5C55A

Crystal structure of the y138f mutant of c.glutamicum n-acetylneuraminic acid lyase in complex with pyruvate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
307
structure length
307
Chain Sequence
TFTGVIPPVMTPLHADGSVDVESLRKLVDHLINGGVDGLFALGSSGEAAFLTRAQRKLALTTIIEHTAGRVPVTAGVIETTTARVIELVEDALEAGAEGLVATAPFYTRTHDVEIEEHFRKIHAAAPELPLFAFNIPVSVHSNLNPVMLLTLAKDGVLAGTKDSSGNDGAIRSLIEARDDAGLTEQFKILTGSETTVDFAYLAGADGVVPGLGNVDPAAYAALAKLCLDGKWAEAAALQKRINHLFHIVFVGDTSHMSGSSAGLGGFKTALAHLGIIESNAMAVPHQSLSDEETARIHAIVDEFLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase/N-acetylneuraminate lyase
publication title Crystal structure of the Y138F mutant of C.glutamicum N-acetylneuraminic acid lyase in complex with pyruvate
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Lyase
total genus 115
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c55A00
3HG3A 5LNSA 4WQ6A 3NL6A 3IIXA 4JX4A 2ZRXA 1ZNNA 2JK2A 3W2LA 3B0VC 1I2OA 1TPC1 2A2IA 2NXHA 3LRKA 5A5WA 4JTFA 4Z0JA 4FEZA 3T78A 1EP1A 3W2KA 1XFBA 2Y63A 3F1QA 2RHGA 1PE1A 3DHDA 4UMBA 3UNDA 3HOJA 1CW2A 2CLOA 2JBMA 2VFIA 3ZR4A 1JUKA 2VENA 3G1AA 1H1ZA 4AWSA 1VCVA 2ATMA 2DJXA 3CEPA 4POCA 5KITA 1R2TA 2BWGA 2YPIA 1R2RA 4XBKA 2WNQA 5DXYA 3W2NA 1JVNA 1GVRA 2ZFAA 3A5VA 5D32A 5K4XA 3BV4A 3W1PA 5K4ZA 3NPVA 3STFA 3MUXA 3H54A 5K2ZA 5EBUA 1QPNA 3S5YA 3HG4A 5EPDA 3TFCA 4O0KA 2R94A 3AO0A 3GDMA 4AVFA 3DKJA 1OVDA 3C2FA 4DXVA 4S2BA 3W2UA 2H3DA 4MLRA 2C6QA 1YPIA 1PHWA 1N7KA 4UFJA 2NXIA 5DXXA 2FIQA 4NJGA 3LCFA 1EUAA 1MEIA 5C6MA 2CLHA 1G4EA 3L5LA 4YCPA 2EF9A 2VOMA 4E38A 2FDSA 1VJIA 2P0OA 3W7QA 1GWJA 3BG3A 4MYAA 1JQVA 4A21A 4WZHA 3G1YA 5IM51 1Q45A 1LLWA 5D03A 1TTIA 1KLYA 3ABRA 4M19A 1XUZA 3WFAA 1SO3A 4OV9A 3U6WA 3B06A 4O17A 2QJHA 3TR2A 1KM5A 1P4CA 5E0KA 2ZTJA 4IPIA 3VE7A 1YYAA 1FXPA 1DBTA 4O54A 1XCFA 3IGSA 3L5AA 4JGDA 3M1ZA 1VHCA 3G0XA 5F4XA 2WNNA 1H60A 1OX4A 2V9DA 5DLCA 4LC6A 5HWNA 1B4KA 4N2YA 3T40A 3QSTA 4M7TA 1FDZA 3A21A 3LB0A 3CQ0A 2A7NA 3E49A 2Z6JA 4A3UA 3LHZA 4LC8A 2JKEA 2XN1A 4NU7A 3P74A 4AXKA 1G4TA 3E0IA 1QOQA 2H8XA 5L9FA 2V30A 3CWOX 1OK6A 2JKPA 4O52A 3OA3A 3TKFA 2QJGA 4U28A 4UTMA 2YFOA 3R2GA 4UMCA 4TMBA 4IWWA 1OYCA 1TO3A 2CLLA 5D05A 1FXQA 2ZZ7A 3LCGA 5LNRA 4UTIA 3L9CA 4TMCA 4O18A 5AYXA 1QO5A 2J6XA 2RDTA 4XQ6A 4LU0A 5E93A 4JIQA 1VYSX 1ZFJA 2ZTKA 1Z48A 3T44A 4LOCA 2QJIA 2GVLA 3INPA 5TQLA 4GWEA 3B04A 3A24A 1PS9A 1UUOA 2BSLA 3OG3A 4ALDA 4DO4A 3HPXA 3EXTA 1V5XA 3NPWA 4IMFA 3TXZA 4QITA 4NXSA 1ICQA 5C55A 2E6AA 4W9TA 3W84A 2DZTA 3W75A 2VFFA 3N19B 3NQDA 1OJXA 4HSNA 3W6YA 2DZUA 4WY0A 5FF2A 2RFGA 5AHLA 4XWUA 3LCLA 3TSDA 1EEPA 3THAA 1EIXA 3FS2A 1TV7A 1M5WA 1M7PA 4K37A 1VC4A 5C5YA 5AB3A 1O95A 3UWVA 4LRSA 4FNSA 1EWEA 3TDFA 5F2LA 3LTSA 1XC4A 1RQEA 4N6FA 2GVJA 2X1SA 3IEBA 4LVFA 3IIVA 3PUEA 3A5FA 2DJLA 3W23A 3MI3A 3OIXA 4AAJA 2Z0IA 3MP3A 3STEA 5CPNA 4OE7A 1SFJA 4O16A 4H6KA 1HO4A 3O6DA 4MKNA 1PHQA 5DCEA 3RLVA 3MMTA 3LTPA 2Y85A 2VEPA 5AC7A 3GKAA 3SGZA 4KFPA 4BWLA 1LOLA 2ZRYA 2ZBTA 1LYXA 2FPTA 4TIMA 3QPZA 4L4MA 5CPMA 5G4EA 1OYAA 3OVPA 5D30A 4J9JA 1G4SA 2E6FA 1WOBA 4I7WA 1F74A 5KZMA 2VFEA 2E1DA 3VI2A 2NLIA 1PCWA 3L67A 1XL9A 2J27A 4QNWA 3LGEA 4XZ9A 3WK2A 1SFLA 4S2CA 2BLEA 3W1NA 2CZFA 3GIYA 1T96A 1PV8A 1LCOA 4CQAA 3CEUA 4IUOA 1YXYA 4CLMA 4YWIA 4CCDA 4K6AA 1EP3A 2QDHA 1H61A 2B7OA 3DFSA 3G1SA 5HWJA 2CLKA 3M5YA 1GVQA 3LX9A 5LZLA 4M5PA 3KRUA 2A6NA 5KINA 1H50A 4E2BA 2GJNA 3A22A 1FQ0A 2WSYA 2WV8A 3BLIA 3PBYA 4N9CA 3SW6A 5FESA 4DEFA 3HB9A 2CLIA 3IIZA 3W07A 