5C55A

Crystal structure of the y138f mutant of c.glutamicum n-acetylneuraminic acid lyase in complex with pyruvate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
307
structure length
307
Chain Sequence
TFTGVIPPVMTPLHADGSVDVESLRKLVDHLINGGVDGLFALGSSGEAAFLTRAQRKLALTTIIEHTAGRVPVTAGVIETTTARVIELVEDALEAGAEGLVATAPFYTRTHDVEIEEHFRKIHAAAPELPLFAFNIPVSVHSNLNPVMLLTLAKDGVLAGTKDSSGNDGAIRSLIEARDDAGLTEQFKILTGSETTVDFAYLAGADGVVPGLGNVDPAAYAALAKLCLDGKWAEAAALQKRINHLFHIVFVGDTSHMSGSSAGLGGFKTALAHLGIIESNAMAVPHQSLSDEETARIHAIVDEFLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Y138F mutant of C.glutamicum N-acetylneuraminic acid lyase in complex with pyruvate
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase/N-acetylneuraminate lyase
total genus 115
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c55A00
5I3HA 1QOPA 3N34A 2ZTJA 3KX6A 1ZY9A 1JJKA 3HMJG 2GQAA 1QPRA 3SFKA 1HUVA 1XBYA 2NX3A 3HPZA 1SFJA 1W5OA 2QUVA 3VFLA 5BMXA 5AFDA 4OT7A 1H7PA 3THAA 1LRTA 2E77A 4GE8A 3ATYA 3QF0A 4Z1BA 3PF3A 4UTLA 2E5CA 4JICA 2OJPA 4JTHA 3EWUA 3P74A 3DXIA 3CB8A 4FNTA 3YPIA 3W1XA 3K30A 4DO4A 3GLCA 2QJGA 1SZEA 3TE9A 5E93A 4GNJA 1JRCA 2VFIA 4JGDA 2X16A 1KFBA 3C3NA 4XKYB 4RR4A 5D2YA 3N73A 5G2WA 4ICNA 1X7FA 2W0UA 5I3GA 1ZENA 3B0PA 2ATMA 4ONVA 2ZRYA 2B7OA 3LOTA 3GNNA 5K9DA 1LP6A 3EWBX 3EXTA 4NJHA 3W7OA 1GG0A 3TMLA 5F4XA 5CPLA 4ZQCA 1OFBA 2Y7EA 3ABSA 4BI7A 3TH6A 4WXYA 1CI1A 5HULA 3HJZA 3DENA 3P84A 2H8ZA 5G2IA 3QQ1A 3PM6A 3WK3A 4O18A 4C1KA 2G5WA 4LT9A 3W7GA 1W8SA 1WDWA 1EUAA 3DFPA 4QM1A 5D37A 3PUDA 4AB4A 5TIMA 1JCNA 4AMAA 1VC4A 1OG0A 2VFHA 4UMBA 3S42A 4ADTA 2VFDA 3O1NA 1KFLA 3MP5A 2FPYA 1V5XA 3CU2A 1QPQA 4JTLA 3IV3A 3LXAA 1FWNA 2A2IA 4FIRA 4EWND 1P4CA 3QFEA 3TIMA 4HSOA 1XBZA 1KW1A 2ZYFA 1THFD 4N9EA 1TQXA 3C0JA 4FXRA 4UTJA 3QM3A 1LDCA 5DBUA 3S6DA 1ICPA 4GRSA 3QMSA 4IMFA 4YWIA 3S1VA 4O1CA 4NUWA 3W87A 3A22A 4IMGA 3A24A 1W56A 3O6YX 3N9SA 1XCFA 4ZL1A 4R53A 1TO3A 3O16A 3NR0A 2JGQA 1TJPA 3W7PA 3LDVA 3VCRA 4HIBA 3IVSA 3W2MA 4OHQA 4IMEA 1Z48A 4E2BA 3ZFHA 4QAIA 4POCA 3JS3A 1LROA 2X30A 1T0OA 3LCGA 1MXSA 3BLEA 2DZTA 3OA3A 3GR7A 1TPEA 4NNAA 1TV8A 5F1VA 4CCDA 2GVJA 3NPXA 2FTPA 2BWGA 3W7LA 5EKYA 2RDWA 8TIMA 2Y7FA 4DF1A 4ZMGA 4KKXA 3UQNA 2HSAA 4UR8A 4MUZA 2I9EA 3NYZA 3W6YA 2GPTA 3SSJA 3FS2A 4MZYA 1K03A 1S5TA 3OEXA 5F2LA 3HGSA 4X3ZA 3PB2A 3LX9A 4NNBA 2Q8ZA 3FEMA 1D9EA 3I7QA 3GB6A 3TX9A 1YPFA 3S1UA 2A5HA 4TMBA 2VEMA 3B03A 2Y6ZA 3A23A 1FDYA 2DZSA 4A2RA 3SY5A 5HNRA 3TAOA 1D3GA 4UTTC 1Z41A 5D02A 3VI2A 4JTUA 1UCWA 4DBDA 4AWSA 2QCHA 2FIQA 4AAJA 1R30A 3LCWA 4YCPA 2ZZ6A 4HNUA 1W0MA 2Y85A 2YW4A 1TIMA 5K4XA 1F6PA 2J24A 4MZ1A 2V2CA 2E6DA 2P0OA 2WOQA 4CLMA 5LZLA 2CU0A 2DP3A 4AF0B 3TUUA 1KBIA 3KFTA 3E12A 4WOQA 3W76A 3L9CA 1FCBA 3W1TA 2I1OA 1RVGA 4Z1CA 5K2ZA 1TTJA 1XKYA 4P61A 3M43A 1PE1A 4RJEA 1KFKA 3PSWA 3U2OA 5AYYA 2ZZ5A 4M6VA 2ZTKA 3LRMA 4K8EA 4NXKA 3O8AA 4RXGA 3L0KA 1QAPA 1F76A 1JUKA 2FFCA 5F2IA 1R2TA 1BTMA 1S5WA 1QR7A 1JUBA 4CCCA 3MBDA 4Y6GA 2V2HA 4DBEA 2H6RA 3BW4A 1SR9A 3PWAA 3P7YA 1JCMP 1VCGA 4LWWA 3QPYA 3N9RA 2V5BA 1E51A 1I2RA 4FNQA 2F84A 4DXVA 2XFWA 3DFQA 4IPJA 3L67A 5H91A 2J27A 5KITA 4RZ5A 3LHZA 2XN0A 1O95A 1ZJIA 4OV9A 2CLEA 4Y9AA 2NXHA 2WQPA 3PAJA 1ALDA 4JTIA 2V5LA 5D32A 4PFMA 1F05A 4M6QA 4E0CA 4JDBA 5EL1A 1K3UA 1WV2A 5G4EA 1A53A 3UY8A 5HR6A 1QFEA 1UUOA 4MOZA 3ZWSA 4YLWA 3NA8A 2CZFA 3EB2A 3GXPA 1NF7A 4GBUA 5EY5A 4AHQA 4TMCA 2X1RA 4X2RA 4LVBA 3N19B 2C6QA 2OMAA 2ZZ7A 4XKYA 4HN4A 5EYWA 4MPQA 4K7VA 3GAKA 3W7JA 3R13A 5DBTA 3STFA 3PS7A 1A5CA 2A7NA 2G96A 3N14A 2E68A 4FF7A 1PVNA 3BLIA 5IM51 5CPNA 2Y63A 3NQMA 3MJYA 1I8JA 6ALDA 3G18A 5DXXA 4FEZA 4CNOA 3P60A 2KZHA 2ZRXA 3BG9A 3LTPA 2V0TA 2D73A 1KM6A 4A21A 1YDOA 3CT7A 3KVLA 4UTUA 1N8FA 2W6RA 1VRDA 3CC1A 5D38A 5HWJA 1KFJA 4PL2A 3T55A 3W22A 3TW6A 2V82A 1M6JA 2ABAA 3UZ5A 2B7QA 3DZ1A 4MIMA 1C8VA 4O13A 1ZFJA 2EPHA 5TBOA 2GQ9A 5D2WA 1K02A 2Q3RA 5K4ZA 4M5PA 3FKKA 2B7NA 3NL2A 3C2OA 3NQ8A 3P8IA 3H55A 2GQ8A 3OVQA 5LHEA 2C14A 5FESA 2WSYA 3LB0A 1LRQA 1LLZA 1YTEA 3M9YA 1OF8A 1W37A 4JYFA 3G1VA 1VH7A 3OG3A 1UB3A 4A3UA 3W07A 2ISSA 3LM7A 1BEUA 5C54A 1IGSA 1O5KA 2JGYA 4GWEA 2ZCGA 3G3DA 3EWWA 1TV5A 1X6UA 3NG3A 3CWNA 3WFAA 5FF7A 1H62A 5LNWA 3WJSA 2HS6A 4ORMA 1MZHA 1DBTA 1MEIA 3LBMA 3EX1A 2XN1A 5CZTA 2CLFA 4FX8A 1UUMA 4NVTA 2NX9A 5IBXC 3BGGA 3S1WA 2GUUA 5G1YA 2V81A 2ZA3A 4MLJA 5HWMA 3CEUA 4MJZA 3QMTA 2HS8A 4XQ6A 3PR2A 2VC6A 5DN1A 1ZALA 4FNPA 4UIOA 1Q6LA 4NZJA 1FDJA 3BARA 2J6XA 3IVUA 5BNKA 2QAPA 1OYCA 1GTEA 2BXVA 2WSQA 4O53A 3NZ1A 5AC6A 2ZRUA 5DLCA 3NQCA 1DQXA 3WJWA 3QW3A 5F1UA 1X8FA 2QJIA 4JXCA 1KTNA 4ML9A 4J9JA 4E38A 5K7JA 3H54A 3MO7A 2PURA 4XUGA 2PRLA 4GJ1A 2ZRWA 1FCUA 3DKJA 3L68A 3LBCA 3HOJA 3OIXA 1OFAA 4W9TA 2CFFA 2DZUA 1VYPX 2WNNA 4UFIA 1FX6A 1IIGA 1OX4A 3Q2DA 1EWDA 3TR2A 3HPSA 4WX2A 3L66A 1AL7A 1B4EA 1GWJA 1Y0EA 5EPDA 2FQIA 4GUJA 3NGJA 1TTPA 1UJPA 2F7FA 3PSVA 1PV8A 3UWUA 4JDYA 4O1AA 4MJMA 2H3DA 5I3JA 3RLVA 4NXSA 4CNPA 4DQWA 3IIVA 3LHUA 1Q6OA 1M5WA 1GVSA 1HL2A 4JY8A 1RR2A 5C2XA 1KFEA 3PY2A 2YXGA 1FWTA 1F73A 3QH2A 3LLFA 4YCOA 3KOFA 1LOQA 2DJXA 3A5FA 1YXYA 1A5SA 4GFSA 3W2JA 4I7VA 3FOKA 3R8RA 4LY8A 