 5H8PA 1E0WA 4YTRA 5CC3A 4IJBA 4NASA 3VNKA 1I45A 4NL1A 1K03A 3KDNA 5EA9A 3NNTA 3VUPA 1LP6A 1EC9A 4HHMA 1JFXA 1V3LA 3W2JA 1PZ0A 3PFRA 3H2MA 4LALA 1E4NA 1K4HA 2EBNA 1R85A 4RDWA 1U83A 4E2OA 3NQ2A 3PAOA 1R3TA 2DQXA 1XDJA 1XFCA 1TX0A 2X0YA 1CEOA 4NZ3A 3W4RA 1XIGA 2KX9A 4PMQA 4LB3A 3V75A 5KEZA 1QBBA 3UWZA 4FNSA 4MGGA 2ZRXA 1CT5A 4UQEA 5HWJA 3LLFA 1C90A 4LGXA 3WUGA 2OSYA 2YZRA 4Q6XA 1NDZA 4KKXA 3U6WA 1EF2A 4DF1A 1V08A 3THUA 3M0VA 5LA2A 1B4EA 1S5VA 4B9YA 1PJ9A 3MB9A 3OGVA 2O4QA 1WKFA 3LCIA 4F3HA 2QUTA 4YYFA 3VM7A 5CXPA 3DBNA 2OLHA 3SN4A 1S1PA 4Z1CA 2FZNA 3A47A 5FI8A 3GK0A 2VZTA 4KQNA 4DJFD 1XIJA 1XWYA 4JQAA 1EEXA 4JD4A 3S83A 3WJZA 4MG4A 4GQGA 3E9AA 3EXSA 5H8UA 2ZUTA 2CESA 4L1GA 3RJXA 4RPQA 4IZGA 3KHJA 4H8VA 4YCOA 1MI3A 4B5VA 3VGEA 4AEEA 5E1QA 1XQKA 4DNMA 1W8SA 1KM2A 1V3MA 2PDYA 1CX9A 3TW6A 2JIEA 1G01A 2GZXA 4GIEA 4M51A 2BP1A 3IANA 4XUGA 2QVHA 2D2GA 4BF5A 1E9ZB 4PSPA 1C7SA 4LF2A 3NPWA 3W23A 4AMCA 1F4AA 2HRWA 2BMBA 4HZMA 2OZ8A 4AISA 1W1A1 3HGRA 1BTCA 3NQAA 3M6DA 1S5WA 1O95A 3L0KA 3E74A 1TWWA 1QMLA 2W5FA 1OYCA 1E4LA 5FF0A 2XGIA 2VT0A 4Q4OA 5AC4A 3VX0A 3CT7A 1P5BA 4FF5A 3TLQA 4O0KA 2ATSA 3M0XA 3LDVA 4QISA 3HPSA 3OHMB 3CV6A 1E73M 1GYMA 4L6OA 5U7SA 3EPMA 1PSCA 2QUVA 3S5OA 2GYIA 5BZAA 1GONA 3O6DA 2DIKA 2BZNA 5C2XA 4UZSA 3NURA 4Y8EA 4NJHA 1LOLA 3GTIA 1TVPA 1A5NC 3I4KA 3VPLA 3N15A 2BV9A 3B0YA 4WY0B 2OO0A 3NGJA 4L56A 2XZ7A 4XV0A 2POTA 3WH6A 2WZMA 1HW6A 4GXPA 2XYLA 3DFSA 1H0GA 2O7SA 3EB2A 1POKA 2ABAA 2CZ5A 4O17A 4JZ5A 4WHBA 2Q3RA 1VIWA 4FA3A 3MBDA 4TV6A 4MZ1A 1HG3A 2ESCA 3NZRA 3OP2A 3E12A 4I5UA 3G3MA 3C3UA 2HDJA 3EB4A 7ENLA 4AG0A 3RF9A 4UTIA 4MDPA 2GK1A 5HANA 5I3KA 1QNPA 7A3HA 2D2JA 5G2HA 3W71A 1Y65A 5AYYA 5I3DA 3QXBA 4FHAA 4LVDA 3S6TA 2EQDA 4Q7BA 1Z8AA 4AD4A 1GHSA 2DDXA 1RZMA 3A6OA 3CUFA 1HKVA 4FPSA 3TC6A 3PSWA 2QQ6A 3PPCA 2JEPA 5JQ9A 2VFIA 2DGAA 3C6CA 4LVBA 4RK8A 3EA3A 5HULA 3ABZA 2POZA 3GU2A 3W0KA 4DYEA 2E8YA 3M4HA 4PMYA 2Z1BA 4NJGA 3U4FA 1DP0A 1SPQA 1L6WA 1NEYA 1TREA 4R34A 2WZHA 3A5FA 5M3WA 2Z27A 4WXZA 3NTYA 5D05A 3CV2A 4RXGA 4AEFA 3OOQA 3E96A 4WDTA 4CQCA 5ABHA 2HK1A 1J0HA 2YCIX 1FH9A 3II1A 2NX1A 4ROPA 3W1RA 1SZFA 3MP5A 3UJSA 1MFUA 1XLIA 5I0DA 1KTBA 3WQEA 8TIMA 4XX6A 2YYUA 1PZ2A 3CB8A 1JCMP 1SYTA 4Z0JA 2QDGA 2NV9A 5A69A 5HUOA 4DJDA 4JTUA 1KFBA 5HJXA 3MU7A 1E0VA 2XH0A 4QS6A 5F4XA 4PBFA 1XD1A 3N1AA 1TSIA 4F2TA 2DVTA 4PB3A 4JY9A 3UA3A 1NDYA 4XD4A 2FFIA 1FWWA 1US0A 1MZRA 2FGBA 1VEMA 4O14A 2PGWA 1S46A 3I3BA 1OX6A 1OYBA 2EO7A 3ABQA 3QMTA 2ACUA 3EX2A 2QJIA 3OGSA 2P3EA 7TIMA 1LROA 2C7FA 1PVNA 1DXIA 2C19A 4HQVA 3ATZA 2TRSA 3SJ3A 4C6JA 3UXLA 5AZ1A 3NJ3A 1TX2A 2IKGA 5HMSA 5EPDA 1KM0A 3VOGA 4B5TA 4M19A 5I23A 4FR1A 