1LROA 1R30A 3NPUA 1KM0A 4N4PA 1K02A 4O11A 1QO2A 4XKYA 4YL2A 3TNOA 3U2OA 3CWNA 4K7YA 3WJZA 2Y89A 3NQ2A 2VXNA 1VZWA 4UTTA 2E5DA 4M6VA 4UTJA 3S1UA 3W1XA 5FF3A 1H7OA 3NM1A 3C8FA 5FEXA 2JGYA 3W2JA 1TPB1 3IRDA 3DFNA 3SECA 1SSDA 2HSAA 4FXSA 4JNMA 5KZEA 1NF7A 3W2MA 2QUTA 4GXMA 3IGUA 1TSIA 2YYUA 3W9ZA 3N9SA 4BFAA 1AW1A 1TPUA 2V0TA 2V2CA 2FPVA 1OX6A 2ZZ6A 2QUUA 1B9BA 1S3HA 2TRSA 1L6SA 4IMDA 4OU1A 1S5WA 3SFKA 4WOQA 1XDMA 2Z6IA 4CNPA 2CWNA 4A22A 1A53A 4R7JA 2Y70A 2GJLA 1TMHA 1PVNA 3W7OA 3OVRA 1MZHA 3CU2A 2GUUA 2ALDA 4UMAA 4LRTA 3FYOA 2V2HA 4WD0A 2ZZ3A 1GYLA 1KLZA 1YXDA 3EX3A 1GTHA 5CSSA 4UFKA 2VFGA 2W0UA 5J5DA 3FFSA 1ZALA 2ZA2A 3ATYA 4DQWA 3IVSA 4Q32A 1LRTA 4NX0A 1VGAA 5EL1A 5G2HA 1W3NA 3M43A 3C52A 3KVJA 4DF1A 4HPXA 2ZRZA 4M7SA 3LDVA 3NL5A 3HG2A 2A7PA 1O60A 5I3IA 5BRBA 3OVQA 4TR9A 5DBUA 3K30A 4TU1A 1P1XA 4WXZA 1Q3NA 2PRLA 4YLWA 3ABSA 3W72A 4N9BA 4WY0F 3G1XA 5AHMA 4O0ZA 2ISSA 1T0OA 1H7XA 1J4EA 1LLZA 3NQVA 4X9SA 8TIMA 4DF2A 1K7FA 4AB4A 4LV4A 4LTSA 2W79A 3UYCA 4N4QA 5AHFA 1K8ZA 3QZEA 4UTHA 3S6DA 1X7FA 1VS1A 1OG0A 1W5MA 3PUOA 4HT3A 4GUGA 2IQTA 3S5ZA 5K9DA 1RD5A 2BTMA 5BW6A 3EXSA 5LGXA 1IXPA 1I45A 3S42A 1U83A 2YX0A 3KAOA 2EGZA 2ZZ2A 5G5IA 3P81A 1GVSA 1TTJA 1Z42A 3PAJA 5KTLA 2GPTA 2NX1A 4DPPA 3PR2A 2A6LA 3SY5A 3GXTA 2DORA 3QRHA 1JR1A 3KFTA 3M47A 4RZ6A 4RXGA 1UB3A 2VFHA 3TW7A 1GJPA 2QCFA 1UCWA 5D04C 3PB0A 4O50A 4S1FA 3BG5A 4D2JA 2C3ZA 3GAYA 1GG0A 4M6QA 3O1NA 3WJXA 3QC3A 3N34A 1TPVA 3BK0A 4HNTA 1OX5A 3LRLA 1YPFA 1VYRA 4AMAA 4MJZA 1YTEA 3AJXA 3M44A 5J5RA 2Q3OA 1VYPX 3S1WA 2YXGA 4K39A 3C2VA 4RK8A 5CZJA 2X2GA 1MSSA 3G22A 3LOTA 2PE4A 4JTUA 4LV9A 3HPZA 2NUYA 4PEKA 1OFPA 2TSYA 3HGOA 3I7RA 1X1OA 3R8RA 4I7UA 3PSWA 3PM6A 4QJ1A 3N14A 3C2OA 2HTMA 3TJLA 1ME9A 4JTEA 3P5YA 5I3KA 4LVAA 1OFRA 2CLFA 1TJRA 1CI1A 1RQBA 3H53A 5BMXA 3P67A 3O15A 3M6YA 2CFFA 2XN2A 4IPJA 3GXPA 2C16A 3M41A 2VFDA 2A5HA 4ADTA 3MHGA 4JYEA 3UPWA 3TMLA 2YSWA 1XKYA 1EA0A 3IVTA 3W7PA 5KSWA 4AF0B 2YYTA 4ADUA 4HN4A 2FB2A 3G0SA 2WKJA 3HMJG 3DAQA 1WV2A 4O1BA 1UJPA 2G97A 5CGQA 3QPYA 4HNVA 1ME8A 1TYGA 1ICPA 2ZZ4A 2Y88A 1OK4A 3BO9A 2A85A 4WUIA 4ZQRA 1WDWA 3A9IA 1G7UA 1FWWA 5D38A 4OBTA 1A5BA 2ZQ0A 3LV5A 3TIMA 3C6CA 3LXAA 4K7VA 2NX3A 3ABQA 1NVMA 3F03K 1G67A 5U4NA 2JKAA 1THFD 3RU6A 4WJEA 4ML9A 3UZJA 3I7QA 1KBIA 1HTIA 4X22A 5AFDA 2AQWA 1KV5A 1H7WA 1E51A 3DKLA 3IVUA 4CQ9A 1P0KA 3WJYA 4K8EA 4FIRA 3ZWTA 3G18A 5F4SA 1VLWA 4JY8A 1FDYA 1K7XA 2RDWA 2O7QA 4OHQA 1QOPA 3M9YA 4O57A 3S1XA 4O14A 3L0KA 1LTDA 3GB6A 4FIQA 5G1YA 1WQ5A 3FKRA 4AEOA 1P5BA 4FNTA 3NEVA 3LCIA 1KBJA 1Y0EA 1SR9A 3UWYA 1EPXA 3DGRA 2CZEA 5AHIA 4X2RA 3C4UA 1JCMP 5MHBA 1H7PA 2NUXA 4MPQA 5FF4A 1FWTA 3O07A 3GVGA 3MI2A 1XM3A 1ZY9A 4FNRA 4Y6GA 2J9YA 3WJWA 3B03A 3TAOA 3LHWA 4UTLA 3U8GA 3L65A 3GZ3A 4ZL1A 4LS0A 1W5PA 3GXNA 4RZ5A 3FJ6A 3JR2A 2V81A 2OT1A 5A8GA 1HL2A 4JTLA 1SPQA 1I2RA 3YPIA 1TCDA 4ZZ9A 4LWWA 4K38A 1S5VA 5HINA 2BZNA 6TIMA 4LY8A 3MBDA 1OFBA 4NZFA 5AHNA 4DBEA 3UXAA 3PULA 1BEUA 4MUZA 5I3HA 3PB2A 4GE8A 1W3IA 4P2VA 3W7LA 3DFPA 1K3UA 3TSMA 2C1HA 4BR1A 5F1VA 1XBYA 1AW5A 4RCXA 4LVDA 4Z08A 3FJLA 4MZYA 4IXHA 1C8VA 4ZQPA 4QIUA 4FXRA 4QNEA 2FQIA 1OFAA 3SZ8A 2C14A 1J2WA 3DI1A 2QCNA 5D02A 3N2MA 1F76A 1SUXA 3DXIA 1QDSA 3L2IA 1LBFA 1LBMA 1GQNA 3PWAA 3W1TA 3BG9A 1TQXA 3KVLA 5HULA 3GDKA 1JCYA 1DJQA 1Q6QA 3I65A 3PSVA 3DFOA 3O06A 3EWZA 4M6PA 1QAPA 3BPWA 1GT8A 3LCXA 1JULA 3C61A 4GFSA 2DZXA 4AWUA 2GVGA 2J9XA 5D2TA 1B4EA 1JCJA 1EP2A 1H51A 1KM3A 3FA5A 2I1OA 3E02A 4RKAA 4O4WA 3TE9A 3S0CA 3W85A 