5KMYA 3LERA 2JK2A 4UFMA 3PBVA 1WBHA 4LTSA 1LORA 1JQVA 2VFFA 3P5ZA 4FB7A 3OHIA 5HR7A 4A29A 4UR7A 3W1AA 3MBFA 1EWEA 1AW5A 4RLIA 2A6LA 3DHDA 2RHGA 1KV8A 2DZVA 1IXNA 4UTIA 1YTKA 4QNEA 3W1LA 2TPSA 5G5IA 2Y89A 4H4IA 3F4WA 1JR1A 3W72A 1B3OA 1JCLA 1G4TA 3S9YA 2V30A 2QCDB 5HUPA 4UMCA 3MI3A 4OV4A 1YDVA 3NQFA 3UWYA 3BW2A 3DBPA 4NX0A 4ZQNA 2HMCA 1BWLA 3BV4A 1KTCA 1I4NA 4ZZ9A 1VPXA 4FHAA 3MHFA 3LTSA 3PG9A 4K6AA 3C2FA 3NM3A 3UXDA 1G4PA 1ADOA 3MHGA 3LI0A 3S5YA 3P8JA 2YR1A 2VOMA 2Y70A 4LUJA 1P0KA 3HIJA 3KRSA 4DF2A 1QCWA 1JCXA 4IMDA 5J5DA 4XBSA 2CZEA 3ANYA 1OFEA 2A1YA 1AMKA 1W5QA 1UASA 3HBLA 4K38A 1W5NA 2NWRA 3LCHA 4LVFA 3M5YA 4LV9A 4O17A 1AG1O 3UWWA 1DQWA 3PVFA 4NX5A 3FYOA 3KXQA 4GUIA 4AWUA 5G4WA 1JQXA 4BFAA 4BWLA 4L4LA 1W3IA 1TYGA 2GVGA 3AO0A 4UC5A 4WY0F 3WK0A 4HNTA 1OYAA 2QCGA 4QJ1A 4O1BA 1HO4A 3TC6A 2RFGA 1OABA 3TSMA 1RZMA 2BSLA 1JCJA 2G95A 3C4UA 3DAQA 5F4WA 4NZFA 3GDRA 4EF8A 1TREA 1VJIA 4WY0B 1KM1A 1LBLA 3W84A 2QCLA 1TPDA 2TRSA 3O63A 1SQ7A 4UCGA 3ZS4A 1IF2A 4JY9A 4JTSA 1W5MA 4UTKA 3W1NA 3NQAA 7TIMA 2O7SA 1GQNA 3LLDA 3HGJA 3UZJA 5EA9A 4AHPA 1LM1A 5CKSA 5K9CA 4X22A 4OU1A 1JRBA 5AHMA 3DH7A 3E49A 3VE9A 3NDOA 3F03K 3IVTA 3GXTA 2X1UA 3WK1A 4FIQA 1TQJA 3T44A 3W70A 1WBJA 4RXFA 3HG5A 1YYAA 1XL9A 2QUTA 2R14A 1H7XA 2H8XA 1TB3A 1TRIA 3TFXA 2NV2A 3NNTA 2WNQA 4LVGA 3B8DA 5CG7A 3MYPA 2Z1BA 1OX6A 4GC4A 1TRDA 3M41A 3GVGA 3STCA 4JIQA 2CZDA 1YADA 2HTMA 4A22A 4R33A 4WY0A 4DPQA 3M44A 4BWLC 3CWOX 1M7OA 3S0CA 5A8GA 3KRZA 4TU1A 2CLHA 2ZQ0A 1YDNA 4K37A 1FWWA 3PUOA 4TO8A 2A21A 4Y96A 4IXHA 4UFKA 3T78A 3TQVA 4JTTA 5LNSA 3W1UA 1SW0A 2QJHA 3W23A 2Q3OA 1YLVA 2RKXA 1EP1A 3NL3A 1MSSA 1OYBA 3DKLA 1VZWA 2VEPA 3W71A 1ZAHA 3I68A 3V75A 3QEZA 3PUEA 1OK4A 2EGZA 3MYOA 1KV5A 4I7UA 2X2GA 4N02A 4TR9A 5AN7A 3NZRA 3GAYA 1SO3A 1FBAA 3P62A 2YX0A 2V2DA 3I6RA 5DY3A 4S2BA 4XTDA 3L5MA 1AW2A 4OQVA 1EIXA 3ABRA 1SSGA 3IIPA 1L9WA 1ZAIA 4LUIA 1KFCA 4PH6A 3T4CA 3F1QA 2YSWA 3IIZA 3P82A 1XFBA 3HGRA 4M19A 2H3BA 1O5XA 3HGOA 3NL5A 2ZA2A 5ABTA 1TJRA 3NAVA 1WQ5A 1C9DA 2OCZA 1G4EA 3PG8A 1SSDA 2C3ZA 3O6CA 5D09A 1XBVA 5DCBA 2DZWA 1WAUA 1P0NA 4BK9A 4H3DA 4O10A 2JBMA 3B06A 2IQTA 5AHIA 2V8ZA 3GDLA 4HPJA 3TNOA 1TPC1 2A6NA 3HF3A 5LNRA 3QMRA 4YXGA 1ZHAA 5AHNA 1LZOA 4O16A 4UUIA 4MY9A 5D2TA 1H50A 3T7VA 4DPPA 5C5YA 3HO8A 4X9SA 2NXGA 2WKJA 3TSBA 4UXDA 4B5NA 4NT0A 2CZ5A 5G1TA 1XDMA 3NPVA 3G1DA 4LRSA 4FX6M 3TFCA 4DO6A 2A0NA 4FO4A 2VKZG 5CZSA 2O7QA 1W54A 1GPWA 1JVNA 1MEWA 3IEBA 5AYZA 4S2CA 3RLUA 4IUOA 1J5TA 2AGKA 1QO5A 1V7YA 2Z6IA 3NPUA 2RH9A 3I7SA 1Q6QA 3TSDA 3C52A 3QC3A 4QSHA 5DXYA 1DV7A 3I7RA 2TYSA 3O05A 5FF4A 5LSMA 2VEKA 3W7CA 3C8FA 3W74A 1P5BA 4NJKA 4KWVA 1K8YA 4JTKA 1FUYA 5KINA 3UD6A 1F7BA 4O28A 3EWYA 3S5OA 1A50A 3NEVA 4LNYA 3KVJA 1YXDA 3L2IA 4LS0A 3TROA 1T8XA 2J9XA 2Y88A 1OX4B 1WYIA 1VR6A 3E96A 1BWKA 3S5ZA 3TXVA 3NM1A 3GDKA 3HG3A 1EPXA 1D3HA 3B05A 3LCFA 3UWVA 4K36A 3JRKA 4E2DA 2YFOA 5EBUA 5LGXA 3B0VC 2RDUA 1GT8A 5HJLA 5AHLA 2J88A 2NLIA 5DY2A 2BLEA 3PC0A 3ZWTA 2QCNA 3QW4B 2CLOA 5FF2A 1H51A 3FJLA 1VGAA 4Z0JA 1ML1A 4ZQMA 2GJNA 4PTNA 2AQWA 1DVJA 2YDAA 1SZFA 5CPOA 4C1LA 1NSJA 3KAOA 4O50A 4JTEA 4NJJA 4OGZA 1TPFA 3LCLA 3NPWA 1M7PA 4PA8A 5D04C 3D0CA 3SR7A 1W1ZA 1ZAJA 4N4QA 4GUHA 3STEA 5HQEA 1KLZA 2XN2A 3W88A 4L4MA 2NUWA 1VCVA 3NQGA 4JX4A 3NL6A 3SZ8A 3MP4A 4JIPA 4O0ZA 1Z44A 1UBSA 2A4AA 3PBUA 5LKYA 3S5NA 1J4EA 2QCCA 2PRMA 4JEQA 3NQ7A 5LNVA 1IXPA 2TSYA 3BG5A 3LHTA 4TIMA 1GVOA 4NJGA 2GVLA 1VLIA 1G7UA 2QEZA 4N2YA 3G1FA 3SECA 3UPWA 4LRTA 1F74A 4JD4A 1GVQA 1XDLA 4JS3A 4O11A 4LVDA 5D2VA 2NUXA 5FEXA 4FX7A 3GXNA 1GVFA 3TA6A 4EIVA 5EMUA 5D2XA 5AOUA 3B0UX 2R8WA 3DFOA 2EHHA 1H61A 3UYCA 1C29A 3MHUA 1LRNA 3CLMA 2CW6A 3LGEA 1WX0A 1QOQA 3W7DA 1RPXA 3IIXA 3W1QA 3TU9A 1OFRA 1SW7A 5U7SA 2E6AA 1L6WA 2AAMA 3VE7A 5D03A 3Q94A 1K7XA 1FXQA 1G67A 2EF9A 2YPIA 2E6YA 4UFJA 5FI8A 3W7MA 4PCFA 1O60A 4CQAA 2FDSA 3EX2A 1ME7A 2C13A 3RK8A 2OX1A 5AYXA 1OFQA 4QNWA 5GVJA 3W7RA 3W7QA 4O4WA 3ABQA 2ZRZA 4HPXA 4K39A 3EWZA 5DCDA 1PCKA 3INPA 4BI6A 2QF7A 5IBXA 4IX0A 1K8XA 3JR2A 1I2PA 1GVRA 1IIHA 3TQKA 1IXQA 2VXNA 5AHFA 5FF3A 2LLEA 3NXFA 3DFNA 2FB3A 4A2SA 2Y7DA 1GJPA 4HSNA 3NVTA 3G0XA 3G0UA 2VEIA 3IGUA 3W85A 1XUZA 3DU0A 3P5YA 4XBKA 3W1RA 2NV1A 3MWAA 1H7WA 2YCEA 1QWGA 3GKAA 3P81A 5I3KA 4R34A 4MFDA 2OT1A 3USBA 5BW6A 2E1DA 1LOSA 4N6EA 2DORA 2JKAA 3FA5A 4U28A 2E09A 1XUUA 4H6KA 1KA9F 3PB0A 3RFAA 3M5ZA 4TX9A 3GDMA 4IPIA 2NWSA 3AJXA 4AEOA 1ME9A 4NJIA 3THQA 3Q58A 3GKFA 4KFPA 4O1DA 1LYXA 2VENA 3SW6A 4AF0A 4EOUA 1HTIA 4S1FA 1VS1A 1FY6A 1HG3A 3QSRA 3RMJA 5KZMA 1GEQA 1PIIA 2CWNA 3PBWA 3TC7A 1ONRA 1F2JA 2QCDA 4O54A 2VELA 4JYDA 1WA3A 5CSSA 4ADUA 3BW3A 1SO5A 3C6CA 3W86A 1DJNA 4K8HA 3HG4A 1JULA 3EX6A 2C0AA 1SZNA 1R47A 3UWZA 1VYSX 5F2MA 2WJZA 4XTIA 2FB2A 3MI2A 3KRUA 1TPVA 3P61A 4NQ1A 4WQ6A 3TDFA 3FFSA 3W3OA 4KFOA 3L5AA 3EEGA 5D05A 4AH7A 3U6WA 2PE4A 1QMLA 1KBJA 2Z2UA 1S3HA 1S5VA 1F6KA 3BK0A 4LC8A 4YL2A 5BRBA 4O15A 2TMDA 3EXSA 3KHJA 1OK6A 3W7NA 3LV6A 3H53A 3LTYA 4Y90A 3UY7A 3TJXA 5H2ZA 4JN6A 1KM4A 2VFGA 2E5DA 5I3FA 3BLFA 4AHOA 1VHNA 4RV8A 3CIWA 1LBMA 1OX5A 1G4SA 1AW1A 3M16A 1W3TA 2FLIA 1DHPA 3E02A 4KWWA 1QPNA 1OFPA 