3AOFA 4H3DA 4D6GA 3GRIA 4GUFA 1LLOA 2L5HA 3O1NA 3URNA 1BTMA 3LXBA 4DYKA 2ZRVA 1OD8A 1BVNP 1DBTA 2DUXA 3P82A 4HHLA 4HMNA 4IL2A 1R3VA 1K9FA 1OEPA 5AVHA 3P2VA 3Q67A 4KWVA 3UETA 4X9YA 1E6XM 1XLJA 2O55A 3GXPA 2Y8UA 4DBWA 3BLFA 1A4MA 5BXRA 4GUHA 4A6GA 1UC5A 4ZO9A 6ALDA 3PZ9A 4LYRA 4HOWA 3KRUA 3EWWA 4K8EA 2WNQA 3UWQA 4W89A 1DJYA 1RA0A 2IKIA 3DH7A 3UZZA 3CQIA 4HK6A 3WK3A 4Q33A 1CIUA 1JJKA 1Z44A 2JALA 3NZQA 1J01A 1M41A 4FLQA 1TWZA 4AY1A 4Q8NA 3GH5A 5FJJA 1FP8A 1SFSA 2HE8A 6ENLA 2PWEA 3VCCA 4ZSTA 3BL3A 3R5EA 5D8ZA 4ERGA 4M24A 1OC7A 4YLWA 5A8QA 3ITVA 4XZHA 4D2JA 1R3SA 4FXFA 3C86A 4K3ZA 1I75A 1Q2SA 3KOZA 4DJED 1CGVA 5DY2A 3SADA 1JDEA 3GW3A 5CZSA 4I7UA 1Q85A 2E9MA 1BRLB 1NOWA 3L5LA 4ZENA 2VD9A 4XG1A 3C4UA 5JIPA 1OFOA 1TVLA 3JZEA 1O68A 5T26A 1GYLA 4QRNA 4O18A 4TVCA 3NO5A 4MB3A 3A4XA 1YXCA 4PTVA 4CLMA 1XHGA 1FH7A 2HCVA 5H1WA 1VBJA 2QHAA 4F4RA 2ADAA 1P7TA 2NQJA 1X6UA 2VOMA 3WLOA 4FNUA 5CEWA 5C70A 2GVGA 3HV8A 1UR8A 3H4XA 2OG9A 4O15A 3TTQA 3BCFA 5CAKA 5F1UA 1UCWA 1ZHAA 1X39A 3NGFA 1LT7A 5DBTA 3MI3A 1SM9A 2RDXA 4N9DA 1R7AA 3BSHA 1E6NA 1KBJA 3GR8A 2IW0A 1MZHA 3VGHA 1B30A 1ISZA 2OLAA 2OX4A 3C0QA 3GNNA 4Q7NA 1FX6A 3GU9A 3KL5A 5PTDA 3TJXA 1FWTA 2Z2BA 4JCLA 2EPNA 3K5XA 2NW0A 3A4JA 2GLKA 1JR1A 2QXWA 1EO5A 3ZLHA 3AALA 2DZPA 1FCQA 1QNOA 4I5XA 3H2FA 5I5RA 4D6JA 2C1GA 4R7WA 4Q4RA 3GDRA 4X0NA 2OMAA 4JDBA 1G4PA 1AH0A 3GYCA 1ZJBA 4L9XA 1TJ2A 3QMRA 1GW9A 3BLEA 4QG9A 3CLMA 3SCPA 4IFRA 1QW9A 4Z1BA 4LUJA 2TYSA 2TODA 4CD7A 2GJRA 2D3NA 3DEQA 2NQLA 4GJIA 4FXRA 4L9YA 4XZLX 2X7VA 1TYGA 4NAEB 4MDOA 3ZLFA 3K46A 3EXRA 2JGYA 2OEJA 2ZYFA 5DANA 1UW9A 2Y6ZA 3KUMA 3ZFHA 1O5XA 3RX4A 1X8CA 1FDYA 1L9WA 3T44A 4A21A 2TAAA 1UP2A 2J78A 4PC8A 3LTPA 4LT9A 3VE7A 3PTMA 4UFJA 2R8WA 1SFJA 3WZ0E 4IP4A 1W1YA 3C0SA 1M5WA 4YTUA 4JTAA 5FL0A 1DXEA 4ZQMA 1FWCC 2XN0A 1GQLA 3MKKA 2OZTA 4OFCA 3WBWA 4PMOA 3UZYA 1VAHA 4B4FA 3KBMA 4ZTXA 4MLRA 4PE8A 5LA1A 1V03A 3G1SA 3KW3A 3VC5A 3S4TA 2INEA 4MMWA 3OU8A 2E5CA 1ZAIA 1D2KA 2YFOA 2D0FA 2ASHA 3DKLA 1DQUA 1C8XA 1ZQ5A 3ERPA 1M01A 4EKJA 1DJQA 2YBUA 2OZ0A 1V6YA 4JL2A 1D7KA 4DO7A 5LIWX 4JX5A 4A35A 3T2OA 3UCQA 4AWEA 3K4WA 4QITA 3FHAA 3EWXA 2GOKA 3ZSSA 3WQOA 2QDDA 2ZZ5A 1FHVA 3E02A 3JU2A 5LXXA 4G7EA 1KGWA 1V79A 4IJRA 2J7GA 3WY1A 2G50A 3AQUA 1BQGA 4W8BA 3CH9A 5FKYA 5D33A 1XLEA 3L5MA 1YTKA 1JUBA 4LCRA 3C2OA 1DORA 4IX0A 3TWBA 1HN1A 1D3GA 1PEZA 3QOMA 4NX5A 3LLXA 4DM1A 1AD1A 3RILA 4XZBA 2AQVA 3OB8A 4PUJA 3GNRA 1WBHA 2X1TA 4HU8A 1MUMA 1B9BA 3W70A 1RLDA 3VA8A 4IOTA 1A50A 2EAWA 1KXQA 1VP5A 3T8QA 3IV8A 5DCEA 3UXIA 3TFCA 3W1LA 3MI6A 2NZLA 4YIWA 2Q71A 2HVMA 3BPWA 1V0KA 3W86A 1HJXA 5CLTA 3PNUA 5BOEA 5LZLA 4Y8FA 4AH7A 3GZ3A 5A6MA 3CJPA 4AYSA 