1SO4A 5TBOA 4EOUA 3SIZA 4EIVA 2CZDA 1KM1A 5FF0A 2FPYA 2X1TA 1IXOA 3HPSA 4Z0SA 3RLUA 4OV4A 3RMJA 5DY3A 4UNKA 3CIXA 2PURA 1T8XA 3G8EA 3UY7A 2W6RA 4UTUA 3I68A 4IJBA 3LBCA 1GG1A 1JCLA 2GQ8A 2XFWA 2QCDB 4I9AA 3TXVA 1AG1O 1DJNA 4AHOA 5CSRA 5F4WA 2G5WA 2PRHA 3NVTA 2WOQA 5U7SA 3B4UA 4UTWA 3ABOA 5BMWA 3LI0A 4FO4A 3TFXA 3TJXA 1RV8A 3W7CA 3S5OA 1W0MA 3G1DA 4GRSA 3C2RA 2FFCA 3EKLA 4HNNA 3JRKA 2WPBA 3ZFHA 2C19A 3PVFA 2V5LA 3TH6A 2VEKA 3L0GA 3TU9A 1ZJIA 4OGZA 3NDOA 3W1MA 1FWSA 4RV8A 5I3JA 1Q6OA 2FLIA 2OT0A 4NXKA 3NZ1A 3TUUA 3NAVA 4QQ3A 4HHPA 2ZRWA 3DBPA 3N3MA 1U5JA 2J88A 3P60A 3QH2A 3TC7A 1XDLA 3LCWA 3NXFA 3GNDA 1XBXA 3NL3A 4KFOA 3N9RA 2A0NA 2BXVA 1QNVA 2RH9A 4GUIA 4XUGA 1KV8A 1SQ7A 3DFTA 4K36A 4UCGA 4UFHA 4NJIA 4QSHA 4A2RA 2BX7A 1C29A 4NUWA 1HO1A 1Q6LA 1JCXA 3QW3A 1MEWA 3BGJA 4DBDA 5CZSA 1QFEA 3LERA 3QM3A 4PTNA 1R46A 5CG7A 1DV7A 5DY2A 3WK0A 3P80A 4BWLC 4Y96A 5C54A 3S8HA 5AOUA 4P61A 3M0ZA 4NNCA 1W54A 1PL9A 4RX0A 4XTIA 1VRDA 3QQ0A 5HJLA 3KRSA 1TRIA 1F05A 2ISVA 1XXXA 4YCOA 3O63A 5HUOA 3NO5A 2VKZG 1GVFA 5D33A 4WX2A 3S9YA 2O7SA 3W7JA 1BWKA 2NV2A 3C56A 5HR6A 3BGGA 3KVMA 1CX9A 2I9EA 3NYZA 3PBUA 2ZCGA 5DCBA 3DH7A 4FX8A 4Z1DA 3NPXA 3RFAA 3PC0A 1GPWA 2DZWA 1I2PA 3PF3A 3V1PA 3LXCA 2H3BA 1ZENA 2Y7DA 1OF8A 1F7BA 1W56A 2P10A 3G0UA 1FBAA 4G1KA 4AF0A 1MXSA 3EX6A 2B0MA 5FEPA 3TK7A 1W5OA 2DP3A 4UUIA 5FF7A 1TPFA 5HMSA 4PFMA 3CIWA 4Z1CA 4IMCA 4XTDA 1DHPA 3LHUA 1F2JA 3NZRA 1KFCA 3Q2DA 5AYYA 3DI0A 4JX5A 2X30A 2E5BA 4UTTC 3TA6A 3LI1A 4LUJA 1M6JA 4GJ1A 1QPOA 3KXQA 1K7EA 4I7VA 5CPLA 5DBTA 3QYQA 3L5MA 3EX2A 3GR8A 4JN6A 1L9WA 3W22A 3O8AA 1YDVA 1NFBA 5CZTA 5HR7A 1XBZA 4PA8A 3SGUA 4OT7A 1IXQA 1TB3A 2ABAA 1YTDA 2QCEA 2VEIA 4ZQNA 1KTBA 2F7FA 2YW4A 1UASA 2H90A 5HNRA 2E5CA 4GUJA 1KFBA 2QAPA 1GYNA 1Z44A 3EXRA 5F1UA 5HUPA 4Z1AA 3R13A 4YMZA 1HFBA 1B3OA 4KWVA 1QMLA 1TREA 1NAL1 3M5ZA 4TO8A 5IBXA 1JJKA 3N2XA 4MY9A 1N55A 2J24A 4O8RA 2QCLA 3W7NA 2RDUA 2Y62A 3W7IA 2NV1A 4FNUA 3EKZA 3DZ1A 3I7SA 4B5NA 5K9XA 1JQXA 3W7EA 1DVJA 3NNTA 1TQJA 3OEXA 3W1AA 1KFLA 5K3VA 3O05A 4JTGA 5C2XA 5KZDA 3LRMA 3LXBA 2X16A 3CB8A 4O19A 1W37A 4Q33A 3P84A 2DZSA 1WX0A 3B0PA 4MFDA 5CZ0A 1NEYA 2NWRA 3W73A 1RPXA 4NQ1A 1DOSA 2ZDRA 4MY1A 4OQVA 3FEMA 3UWQA 3ANYA 3Q37A 3GNNA 5AC6A 1SU5A 3HGRA 3MW7A 4E2DA 4UTKA 1ZHAA 1AW2A 1OABA 1ZAIA 2QKFA 3W88A 2V5BA 5E1QA 1DL3A 1OYBA 3PG9A 4NZJA 1WXJA 4MIMA 4NT0A 3GDTA 3NQEA 1SSGA 1KFKA 3HO8A 1TV5A 4MVAA 4RZ4A 3W7DA 4H3DA 3LV6A 3HGJA 5BOOA 1K8YA 2JGQA 3R5EA 3P8IA 1EB3A 5LNUA 2ZRVA 1SW0A 2VEMA 4Y8FA 4JTJA 2Q8LA 3W86A 5LGZA 5EYWA 3G8RA 4DO5A 1FCQA 4LT9A 4UIOA 1W5QA 3M5VA 1LM1A 1VCFA 4R53A 5T26A 3JS3A 2ZYFA 1RQHA 1WBJA 1A50A 2OJPA 3W7GA 1UUMA 2TYSA 4NNAA 4R33A 5FEWA 1J5TA 3M16A 3V75A 3MHFA 4ICNA 1F6PA 2ABBA 5DN1A 3W7HA 3E12A 5HQEA 5AYZA 3NQ6A 3C2EA 1N8FA 1TIMA 2A7RA 5CKSA 3L68A 4FX6M 3GYEA 3FYPA 2E77A 2YCEA 1HG3A 4UFIA 1G7VA 1SZFA 4N02A 5BNKA 6ALDA 2DZVA 1GTEA 3G1VA 2CLMA 2WJZA 5LNVA 3R89A 5H91A 4MLJA 1M7OA 1ADOA 4UFMA 3G1HA 1H63A 3QW4B 5G2IA 5ABTA 3SSJA 4QISA 3MP5A 4AH7A 2V2DA 3MYOA 1D9EA 3KVKA 3CTLA 1V7YA 5SWUA 1F6KA 1SZGA 2QAFA 1G6CA 1EX5A 1D3HA 1SO6A 2ISWA 3HF3A 3W87A 2ZRUA 2PCQA 3SJ3A 1O5KA 4HKPA 4JTTA 3GK0A 3EEGA 4E0CA 4KWWA 4BI6A 4LW7A 3NM3A 4FX7A 3S5NA 1I2NA 2B7PA 2B7QA 1I4NA 3P62A 1OFEA 4YXGA 3VFLA 3EWYA 3TMQA 3P5ZA 1ZCOA 5G1TA 2C13A 3W3OA 2C0AA 3WJSA 2H6RA 4X3ZA 1R47A 1TPWA 4XBSA 4O13A 2V82A 5LHEA 2HMCA 2QCDA 3GLCA 4O12A 2DU2A 1XUUA 1NF0A 2Y7FA 2YW3A 3O6CA 4Z1BA 2OX1A 2KZHA 4JIPA 3BW2A 3KHJA 2AAMA 3HJZA 