1GYNA 4UTMA 4FNSA 2G97A 4MZ8A 1WOAA 1ME8A 5F4SA 1H7OA 1A5BA 3B4UA 3QSTA 3S1XA 1GG1A 1YPIA 3P67A 2YYTA 3DFTA 1DOSA 5CZ0A 1SFLA 5KSWA 3BO9A 5FEZA 2QCFA 3CHVA 1OFOA 4M7SA 1AL8A 2C19A 3GIYA 3GK0A 4BF9A 3BGJA 4O0KA 3I65A 3BPWA 3EKLA 1OFDA 3NQ2A 1F5ZA 1GOXA 1O94A 4O12A 3SJ3A 3UXAA 3LI1A 3SI9A 4N9CA 2WPBA 1GTHA 4GUGA 2H90A 2QUUA 3L21A 3L0NA 3C2VA 1EUNA 3O06A 2FJKA 5FEWA 3GDTA 5AC7A 1LBFA 5C55A 1MEHA 4ALDA 5SWUA 1RQHA 2ZZ2A 1K8ZA 2GOUA 3CM4A 1B57A 3W1PA 3WJYA 2RDTA 3LXBA 3HQ1A 4O8RA 1QDSA 1I2NA 4CCEA 2A7RA 4N6FA 3E9AA 2JKEA 3KVKA 2ZBTA 3C56A 2DZXA 2Y62A 4CQ9A 4O52A 4RZ4A 5E1QA 1SZGA 2QDGA 5DELA 1ICQA 3NQDA 4O19A 2WV8A 1K7EA 1RQEA 1H5YA 2ZA1A 3IIOA 2Y61A 4HNNA 3TV8A 2YFNA 3ELFA 5L6UA 3SGZA 3N2XA 3W75A 3KVMA 2W79A 2WSRA 2I14A 3S8HA 5LGZA 2X1SA 3W1MA 4NU7A 4QIUA 2Y7GA 1FXPA 1TSIA 1CX9A 2A85A 1FQ0A 3FKRA 3FIGA 3VNDA 4I7WA 5CSRA 3LHYA 1HO1A 4Z0SA 1ZNNA 3W2NA 2ZZ1A 3MMTA 3A9IA 3LRKA 2CLLA 1R2RA 3G1SA 4IOTA 3TJLA 3W7HA 3GNDA 4RKAA 3N3MA 4CQ8A 4N9BA 4ZQOA 4JTFA 4PODA 1GYLA 1NVMA 3QZEA 1U83A 1G7VA 3M47A 1Q3NA 2JKPA 4O14A 3W2UA 1QNVA 3G8RA 4HNVA 2DU2A 2NX1A 5C6MA 4JX5A 4MKNA 1JCYA 2E5BA 1QO2A 1Q6RA 1JUEA 1LLWA 3R12A 3M5XA 3FJ6A 5CZJA 1PL9A 4K7YA 3WK2A 1YTDA 2C15A 2CLKA 3TK7A 4GXMA 1XM3A 5BOOA 1TPB1 3DHFA 3F4NA 5LHFA 2BZNA 3M7WA 4WXZA 3TMQA 5D33A 3EKZA 3UPBA 4UFLA 1Q45A 3WJXA 4PL1A 1OHLA 4JNMA 5LNUA 1P1XA 2YYUA 1B4KA 3GR8A 5K3VA 4FNRA 1PS9A 1XXXA 1R2SA 2ZDRA 1OJXA 3G3MA 1H60A 3TKFA 4P2VA 4JTJA 3V1PA 4DELA 2BX7A 4IXXA 2YGYA 1VLWA 5AC8A 4MY8A 1H7NA 3NQEA 1KM0A 4UTWC 4WOZA 1T99A 4ORIA 4Q4KA 3O07A 3MUXA 3PULA 3M0ZA 4LC6A 4HHPA 1FCQA 3EXRA 4RX0A 4XWUA 4AWTA 1BKSA 4QQ3A 2ABBA 5DCEA 4M7TA 3N2MA 4UNKA 3R89A 4GUFA 4MVAA 5AB3A 2GJLA 3LRLA 3OVRA 3FYPA 4MYAA 1KTBA 3SIZA 2C1HA 1TTQA 4OWGA 2NXIA 1TPH1 3EX4A 2QCEA 5AHEA 3LHVA 3STGA 5T26A 2ZRVA 4UFHA 1FCVA 2PC4A 3G1HA 2PCQA 3L5LA 3ZR4A 1X1OA 3OVPA 3QQ0A 4JYEA 3C2EA 4N9DA 1H1YA 2ZFAA 4EF9A 2NUYA 4AXKA 5KTLA 1NFBA 1CW2A 2CLMA 1OF6A 3U8GA 4ZQRA 2B0MA 3DI0A 4PC8A 1ICSA 4FXSA 3M1ZA 3LCXA 1ZCOA 1L6YA 1TCDA 5G2HA 3RF9A 3A5VA 2P10A 3LV5A 4DO5A 1LCOA 2A7PA 4Z08A 4MY1A 1B9BA 2QDHA 2QR6A 2X1TA 3BVJA 3HPXA 5D30A 4OBTA 3IGXA 4EVZA 4XZ9A 1SW3A 1H63A 3RU6A 4ADSA 4WZHA 2C18A 2ISVA 1EEPA 3UWQA 1I2QA 1H1ZA 3MI6A 1DKWA 1TTIA 1XI3A 3DFSA 4UTTA 3HB9A 3ATZA 3P80A 2ALDA 2B4GA 1K7FA 3W2KA 2YW3A 3CIXA 5KZEA 1L2UA 1X1ZA 1SU5A 1RV8A 3TXZA 4FNUA 4IX2A 4RK8A 3MW7A 1N55A 2PRHA 3O15A 4WUIA 1VCFA 4LOCA 1KM2A 3G1AA 1SUXA 1KLYA 1OVDA 2DZPA 2WNZA 3G24A 4LS1A 2FPVA 5A5WA 3DI1A 4G1KA 3E0IA 5KZDA 3CQ0A 3IGSA 1TPWA 3NQVA 4HKPA 4PEKA 4IMCA 2J9ZA 4Q33A 5MHBA 1I45A 3MP3A 1H7RA 4UNLA 1KM5A 3W2LA 3G8EA 1EX5A 4Y8FA 3TCEA 3C2RA 3VKJA 5FEPA 1SPQA 3ABOA 5F2GA 2ZZ4A 4JX6A 2Z0IA 1GZGA 2QAFA 1N7KA 4IJBA 1VHCA 4R7JA 2V9DA 3L0GA 5BMWA 4AVFA 1T96A 4MLRA 4RCXA 1EB3A 2DJLA 4I9AA 3T40A 1XC4A 3Q37A 2ZZ3A 3NO5A 1QPOA 3G22A 4MFEA 5I3IA 1DJQA 5HUOA 2OZ0A 3GZ3A 4UMAA 4KFNA 4HT3A 3SGUA 3O6DA 3QJAA 3R5EA 1PCWA 3EWXA 1A5AA 4Q32A 1WOBA 2EKCA 2Z6JA 3FLUA 4D2JA 2QCMA 4BR1A 2VFEA 5E0KA 4OE7A 5FF0A 3UNDA 1EA0A 3LHWA 1L6SA 4IGHA 4DEFA 2J9YA 4WD0A 5TQLA 3LCIA 2E6FA 1DL3A 3NOEA 3R2GA 2B7PA 2WO5A 4UTHA 5U4NA 5CGQA 4IWWA 2ATSA 1WXJA 4CNNA 3G1YA 4ZVJA 3B04A 3C61A 5J5RA 4LW7A 4MYXA 1XBXA 4M6PA 1MO0A 4RZ6A 1O4UA 1EP2A 1J2WA 2UV8G 4JTGA 3PBYA 1HFBA 2YZRA 5HMSA 2OT0A 3GX9A 2QKFA 3EX3A 1NAL1 5HINA 1TV7A 3M6YA 2P1FA 1W3NA 4DF0A 4LS2A 1Z42A 4QISA 3TAKA 2NZLA 4BI5A 1VYRA 3QPZA 4IQLA 3CPRA 1KM3A 1PHQA 4JR5A 1LOLA 2FPTA 1SO6A 1IXOA 2BTMA 1SO4A 3W7KA 4LU0A 3TQ0A 4UTWA 5CPMA 1FWSA 2R94A 3OBKA 4NNCA 4Z1AA 2CLIA 1PHWA 3NQ6A 1G6CA 3CEPA 4O4VA 1RQBA 2C16A 1LTDA 1DORA 3A21A 6TIMA 4O57A 3W7IA 3W73A 4U4MA 3WJZA 3BG3A 4WJEA 1RD5A 1AK5A 3DGRA 3G0SA 1TMHA 1I2OA 1NF0A 3TW7A 3HG2A 2Q8LA 3G1XA 5L9FA 4N4PA 3LXCA 4Z1DA 1U5JA 4ZQPA 3W83A 4QITA 3QYQA 1G69A 1W5PA 2EAWA 3QRHA 3L65A 4YMZA 3RNDA 5HWNA 3GYEA 3W9ZA 1FWRA 1FDZA 3IRDA 1R46A 3CTLA 4LV4A 1TPUA 5K9XA 2ISWA 4LVAA 3W7EA 1NEYA 2R91A 3M5VA 1VQTA 1YXCA 1W31A 1EP3A
chains in the Genus database with same CATH superfamily
4JN7A 2ZTJA 1XINA 1ZY9A 5CBBA 5AZ0A 4FI4A 1XBYA 4FK9A 1QUMA 3AIWA 3LGGA 3HPZA 4ZBCA 1NDVA 1SFJA 2QUVA 4P7QA 5A6BD 3WLSA 4OT7A 1H7PA 3THAA 4GE8A 2CPUA 5BXPA 4Z1BA 4EPEC 1UYQA 4UTLA 3LSBA 3WLKX 2HBVA 4JICA 4JTHA 3CS2A 3GSMA 4B91A 4FNTA 3YPIA 3ZJKA 3W1XA 3K30A 4B92A 1AQ0A 4DO4A 1OGSA 3TE9A 3PJTA 3CPGA 4GNJA 6ENLA 7XIMA 4AD1A 3VM7A 3C3NA 3C86A 1UR4A 4DI9A 3P14A 2OXNA 5D2YA 1Q6GA 3N73A 3MJMA 4LUTB 5A3HA 1GVYA 3D3FA 2E1WA 3GTNA 1RJRA 3M07A 2B7OA 3S4TA 4C6CA 3EXTA 4NJHA 3ZT5A 2P8BA 3TMLA 4ZQCA 1B2YA 1VD6A 2ZX5A 1GOKA 4H9MA 2XG9A 4W7WA 3WK3A 4J28A 4O18A 4LANA 1VRXA 5EFDA 1EUAA 4QM1A 4MB4A 3PUDA 3CUJA 4AMAA 4PUWA 3VO0A 3UETA 4ADTA 1KXHA 3S6TA 3NDYA 2VFDA 3UZXA 4HOXA 1P0BA 1KFLA 2YL9A 1PO9A 4FF5A 4MB1A 4YVXA 1R85A 1K1DA 4EWND 1GQIA 1V3MA 4GBDA 4IPPA 3OGSA 4F2BA 4N9EA 4FXRA 4UTJA 1DIDA 3WG6A 1HIZA 4GJIA 1QNSA 2EPOA 4GRSA 4D6IA 4WJ8A 4IMFA 4F8XA 3S1VA 2DH3A 4JTDA 3UJEA 3A22A 3HTWA 4EACA 3EDDA 3N4FA 1KBLA 2OWXA 1P6WA 1OWQA 3V7PA 1SJCA 3O16A 5HJYA 4XSLA 5CLTA 3LPFA 2JGQA 1TJPA 5DF0A 2GSJA 3CYVA 