2EKCA 4Z0SA 1I1XA 1HL2A 2DIEA 3R25A 3IVUA 5C5YA 4MWAC 1FCVA 2W4XA 1DYSA 4YMZA 4I8DA 2XWEA 3LM3A 3O16A 1KM1A 4HK5A 4N42A 2X30A 2VQTA 1XQLA 1YXDA 1NWTA 3W28A 5DELA 2HTMA 3IJ6A 2DSZA 4ZB5A 2O7QA 1JEZA 4C6KA 5AC5A 4IIFA 3BW2A 4JTIA 4C6QA 1XLLA 3ONCA 1AFSA 4WGXA 4ICMA 3SCTA 4JTEA 4JN7A 1J5TA 1NFBA 4IG2A 2EG7A 4Q7IA 4Z2LA 4BI6A 2YL9A 4I7VA 4DIAA 1E6QM 4FNRA 1H7OA 2ZRYA 2XG9A 2O9PA 4RE2A 2X1IA 1QR7A 2JF7A 4MHBA 4DWSA 2VI0A 1F61A 3ZJ6A 2B7PA 4GUJA 4LUTA 1TQXA 3W7LA 1Q66A 4KEMA 2QJJA 3B97A 4OBSA 4KIRA 1G94A 3A24A 1N7KA 2Y7GA 1UZ4A 1RJQA 3N2XA 3WUFA 2BHZA 4WKFA 3TJLA 4GO8A 2BODX 3KFTA 1KBLA 3L0NA 1SW3A 4BFAA 4HJWA 3WUEA 2BS9A 4J40A 3P5ZA 3ARYA 1YPFA 1BKSA 4CNOA 1C9DA 4AX7A 3N2MA 3MUY1 4NXSA 3JR2A 3B9EA 3AC0A 4F2BA 4XAZA 2Q8ZA 3ZLGA 2VDIA 4L6HA 3BV7A 3UJ2A 3AHYA 4NILA 4C5YA 3QPZA 3THAA 5MF5A 2PTXA 5FSEC 3FGCA 3PY2A 1G7VA 4R9XA 1NWUA 4XK2A 3TYDA 3GQYA 4XKYB 2HXUA 2O0TA 4CNUA 4Z2IA 1UR9A 4FOJA 4M29A 3PJUA 1LWIA 4E8GA 3UEQA 2QPUA 1ZENA 2J4GA 3D0CA 4IMDA 3NQBA 2BGQA 2Y24A 3WQVA 4QDPA 1R9ZA 1IQ8A 5E09A 3I6EA 1JULA 3RHGA 4HNUA 5XIMA 3S3GA 4IIBA 3NQ7A 3W7GA 4A05A 3MI2A 2PDHA 1W1IE 2WNNA 4PTXA 2D23A 4HZ7A 4W8LA 1Z32X 5CSSA 3QPEA 3QR1A 1HUVA 1Q6EA 1RY0A 4KWSA 3QTPA 4KPLA 1DIOA 3FDGA 3ZIZA 1EIXA 5C7HA 4EOUA 1QNSA 1S5NA 4FX8A 2YOCA 1FA2A 1EFZA 1PIIA 1BHGA 3OIXA 3LLDA 3OA5A 3HFTA 2V5LA 4C90A 1WYIA 1P43A 2REQA 3OIHA 1ZJIA 3BQ5A 3PVFA 1MRQA 3SCWA 1W3LA 3CAKA 4BEUA 4AD2A 1UD3A 2PDFA 1XD0A 1NOFA 4UMAA 5HMDA 3FHQA 3CUHA 5CSUA 4N6EA 5CZTA 2CBJA 2FVMA 2E1DA 1RJRA 3XIMA 1JUEA 3NDOA 3DUGA 1J5SA 1LUCB 2YBVA 4AWSA 3MVTA 5TBOA 4GI9A 4YTTA 5KZ6A 3W7HA 1NOUA 2PGFA 5AYIA 1J10A 1DPMA 2GDUA 3U2CA 3G8EA 3T7VA 3L67A 2WB5A 3RM4A 2FJKA 3MO4A 4V2XA 5T9CE 3SCOA 2G95A 2G4FA 1PX8A 1XFBA 5HUPA 8XIAA 4MWAD 4ACZB 1VJIA 3I3DA 3W6MA 4A22A 1VQTA 4UTHA 1VFTA 2VYOA 3W2KA 4LV9A 3STEA 4QNWA 1A53A 4J35A 1HJSA 1F05A 5FF3A 2VRQA 5DX7A 1VFMA 1IT0A 4NAFB 1LTDA 3V16A 1IWPA 2PMQA 1YIXA 1TG7A 1K1DA 3AS0A 4K8HA 1XINA 4MSSA 3VDGA 5FJTA 4GQ0A 2JBMA 2W79A 1JYNA 4WKHA 4LAOA 2I7GA 2J75A 3VD7A 3TQKA 2GOUA 3URBA 4M5PA 3CYJA 1YEYA 2NSOA 4A29A 1XPGA 1WUFA 3B0PA 3CS2A 4WIWA 3DFNA 3FA5A 3M0JA 4NJIA 2PRHA 1OK4A 3VO0A 4C65A 3F4VA 3VIIA 1H2JA 1GEQA 5BYWA 1HKMA 4L64A 1VB9A 3S8HA 2G3FA 4ZZ9A 1JUKA 1KW1A 3LCFA 1RUSA 3ID7A 1C7TA 1YPXA 3IPWA 3SCRA 2ZRUA 1ME7A 2CLLA 3CTLA 3TW7A 1W9UA 2QCCA 3WX7A 1DWJM 4R33A 1EJVC 2CHRA 2NV1A 1VBUA 4DUXA 4ML9A 1EX5A 3RM9A 1BF2A 4UFLA 3NL5A 4AEOA 1PWMA 1CWYA 2DPEA 1U1JA 3S46A 5D2VA 5DCDA 3GY1A 4GZIA 5BXPA 2GSJA 4X3ZA 5F4SA 2DUAA 4XVEA 3RJYA 1MYRA 1AUSL 2H3DA 1THFD 6XIMA 3LXCA 1W6TA 2RJHA 2Q02A 4UQAA 4NIRA 1B3VA 4O4VA 3EOUA 1J0KA 4IIDA 2GGJA 1ICPA 