1RR2A 1FUYA 2YZRA 4C1KA 1QCWA 3NL2A 5EA9A 1VH7A 5K7JA 4NNBA 1AL8A 4EVZA 3NOEA 1D3GA 3BVJA 1QPQA 4CCEA 1YADA 1TPH1 4RR4A 4OWGA 4MY8A 3W83A 4PCFA 1VLIA 3LHTA 3DFQA 3HBLA 2QR6A 1MEHA 2YR1A 2NX9A 3T4CA 1L2UA 4LS1A 2VELA 1SO5A 3EB2A 3STCA 3N73A 1K8XA 3IV3A 4RXFA 2AGKA 1B57A 3W74A 1T99A 4JR5A 3P61A 3P82A 1FWRA 2EPHA 5D2VA 3QFEA 5D09A 3GAKA 1KTCA 3UWWA 1GEQA 4A29A 2EKCA 1MO0A 3TW6A 3M7WA 2HS8A 3GX9A 3O6YX 4HIBA 5I3FA 1TPDA 3P8JA 5TIMA 1KFJA 1VQTA 2ZA3A 3QQ1A 4PL1A 3IGXA 4Q4KA 1I8JA 5G4WA 4QM1A 1G69A 2CW6A 1G4PA 3TQVA 3LM7A 4K8HA 5FI8A 4DO6A 4CCCA 3HG5A 2OCZA 2G96A 3PY2A 1FCUA 3EWXA 3PBVA 4GUFA 4LVBA 2FJKA 2P1FA 5D2YA 3NQ8A 7TIMA 1JUEA 1OFQA 3CT7A 1X6UA 4IX0A 3MJYA 3B8DA 3W1LA 3L66A 3NR0A 1LDCA 1VPXA 3RNDA 1O5XA 4HPJA 2ZA1A 3NQ7A 2ZZ5A 3Q94A 4L4LA 3W70A 4WXYA 4JYFA 1TJPA 3OHIA 2R91A 3TCEA 4FHAA 3STGA 1EWDA 3QSRA 4GC4A 4O10A 1H1YA 1KTNA 1A5AA 3UWUA 1FCVA 1W31A 1JRBA 1LORA 1H7NA 2E68A 2F84A 1FWNA 1IIGA 4O28A 2WSRA 4JX6A 4N9DA 4N9EA 5DCDA 2YGYA 4FB7A 3UXDA 4O53A 1WAUA 3NQMA 2E09A 2YFNA 3B05A 3MHUA 3MYPA 1H62A 4LNYA 2Z2UA 4JICA 3BW4A 2I14A 2PRMA 1KM2A 5LSMA 2TMDA 3C0JA 1ICSA 1WBHA 1F5ZA 1UBSA 4U4MA 2HS6A 3HIJA 2A21A 4MYXA 3UPBA 3ZS4A 1OHLA 3F4WA 3UD6A 3WK1A 1H5YA 2OMAA 3B0UX 3D0CA 4JDBA 3TSBA 3W1QA 1LRQA 4KFNA 3VNDA 4IGHA 3GDRA 2QCHA 3BARA 1QPRA 4AHPA 2CLEA 3NQFA 1XBVA 1TPEA 1IGSA 3NQAA 2B7NA 2NUWA 1KW1A 4MFEA 5D2XA 5F2GA 1TTQA 3EX4A 3GDLA 1OF6A 3TROA 4IMGA 3UZ5A 2YDAA 4DPQA 4H4IA 3CC1A 2QUVA 1W8SA 3T7VA 3TC6A 2Y6ZA 2Y61A 5F2IA 2UV8G 4HSOA 2Y7GA 3CPRA 1P0NA 2ATSA 3KRZA 3MO7A 3FOKA 3MBFA 3CM4A 1JRCA 3QEZA 3W76A 1L6WA 1AL7A 1ME7A 2DZPA 5FEZA 1VR6A 4CNNA 1DQWA 3EX1A 3NG3A 1X8FA 4ADSA 4JTKA 3NQGA 4FF7A 2Q8ZA 3IIOA 3L21A 4O4VA 1OX4B 4UFLA 4JTIA 3VCRA 3QMSA 4UNLA 3G1FA 4BI7A 3FIGA 1IIHA 3EWWA 4AWTA 4ORMA 1YXCA 1GVOA 3A23A 3LHVA 3C3NA 3G3DA 4CNOA 4O15A 3W71A 3UWZA 1L6YA 2R14A 1H7RA 2GQAA 3W7RA 1BKSA 4EWND 1FCBA 3OBKA 2EAWA 3GKFA 2QDGA 3FLUA 2Y7EA 4JY9A 4EF9A 4UC5A 1K03A 4ZQCA 3W7KA 3M5XA 3R12A 1R2SA 1RVGA 5EKYA 3F4NA 4UR7A 3P7YA 1IXNA 3DU0A 4RLIA 4A2SA 2QCGA 4NJKA 5HWMA 5L6UA 2E6DA 4FNQA 3BW3A 2H8ZA 3LCHA 4PL2A 3NA8A 1YDNA 3QJAA 3SR7A 1HUVA 1DORA 5EY5A 1O4UA 5DELA 4IXXA 3MI6A 4PC8A 1WOAA 3NGJA 4UTWC 3G24A 5F2MA 2QEZA 1ML1A 3H55A 1ALDA 1LOQA 4LVGA 4JXCA 4GBUA 3IIPA 4QAIA 2OZ0A 3BLFA 2C15A 4JDYA 5KMYA 3VE9A 1ZAHA 4IX2A 1OFOA 1KM4A 3VKJA 4C1LA 2PC4A 1BWLA 2E6YA 4WY0B 4UR8A 4RJEA 2D73A 1ONRA 3DHFA 5G2WA 3MWAA 1W5NA 4JTSA 3L0NA 4Y90A 2FB3A 4ZMGA 2Q3RA 2NWSA 1KA9F 3UQNA 3W1UA 3HGSA 1DQXA 3TQ0A 1LBLA 3ATZA 2WQPA 3Q58A 4AHQA 1W3TA 4NJHA 4LS2A 2A1YA 4JEQA 2EHHA 1BTMA 1LZOA 1LOSA 4IOTA 1Q6RA 3QMRA 4PODA 1SZEA 3TQKA 1RZMA 3GR7A 4IQLA 5EMUA 1WA3A 5AHEA 5CPOA 4FNPA 1Z41A 5LNWA 3E96A 3W7MA 4MZ8A 4O1CA 3S1VA 3PBWA 2XN0A 1JCNA 1KM6A 1LP6A 3RF9A 3E9AA 4UXDA 4BK9A 3EWUA 3LHYA 2R8WA 4MOZA 3LBMA 2WNZA 3TX9A 1VHNA 2QCCA 1AK5A 3USBA 3LLFA 3KX6A 2X1RA 4JD4A 3WK3A 1YLVA 2WSQA 4DF0A 2GOUA 1X1ZA 1ZAJA 4DELA 3DENA 1SZNA 2NZLA 4NJJA 3TV8A 4ZQOA 3FKKA 2CZ5A 5GVJA 1GOXA 2Z1BA 3SI9A 3NQCA 3QF0A 3O16A 4N6EA 4JYDA 1OFDA 2V8ZA 4ZQMA 1W1ZA 5LKYA 3TAKA 4ONVA 2A4AA 3ZWSA 4Y9AA 5AC8A 2G95A 1EUNA 3CHVA 4BF9A 3ELFA 4HNUA 1FDJA 2FTPA 3I6RA 4MZ1A 1S5TA 5D2WA 4EF8A 1NSJA 1LRNA 2RKXA 1JUBA 1FX6A 1FY6A 4TX9A 2GQ9A 1AMKA 1KFEA 3T55A 4PH6A 4NVTA 5D37A 4JTHA 1PIIA 1SW3A 4ZVJA 1O94A 3PS7A 4MJMA 4R34A 4JS3A 4KKXA 1WYIA 2B4GA 1YTKA 1F73A 2NXGA 3KOFA 4WOZA 4XKYB 5AN7A 2QCMA 1QWGA 3BLEA 1GZGA 4GUHA 5I3GA 1TRDA 2WO5A 4O1DA 4ORIA 1C9DA 3HQ1A 1A5SA 4NX5A 3LTYA 2LLEA 3CLMA 3LLDA 1DKWA 4CQ8A 3QMTA 3EWBX 2CU0A 2QF7A 3G3MA 3MP4A 3UY8A 2TPSA 1A5CA 1XI3A 1SW7A 2X1UA 3PG8A 4IMEA 4LUIA 4BI5A 1IF2A 2J9ZA 1PCKA 1TV8A 5K9CA 1I2QA 5H2ZA 3W1RA 4GNJA 4O1AA 1TTPA 2C18A 3RK8A 5LHFA 2VC6A 3THQA 1YDOA 3PUDA 5IBXC 1VCGA 1QR7A 2ZZ1A