1KXQA 4HZ6A 2R1PA 4WKAA 3H23A 4JHZA 1X97A 1T5AA 3GY1A 4HIBA 3BLOA 1OCQA 4OHQA 1Z48A 4E2BA 3JS3A 1ONEA 2PTYA 3LCGA 2DZTA 1QK2A 1J8VA 4CCDA 1R3RA 2GVJA 5ABFA 2FTPA 2BWGA 2RDWA 1GQLA 5EB8A 3WLTA 3UQNA 1HGWA 2OKOA 2J79A 3PZQA 3NYZA 3AIQA 4NP7A 2GPTA 3SQLA 3FS2A 4I3GA 4MZYA 4DHGA 3G5EA 1M41A 3WY1A 3LX9A 2Q8ZA 3BAXA 3I7QA 1DWGM 4PBFA 3GB6A 1LL4A 3FAWA 2VEMA 1HKVA 2Z25A 3PZMA 2J7EA 2DZSA 2ESCA 2CC0A 3SY5A 3GYCA 3UXKA 1D3GA 1O1HA 2ZUNA 3VGHA 4UZUA 2WWDA 1T7LA 4HZMA 4S38A 3LCWA 4YCPA 4Y9PA 2ZZ6A 1W0MA 1SFSA 3WQCA 1F6PA 3CZLA 3OB8A 1BXBA 3W6MA 5T8GA 3VNJA 3AYSA 4CLMA 1SMDA 2DP3A 3BZJA 4AF0B 3TUUA 1JFXA 3E12A 4D6HA 4WOQA 3L9CA 4QJ4B 2ODOA 3WNOA 4DWSA 1E9YB 3H2MA 2IQ0A 4P61A 1E5JA 4RJEA 4IQJA 4ZR8A 3U2OA 1TZ7A 4HJFA 4M6VA 4WRHA 4ZOCA 1F76A 1JUKA 2FFCA 3QC0A 1S5WA 1QR7A 5TD4A 3ISIX 3MBDA 4CQDA 2WLYA 1XIMA 2H6RA 1SR9A 1JCMP 4MF4A 2F84A 4DXVA 4HU3A 3DFQA 2FFIA 3L67A 3LHZA 3VNYA 1O95A 2XH7A 1ZJIA 4LX4A 2O4MA 2NXHA 3FGCA 4ZEPA 2OO0A 5D32A 4Z1YA 5F7UA 5EL1A 4GVGA 3IJDA 3RGTA 4BCEA 1A53A 4M6UA 1UUOA 1UHVA 2YA2A 1XIHA 1UP3A 1V6XA 3GXPA 3ARVA 4GQ0A 4AHQA 3C2YA 2X1RA 4HK5A 2C6QA 4WDTA 3KTXA 1BYDA 3AWNA 5C70A 1KXVA 3GAKA 4OKDA 3W7JA 3SIMA 1MQRA 3N3TA 3NQMA 3AZTA 1I8JA 3GC4A 4FEZA 3OLIA 4JHOA 3BG9A 3LTPA 1EJ7L 1MVYA 2D73A 4B5XA 3ZOAA 1XFCA 3VNLA 2OO6A 3WMBA 1N8FA 5FD0A 5HWJA 5FCZA 3VNIA 5A8NA 3W22A 3K13A 3MUAA 5GJMA 4DWSC 1D7KA 3UZ5A 2B7QA 3DZ1A 4MIMA 5TBOA 2GQ9A 5D2WA 3E6EA 3AHXA 4Q4SA 2Q3RA 5K4ZA 2B7NA 3NL2A 3EBVA 1MRQA 3AC0A 4HSHA 1W1YA 3C2OA 3NQ8A 2GQ8A 4CGTA 3BJTA 1WPCA 5FESA 1I9CB 4S23A 4AYSA 1YTEA 1LWIA 1YHTA 4KEZA 1XIBA 2Q01A 4A3UA 3VILA 3AXHA 1BEUA 4U5KA 4DJDD 1O5KA 2JGYA 1KR1A 4R9XA 4JQ2A 3VZXA 3GWQA 1FHDA 3EEZA 2Z24A 1FH9A 3WFAA 1H62A 4ORMA 1AQFA 4LYRA 1MZHA 1BVWA 1R6WA 1EC8A 4NVTA 2VWSA 3AJ7A 5CBIA 1JXJA 3BGGA 1DQUA 1HN1A 5G1YA 2V81A 3CEUA 4B3ZA 4XQ6A 1KCZA 4A3YA 1JL8A 3RPDA 5DN1A 5I09A 1IQ8A 2V3EA 2OYLA 2D0GA 5BNKA 2OTDA 2WSQA 2GGJA 3NZ1A 3QZ6A 4XBJA 2JF6A 5DLCA 3H6OA 1XYZA 1PAMA 1X8FA 2DT2A 2CESA 2OOGA 4V27A 1MDRA 2D24A 3CZ8A 4L4PA 1GORA 2PURA 3OZYA 3LBCA 3L68A 3FYYA 4GG9A 1VYPX 2QZRA 3TVAA 3E5BA 2O0TA 1R87A 4XAYA 3TR2A 3VVGA 3HPSA 4RNIA 4DZIA 3RCMA 2PF8A 1GWJA 2ANUA 1Y0EA 4GUJA 1VFSA 1JDCA 1TTPA 3U4FA 3PFMA 1VBGA 3WF0A 1LT7A 3PZUA 3KL5A 5I3JA 4Q7BA 3TEVA 1E72M 3LHUA 4J3SA 2GK1B 3GVVA 1RR2A 5EGRA 5C2XA 4J3WA 3DFYA 5C2GA 1GOMA 3ZM8A 3GIPA 2CWXA 4CN1A 2D3LA 4Y8EA 3A64A 1J12A 4AZ7A 1XLEA 3W2JA 4GFSA 3R8RA 1CGWA 2X05A 1JQVA 2J4GA 1HT6A 4RNJA 4A29A 3SCUA 3R43A 4I5UA 1NDWA 1QI0A 1K70A 4UNIA 2WANA 4RLIA 2NQJA 3BL3A 3CZEA 1U33A 1IXNA 3H8AA 3W1LA 2Y89A 4H4IA 1E3ZA 4GO9A 1YE4A 1JCLA 3UXIA 2DQXA 2GGHA 4KH2A 3WELA 3MI3A 1YDVA 3UWYA 1A3WA 4EXQA 3BV4A 1Q8JA 5CXPA 5D9OA 1KTCA 2C7FA 5ABHA 3KCLA 2PD5A 2YL5A 3KWXA 3LTSA 4JTAA 3C2FA 3UXDA 9XIAA 5J04A 3S5YA 1LQ0A 2VOMA 3WQFA 2Y70A 1FKWA 2NT0A 3HIJA 1QCWA 4OOUA 1WB0A 3RU8X 4IMDA 4XBSA 1ZBKA 2HK0A 1AMKA 1REQA 2HROA 1W5NA 3M5YA 3EA3A 4NX5A 1DIEA 3KXQA 4GUIA 4BFAA 5LIXX 3ITGA 4WY0F 4ZE4A 3WBAA 4HNTA 2QCGA 2HNEA 4PCTA 4U3CA 1HO4A 2RFGA 4E8DA 4NZFA 1DIKA 1EHAA 3KBSA 3EPOA 4KESA 4WY0B 3SO7A 3W84A 1SQ7A 4UCGA 3WUFA 3G77A 4JY9A 3NCOA 4UTKA 1CGVA 4GI9A 3L4TA 1SR0A 9RUBA 1GQNA 1CGUA 4AHPA 2XIBA 1HW6A 3TQPA 2R1LA 4HHMA 3T8QA 2AMGA 3KP1A 2DT3A 4A8LA 4B9YA 4DO7A 5AKQA 2OODA 2WZHA 3HG5A 2RJHA 1U22A 4OUEA 3VA8A 1H7XA 2H8XA 4B9ZA 1TB3A 3H2FA 1KRCC 4KGLA 3TFXA 2NV2A 4E2VA 4LVGA 1QNRA 1BRLA 1R7AA 3WUGA 4JIRA 3GVGA 3TLLA 4JIQA 1E6SM 1YADA 3M44A 4BWLC 1ZS2A 3QLLA 4FZIA 1YDNA 1Y8BA 1FWWA 4MKSA 4Y96A 4IQEA 2Y4SA 1E5NA 4UFKA 4LCSA 2XJ7A 3W1UA 1WDSA 2Q3OA 5REQA 3MVTA 2ONEA 4EKJA 4GQBA 1D3CA 3AYVA 3PWIA 1CB2A 1PTGA 1ZAHA 3V75A 4MAVA 3QR1A 5A6JA 1EYWA 4XV0A 3U2EA 3MYOA 3H22A 2PDXA 3TJ4A 2G3FA 4X63A 3NZRA 4YYCA 1VPQA 5HPCA 1W1IE 2E9LA 1X39A 2PTDA 4S3KA 3SCQA 3XIMA 2J74A 2V2DA 4YWSA 7A3HA 3L5MA 4OQVA 3LPOA 3IIPA 3M0IA 2PPGA 2YSWA 2WC4A 3SM0A 2H9AB 3IIZA 3P82A 4TOQA 1VIWA 4PEEA 3A3XA 4F48A 5BWFA 3ARRA 3HGRA 4B5VA 1QNPA 5JMUA 1PKNA 2O9PA 2NQ5A 4DNHA 3HGOA 1AD1A 3NL5A 3TOYA 1A3XA 2ZA2A 1RH9A 2EO7A 4C5ZA 3APTA 2OCZA 1HVQA 1S5NA 5CBJA 1WAUA 3UBPC 1TFVA 4H3DA 4XAGA 2JBMA 3B06A 3MDUA 4LH8A 1F3XA 2SFPA 3F4CA 4HPJA 3TNOA 3TW9A 1TPC1 3HF3A 1ZHAA 5AHNA 1LZOA 3PUGA 1H50A 3AZRA 3CV2A 3HV8A 1QNQA 3E0FA 3OODA 3GNXA 4UQEA 2VO5A 3G1DA 4FX6M 2EG8A 2W91A 4DO6A 5DMLA 4FO4A 3B8WA 2O7QA 4YIWA 1JVNA 3IEBA 1J5TA 2AGKA 1QO5A 3NPUA 3QGKC 3TTQA 1JG9A 3U48A 1Q6QA 2HVMA 2Y8KA 5BCAA 3XINA 2DUXA 1UR9A 3I7RA 2TYSA 3O05A 5TAOA 2P3EA 3GQYA 3WBWA 1FUYA 2D2OA 1S2VA 5KINA 3K8MA 2FKPA 1F7BA 1DJIA 4O28A 2YBUA 3S5OA 3UA3A 3M0HA 1SVDA 3PZTA 5DEZA 2D2GA 1Q6EA 4CKQA 4GX9A 2GLKA 2FYMA 4HU8A 4YS1A 1S1RA 5EBUA 4BEQA 1PIGA 2RDUA 1GT8A 3VUPA 2BGNE 1GQKA 2J88A 2YCIX 5DY2A 2BLEA 3ZWTA 4DZ5A 3QW4B 2DVUA 5FF2A 2GGGA 2VC9A 4BF5A 3FJLA 4IISA 2DUZA 4S3CA 3I3BA 2GJNA 4PTNA 4US5D 1LWHA 3FV9A 4B3LA 4G7EB 1M3UA 4LALA 3UZWA 1MQPA 4AD4A 1UR2A 3AIRA 1ADSA 1M7PA 1GNXA 2Z7GA 4PA8A 3CHCA 3SR7A 5CJNA 5EMJA 4L9XA 3RO6A 2WKGA 3E2VA 3NQGA 3BXWA 1I6NA 5LYRA 3A13A 3PBUA 1ZP4A 4JEQA 4NZ3A 4PZVA 3VPLA 4PMVA 5CPSA 3RX3A 4KERA 5DMMA 4TIMA 4HA4A 