4W7UA 1TPH1 3K8LA 5H91A 1KFJA 3K8MA 1QATA 2BY1A 3TTYA 2VC9A 3GVVA 2XSXA 3JRKA 4GABA 1ZLPA 2XM1A 1A5BA 1JI1A 3VCRA 1W2PA 4ZB2A 4JYDA 1VBRA 1D3HA 2WLYA 1TV2A 1VIZA 2VGFA 2FZ8A 4XAYA 4NI3A 4WDXA 1YXYA 3WF2A 1GOXA 2VP8A 4HPXA 4J27A 3T05A 1E70M 2OWWA 4GZJA 5LXEA 4M80A 3SGGA 1QK2A 1SMDA 4NT0A 4IGMA 3WK1A 5LSMA 4ZVJA 3M46A 4D8AA 2ZUNA 4QE1A 4C6IA 4AF0A 1TMLA 2ZZ6A 3W74A 4H6QA 2D22A 4QR6A 1L6YA 1P6CA 4O1CA 4MNKA 3LU2A 5AB3A 1A5UA 1H0IA 4PMZA 2AQOA 3NSXA 1BKHA 3BWWA 2EPKX 2PWGA 1I9CB 1TTIA 2NXIA 4D6CA 3NQFA 4UNKA 3RRXA 1U5JA 1REQB 4IQJA 1EEPA 3WLMA 3PM6A 1VS1A 2WC7A 2C6QA 1XLGA 5J5RA 4HIBA 1UBPC 1YMYA 3TROA 5REQA 3SCNA 3BSGA 3CU2A 1TZ9A 1XGEA 4JQ4A 4JS3A 2YA0A 1DJNA 4ICNA 1MEIA 3P67A 3BLPX 1OCQA 2E8ZA 1BXBA 2W67A 4WDWA 3R13A 1LLWA 1SR9A 1UWUA 5A6AA 4Q8WA 4UMBA 2YXXA 4LEFA 4UZUA 4UTMA 2ZWZA 2PTZA 4I7WA 4RXFA 3KM8A 3L66A 3VKAA 4XBSA 4UUIA 1C93A 4PSRA 3S9YA 4LV4A 3TXVA 1LBMA 1XXXA 3KVJA 5HPOA 4YS1A 2PDIA 2WJFA 5AHNA 1B9ZA 2Y63A 4ZGYA 4YWIA 1W37A 3NOEA 3MUXA 5G1YA 5MKGB 3M16A 2BXVA 2EEXA 3CAWA 2WQDA 4JTRA 3A4AA 4X63A 4CQDA 1IEQA 3K4DA 1ITUA 4O10A 2Z1SA 3LY0A 3SRKA 3WFLA 4JHOA 4P7NA 1HT6A 2WQPA 2QF8A 4F2UA 1GJWA 5BCAA 3G8RA 2QUUA 4WGHA 4FX7A 4DPQA 3WQFA 4CD5A 1CLVA 3QHNA 3LHYA 2C71A 1YDNA 3TA6A 3IGUA 3EGJA 2PWDA 1X7FA 2HWGA 2V3FA 4LCSA 3R6IA 3ENLA 3GKFA 3UYCA 1DIKA 3ARWA 1QI2A 3GB6A 5M1TA 2CLIA 3IIXA 4MKNA 1UWSA 1ODUA 4PB4A 2CW6A 3XISA 1PWLA 4I5RA 3LENA 3DCPA 4Q8VA 1TZZA 4KCTA 1BLIA 3SRDA 1QCWA 1XH0A 3DZ1A 4BS0A 1SFTA 4J3SA 3BLOA 4JKLA 3IWPA 4HZ6A 3UPMA 4F8XA 4OBTA 4NRRA 2HROA 2GUBA 3LTSA 4FZIA 5DCBA 1H62A 4YPJA 4CNNA 1CDGA 1TPEA 3QTGA 3PC0A 1AVAA 1D9EA 1XKYA 1SO4A 4OE7A 2V81A 3ALFA 5D03A 1XR2A 3HPAA 4RV3A 4XO7A 2XH4A 3OO2A 4GX8A 5GJMA 5C9XA 4MY9A 4QTGA 3BOLA 5AOUA 4BI5A 4N6FA 4ZQRA 1E55A 1ZL1A 3OZMA 1GVFA 2NQ9A 4CCDA 1FTXA 1I2OA 1POJA 1QK0A 1QNQA 4L4PA 2WV8A 1X98A 3QZ6A 4LEQA 3N9RA 1H7NA 4ADUA 3TR2A 5I02A 4UTTC 3C2YA 3SUTA 1GG1A 1ONXA 3EA1A 4IH3A 2CBUA 5ECVA 3DC0A 4BWLA 3MWCA 3GTFA 4AZ7A 1RCXB 3S1VA 2OO6A 4A8NA 4HTBA 4NRSA 3W2LA 3BC9A 1GQIA 1MXGA 1A0DA 2VC7A 1OYAA 4XB3A 1EHAA 3QV9A 3E1F1 4JIRA 2GDQA 4NVTA 1RVKA 2X7WA 4DI9A 1EPVA 2EXOA 1FQ0A 5BMWA 2C13A 1I4NA 2CLEA 3PZIA 3WLPA 4ATWA 4P2VA 1ELSA 1NWRA 1B57A 2ACRA 3W6LA 3EPNA 4AWTA 3UR8A 3LSBA 2PDQA 5H8MA 4I90A 3AYSA 1SW0A 2FH8A 4EP8C 2PD9A 2WO5A 1R0MA 2Y2WA 3AMKA 4QXIA 4DYJA 1TWSA 4GQRA 3NVTA 2YLAA 4C7FA 3GVQA 4IUOA 3URAA 5C9RA 1JCNA 4WOZA 1T96A 2UZ9A 3WLHA 4S3BA 1OVDA 3CL6A 1H49A 3WLKX 3MQTA 1GORA 4XWUA 4OVXA 3ANUA 3RAOA 5J04A 4YNGA 2AGTA 4DUOA 4HD5A 1EDGA 4KESA 4N4QA 3LGDA 5FAJA 2BG5A 4FF7A 4MFEA 5D2YA 3B0UX 3M0KA 5EFDA 3L2LA 2EHHA 3UNTA 5K9DA 2YBTA 