chains in the Genus database with same CATH superfamily
5LNSA 4ERIA 3GIQA 3NL6A 3DIPA 2VWSA 3IIXA 4JX4A 3W2LA 2NXHA 5GNXA 1JFHA 2PDLA 5IOBA 1EP1A 3W2KA 2Y63A 2BFGA 3F1QA 1BTCA 2WZMA 1PE1A 4NIRA 3DHDA 4UMBA 3KS6A 3ZMRA 3PPGA 3P6LA 3MSDA 3DG3A 3G1AA 4AWSA 4S3BA 2P88A 4KWUA 1VEOA 3NEHA 3KBWA 1IHIA 3KP1A 3RR1A 4Q7NA 3WLPA 1R2RA 4XBKA 4GX9A 2BB0A 1U1HA 3W2NA 1JVNA 3W02A 4XKMA 3A5VA 3WEOA 2OO0A 3NPVA 3STFA 1KR1A 1VFFA 3H54A 3KHDA 5K2ZA 2AL2B 2OKTA 3TFCA 4ZFMA 1G01A 1LUCB 3AO0A 2VUNA 4AVFA 1OVDA 3ARZA 1MZRA 2H3DA 4QLKA 2C6QA 1YPIA 1N7KA 1MQPA 4BQ5A 2AMXA 3ARTA 5DXXA 1EUAA 2NQ5A 2GWGA 4P8UA 1G4EA 4DJDA 2HPIA 5HMDA 2FDSA 1IZKA 4XVEA 3AWNA 1DE6A 1GWJA 2IKJA 2HK0A 3BOXA 4YNGA 5IM51 4HOWA 1TTIA 5E09A 1ITXA 1J0HA 1UZDA 1JNDA 3T08A 2HE8A 3B06A 4DO7A 4EPBC 3EWCA 2QJHA 1U22A 5E0KA 2ZTJA 4GI4A 4Z2KA 4JGDA 3M1ZA 4Q6JA 1VHCA 1UIOA 1H60A 4S3JA 3T40A 3WQEA 3AZTA 1FDZA 3A21A 3LB0A 2HEJA 1J10A 2IQDA 3VGFA 2XN1A 2VR5A 3P74A 4G7FA 3B8SA 2H8XA 4GCXA 2V30A 3EOLA 2JKPA 2DT0A 4H8HA 1BVNP 3WNPA 4F9DA 3TKFA 2QJGA 3H70A 1NOUA 3VM7A 2WVVA 4TMBA 3AUJA 4BEUA 1OYCA 3BDKA 4PUWA 4H9UA 2X41A 5D05A 4H9XA 4GI6A 2V63A 2E9BA 4W8LA 4L9YA 2DT1A 1RCQA 2DSVA 5I6SA 2J6XA 2RDTA 1QW8A 3UG5A 4PMVA 1O5QA 3AZRA 3PWGA 1Z48A 3T44A 3PFMA 2QJIA 2GVLA 3INPA 4X0VA 2Y0FA 5CBBA 4LPCA 6REQA 2I16A 4DO4A 5IDZA 3EXTA 1EOMA 3RXZA 2HPMA 1W1B1 2W5FA 3BLOA 4IFRA 3WUBA 3S46A 4QITA 3CUXA 4C6MA 5C55A 2PD5A 5REQB 4V15A 4P7RA 3TYZA 4GYKA 1ZJBA 4X61A 4AZIA 1CXEA 1CWYA 3TSDA 1VBUA 1EIXA 1TV7A 4FSAA 3B8VA 1FTXA 1VC4A 5C5YA 3UWVA 3MVTA 4JBRA 4M3PA 1A5UA 4JAWA 3GIPA 2R82A 3QQWA 4DJFA 2X1SA 2DQXA 1H3GA 1NM9A 3PUEA 3A5FA 3MI3A 3R4IA 1OWQA 1CB2A 1UD4A 3ITTA 3QFWA 1S2TA 1QBAA 1HO4A 4MKNA 4GGHA 2Y85A 3SRFA 2VEPA 2QPUA 4AEEA 3GKAA 3SGZA 1LOLA 4D1IA 1UOKA 1V3KA 3QPZA 1A3XA 1IT8A 2VZUA 5G4EA 1B3YA 3S6OA 4HHLA 2JE8A 2EXOA 4B90A 4I7WA 2QMKA 2OG9A 3TLLA 3BAYA 1JI2A 2J27A 3BJSA 4N0RA 1A0EA 2WHJA 3O2LA 4WKHA 4Z2GA 1L6FA 2A3AA 7CGTA 3WF1A 3OPSA 2VWTA 4U3AA 3GIYA 3VO0A 2G50A 4P7NA 3SQSA 3MC5A 1XRTA 2V6AA 3JZEA 4GYFA 5HWJA 2YB4A 3M5YA 1GVQA 1FRBA 2F38A 2PF0A 1A0DA 1DWGM 3KRUA 2A6NA 3ANVA 1G9HA 2WSYA 2VTFA 4W87A 3WDJA 4DEFA 1UKTA 2CLIA 1PBGA 3JUGA 3W07A 1LROA 3NPUA 2WHLA 4CU6A 4JTRA 1GQIA 1JZ6A 3EMCA 2PZ0A 3WJZA 5RUBA 4PBEA 1R85A 4UTTA 3W1XA 1UWIA 5LIUX 3NOYA 1IEIA 5FEXA 4QE5A 2PU1A 2G3JA 3ABZA 1TPB1 3DFNA 1EZWA 3SECA 1SSDA 2HSAA 1CBGA 3HMCA 4EAYA 3CL8A 1NF7A 2QUTA 4GXMA 1M03A 4GH3A 1KKRA 2V3EA 1EJ7L 1FOBA 3DCPA 2WAGA 4IIHA 4EXQA 2VCBA 3QR1A 2V2CA 4UWMA 1OX6A 2VGBA 5ENLA 1CEOA 3CL7A 3E1F1 4GY1A 1WUFA 2CITA 4RE4A 1XDMA 4NSBA 1UA7A 3U4AA 2CWNA 4A22A 1A53A 1N2VA 2XSAA 4R7JA 3SRKA 1TE6A 3IJDA 1TMHA 1IZCA 2OYKA 4NG3A 2VVSA 1SJAA 3MT1A 3B9EA 4GD0A 3WNNA 3MUAA 3FYOA 1R38A 3C5QA 3A4AA 1EQPA 1J0JA 4IGNA 2XINA 1GTHA 1AJ0A 1F3EA 3N18A 1NFPA 5A8NA 2W0UA 4ZOEA 4FXJA 3FFSA 3LY0A 1ZALA 5BCAA 3IVSA 3VNYA 4HHMA 1EO5A 2BOFX 3C0LA 4HMEA 4YJ5A 4CD8A 1AH4A 2ZRZA 1V3HA 1XLFA 1EJTC 3I3EA 2XIBA 2VX5A 5I06A 4WDXA 5I3IA 1QK0A 4ZE5A 5BRBA 4R27A 3K30A 1P1XA 1L8NA 4GPNA 1GZ1A 3ABSA 3WKZA 1DJXA 3G6MA 3G1XA 3H12A 4ZO6A 1JD7A 1P0EA 4ICCX 3UYIA 1T0OA 3BAJA 1LLZA 4MF4A 3SCNA 3N4FA 3VIPA 8TIMA 