4NJGA 4NSBA 2GVLA 4XB3A 1G7UA 3G1FA 3LBOA 2WQDA 3NQBA 3URBA 1OCJA 1D2KA 3UPWA 4AIUA 4AFYA 2QV4A 3N9KA 1GVQA 1XDLA 4JD4A 4PMOA 1C7TA 5LIUX 2VUNA 4EIVA 5D2XA 5A6KA 5AOUA 5GJNA 1GZ1A 4WSJA 3MHUA 5I02A 1UH3A 1J2BA 2CW6A 1AJ0A 2QLYA 4ZOEA 1UMLA 4JTCA 4IP7A 5H8UA 4W8BA 3AYTA 3Q94A 2YPIA 1FXQA 1XSKA 4NASA 3S1GA 1TJ1A 2I16A 1ME7A 2C13A 4REQB 2OX1A 1OFQA 3WH9A 3W7QA 3ANVA 1D7FA 2VTFA 3WBXA 4BI6A 3AICA 1X98A 4GMEA 4F0SA 1EO7A 1EDQA 1TVNA 1GVRA 3DOPA 3FGCB 4N42A 4HOWA 3PK7A 1IXQA 1NDYA 1CGYA 4H41A 2LLEA 2EKGA 4GI6A 5A8MA 2FB3A 4A2SA 3E38A 3RPMA 3DYMA 2D2HA 2BHZA 3G0UA 2VEIA 3KCOA 3IGUA 3W85A 1XUZA 2PZNA 2VEFA 3P5YA 4XBKA 3N13A 3W1RA 4FS9A 2NV1A 1W2VA 1EJVC 4YVPA 4R34A 4MFDA 3USBA 4GPNA 3FA5A 1KA9F 3PB0A 3RFAA 1PKMA 3GDMA 4E5TA 2NWSA 4V28A 4O1DA 3USZA 3QGVA 2VENA 3SW6A 2ZVRA 1HTIA 3UVIA 4GJJA 1HG3A 4DJFD 3LA4A 3EPNA 5TF0A 1GEQA 1PIIA 2AGTA 2CWNA 1H4PA 4HVXA 1F2JA 2QCDA 2ADAA 5BRPA 4INFA 2E9MA 1R38A 1XDJA 3W86A 1DJNA 1JULA 4XO6A 3EX6A 2PDFA 1BG9A 2HVNA 2FZ8A 7ENLA 4XSMA 3KRUA 1UROA 1K9FA 1LL6A 4NQ1A 4HHLA 2QT3A 5AYBA 1K9DA 3L5AA 3EEGA 3NEHA 1N8IA 4AH7A 1QMLA 3P0WA 3H2OA 4WDWA 1Z7AA 1JPDX 3ICJA 4XZNX 4O15A 4PUDA 4CU7A 3BOXA 3KHJA 1OK6A 1BYAA 3LTYA 3K8KA 3SUWA 3TJXA 4KF1A 1B3XA 3RYSA 1RCXB 2VFGA 2EJAA 5ECVA 1NELA 1G4SA 5HJXA 4YTUA 3T0DA 3WNMA 1K4HA 3IUHA 3UCDA 4JBRA 2QQ6A 1C91A 4YPJA 4NG3A 1GYNA 2J8FA 4MZ8A 3VX1A 1WOAA 1ME8A 5F4SA 3M6DA 3QSTA 4W8AA 4P5UA 4L61A 4IF2A 2P88A 2YYTA 1N2VA 4GI8A 3GIYA 3GK0A 3GFZA 4PN2A 3WNPA 1V6TA 1F5ZA 1GOXA 3FEQA 2OVLA 4DZAA 2QMKA 2H90A 2QUUA 4KCWA 1XLHA 5I03A 4Q8WA 1GHRA 2FJKA 3GDTA 1RSCA 3BSMA 1BPLB 4ALDA 5SWUA 1RQHA 4P7OA 1K8ZA 3ALGA 1B57A 3W1PA 4UOQA 4JN8A 3BJFA 1E4NA 4UOZA 2WHJA 2J7FA 4W7VA 3E9AA 4N6FA 3VD7A 3KVKA 1JYWA 4GIRA 2Y62A 3EMQA 5HQLA 3W25A 3QFWA 2OSXA 4RZ4A 3E2QA 2BV9A 3VNKA 1D8CA 4QS6A 1AJ2A 1ICQA 4JNYA 3NQDA 1XH1A 4O19A 4ZO7A 4V2XA 1E71M 2Y61A 2YFNA 3ELFA 1GJWA 3SRDA 4IP4A 2GZXA 3LMYA 1R3VA 3N2XA 3DYPA 3WH5A 6XIAA 3KVMA 4IIGA 2W79A 3BAIA 2WSRA 4J3UA 3W4RA 3WQDA 5LGZA 3ABXA 3U3HA 1DIOA 1XICA 3B4YA 3NZGA 2YA1A 1CX9A 4H2HA 3P0XA 3FKRA 3M46A 5DQPA 3ITVA 3RMEA 4M51A 5AY7A 3GXMA 2ZZ1A 2UBPC 4ZXLA 3LRKA 1R2RA 3W7HA 4AU0A 2PLJA 5JUVA 4KETA 4M82A 2BBFA 1GYLA 1NVMA 3QZEA 2PDCA 2X8RA 2JKPA 2PD9A 3NTYA 4GD0A 2O9RA 3S6OA 2GJXA 1J11A 2E5BA 3AYRA 1JZ2A 1QO2A 2XTKA 1Q6RA 1JUEA 3M5XA 1ESWA 3TTSA 5DT5A 1FWAC 7REQB 5BOOA 1AA1B 1TPB1 3F4NA 5LHFA 3TMQA 3EKZA 3UPBA 1QATA 1Q45A 3QV6A 2UY2A 4WVXA 4GNVA 3DESA 3FA3A 4JNMA 5LNUA 2YYUA 5K3VA 1VENA 1PS9A 3WLNA 1XXXA 1R2SA 3A4JA 5A6LA 2WMJA 1OJXA 4UQCA 4AZCA 3TKFA 3ZJ7A 1A4MA 3V1PA 3ES7A 3RM8A 2BX7A 4IXXA 4IT1A 3SJNA 2QS8A 1WXZA 4WOZA 4PTVA 5D8WA 3D47A 3O07A 3FAXA 1UP2A 3M0ZA 3A3WA 2F61A 4HHPA 3EXRA 4RX0A 2GVEA 4C6NA 3QR3A 1QT1A 4I5XA 3FA4A 1QW8A 2D20A 3N4AA 1TTQA 4HYVA 2NXIA 2QCEA 3LHVA 3STGA 3WNNA 4UFHA 2PC4A 3G1HA 2PCQA 4JYEA 4EPDC 5I0DA 4AXKA 2HRWA 3D46A 4S3GA 2CLMA 2DW6A 4IUGA 3W0KA 3MCOA 4GOAA 1OG6A 2V67A 3OW1A 3AAMA 3MA8A 3M1ZA 5I3DA 4QGCA 4LNCA 8XIMA 2XSBA 4CVUA 5GJPA 5HQMA 3A5VA 3M64A 2P10A 3CGTA 4AIBA 4IJCA 5C7VA 1CLXA 1YE6A 2WSKA 2NVDA 3O9NA 4MY1A 1XIEA 3UWEA 1B9BA 2QDHA 4GVIA 4CD5A 3MSGA 3IGXA 3VU2A 2GWNA 3RU6A 5XIMA 3C5QA 4HTBA 5G1MA 1AFSA 1I2QA 2ASHA 1XI3A 1AZ2A 3HB9A 3N18A 3DDMA 4ECLA 3ATZA 3AS0A 3W2KA 4FNUA 2HWGA 3MW7A 1UKTA 3O15A 1VCFA 3MANA 4AY7A 4L5ZA 5M1TA 2VC5A 1OVDA 3RUBL 4PTWA 4UR9A 1XX1A 3CO8A 3CHFA 3TYAA 3SFWA 3E0IA 4Z2JA 2Y5JA 2DT0A 3IGSA 1TPWA 1RLDA 2C1IA 4LAMA 2CITA 4V15A 2J9ZA 5T91A 3T0TA 3TOPA 1DTUA 6REQB 1IEIA 3HA1A 3U2ZA 1KM5A 4PCNA 4Y8FA 1X1NA 1VJSA 1KR0A 4QQUA 3VK5A 4ZXOA 3VKJA 1JNEA 1TR9A 2OZ8A 3R10A 3ABOA 4WR3A 2ZZ4A 4JX6A 5LIYX 4JFTA 2AQVA 2QAFA 3WL1A 4RDWA 1J0ZA 3S9ZA 4JFVA 1T96A 3MSDA 4AZBA 4MLRA 3VCNA 4GC3A 1E4IA 1EB3A 4I9AA 4XD6A 1HX0A 4U5IA 1CTNA 3AXIA 4IFRA 3VMOA 1EXBA 3Q37A 2QUMA 1DWHM 3UZYA 2ZZ3A 1QI5A 1NQKA 1QPOA 3G22A 4JNZA 1BFNA 4MFEA 1DJQA 4AVNA 3R5EA 3ZSTA 1C92A 2Z6JA 3FLUA 3EZ4A 3HFTA 5E0KA 1ZUAX 5FF0A 1FP8A 2ZADA 4O0QA 4L6OA 1CEOA 3QV8A 3B0XA 5FAGA 1DJHA 3UR8A 4PUEA 1PTAA 1OIMA 4UTHA 1TUXA 2I57A 5CGQA 3GH5A 4AYGA 4NKCA 4ZTYA 4MYXA 3EOEA 4M6PA 2UV8G 1HFBA 4NZCA 2W92A 5HMSA 5A6AA 4JIEA 1AZ1A 5HINA 1TV7A 1UC4A 3GRIA 1MMFA 5CAKA 3PJXA 1E6RA 3QPZA 4X0NA 4P8VA 3SURA 1SFTA 3WLOA 1PHQA 2TODA 3SY1A 2D23A 2CXGA 2FPTA 4MWAB 2VCBA 3W7KA 1WKFA 4AD3A 3CZJA 3OGRA 4CN6A 4UTWA 4EPBC 1GK8A 3OBKA 1JZ7A 2CLIA 1PHWA 1G6CA 4V1YA 3CEPA 3GXIA 4OZOA 1LTDA 1RBAA 4MWAD 1XLGA 4KCUA 3W73A 3WJZA 2F8QA 7REQA 4HPGA 1RD5A 3G0SA 5GNXA 2XU2A 1NF0A 1U5JA 4IGNA 1J6PA 4QITA 1W5PA 1XIGA 3L65A 2YJQA 5KETA 3RNDA 1P43A 1J9YA 3VDHA 3IRDA 1R46A 2ISWA 4G2DA 1KFWA 1VQTA 4JL1A 3WFZA 1EP3A 2V5JA 5IDIA 1QOPA 5HPOA 3KX6A 2F6XA 4JCMA 1FWFC 1QPRA 3SFKA 1HUVA 3N29A 1UIPA 5AFDA 3WKZA 1LRTA 4LBSA 4TX6A 4C6BA 3EKGA 4IJRA 4HN8A 3GS6A 2ZX6A 5LXXA 3FX4A 2J66A 2X7WA 3CB8A 2FGBA 3CBWA 1MDLA 3GLCA 1SZEA 1SMAA 1JRCA 1XJBA 4A3QA 2VFIA 2BODX 4H9TA 1KB3A 3BURA 2WWCA 4Q8MA 4DAIA 4MNKA 4DBUA 4KPLA 3H2AA 3WD4A 4ENLA 1C8QA 4J1OA 5I23A 3ZT7A 4J27A 1OEPA 3B0PA 4Z42C 4K68A 3LOTA 2BVDA 3GNNA 5K9DA 2B81A 1G0CA 1GG0A 1R3YA 3BJSA 