2OWCA 4F9DA 4D1JA 2FFCA 5C0QA 1ICSA 3TP4A 1CXFA 3QEZA 2CC0A 3UWVA 4Y9NA 3B8DA 1CNVA 1BVZA 2OQYA 1PUDA 2XJ7A 4XIMA 3FVMA 3HGOA 4IQLA 5D37A 2WSYA 3G0XA 3DFOA 3ZVHA 1UBSA 2CYGA 2NUYA 3LI0A 3FKRA 4DUVA 3VOCA 3QZAA 4JIPA 8CGTA 4U31A 4S38A 1FKXA 5G1MA 5C71A 3P8IA 3RCMA 3ZXWA 2YA2A 3F4CA 3WD2A 4P8VA 4JTSA 4LY8A 4MB1A 2DH2A 3MMWA 4NUWA 3PPGA 3ZT6A 3CUGA 2FVKA 4U2ZA 4H41A 3DERA 5BMXA 3CZJA 3V0SA 3UGVA 3WLLA 3BJTA 3LGGA 5XINA 1DOSA 5EMMA 1Q5MA 1W1B1 4CCCA 2YXOA 1KR1A 3BOXA 1ZTVA 5AC8A 3S2JA 3NL6A 1E40A 1LLZA 1BPLB 1O6IA 3Q37A 4RE0A 1WOBA 2DUZA 4C5ZA 1EJUC 4XVDA 3RPDA 4PB5A 4E4PA 4AU0A 1E0XA 2C0AA 3LCXA 3R94A 3W1UA 3EEGA 4GUIA 2DZTA 5EBUA 3MC5A 4HA3A 5D9NA 3FKKA 3T0TA 4FLSA 3T0CA 1VPXA 2Z1XA 3CMJA 5D9OA 2MNRA 2RJGA 3VMPA 1DL3A 1XJBA 4KGLA 4YVPA 1ZCOA 4H9UA 1VLWA 3AXMA 3GU1A 2OYKA 1V5XA 1VEOA 2XTKA 4D6EA 5BWAA 1UKPA 2OYMA 3BLIA 3TTEA 5C9WA 3MCNA 4WD0A 4GH3A 2HXTA 2BFGA 5IOBA 4G6CA 3W75A 1J8VA 3EMQA 4GY0A 4GI6A 5CBJA 1CLKA 4ATLA 3A13A 4P7QA 2JKEA 3OTRA 4J3ZA 2PDKA 2WSKA 4UFIA 5FD0A 3ARUA 3OLIA 3BAXA 1YADA 3LHTA 4TQTA 1PDZA 1S2TA 3PBYA 1UD5A 2P50A 4RNJA 1PTGA 3DECA 3OBKA 1JXJA 5A6TC 3TQ0A 3TOYA 2ZA3A 4JQ2A 3VFLA 3RK8A 4LS0A 2GSHA 3W1TA 1B1YA 3M0IA 4W5UA 4TTGA 4POCA 1KFEA 4KFNA 3JS3A 4KEVA 2VFEA 3HB9A 1XIDA 2NXGA 5EMKA 1AQ0A 3BV4A 3W9ZA 4V27A 3KRZA 4QCEA 5HQEA 2Y5JA 1E4MM 4XAFA 3B8WA 5C9UA 4CEUC 4ZFCA 9CGTA 3P5YA 1PZ3A 1ZSXA 5FJRA 2VX5A 1IXQA 4N0RA 3BAKA 3NWRA 1ENUA 2X09A 4M8UA 1UMLA 3R58A 5LIXX 1QPRA 2J66A 4LC8A 4MF4A 3SECA 3CQJA 4I8YA 1WXJA 3P60A 1PTDA 5EBAA 3LMZA 1HFBA 4MZ8A 3UXKA 3EBVA 3GTXA 4LX4A 1I0DA 1WZAA 1B3WA 2Q6ZA 3NVDA 3T42A 3AWOA 4OKDA 3S2MA 2Z1KA 1K9DA 2VEFA 1OF6A 1VZWA 1EYWA 2CHNA 5DO8A 4ZO7A 1KRMA 4N7QA 3C2EA 1RBOB 4CVWA 1NU5A 4ZEPA 2WNWA 2VEPA 1C3FA 2INFA 3AZRA 3GS6A 1SO3A 4HNVA 3HN3A 3EDJA 5EMLA 3BJFA 4C1NA 1WA3A 3W29A 1EQPA 3P14A 2CXEA 2DSKA 5FCZA 3OVGA 1KA9F 4HN4A 1EKOA 4YTQA 2J27A 2H9AB 3E2SA 4QEHA 4KRZA 4HVXA 2WVTA 1CYGA 3WJXA 2VEMA 4JTHA 4HU3A 9XIMA 4NNBA 3IGHX 4DBDA 6REQA 5E6ZA 3ISIX 4HHPA 4W9TA 4DZHA 3CB3A 1JI2A 4LVGA 1R87A 3K2GA 2Z00A 2IQTA 1YRRA 3FNDA 2P8CA 5BRQA 4MWAE 1B0IA 4NF7A 3MSYA 2CBVA 3R11A 3A3HA 3JW7A 1MNZA 4YVXA 3PTQA 1OHLA 1XBZA 2BDQA 3ONBA 1GUVA 1JRCA 1S2WA 3OBAA 1GOKA 2WAGA 3APTA 3CZEA 4O8AA 1Q6OA 2J7DA 2DFAA 1EJXC 1WDSA 1KM6A 4HU0A 3RPMA 1S5MA 1OSEA 4O0ZA 5A6BA 3COTA 1LBFA 2NLYA 3WQWA 3MV01 2GVJA 1VCFA 3B3DA 1R3YA 3BGAA 3GBDA 3LI1A 1J6PA 3MYPA 3HFYA 3WLJA 4PTMA 5KINA 1Q45A 4GRSA 3AS3A 3P3BA 4AIBA 2Z1VA 4O1FA 2CWNA 1Y5WA 3UWEA 4KFOA 3PJTA 3VDHA 3UWWA 1ONRA 3BGJA 3WFZA 3S2LA 1HX0A 4OWGA 3GC2A 4GBUA 3L9CA 4GHRA 4HMCA 2DW6A 4C6OA 4O1BA 1B5TA 4AZ6A 2PS2A 5MHBA 1K7EA 3NUKA 