4JN8A 4LTSA 2W79A 1JPHA 4N4QA 4LSBA 1TUFA 5AHFA 4L1WA 2ACRA 4LUSA 2P76A 2IQTA 4GUGA 3BJFA 2W61A 2WC7A 1XX1A 1M65A 4LAMA 4BY3A 4F66A 5LGXA 3S42A 3V5CA 4HB7A 2YX0A 4IIEA 5PTDA 4XVDA 3E74A 1TG7A 4HMCA 1TTJA 1FWAC 4IIDA 4C60A 3GXTA 2DORA 3WDPP 3DESA 3VNIA 5BXTA 2OWXA 3GG7A 2WCSA 2J7HA 4GMEA 1F4HA 4CUCA 1FWFC 2VR2A 3KBNA 4IGMA 4L6HA 4O50A 3FX4A 3O1NA 4K1GA 5DF0A 4XZHA 1XLJA 5JH2A 3UWEA 2VHLA 3RHGA 2O56A 2XJ7A 1YTEA 1JI1A 2I7GA 1UWRA 2Q3OA 2Z24A 2XVPA 4TX6A 4S3KA 4K39A 3C2VA 1HVQA 4RK8A 4DWSC 4GACA 3VC6A 4WF7A 1VAHA 2BHUA 3DFYA 1M68A 2YDSA 3LOTA 3DYOA 4DWSD 4PEKA 1OFPA 1B31A 3R8RA 3UG4A 3S2LA 3N14A 3TJLA 3EMQA 4D6GA 2BY3A 4LVAA 2V3GA 4I6VA 4IJRA 4QTGA 3BSMA 1C92A 2A5HA 2Z25A 1XH0A 3BXWA 1BLIA 3MHGA 4JYEA 1V4YA 4KCVA 2X7VA 3R0DA 3TMLA 1TWIA 1OZMA 4C1NA 3WDHA 1EA0A 3W7PA 1HJSA 2DGAA 4AF0B 1OBAA 3NCOA 2IPFA 2FB2A 3QV7A 1WZKA 3KDNA 2WKJA 4F0SA 2ESCA 2VC7A 5DT7A 3HMJG 3CZEA 3BQ6A 3EKGA 3DAQA 1UA3A 4O1BA 5CGQA 1ME8A 2WSKA 2NQ9A 1OK4A 3VGHA 1E4IA 4WUIA 1WDWA 5BXPA 2YOCA 3RIKA 3QR0A 4WGHA 2P8BA 1SJDA 4W84A 3TIMA 3LV5A 1Z89A 2PGEA 4Q8WA 5D9NA 2VEFA 4FLOA 3F03K 5CEWA 2JKAA 2QQ6A 3VA8A 4NZ3A 1PJ9A 4G7EB 4ML9A 3IJ8A 4KEVA 4C7FA 5FJUA 1RP8A 1E51A 1V3JA 2W3ZA 2VMFA 3DKLA 4F2BA 2O92A 5AKQA 4CQ9A 1V6WA 2Q6ZA 4TVUA 4GJIA 4FIRA 3ZWTA 3A4XA 3GH4A 3O9NA 4RNFA 4AC1X 1FDYA 3E2RA 1OB0A 1W2VA 4OHQA 1QOPA 3M9YA 3TJ4A 2PUZA 1LTDA 4GFIA 3R8GA 5G1YA 1RA0A 1HGWA 3NEVA 3VDBA 2WVSA 3FAWA 5C9WA 1SR9A 3DGRA 3N6JA 1EBHA 1PYFA 5MHBA 2CXGA 4MPQA 1FWTA 1H1NA 4D6JA 3O07A 3OQEA 4RE3A 4CVUA 3H4WA 3ZIZA 4F4RA 4Y6GA 2PGWA 4PTXA 2BVWA 4C90A 4B5VA 2VC5A 3NDYA 2YBUA 4IUGA 4RZ5A 1VIWA 4OFCA 4QR6A 2G3IA 5A8GA 3E0LA 3MSYA 1AFSA 2OZ8A 1UW9A 3W26A 3SB0A 3K13A 1E1CA 3YPIA 4ZZ9A 5A95A 2IUZA 1UC4A 1S5VA 3M46A 3WQCA 4EANA 4JPGA 4NZFA 5H8MA 4MUZA 2PDKA 5DMLA 4Q3MA 5FAGA 2OQHA 1C7SA 1K3UA 3TSMA 4PUUA 4BR1A 3SUTA 4OZOA 4JTDA 3AS2A 2R1KA 4LVDA 4WLCA 4QNEA 1SGJA 2OEJA 3SCVA 1XR2A 3DI1A 1J0IA 2HDJA 2F6KA 1F76A 1W6TA 4KRTA 3ABXA 4PMJA 2J7FA 3H2EA 1QDSA 4INFA 1GQNA 3PWAA 3OTRA 3FY1A 3TLQA 4L7ZA 3MUCA 1YBQB 2G37A 1E56A 1DJQA 1Q6QA 1UKOA 4ML4A 3O06A 4DUOA 2E28A 7ENLA 4GFSA 2DZXA 1E71M 4E5TA 3D47A 4LAZA 4A8NA 2J8TA 4GI8A 3WDQA 5BU9A 4O4WA 3W85A 5HBFA 1X8CA 5CPQA 1TV2A 1UH4A 5FF0A 1NDVA 1XS2A 2X1TA 1IXOA 3NZQA 4HD5A 2F2HA 4NYUA 2P5NA 1TA3B 4UNKA 1T8XA 4NZ5A 3N2TA 3I68A 3L7RA 2AMGA 2XFWA 2HVMA 2ZUUA 4GNVA 1P6CA 1AG1O 3T2OA 5CSRA 1W2PA 4ZB0A 3C8NA 3HA1A 3OBEA 3N12A 3LI0A 3TJXA 1UMLA 3R10A 3VNKA 1IT7A 1LT8A 4L1XA 4XZBA 2VEKA 1FWSA 3UPMA 4HHPA 2ZRWA 3DBPA 2BMBA 4NAFA 1OC6A 3GNDA 4PUKA 2BXVA 4WRHA 2R9RA 4PFHA 4GUIA 5FJIA 1E0TA 4UCGA 4UFHA 3UJFA 1LG1A 2ZUMA 4ZB5A 3VIFA 1JCXA 3QW3A 1MEWA 5I00A 1GJWA 1QFEA 4PTNA 3OLDA 2PFHA 3R25A 3WK0A 3P80A 5GNZA 4BWLC 2O9TA 1WZLA 5AOUA 1U1UA 1J0KA 3IUIA 1W54A 4RX0A 4WKAA 4XTIA 2BBFA 3KRSA 4W93A 3FNDA 1XXXA 1OGBA 3VDAA 5HUOA 3B0XA 3NO5A 4WDTA 1IGWA 4H6EA 4WX2A 3S9YA 3C56A 1T41A 2Y8UA 1NU5A 1PO9A 4ZXOA 1E73M 3CV1A 4Z1DA 3PC0A 1WP6A 2BDQA 1XP3A 3EPNA 1ZENA 1OF8A 3ONCA 5HMEA 2P10A 1FBAA 4G1KA 3EX6A 2FMOA 2B0MA 3PTQA 1XWYA 1W5OA 3CQHA 4XD6A 4UUIA 4F2UA 3M0XA 1ONEA 4NASA 3NO1A 3VC5A 4GVFA 3UXKA 3HV8A 1F2JA 4JFWA 1E9IA 5LIXX 4D6IA 3LI1A 1UD6A 4N42A 2YCLA 4LUJA 4GJ1A 1K7EA 1SM9A 3QYQA 4EX4A 1BXCA 3EX2A 4YU1A 4JQ4A 2YCJA 4A3RA 5HR7A 1XBZA 2XVKA 3SGUA 3JW7A 3TN6A 4OT7A 2W62A 5LA2A 4ZQNA 4QROA 1REQA 1OC7A 1UASA 4HGXA 4TUFA 1TWZA 1BPLB 1FP9A 4HA1A 1HJQA 1GYNA 5F1UA 3EDKA 5HUPA 4Z1AA 1C9WA 2HXUA 3ZLFA 1HFBA 