4IIFA 5CPLA 4C7DA 4KT2A 2X0SA 3ABSA 4WXYA 2WVSA 2XIIA 3HJZA 4WCJA 1FHVA 3QQ1A 3H12A 2WM0A 3W7GA 5CEWA 3DFPA 4JHMA 2POZA 4DUOA 1VC4A 2CERA 1EOKA 3IRSA 1QU4A 3UERA 1PTDA 3O1NA 2REQB 3PZNA 3MP5A 2FPYA 1BGGA 3CU2A 1ISVA 5CJ5A 3LXAA 1E40A 3HJEA 2ZDSA 3QFEA 1XBZA 1ZCCA 1TQXA 3C0JA 4F0LA 2E9BA 3QM3A 2XZ7A 4X61A 1LDCA 5DBUA 3S6DA 1EJWC 3VIIA 4M1BA 5HNTA 1JYXA 2Y8VA 4O1CA 3GTXA 4CNTA 3W87A 3RXZA 2AKMA 1XYBA 1O1ZA 3SN0A 1WUEA 4AD2A 4DN1A 3K1GA 3O6YX 1GYMA 3UJ2A 5I24A 5LIWX 1KCXA 4GH1A 1F4AA 3IVSA 4DB7A 4JQ4A 3O2LA 1B5TA 3W2MA 3ZFHA 3GR4A 1YNQA 4FR6A 3L4WA 3OA3A 2XSXA 4NNAA 1CXEA 5E5CA 3ITOA 1QHOA 1YBQB 2FVLA 3W7LA 1XRSA 3SN4A 2X0YA 5EKYA 4F0RA 8TIMA 1J0JA 2PU0A 4QE1A 4ZMGA 4GABA 1WDQA 2PP3A 3VIPA 4FLSA 3W6YA 4RDZA 2O92A 1J0IA 4DBWA 3UESA 1S5TA 3ZVHA 4X3ZA 3VZYA 5DO8A 4JQAA 1X38A 3NO1A 4PRTA 1YPFA 2OFJA 1VFHA 3B03A 3A23A 1ENUA 2ZE0A 3AIUA 4A2RA 2HK1A 4CCZA 1DWAM 4UTTC 1Z41A 4JKKA 3VI2A 4GX8A 4DBSA 4DBDA 1JNDA 4AWSA 2QCHA 3OJGA 3KOWA 1R30A 2PDBA 2VOTA 1E6PA 2V2CA 1TJ0A 1YNYA 4MWAE 5LZLA 2CU0A 4RDYA 1KBIA 3KFTA 4MB3A 3W76A 1KRBC 1DWIM 4LB3A 2I1OA 2PTXA 5LXEA 3FXYA 1XKYA 1PE1A 5T9CE 3WLJA 4QP0A 5AYYA 1TE6A 2ZZ5A 1PWLA 2BY0A 2ZTKA 4NXKA 3O8AA 3E5PA 5XIAA 3EOOA 3QYSA 5F2IA 1R2TA 1BTMA 2OLHA 1JUBA 3VGEA 2VGIA 3P7YA 4WK9A 2ZXBA 4ZTXA 3NO3A 1R3TA 3N9RA 3L12A 1YRRA 1FWGC 5AC5A 4M8UA 3JZUA 3L4ZA 3OBEA 2J27A 1ISXA 1Q13A 3BMWA 4O8AA 4DLMA 1FTXA 2GL5A 3GDBA 2V5LA 1UWSA 3AOFA 1XKJA 2ZXAA 4M6QA 2IPJA 4E0CA 2XVNA 3CWHA 2WMGA 5G4EA 5HR6A 1QFEA 4Q6JA 2PWUA 3ZWSA 4YLWA 3NA8A 2WHLA 4L6DA 3ALFA 1NF7A 2DEPA 1HZYA 4HA3A 1W9UA 1HJSA 2V5KA 4LVBA 2OMAA 5ABFB 5JIPA 4HN4A 5EMKA 4MPQA 4W5ZA 3R13A 3TWAA 3STFA 1A5CA 3CT2A 5I78A 3WL0A 3BLIA 3P93A 5H8MA 4DJEC 3CYJA 5JH1A 3K1DA 4DJFC 4EX4A 1DYSA 1J0HA 3CQIA 4PCSA 1EGVA 4GKLA 3WBEA 1KM6A 3CTTA 4ICMA 4Y2WA 5D38A 2ALRA 3AXKA 3L4UA 5B7ZA 4PL2A 1WUFA 1M6JA 3QHOA 4O13A 1C8VA 1ZFJA 2EPHA 4DLFA 1HJVA 4M5PA 1I0DA 4F0KA 5LHEA 3IK2A 3LB0A 1LLZA 1OF8A 4JYFA 1VH7A 1UB3A 2I5GA 4KBXA 4PUMA 1JEZA 4G7EA 3CH0A 2ISSA 1IGSA 4ZO9A 3C3UA 2ZCGA 4W85A 5FA5A 2CZVA 3CLWA 1UH4A 2E67A 3LBMA 1XHGA 1E0VA 4C1NB 1UP0A 1OIFA 2CLFA 2NX9A 5IBXC 4WKHA 4BY3A 2O4QA 2ZA3A 5HWMA 4MJZA 1EC9A 1W9PA 1W32A 4H8NA 4UIOA 4NZJA 1FDJA 2J6XA 2HXTA 3IVUA 1OYCA 2INZA 4O1EA 4O53A 2XHYA 3V0TA 2I56A 5AC6A 9XIMA 4GCXA 3F2DA 1DQXA 4XD3A 2P0IA 4Q8PA 1KTNA 4J9JA 5JQ9A 1FCUA 2C71A 3ZLFA 3OIXA 4KWSA 1BG4A 3VD4A 2W63A 2PLKA 4CQCA 1R3QA 4H9XA 3VD9A 2RGMA 4WX2A 4FAMA 3B8UA 2PDQA 5C7HA 1J0KA 1QWKA 5MKGB 4C6OA 1XQLA 1Q4WA 4MWAA 3N25A 2PBOA 1UJPA 1UQZA 2PDHA 1ZLPA 2YOCA 1JZ3A 1V03A 1Q66A 4JDYA 3KOZA 4IH3A 1XGDA 4DQWA 1JI2A 1HL2A 1EKOA 3T42A 4JY8A 3SQSA 1KFEA 2IXUA 3AU2A 4Q4MA 2YXGA 3B9EA 1F73A 4BQ5A 1K6WA 3LLFA 4KMQA 4RNHA 1UMYA 1FWCC 1H49A 1YXYA 3FOKA 2PODA 3VAVA 4QTGA 4CEUC 4UFMA 2XVGA 1WBHA 4LTSA 2VFFA 1W1VA 4FB7A 3CXOA 1E4LA 5HR7A 2G3MA 1UR0A 1B3VA 1GKPA 3PZGA 1EWEA 2ISFA 2QVNA 3QKZA 1DJGA 2RHGA 2BFGA 3BANA 3OZPA 2DZVA 1XD1A 3QY7A 3LPPA 2TPSA 3CL6A 1XLFA 3V0UA 1JR1A 1JIBA 2AAAA 1B3OA 3VIOA 3S9YA 3UFYA 4LFYA 1IR1A 3VGBA 1TA3B 4OV4A 4HZ8A 3BW2A 3DBPA 2XIMA 2HMCA 4AZ5A 4ZZ9A 1VPXA 3FDGA 3PG9A 1G4PA 2VUYA 6REQA 3NWRA 2HV5A 3P8JA 2YR1A 3UR2A 4I9MA 5E70A 3R0UA 4ERAA 1UZ4A 3PZIA 3AUOA 2VQTA 1YX1A 2CZEA 3ANYA 3RJXA 1B90A 1UASA 1VEMA 3PHAA 3WQ5A 2NWRA 4O17A 4GQQA 4LV9A 1AG1O 1TX0A 1DQWA 3UWWA 3PVFA 3UCCA 2X2YA 1KGXA 3KTSA 2VZUA 2GVGA 3AO0A 3WK0A 3AISA 1LL7A 3TC6A 4Q3MA 1OABA 2G95A 4D1JA 3C4UA 3DAQA 4FXFA 3KBMA 4RL3A 3MCMA 4H1ZA 4EF8A 7CGTA 1VJIA 3GBDA 1JD9A 1W1B1 1LBLA 4AC1X 3AS3A 1TPDA 1KCKA 3W1NA 4PTDA 3F2CA 4HZ7A 3ITTA 4Q4OA 3DC8A 3DIPA 5EA9A 1LM1A 5K9CA 1FWJC 4X22A 5AZ1A 4LAOA 3DH7A 3KOYA 4ES4A 3PTDA 3FNDA 3VE9A 3TYZA 4DJDC 3PZOA 3GXTA 1IWAA 1TVLA 4OECA 4K1GA 3KE0A 3VOHA 3REQB 5HMEA 4RXFA 2CHNA 1YYAA 4RW5A 3NVDA 5BWAA 1M65A 1RALA 4DYJA 2QPUA 3MYPA 2Z1BA 2HISA 3W28A 3M41A 2HTMA 2XM2A 3SDOA 3QTPA 4P7LA 1IZJA 3CWOX 1M7OA 1L6GA 3SCNA 2PI6A 9CGTA 2NT1A 1PSCA 1Q8AA 2FZNA 3PUOA 1R86A 2DIEA 3ARPA 4YHEA 4R7WA 3TQVA 2GVYA 1SW0A 3W23A 2R24A 1EP1A 4RV3A 1OYBA 2QJNA 2VEPA 3IANA 3KOXA 2BDQA 4US5A 1BQGA 3V18A 3PUEA 4R27A 3ZIZA 4N02A 2O56A 4TR9A 2VJXA 3GAYA 1SO3A 3B9DA 5DY3A 2PLCA 1GVEA 1SSGA 1XIDA 3T4CA 3F1QA 5I00A 3Q4DA 3AIBA 1V0LA 3NDZA 1XFBA 2W62A 4M19A 1LF1A 2H3BA 4HHHA 3IARA 1O5XA 1U2YA 2WVUA 4LY4A 1XG4A 4H9UA 3NAVA 1WQ5A 3AMCA 3A3HA 1SSDA 2C3ZA 4FMVA 1XBVA 1ZL1A 1MW0A 1R3SA 5DCBA 2DZWA 2PDIA 4BK9A 5CJMA 1XYCA 5HBFA 2IQTA 4WDXA 4HMCA 4GIEA 1M9HA 2A6NA 5LNRA 1CXFA 2Z1XA 3ZSSA 5C5YA 3T7VA 3HO8A 3TSBA 4QCFA 2L5HA 4UXDA 2W9MA 4NT0A 2CZ5A 1C93A 1RHCA 3NPVA 1TZ9A 1PWMA 4LRSA 2GUBA 4QLJA 2Z2AA 3TFCA 7PTDA 2VKZG 4W86A 2WMHA 3W53A 4RPQA 5AYZA 3RIKA 4S2CA 3RLUA 1GCYA 1PKYA 4IUOA 1AJZA 3THUA 4LYQA 2OYMA 4KW2A 4KRTA 4B15A 4QG9A 1Q4NX 3I7SA 1FP9A 3OQ8A 1MFVA 5FF4A 3RO8A 4W8LA 4AIEA 2VEKA 4F0MA 4NJKA 4JTKA 3F4VA 4DYKA 1K6AA 2VZOA 5XINA 2VX4A 3H7VA 3NEVA 4LNYA 1T8XA 2J9XA 1OX4B 1VR6A 3E96A 4LB4A 2ZX9A 3NM1A 2HEJA 3MWCA 3R8GA 5M03A 1O7AA 3VDBA 1OM0A 4K36A 3BGAA 1RP8A 3JRKA 1KBKA 4E2DA 2YFOA 5LGXA 5HJLA 3BAKA 5AHLA 2PWFA 4IFKA 2WSPA 3CQHA 3QVQA 1J6OA 