3AI0A 5JH1A 3H7UA 4I9MA 3UG4A 2NQHA 3UW6A 5HPCA 3QR0A 2QZRA 3MA8A 4FIQA 3PN8A 4X2RA 3KTXA 1Q7ZA 2E5BA 3VKJA 1VENA 1KGXA 4GBDA 3UCCA 4OBRA 5KITA 4DJDD 2QVNA 2AKMA 3N11A 3CUXA 3TN4A 3T0AA 4WUIA 1EZ2A 4AVOA 1XGDA 3QY8A 2PAJA 3O0FA 4UWMA 4KBXA 2BY2A 1OZMA 1MEHA 1KM5A 3ABXA 3OW1A 2HVOA 2PZNA 3W24A 2Z26A 1EYEA 1PB0A 3HGJA 3VMNA 2G96A 1IWBA 2CLHA 1VCGA 2BLEA 2EGZA 1L6FA 3BSMA 2ICSA 2A3LA 2P0OA 3NM3A 5IFTA 3VOJA 3N2TA 1JXKA 1W3IA 2C79A 4E3VA 5HXMA 1E1FA 3GNOA 1K9TA 2I9UA 1ISXA 3THDA 5JBFA 2BVWA 4O28A 1V6UA 5CPQA 3M7WA 3L4WA 3N2OA 4QFUA 3AO0A 3CK5A 3RLUA 4F0KA 5K4ZA 2DZSA 3WDQA 1IIGA 3SSZA 2CXGA 3WQ5A 3KZPA 1KRAC 4A8LA 3TN3A 3W83A 2OXNA 2VJXA 4KCWA 1QI0A 2VFGA 2CLOA 3FIGA 3TXZA 5BRPA 1DJHA 3GAKA 4GISA 3TR9A 1WAWA 3QSRA 3GAYA 1QO5A 3L4UA 3MUCA 4Z1DA 4HB7A 1ZCCA 3A12A 3KBJA 2I5GA 1D3CA 5G4WA 1YBQA 3KL0A 4S3JA 3PTDA 1WP6A 1JD7A 3AHVA 2D73A 1RPKA 1BXCA 3EDEA 4CQ9A 4QHRA 2XUCA 1FWGC 3USZA 3LK6A 5GQBA 1U22A 4FNTA 1AMYA 4BQ4A 4I6VA 3ZWSA 3MSRA 2J8TA 3USBA 4U3CA 3TU9A 4LRTA 3DU0A 3KOWA 3W7RA 3NQGA 2YL6A 4Q32A 3W87A 2IQ0A 3VOIA 4AFYA 3BXWA 2C14A 1E1EA 4LAUA 1JVNA 1N82A 1E0UA 2Y7EA 3L68A 3TZNA 2Y8KA 2WVVA 2A7RA 2OLSA 4PH6A 3KOYA 2QNEA 4OGZA 4FOUA 1S3HA 3SUWA 5CJ5A 4FXSA 2VZUA 5CG7A 1BWLA 4DJFA 3IJLA 4LNCA 3W7JA 2ZE3A 4BQ3A 2QKFA 1TFVA 5GNYA 4DXVA 1T41A 2E6AA 3E5PA 4ZQNA 1GHRA 2XHYA 2A0NA 2AMGA 1TCDA 1XDMA 4H6KA 2PCQA 4C6EA 5L9FA 2WZIA 4C6LA 1US3A 1HKJA 2C1HA 4HNNA 3MHUA 4LAMA 1TUFA 1R5YA 1NDVA 2DZVA 3R2GA 3W07A 1Q3NA 2WCSA 3VOFA 4AB4A 1W31A 1NQKA 1K8YA 1CXHA 4W7WA 3VKKA 3DYPA 2ON3A 1K7FA 5F4WA 3CIVA 1WXZA 4WR3A 3I7SA 5I7GA 1FY6A 2BWGA 2UY4A 1PCWA 2CZFA 4UR7A 4C6DA 1EH9A 3G77A 3SRFA 4K7YA 3SFWA 1M7XA 2OELA 3A21A 2FTYA 3PZNA 1F73A 2GDVA 4O0QA 5CSYA 3NA8A 3KS5A 3NSMA 1AD4A 4P5UA 3EWDA 4CUCA 3U7VA 3A3WA 3FYPA 3GD6A 3I7QA 4DBSA 3TA9A 3LRKA 3MBFA 1EOMA 1H09A 1UD6A 8RUCA 1XSIA 1K4GA 1XIIA 2VFFA 5M03A 1A47A 2GUYA 2DIJA 2J88A 1UWTA 1AK5A 2A2IA 4I6KA 4ZOCA 1AG1O 2E25A 4RUBA 4H7ZA 2WZEA 4DF2A 3HQNA 1CTNA 4LUIA 2PEVA 4AC7C 4MNLA 3HM7A 4JTLA 4KFPA 1EL3A 4LPCA 1U33A 1GVQA 4K1WA 4KWOA 1M3UA 4GXWA 1XS2A 1E51A 2YDRA 5BOOA 3WQ4A 1MXDA 3ZJ8A 4P8WA 4GC3A 5EY5A 1AA1B 1GG0A 2PU1A 1TWIA 2OX1A 1OFRA 2RUSA 4B5UA 2W91A 1QTWA 3GR7A 1XYFA 2NXHA 3LHUA 2NVCA 3B9DA 1RK6A 3VZYA 3HG5A 4HCLA 1H5YA 1H7XA 4A8IA 2JIWA 2P3ZA 1TA3A 5FIPA 3NDZA 1MEWA 2V2HA 1CB2A 1AW1A 1H60A 1UA3A 4OUEA 5FJIA 1HVXA 2F2HA 1TELA 5FOOA 1KTCA 2JE8A 3MS8A 2YB4A 2GVLA 4C6PA 1O12A 3HMCA 1K3UA 2DY3A 3BDKA 1SMAA 1NP2A 3W2MA 1V3JA 4JHMA 4IFKB 2PDWA 4E2BA 3A3XA 1QNRA 2UY2A 3IACA 3H8AA 3AS2A 3B8UA 3NZ1A 3QHOA 1F4HA 3LA4A 4K38A 4LOCA 4JFVA 2ZX7A 2WWCA 2ZRWA 4LBSA 3ITTA 4OOUA 3N29A 