4HPGA 1NAL1 3GBEA 2OLAA 3GTIA 4MNLA 2XIQA 4TO8A 2DT3A 3BMXA 1JJKA 1N55A 3W7NA 3HPAA 3XINA 1WKYA 3RPDA 3W7IA 2NV1A 3EKZA 2WJFA 3W7EA 3OEXA 1R9YA 5K3VA 5C2XA 3HFTA 3P0XA 3GXIA 3LPOA 3LXBA 1RJRA 4PMDA 5I23A 1W37A 1EX1A 1MQQA 1WX0A 3B0PA 3MKKA 1NEYA 4H8NA 3W73A 4MY1A 3KOXA 1R0MA 1QHOA 3UWQA 1RJPA 5AC6A 1SU5A 4NZ4A 4E2DA 1ZHAA 5FJRA 1AW2A 2PDUA 3W88A 2V5BA 3A9BA 5A6LA 1M1BA 1ZRQA 1WXJA 4MB5A 1FWEC 4NT0A 5CJMA 1PZ0A 3NQEA 1ISXA 4ZOBA 2AAAA 4O1FA 4UZSA 3UGVA 1Q8JA 1K8YA 2JGQA 3QV9A 3R5EA 2PZNA 1EB3A 3T1GA 1W9XA 3L12A 2XYLA 1SW0A 2E8YA 3E3HA 1G94A 3SCRA 5HK4A 3U4FA 4C6EA 3A64A 1RCXB 1VCFA 4R53A 5T26A 3GHRA 4XK2A 2ZYFA 1A50A 2H9AA 1FH8A 3W7GA 2J66A 1UUMA 4L5ZA 4NNAA 3LQLA 1OY0A 4Q8VA 2FH6A 3MHFA 2ABBA 1XJBA 5DN1A 3MUY1 3VUSA 4B2DA 4ZBCA 5AYZA 1QASA 3UR2A 1EYEA 1ZJHA 3MV11 3VOFA 1IEXA 1N8FA 1TIMA 4C6LA 1C8YA 2XGIA 5BNKA 4N02A 2UBPC 2OPJA 3DGBA 3TNBA 1GTEA 2V3FA 5LNVA 3R89A 4MLJA 1CLXA 4JZ5A 3UZXA 1TVLA 1GQJA 4CD6A 3SSJA 4QISA 3OYZA 4M51A 3II1A 1S1RA 3MYOA 1NWUA 4LGXA 2CCRA 3GTHA 1AA1B 1Z32X 5T91A 2I5GA 3LG3A 4UQCA 3SJ3A 1GKPA 4GNKB 3A3HA 3XIMA 3EEGA 4AZ6A 3SUVA 4E0CA 1EXPA 4BI6A 3S5NA 2ZWZA 3VFLA 3EWYA 3P5ZA 1ZCOA 3UU0A 1TFVA 3VGEA 3W3OA 2ZIDA 3WJSA 4A3QA 1UIPA 4LCRA 1JPMA 1KGUA 4LAOA 3WDIA 2V82A 3VMNA 4HCDA 1KBLA 2V3DA 4IICA 3KBSA 2OYMA 3GNOA 2AAMA 1RR2A 1FUYA 4C1KA 3NL2A 5HA7A 1KCKA 1PYMA 1XIFA 3LZ5A 4JIEA 3E38A 1CIUA 4EVZA 2IMRA 3GNPA 2WBGA 1Y5WA 1CENA 1LL4A 4R3UA 2GUBA 2D22A 3O0FA 4MY8A 3LHTA 2Z27A 3DFQA 7TAAA 4HZMA 1MEHA 1ZJAA 3T4CA 4MADA 3FVMA 4LS1A 1VFLA 4AD0A 3STCA 5A6SA 1LWJA 3T9PA 2VX7A 5C9XA 3IV3A 1T99A 2J8GA 1TIWA 2GVEA 2O4QA 3P82A 3CUZA 4FK9A 2EPHA 4DZHA 3AHYA 7REQA 3E0VA 5E5CA 3KL5A 3NWRA 2PB1A 4KEMA 3O6YX 4HIBA 1XYBA 1RBLA 1CLVA 4DJDC 3I6EA 2WM1A 4AXNA 2GDQA 3P8JA 1JZ5A 5TIMA 1CZ1A 1VQTA 2ZA3A 3QQ1A 2DW7A 2POZA 3IGXA 3XISA 4DJDD 4QM1A 2OLSA 4AISA 5C9ZA 4AVNA 3PY2A 2Z2BA 3LNPA 4LVBA 2EBNA 2JEQA 4XZWA 1Q7MA 1OG6A 2X0YA 3Q4DA 4IX0A 1ODUA 4H2CA 1C91A 3L66A 3IJ9A 3NR0A 1LDCA 1VPXA 1Q66A 4FOJA 5C8BB 4M56A 1XGZA 4HPJA 4UQBA 2ZZ5A 2DEPA 3W70A 4CN6A 4JIIX 3FEQA 3OHIA 2R91A 5TD4A 1V3MA 1EWDA 3QSRA 4GC4A 3PUGA 2PU0A 4Y9MA 1VEMA 1JRBA 3VNLA 4GO8A 2A3CA 4NP7A 4JFVA 3WX7A 2VZOA 3GH5A 1FWJC 5C2CA 2NVCA 3NQMA 4U3CA 2X40A 2VRKA 3B05A 2EPMX 1CT5A 2HVOA 2PRMA 1KM2A 4XSLA 3UZWA 5LSMA 3QTGA 2BXZA 1ICSA 4QE1A 3CV7A 4U4MA 2IQ0A 3T8LA 1R3TA 4DX3A 3HIJA 4KRZA 1OHLA 3AZSA 4KGJA 1H5YA 2GVYA 2OEKA 2WHMA 3D0CA 3NSXA 4G56A 3SRHA 3DBNA 1QPRA 3UBPC 2C71A 4AHPA 2CLEA 3NQFA 1LWHA 5DQPA 3ZYZA 3H21A 4PE8A 5F2GA 3ARPA 4W4QA 4QE4A 3GDLA 3QY7A 1QW9A 4X2PA 4IMGA 2YDAA 2QGHA 3WH8A 1W8SA 5FACA 5B7ZA 5F2IA 4L9ZA 4HSOA 1L0PA 3KRZA 3MO7A 1B3ZA 3W76A 1ME7A 2DZPA 5FEZA 5M3WA 3KOZA 3NG3A 4ADSA 4JTKA 2PP0A 1TV4A 4DJFC 2XTKA 1QXLA 3L21A 4B5TA 4O4VA 3I6TA 3AIBA 3GXMA 3G1FA 2XG9A 4DJFD 5JBFA 1IIHA 3BOFA 1ELSA 1KXHA 3EWWA 5EB8A 1UOZA 1W1VA 2Z4GA 4ORMA 4JQAA 1HXJA 2PDPA 1YXCA 3AJ7A 5C0QA 3A23A 3LHVA 1XV8A 3GZAA 2BVDA 1TR9A 4O15A 1DJHA 5CPTA 4HTBA 4NRSA 1Q2RA 1L6YA 1H7RA 4XZNX 4P7QA 2GQAA 2DH2A 2WYSA 2WVVB 2QDGA 1WZMA 4EF9A 3AQUA 4ZQCA 2P50A 8RUCA 3F4NA 3DU0A 3UCCA 4NY2A 3BW3A 4LAKA 2H8ZA 4C5YA 4DY1A 3F2BA 1E0XA 1YDNA 3QJAA 3SR7A 1OADA 4GQGA 2VCCA 1NQ6A 1O4UA 6REQB 3URNA 4PC8A 3G24A 5T9BG 2QEZA 1XIMA 4RDYA 4GBUA 1POJA 3IIPA 2QLYA 5KMYA 3MUZ1 1KB3A 3LGDA 3VE9A 1OFOA 2E7FA 2E6YA 4M1RA 2OKOA 3EPMA 2D73A 4ZEPA 1W5NA 3L0NA 4AYGA 4L65A 4ERGA 4IFKB 4ZMGA 2C1IA 2NWSA 1PZ1A 3FJ4A 3UQNA 3W1UA 2QYGA 4LB3A 4AHQA 