2QCNA 2CLOA 3FJNA 1UD3A 4D8LA 4Z0JA 3I3EA 4G9PA 1ML1A 4ZQMA 2AQWA 4DXXA 5DMNA 1ZZMA 4GIYA 1L8NA 5CPOA 3KAOA 4O50A 4JTEA 4NJJA 3ZO9A 1Q7MA 3V35A 5FJPA 4AG0A 3BLPX 5D04C 3D0CA 1AH4A 3VYLA 2CNCA 1HP5A 4IZGA 3LPGA 3STEA 1KLZA 2XN2A 3NGFA 3W88A 3WH8A 4L4MA 1VCVA 3AROA 4RE2A 3MP4A 1TIWA 1Z44A 2WLZA 2A4AA 5LKYA 4AISA 1P7TA 5A6BA 2QCCA 3WD1A 4TTGA 1KKRA 1JF5A 4L64A 1IXPA 2VGBA 3H4XA 3LHTA 4J5NA 3FCPA 2JF7A 5AVNA 2XVLA 4N2YA 1HL9A 3LEPA 2XISA 2DV0A 4MSSA 3NYDA 5CG0A 3K2GA 5E9XA 4O11A 1JZ5A 3M4HA 5D2VA 2NUXA 2PU1A 2GGIA 3T07A 1GVFA 2G37A 3TA6A 4XZIA 1VB9A 1ISYA 3LENA 3B0UX 3KUMA 3UYCA 2PGFA 5D9MA 2UY4A 3LGEA 1O5RA 1WX0A 1QOQA 3IIXA 3TU9A 2F6UA 1OFRA 2NSXA 5U7SA 4YTRA 5FL0A 3VE7A 4CD8A 3VOCA 4W87A 3ZMRA 3CUFA 1XV8A 2E6YA 3EAUA 1R3WA 2FDSA 3DN5A 1M53A 1IZKA 1JXKA 2G50A 1U5HA 2GQ3A 4MNJA 3PN8A 3ABQA 2ZRZA 3ARZA 4HPXA 3EWZA 4LEQA 5DANA 1WKYA 5IBXA 4C6IA 1V8EA 4M1RA 1IIHA 3NSMA 1BKHA 3RR4A 3OLGA 1A5UA 3WQ8A 2YDRA 2Y7DA 1GJPA 4HSNA 4DZHA 3H26A 4OJYA 4HCLA 2CIPA 2YCEA 4QBXA 3HMCA 1RP9A 3K4WA 5HAOA 2E1DA 3OGVA 4QJ3B 2BHUA 4N6EA 4UQ9A 2VZTA 4U28A 1QHZA 4L1GA 4TX9A 5C8BB 3IJ9A 1TV4A 3UJSA 4X2PA 1FFRA 3WO8A 3AJXA 2ZICA 4XD5A 2VVSA 4PE8A 3UG3A 3GKFA 4F9DA 3U57A 3PTQA 3AXMA 1HGYA 3VKCA 4A05A 3JU2A 2HBXA 1BTCA 1VS1A 3WLMA 3RMJA 3CUIA 5FSDC 4O54A 1MYRA 3U4AA 1CNVA 3V4BA 3BW3A 3C6CA 3GVQA 3KS6A 8CGTA 1FH7A 2C0AA 3M0LA 3TR9A 3KZSA 3OZMA 3UWZA 1VYSX 3KZPA 3QZAA 1E9ZB 2WJZA 1RVKA 1UWQA 2FB2A 2WVVB 3GG0A 4QE5A 4ACYA 1NFGA 4BKNA 5M2FX 1J18A 3FFSA 3W3OA 1OD0A 2OYKA 2PE4A 3VABA 2EPKX 4GNKB 4ZO6A 2VYOA 1KBJA 4WIWA 3SGGA 1M7JA 4LGXA 3BK0A 1W9XA 3VFCA 4HGXA 3EXSA 4J3ZA 3CAQA 4P8XA 1TE1A 2O9TA 4PMYA 3H53A 2BXZA 3IWPA 4Y90A 4G6CA 5CPQA 4C6JA 3ONCA 3UY7A 5H2ZA 1EOMA 1IEXA 1UR1A 5H8PA 5DRIA 1CT5A 1XLAA 1PYMA 2E4TA 1B9ZA 3B40A 3T2QA 1VHNA 1BRLB 4RV8A 4LEFA 1JFHA 3ARWA 2X41A 2FLIA 1FRBA 3RG6A 1E1CB 1OFPA 3GTIA 4UTMA 1XW8A 1SGJA 3AI0A 4NZ4A 3VKAA 1H7OA 2ZOXA 1YPIA 5FAJA 2VGFA 3DFTA 5KSWA 5FEZA 4FR1A 3KS5A 3L4XA 2VDGA 3ZQ9A 2J8TA 3MQTA 3CHVA 4M7SA 2C19A 1G94A 4BF9A 1E0WA 4OUIA 3VOIA 2WK2A 4CD7A 1UWTA 1OFDA 3NQ2A 1T6MA 3A4WA 2WW5A 1BSIA 2CBJA 2WYSA 2V5CA 2WPBA 4GUGA 1XYMA 3BH4A 3VKKA 3NZPA 1C3FA 2ZXQA 1EUNA 5FEWA 1XLJA 2VR5A 5FJJA 1XP3A 4A8RA 1L8PA 2HNHA 2ZZ2A 4WLCA 2WZMA 4C6LA 4C60A 1RCQA 2IMRA 3LXBA 2PDWA 4O8RA 3OU8A 3OYZA 1I2NA 4CCEA 2A7RA 2YXOA 2QXWA 2GJRA 2JKEA 1TCMA 2ZBTA 1Z89A 4O52A 3WZ0E 1QBBA 3PFRA 5E1QA 2XWEA 5CGTA 3UGVA 2PDMA 5DELA 3TN6A 4IFOA 2PBGA 1K7EA 1S46A 3IIOA 1C7SA 3H2NA 3TV8A 3ITCA 5IHRA 2FH6A 1US3A 2VQUA 1IV8A 2EJ1A 2OWCA 3EA1A 3QXBA 1R5YA 4QIUA 2WCGA 5IOBA 3FIGA 3VNDA 4JKMA 3LHYA 4Z0SA 4ZE5A 2CBUA 3G1SA 2Y24A 5E9AA 4ZB5A 1RA0A 4ZQOA 5BU9A 3JUGA 1G7VA 3QBUA 3W2UA 4HNVA 1W9VA 5C6MA 1JCYA 1QTWA 5CZKA 3B8TA 5JVLA 1XM3A 4MB5A 2YCJA 4GO8A 1LT8A 4WXZA 5D33A 4A8IA 3TYUA 3WJXA 3CUXA 3UXLA 2HXUA 1P6CA 5PTDA 3AXXA 3S2JA 1H11A 3LQLA 2WHMA 1V0KA 3CPUA 3PZVA 1DXIA 2WZIA 4D6FA 4JTJA 3AU6A 5C9XA 3WQVA 3H4WA 2EXOA 3MUY1 5AC8A 1H7NA 4MGGA 1T99A 3K8LA 3MUXA 1I0BA 4LC6A 1KBBA 4RUBA 4QQ3A 3KBWA 1OB0A 4M7TA 2XH2A 4GUFA 2GJLA 2P50A 4GY0A 5RUBA 3MUCA 1FCVA 3L5LA 4JCLA 1FVPA 3OVPA 1V02A 2WB5A 1VFFA 4HK6A 2X7VA 1MW3A 2NUYA 4HNLA 5KTLA 1CW2A 2IS7A 4QAWA 4E6MA 1YPXA 1FHUA 2YZ5A 3U8GA 4ZQRA 3B97A 4ILSA 2B0MA 3DI0A 4PC8A 4FXSA 2F2KA 4PSPA 1L6YA 5G2HA 2ZXDA 4BQ3A 2PC8A 2DSVA 3LV5A 2A7PA 3WNKA 3HPXA 4K2SA 1N82A 4OBTA 2VRKA 4EVZA 3WEMA 2OG9A 1QRQA 2FZDA 3ZVIA 1YEYA 3U5UA 1EJTC 5B7YA 1TTIA 1DWJM 1I75A 5BROA 2PWHA 3CMGA 7ODCA 1L2UA 1SU5A 4G5DA 3TXZA 1WKEA 4IX2A 2HDJA 3WDJA 2Y1HA 4N0RA 3MMDA 3G1AA 3WEZA 3VIGA 4W4QA 2DZPA 3G24A 4LS1A 2FPVA 4EANA 1WCGA 4G1KA 3F5LA 3WX7A 3CQ0A 3F4DA 2F38A 3NQVA 4V1XA 4ZB0A 3PAOA 4PMZA 5GQBA 1OY0A 2VL4A 4UNLA 5HXMA 5CLWA 1EX5A 3APYA 1BLIA 3GIQA 3EOLA 3TCEA 4E4FA 2YB1A 4L6HA 3C2RA 1WDDA 4ATWA 3VIKA 4R5EA 3BZGA 2V69A 5F2GA 1F07A 3BQ6A 2Z0IA 3BE7A 1PBGA 3R25A 1ZJBA 3IJ7A 5A2AA 2IPWA 3L0GA 3T0CA 5BMWA 4AVFA 4MAZA 2BHYA 4KWOA 2QW5A 2W67A 2OSYA 1ZJAA 3DYOA 2FHCA 5GNZA 3OG2A 3NO5A 3N4EA 4TXEA 1KNWA 1UWIA 3BMXA 4PTMA 3W37A 4FOJA 5HUOA 3GU9A 1EQCA 4ZFMA 2OZ0A 4KFNA 4HT3A 3SGUA 3WD0A 3EWXA 3URAA 2XYLA 4Q32A 3XISA 4LQ1A 3VTRA 4D2JA 4BR1A 2VFEA 3UNDA 4GCAA 3VGGA 3QQWA 1L6SA 3ZYZA 2J9YA 4WD0A 4A35A 4QR6A 5HK4A 1UD4A 4PUNA 1AQHA 3DFHA 3VCCA 1DL3A 5U4NA 2Z26A 1ISWA 1SYTA 4XAZA 4CNNA 3G1YA 4YHGA 4ZVJA 4QEHA 3C61A 1XBXA 2Y2WA 1O4UA 3R8HA 1EP2A 4JTGA 3T4WA 1O6IA 3SCWA 1V08A 3GX9A 1K8CA 2QKFA 3PWGA 3EX3A 1NAL1 3M6YA 1W3NA 3MO4A 3BAYA 1ZB5A 4DF0A 4LS2A 1EBHA 1Z42A 4NF7A 3CHDA 4QISA 4R88A 2NZLA 1KM3A 3NXLA 4JR5A 3R0KA 4N7QA 3FK4A 1CIUA 7TAAA 5CPMA 4IIEA 1E6QM 4GXPA 4C6EA 2CKSA 1WE5A 4ROPA 4Q8UA 2C16A 1L2QA 2UY5A 2AQOA 4O57A 1CGXA 3W27A 3AMGA 3QY8A 3UU0A 4H19A 2X09A 4UOJA 1AK5A 3DGRA 2J7BA 1TMHA 3LSCA 3RCNA 2FH8A 1I2OA 4HMDA 3AZSA 3KBNA 2Q8LA 2WJFA 2OWWA 4ZGYA 4ACZB 4MNMA 3B9NA 3W83A 1KWKA 3QYQA 1G69A 3N6HA 1FWRA 3W29A 1KGWA 1MFUA 2G4FA 2X42A 2I9UA 3ZLHA 1HKWA 1TPUA 1XH0A 4LVAA 3W7EA 1WZAA 1NEYA 2PP0A 2WMFA 4C1NA 1MXGA 3VOFA 1J0YA 1JJKA 4IHCA 2WMIA 2NX3A 3EB3A 3ARXA 4MDPA 4KEUA 2WJEA 5BMXA 4HTYA 1WZKA 3GUWA 