4BK9A 1WAUA 2IS7A 3SJNA 2PDBA 4X22A 1SZEA 4H2CA 1ISVA 4L6DA 1UG6A 3AS1A 1QWGA 3EKZA 3UG3A 1VYPX 4JY8A 2PDCA 2D69A 4Y2WA 4JFSA 1BF6A 1W1ZA 1AZ2A 2G5WA 1BGGA 2VZSA 4J3XA 3T0BA 2EPLX 4JTGA 2PP0A 5FL1A 1T6MA 5KMYA 2JKPA 1Q7QA 2GQ3A 1XCXA 3S2NA 4FS9A 3PUGA 3W85A 5D2XA 4WKAA 4DF0A 3LHWA 3G6LA 2XFFA 3CC1A 3PUDA 3CT2A 2O92A 3HBLA 4HK7A 4HN8A 2YLLA 4GGHA 3GUWA 5BRBA 4PMRA 1WZLA 3UP8A 2IKJA 2WC3A 3ZM8A 3WLRA 2YPIA 3LX9A 1GNXA 3NXFA 4JYFA 2X1UA 1J96A 2ZUVA 3AYRA 4KRTA 2BOGX 2NX3A 3V36A 3APYA 4IXXA 4EANA 3NZPA 2EF9A 3M9YA 1VJSA 4GFSA 4GVHA 2DJLA 4ZE4A 3VNZA 4WLCA 2YJQA 4QQ3A 2Z6JA 3N19B 4UCGA 1A5AA 2VKZG 4B15A 1YYAA 4IWWA 3NQ6A 4AD3A 2ALRA 2VHLA 1G4EA 1SJAA 2G4JA 4J2MA 3AXXA 2V69A 2OJPA 1ESWA 1JPHA 3W1NA 1F3XA 2WMIA 1EA9C 3C8FA 1TV5A 1FWEC 2WZTA 1J4EA 2Y61A 4MWAB 4FEZA 5DXXA 3BMXA 4REQA 1KWKA 2J7BA 2QAPA 1XSJA 1CECA 4E5TA 3UPWA 2UWFA 4JFTA 1E6ZA 3WQ8A 2PWHA 1EJSC 4DWSD 4K7VA 3M44A 5HNTA 3G1FA 1EB3A 4HPHA 3UCDA 3H4WA 3DX5A 2VCAA 4WJXA 1N8FA 2BY0A 1BEUA 3CXOA 3AICA 5CJMA 3GG8A 3IGXA 4MB4A 3L4ZA 1MMFA 1ZP3A 2E9BA 3ALGA 3AMCA 4GGBA 3ME3A 5EMJA 3UR2A 1OCJA 3WK2A 2MANA 2GJXB 5LHFA 2R82A 3MMTA 1VYSX 3REQA 4GKTA 4TVDA 3SAZA 3S5ZA 1RR2A 1F7BA 2PGEA 3ABRA 4KW2A 4DZAA 1EA0A 4H6EA 3WNKA 2FHFA 2PSNA 2YCJA 1PS9A 5CGTA 5FACA 3C2RA 3AIBA 2XM2A 1OG6A 4LF1A 4TMBA 5LNSA 3RLGA 4DJEA 3W7DA 4HP5A 3A9IA 3AZSA 3V5OA 1A3HA 2P5NA 1VHCA 4Z1YA 3M0ZA 5CPLA 3DENA 4XKMA 1ZBWA 4RNIA 1EZWA 1HIZA 3KOFA 4AWUA 1EP2A 4ZMGA 3QFWA 2XIOA 1BYBA 4N2YA 3DGBA 3NR0A 4O50A 1CB7B 2VEIA 3CTTA 1J0JA 5GVJA 1C29A 1F8MA 4WSJA 1BAGA 2G3JA 3LPOA 5A5WA 5A8OA 1GVOA 3ZZ1A 2BVYA 2PFHA 3WD1A 4YWSA 4AAJA 2W63A 3LTYA 4C6FA 1NELA 1FWNA 3G1VA 4ATDA 1K6AA 4ZQOA 2W0UA 3G3DA 3R79A 2FHCA 4CD8A 4XBKA 5JH2A 3TDFA 3CWHA 1R3QA 3R8HA 3GH4A 3TFXA 3DHPA 4XZMX 1BSIA 2DZUA 2XGZA 2XIBA 1X1ZA 3TOPA 3ECQA 1TPDA 3OPSA 3O3RA 2PLKA 3QF0A 3I68A 3T40A 3BTNA 1UWAA 4TV5A 1Q65A 4RZ5A 2FPVA 2CEQA 3B4YA 3IJ9A 3WF4A 2VX7A 2YFNA 1E1CA 3WH5A 1WCGA 5RUBA 2I1OA 5A8PA 4MNMA 3WL1A 3O63A 1JZ6A 4Q4MA 2H90A 3ZWTA 3MP3A 3EKLA 3LD5A 5AC6A 2ZX9A 2Y7DA 3LPGA 4P7RA 3WH9A 1EC7A 3WO8A 3GG0A 2B7QA 2NV2A 3OQEA 3OG2A 4UTTA 4LB4A 4K2SA 4Y96A 3BANA 4HPGA 1OFPA 4O57A 4UNLA 3PWIA 3VINA 1EGZA 4LBUA 1LL7A 2VX6A 5C54A 4DBEA 2AOSA 5DY3A 2VUNA 2AL2B 1KKRA 5E9AA 4TR9A 1UJQA 1YNYA 3VKDA 2I57A 3AU6A 5E70A 1DQXA 1VFUA 3FEMA 3CEPA 3M0LA 3CBWA 3LHZA 3MCMA 1PAMA 2PWVA 4LXFA 3ES8A 2ZXBA 1TKKA 1GT8A 2VQUA 4BZYA 2B7NA 3MO7A 1JYXA 1M9HA 4DQWA 4JAWA 4K8GA 4AD0A 1HKIA 3MKCA 1V3HA 3OVRA 3WN6A 1E5NA 3QGKC 4CNTA 5ABFA 1KKOA 1JNDA 3WH8A 5HDRA 4GYKA 2V67A 3VZZA 4XZNX 5DMYA 1UIOA 3GZAA 4J4KA 1JZ3A 4DI8A 3B9NA 3AISA 1JZ4A 2ZTJA 4U10A 1WO2A 3PFMA 3B05A 3RITA 4IMCA 3TSMA 1F6KA 2FZDA 3ARQA 3HQPA 4UR9A 3TN6A 4EPKA 2WMKA 4NX0A 5A95A 2V5CA 3G18A 3GH7A 2JEQA 3L23A 4JTCA 1TTJA 2BBFA 1DJXA 2WHMA 1KRCC 2PTDA 4Q6JA 2G37A 1I2RA 2PLCA 5A1AA 3LNMA 3BAJA 3GNPA 5I06A 1MNSA 2BOFX 5L6UA 4N9BA 2FKPA 3RCYA 3MZ2A 3W1PA 1YNPA 8A3HA 1TRDA 4L5ZA 3DFQA 3GHUA 5AC7A 3TTOA 3HA1A 1UA7A 4MIMA 3O15A 3F4DA 4OQVA 2X40A 2EG8A 1TTQA 4N02A 3KCOA 1HGWA 1TVNA 1AMKA 4PULA 1F9CA 4LS1A 1A5KC 1AW5A 2FB2A 5A94A 5LIYX 2X8RA 3U48A 1V0MA 3W37A 3D47A 1UZDA 2V38A 4GIAA 4FNPA 3EDFA 2WCGA 4LUSA 1NP0A 2YYTA 2H8XA 3W38A 4B2DD 4YYCA 3PAJA 4BWLC 2FZMA 1JFHA 3O07A 3CZ8A 4K68A 3H7RA 1UKQA 3T4WA 1SR0A 2KAUC 3UGRA 3F1QA 1R3WA 3EDKA 4LNYA 1H7PA 4UBPC 3V3WA 2J6XA 4AZBA 7REQA 2OKTA 2VL4A 1XLHA 3C52A 4DLMA 2D0GA 1V6XA 3OLEA 1W9DM 1H61A 1HTIA 2A6LA 2QPSA 3B04A 3NPUA 4NG3A 1PL9A 3ZT7A 3ELFA 2R1MA 3UPBA 4DEFA 1EJTC 2XGBA 3NDYA 3UQNA 4HMEA 1MXSA 2XINA 3WEOA 3L2MA 3UFYA 1E15A 4D6IA 2RDTA 3UXDA 4U5KA 2XU2A 2PZ0A 4S3GA 1CI1A 1X7IA 5DBUA 1NTHA 3WQGA 3BUVA 1OCBA 1VKFA 3EOSA 2WPBA 2J77A 1TJRA 1K6WA 5D2TA 1GJPA 4M3PA 4AZCB 1ZAHA 1IHIA 1PIGA 3K8KA 3ITLA 1L8NA 4CN6A 3M64A 1E3ZA 1NVMA 3IGSA 1WB0A 3KL3A 1RY8A 4H9XA 1G5AA 1JRBA 3VKBA 2RDUA 4FP1A 3MTWA 3LBMA 3F03K 1UR2A 3W1AA 2QMJA 3ES7A 3FJ6A 3BCJA 2QV5A 1R86A 4IMGA 1KCXA 4W7VA 4WRHA 1DJIA 1KBIA 2OEKA 4MFDA 5D02A 3VNLA 5TF0A 2HQAA 1R47A 1XLKA 4Q4QA 2CETA 5GJNA 2WW5A 2DT1A 4P61A 3ITYA 2VR2A 4HHHA 5HNNA 1PCKA 3QV6A 4F9JA 4AVNA 1DXFA 3T81A 5AECA 2ZADA 4UTLA 4XZ9A 4ENLA 3ZS4A 2EJAA 3PZOA 3ARZA 3DFTA 4GYJA 4PCTA 3DAQA 3DFHA 3CHCA 2C3ZA 1KC7A 3Q2DA 3UY8A 4H8NA 2Z28A 1OCNA 1KD0A 3H21A 3SUSA 2OOFA 3H2NA 3IK2A 1N55A 3WJYA 1JYVA 1XW8A 1XYZA 3PPFA 4AD5A 3PB2A 2ZC1A 3LMYA 3IUHA 1Z42A 4Z2HA 3OLGA 1H5VA 2I17A 3PUEA 3IJ7A 1JL8A 3WNNA 3SO7A 4O1EA 4GZEA 3VIGA 4AD1A 4RE4A 2F2KA 5DFAA 1UPPA 2BXZA 3L4VA 3PJWA 2PB1A 2UBPC 3WDHA 4US5D 3Q4DA 2QDEA 2I56A 2HSAA 1MDLA 3LCGA 2HS8A 1XIFA 3KCJA 4C6MA 4S3AA 1BGAA 2PDPA 2ZA2A 1LCOA 2BASA 2ACSA 3FJLA 2XISA 2ZOXA 4S3CA 4D9PA 2Z1WA 3T2PA 3NO1A 4S3DA 4PMJA 4H83A 1OX4A 1W32A 4ZXOA 1VFOA 4GINA 5FEXA 5I3JA 4PL2A 2I16A 2ABBA 1LBLA 4WF7A 1LQAA 2X1SA 2X0SA 2VEKA 2WMJA 2ZVIA 4H4IA 4IGSA 3QBUA 2VTFA 1FWHC 1TR9A 4GC4A 5F2LA 3VDBA 4RZBA 4WDUA 5HR7A 3DXIA 2V63A 3PWGA 4CQAA 3SW6A 3UU0A 3SI9A 3CPGA 4TXEA 1I8JA 4KWWA 4IT1A 1XH2A 1TV7A 3AJXA 2GGEA 2HEJA 3FN9A 1TWDA 2QCDA 4UTJA 1V6VA 1RK5A 3QLDA 8XIMA 4GNJA 2C18A 3UWYA 2YSWA 3BH4A 3ZR4A 4TX6A 4RX0A 3PG8A 3RX3A 3W2NA 3I10A 4I9TA 2A4AA 5I78A 1EC8A 1W3JA 2VC5A 4KS0A 2GSEA 1W17A 3UA4A 1V4YA 2YCLA 1RBLA 2FYMA 2FVLA 3QVQA 4DAIA 5HAOA 3S0CA 3RUBL 3EKGA 2XN1A 2W6RA 4HNLA 1XIHA 4ZCWA 2A3HA 4C6CA 2PWUA 1D8CA</