2E77A 3BOFA 3QF0A 3A12A 2QIWA 2E5CA 4AC7C 2ZC1A 3VMNA 2OJPA 3EWUA 3DXIA 2QYGA 1TMLA 4UQDA 1SJBA 2UWFA 2QJGA 1HJQA 5E93A 1E0UA 3CH9A 2B31A 1PX8A 4KGJA 4F2UA 4JGDA 2X16A 2JIEA 4RR4A 1PPIA 5G2WA 1UZ1A 1X7FA 2W0UA 3AMDA 2CHOA 1KGUA 1U30A 5I3GA 1ZENA 4ONVA 1WDPA 2ZRYA 1JCTA 2XIQA 3S47A 2ISDA 1XLBA 4CU8A 1LP6A 2E7FA 2Y0FA 5F4XA 2OOFA 1OFBA 4FLOA 4H9YA 3SRHA 4BI7A 5M17A 3TH6A 4O1FA 1CI1A 5HULA 3P84A 3PM6A 2FVKA 4BF7A 1ZPTA 3OYXA 2YCLA 3WYZA 4B16A 1MNZA 2VFHA 1OG0A 2VX7A 8RUCA 1XRFA 1VFUA 1XLLA 3M0JA 1W8GA 1V5XA 4JTLA 4E3VA 1L6FA 2PTWA 3ARQA 4FIRA 4UQBA 2BVTA 4HSOA 5E6YA 1KW1A 1MI3A 4D6GA 5C2CA 3RDKA 3KRBA 2AMXA 2OB3A 4D8ZA 3GM8A 5I7GA 4D6DA 4S3AA 3WF3A 3KL0A 4PBGA 3GH4A 1Z8AA 4IMGA 3A9BA 2J7GA 1UA7A 1DJXA 3A24A 1X6LA 5I5RA 3N9SA 1XCFA 3MKCA 4M0XA 4ZL1A 1TO3A 1US2A 4KEMA 1XG3A 3NR0A 3TC3A 2Z29A 4TTUA 1ZBWA 3R6IA 5H1WA 3W7PA 3LDVA 3VCRA 1E1CA 3AHTA 5BU6A 3WH6A 4IMEA 4QAIA 5E0FA 4IGMA 1LROA 2X30A 1MXSA 2P3ZA 3BLEA 4XVDA 3GR7A 1TPEA 3ANUA 3ONBA 1TV8A 5F1VA 4GK8A 1W91A 2RUSA 3NPXA 4MPKA 4Q22A 5ABEA 1ITQA 4JL2A 2FGZA 4M56A 2Y7FA 4KKXA 4CVWA 3RRAA 3O0FA 2HSAA 1JD7A 3UZZA 5DFAA 4GH3A 4UR8A 3B3DA 3COTA 3SSJA 1TG7A 1A49A 4GQRA 1HKMA 4QXIA 2J7HA 5ABGA 2P76A 3W00A 1D9EA 3TX9A 3S1UA 2A5HA 2Y6ZA 1TKKA 2VVNA 4S39A 4GACA 4W88A 2DH2A 5HNRA 2JEQA 2XM1A 5D02A 4KEVA 4JTUA 2PDNA 2PDUA 2FIQA 2CKRA 1ZU8A 3C8NA 4AAJA 3PPGA 4HNUA 2Y85A 1TIMA 2J24A 4MZ1A 3FXGA 2P0OA 4EXAA 4C6QA 4H8HA 3CL8A 2V3DA 2FDMA 4CD6A 4GA8A 1EA9C 3KWSA 1XC6A 4P7RA 4J4KA 2G3JA 1FCBA 5IRPA 2VZSA 2QUNA 3TTEA 1RVGA 4Z1CA 5HMFA 4J40A 1KFKA 3PSWA 2E8ZA 5H6HA 4ERGA 2XUCA 4RXGA 2XWDA 1QAPA 3KHDA 3S9IA 3WQOA 2BNJA 4EE9A 4DBEA 3BW4A 3PWAA 1EH9A 4L4OA 2VURA 1EGMA 2A3AA 4FNQA 4PB4A 3MCNA 2VGGA 1Z69A 2XFWA 4IPJA 3QOKA 5H91A 5KITA 4MJ4A 5C71A 6A3HA 1ZP3A 3VX0A 3UJRA 4I6VA 4DWDA 2GJPA 4G1NA 1NJJA 4OV9A 2GDUA 3BICA 2UY3A 1WP6A 4Q8TA 2WZEA 4Y9AA 4XZHA 2WQPA 3PAJA 4HNOA 3SCOA 1ALDA 1ITUA 2CCRA 4XIAA 2G4JA 1F05A 4LUSA 4JDBA 1WZMA 4WGHA 3ZT6A 1M7XA 1DP0A 3NIYA 1VP5A 3B8VA 1GGOA 3UY8A 3D5HA 3G6MA 1RY8A 4P8WA 2W61A 2OGJA 3EB2A 4NAFA 1S3TC 3VKDA 1J96A 4GBUA 4XISA 3NUKA 4XKYA 1WO2A 4K7VA 2GYIA 4MHBA 3FDKA 3PS7A 2A7NA 4GI4A 4FF7A 4E8CA 2GSHA 4XZMX 1V6VA 4NAEB 1WDRA 2IKGA 1TWSA 6ALDA 3G18A 1F4HA 4C6KA 1NM9A 4CNOA 1JPMA 3P60A 4ZA0A 3BC9A 1YDOA 3CT7A 4ERIA 1H3GA 3KVLA 4UTUA 3K46A 1GOOA 4LAUA 3T55A 1R9ZA 3TW6A 4AD0A 3WDRA 4KRZA 2V82A 2ABAA 1Q7QA 2GWGA 2E28A 1FWHC 5AYIA 1G9HA 4WDUA 3FKKA 3TN3A 2Z1KA 3IV8A 3OVQA 1UD5A 2C14A 1EDGA 2WSYA 1A5KC 3DG7A 4RZBA 3M9YA 1W37A 3GO2A 1CXIA 1SJAA 5LIKX 3OG3A 4LYPA 3I3DA 4MTVA 4LXFA 3W07A 3LM7A 5C54A 1Y5VA 3EWWA 1TV5A 3I4KA 1X6UA 2OPJA 3NG3A 1WKDA 4L1WA 2E25A 3WJSA 3URQA 3PP7A 1DBTA 1ELSA 1MEIA 2XN1A 4EK7A 4FX8A 1LJYA 3VDCA 4FXJA 4KWUA 3S1WA 2GUUA 3KBJA 1A5OC 5KEZA 1BD0A 3QMTA 3W01A 1TWWA 2A3LA 4P8UA 1JZ6A 2HE8A 1CB7B 5C9RA 2XDFA 1E0XA 1GTEA 4WHBA 2BXVA 2QVHA 1TWDA 3B9OA 2ZRUA 3H2EA 3NQCA 1FWIC 2ZUVA 3WJWA 4QEEA 3QW3A 3WLQA 5F1UA 2QJIA 2QULA 4E38A 5K7JA 3FSUA 3WFLA 3MS8A 3H54A 3MO7A 3GHTA 1R9XA 2PRLA 4GJ1A 1YQ2A 2Z7KA 4HMNA 2E40A 3DKJA 2CFFA 4UFIA 1IIGA 1OX4A 3GG7A 3Q2DA 2XSAA 4PSRA 3N17A 4B4HA 4RPPA 5FKYA 2G3IA 3EPMA 2EPNA 3HQPA 1S2TA 3QHNA 5EPDA 4MADA 2FQIA 2ACSA 4HYRA 3NGJA 3ARUA 4KRUA 2F7FA 4NILA 3VIFA 1MQQA 3PSVA 2Z27A 4J2MA 1FKXA 1PV8A 4LCQA 3UWUA 3D3AA 3VM5A 4MJMA 3Q45A 3RLVA 4NXSA 4CNPA 4K8GA 2VP8A 2BASA 4DI8A 1Q6OA 1GVSA 1JPKA 1BVNP 1FWTA 4GYKA 2PWGA 1EIBA 3QH2A 4NIRA 4LAKA 4YCOA 4M24A 1TMQA 3A5FA 1B31A 3EWCA 1W6TA 4I7VA 1A80A 4LY8A 6XIMA 5EU9A 5FL1A 1XISA 3LERA 3PJWA 2MANA 2DSUA 2DY3A 2Q8XA 1CLVA 3C0LA 1CZ1A 4DM2A 4EXBA 4QE4A 3OBAA 3HQOA 3KCJA 3OA5A 5E09A 1EFZA 5JIWA 3DECA 3W81A 3C0QA 1AW5A 1XQKA 2ZX8A 3T0AA 3FHQA 2KAUC 1KV8A 4U2ZA 4D9PA 4H00A 4IG2A 3F4WA 2YL8A 3DHUA 1G4TA 4AEEA 2V30A 5ECUA 5HUPA 3T8LA 4OFCA 4UMCA 5REQB 2DZBA 1F3EA 4ZQNA 1BWLA 3LLXA 1B54A 3CV1A 1XH2A 5I79A 3GVWA 5A1AA 1NOWA 1J10A 2PF0A 1ADOA 3MHGA 3LI0A 1NOUA 5I6SA 4HU4A 1V7AA 4LUJA 1P0KA 3PBGA 1ADDA 4H7ZA 4DF2A 4QLLA 5J5DA 5CQ1A 1W5QA 3WMLA 3LCHA 4PULA 1UQYA 3FYOA 4AWUA 3EYPA 1JQXA 2GDVA 4DX3A 3ENLA 4L4LA 4UC5A 4US6A 2PGWA 2XH4A 2F9RA 3TSMA 3UPMA 1RZMA 1JCJA 1MW2A 3GDRA 2KX9A 2XGZA 2VDHA 1VFTA 1TREA 4DWSB 1HJWA 4HPNA 1KM1A 3O63A 2TRSA 2FZBA 3ZS4A 1IF2A 4D72A 4I8DA 5BZAA 4JTSA 3WUEA 1W5MA 3NQAA 7TIMA 4YTQA 2ZX7A 2O7SA 3L2MA 3LLDA 3HGJA 3UZJA 4LYKA 4DWSD 2BOFX 2IPFA 1OZMA 1JRBA 3E49A 3SAZA 4REQA 3REQA 4W7UA 4PMQA 3NDOA 4DXKA 4IM4A 2X1UA 4FIQA 1OCBA 1T40A 1KCLA 3T44A 3H7UA 3JZEA 1TRIA 5FOOA 1VEPA 2WNQA 1RLCL 3IJQA 5CSYA 1I1WA 3STCA 3O6AA 4B2DD 3QOMA 2CZDA 4DPQA 1IEVA 4GZ7A 3VNZA 1B3YA 3S0CA 2FJUB 3KRZA 5A8GA 2D3NA 2WBGA 4K37A 1V0NA 3ECQA 3UW6A 4JZ5A 1NOFA 2VDIA 5JU6A 4IXHA 2VHLA 3T78A 4Z17A 2J6VA 3R58A 5LNSA 2QJHA 3AIEA 1UUQA 1UKPA 1MSSA 3SB0A 3CNYA 1EZWA 4IMAA 3DKLA 1Z6KA 1VZWA 3W71A 3H4GA 4P7NA 3I68A 2Z1WA 1OK4A 1LLOA 2EGZA 2DSZA 4I7UA 3E0VA 5HA7A 2X2GA 3LYEA 4CNSA 3S2LA 1DJYA 1CXKA 4EP8C 1FBAA 5DX7A 3UYIA 3MUZ1 1FOBA 3PANA 2YX0A 2ACRA 3I6RA 4CEXC 1AW2A 4IICA 1EIXA 3BMVA 3KW3A 1L9WA 4LUIA 4PH6A 4Y9NA 3FN9A 3AQUA 4OVXA 1HVXA 3R11A 4ZODA 2PDLA