4LS2A 1K77A 4IOTA 1UD2A 3MDUA 3QMRA 4Q8TA 3TQKA 1AQFA 1RZMA 3GR7A 5E0CA 3QTPA 1DE5A 5AHEA 4MZ8A 3S1VA 4UQ9A 3PBWA 1V6TA 3FAXA 3WH5A 1LP6A 3RF9A 4UXDA 1UD3A 3EWUA 3SADA 3LHYA 2R8WA 3IJQA 3LBMA 1Q6FA 1PTAA 1OGGA 3LN3A 1Q85A 2V69A 1VHNA 2QCCA 3TYUA 1VPQA 4KWOA 1V77A 3D3FA 1YLVA 4DF0A 2GOUA 1DWIM 3RPMA 1C8QA 1ZAJA 1QI2A 3GU1A 3WQOA 4C6DA 2YDRA 1D2KA 1A5KC 4US5A 3WF4A 3A6OA 4HU0A 4R85A 1BF6A 3W81A 1EJWC 3QF0A 5FJJA 2G41A 3TAKA 4C91A 3UG3A 1JDDA 3PN8A 1EUNA 2XH7A 2DPEA 4QGCA 1JUBA 4GVHA 4TX9A 2GQ9A 3PPFA 1KFEA 3WFLA 3OG2A 3N6QA 4ZVJA 1AZ1A 3ZM8A 3QC0A 4ENLA 4R34A 2B4GA 1F73A 2QW5A 1T6MA 1UWSA 2NXGA 3KOFA 1WKEA 1GZGA 1TRDA 2W67A 3AHVA 2LLEA 1UP3A 4CQ8A 3QMTA 2CU0A 7PTDA 2Y8VA 2QDDA 5A2AA 2TPSA 1A5CA 3TZNA 4DNHA 4AIOA 1XI3A 4ZOCA 4J3XA 4LX4A 3L23A 5H2ZA 1TTPA 2NT1A 5IBXC 3SO7A 1VCGA 2VL4A 2ZZ1A 3HG3A 2DZAA 4WQ6A 2HVNA 3BWWA 2HQAA 4ATLA 4KIRA 5J04A 3C0QA 2Z1VA 2HNHA 2XFFA 1I2OA 3LRKA 1PSCA 4JTFA 1S3TC 1MNSA 3DYPA 1XFBA 2WZIA 1WXYA 1AMYA 3VCNA 3AIVA 3UNDA 3HOJA 2YL5A 2JBMA 3ZR4A 2FVLA 3EB4A 2FVMA 2VENA 1H1ZA 1VCVA 1I1XA 3N2OA 5LA1A 4ZGYA 1R2TA 2YPIA 5DXYA 4LFYA 4YTSA 4L4PA 1JZ2A 1GVRA 2FGLA 2ZFAA 5D32A 1LL6A 5H1WA 5EBUA 1QPNA 1YKWA 3S5YA 1HZYA 3APGA 4O0KA 1ZQ5A 2R94A 1UD8A 4QJ5B 3C2FA 2RGMA 4KT2A 5I5RA 4S2BA 3W2UA 1BAGA 1PHWA 2NXIA 5FAJA 2FIQA 2JF6A 2NT0A 3LCFA 4GOAA 4QS6A 4YTRA 1MEIA 4PCPA 3V3WA 4EXAA 5I78A 4YCPA 2EF9A 5ABHA 2X7WA 4M0XA 3KCOA 1D7FA 2FTYA 3UGRA 4E38A 3K8KA 2PF8A 1CNVA 3LU2A 1PIFA 3M7SA 4QDMA 3W7QA 4A21A 1T7LA 1IE7C 4GI9A 4W7UA 1HKKA 3V36A 4UB9A 5D03A 3ZJ7A 3WFAA 1SO3A 3U6WA 3S9IA 4GINA 4L6DA 1V51A 1KM5A 4LUSB 1RBAA 1I6NA 3BSGA 1DBTA 4O54A 1XCFA 6XIMA 4J3VA 1JG9A 1R7OA 2VVNA 5F4XA 2WNNA 3EOEA 5XINA 4YPJA 3WSUA 1I1WA 2VD9A 5DLCA 3T4WA 3QSTA 1NELA 2YBTA 1HJVA 1HL8A 3KWSA 4JIRA 4E2VA 2GSHA 4MMWA 3QKEA 4FLSA 4WVXA 5L9FA 2PTZA 3CWOX 4DZ5A 4O52A 3V16A 2IXUA 4UTMA 3WUEA 4PMUA 2YFOA 4UMCA 2O55A 2GJRA 1QWKA 4DBWA 4KEZA 4PTWA 1NIUA 5BXSA 2CLLA 4A6GA 1FXQA 4IP7A 3OZPA 1B3WA 4O18A 5AYXA 2AKZA 3RM8A 5IFTA 1O5RA 3FVDA 1VYSX 3ZVHA 2ZE3A 5TQLA 1YRRA 1O1ZA 1PS9A 2A3BA 4ALDA 1V5XA 4Y7EA 2VGIA 3ITLA 3ITYA 5EMKA 3W84A 2DZTA 2FZ9A 1ZL1A 3NQDA 1X6NA 1OJXA 3W6YA 4NL1A 5FF2A 3F4DA 4XWUA 3LCLA 4IL0A 1EEPA 2ACQA 3THAA 3G5EA 3FS2A 1M5WA 1M7PA 3MVIA 3VX0A 1RSCA 4FNSA 5M03A 3TDFA 3KDOA 3SURA 4PMXA 5F2LA 2ZKMX 5GNYA 4C1NB 3L2MA 4N6FA 1BVZA 2WCGA 2GVJA 4LF1A 2Z1KA 2JIWA 1E70M 4RZBA 2NQJA 3OIXA 3RLGA 5G4HC 2P8CA 4AAJA 3APTA 1XG3A 3MP3A 4OE7A 5CLWA 3CUHA 1ONXA 4AFYA 1SFJA 4H6KA 3O6DA 3UJ2A 1MW0A 1SZRA 4WSJA 3SCPA 4KFPA 4H9ZA 3AU2A 2FPTA 4TIMA 3CMGA 4L4MA 1J93A 3ZR5A 1JAKA 3EDDA 2OGYA 1J0ZA 4HU4A 5KZMA 2JIEA 3L67A 1XDJA 1T8QA 3W82A 2PCEA 4AZ7A 1KGXA 1SFLA 1ZGDA 1E9LA 3BE7A 3W4RA 2WANA 1PV8A 1LCOA 1DXIA 4Q8UA 3CEUA 4IUOA 1YXYA 4CCDA 2QDHA 2B7OA 1KRCC 1TX2A 2PWFA 1POKA 1UZ4A 1LQ0A 3UXLA 4AYSA 4LQ1A 3ITGA 4M5PA 1Z9AA 3FGCA 2VX6A 2GLKA 3N13A 4E2BA 1EF2A 3S2CA 1CXLA 2EKGA 4N9CA 4AZHA 4AIBA 4MAVA 3FHQA 3IIZA 3K8LA 2DQWA 4N4PA 3HU7A 1K02A 4W7VA 4OBSA 3TNOA 3CWNA 2Y89A 3SN1A 2VXNA 4J40A 1W9UA 1JXJA 3BICA 4M6VA 4BHYA 3N11A 1K9TA 3S1UA 3WQ6A 1XLBA 1N82A 1ZBKA 3NM1A 3QV8A 4H7VA 4HZ7A 3W2JA 1H5VA 1ECQA 4WJ8A 5AYBA 1Q2SA 4KBXA 2YJQA 5KZEA 1HKWA 4QHRA 3HZ3A 3W2MA 3RCNA 4OJYA 3IGUA 1TSIA 4DBUA 1WUEA 3W9ZA 1RP9A 3VGDA 2V38A 1E1CB 2OSYA 2UWFA 1AW1A 1TPUA 1X38A 2GFTA 1E4NA 2QUUA 2DUXA 2TRSA 3EOOA 1L6SA 3FA4A 3PZNA 3WF2A 2CBIA 2Y70A 1JF5A 1A4LA 3W7OA 5LXXA 1MZHA 4FMVA 2GOKA 3QXBA 4W86A 2EPNA 2GUUA 4LRTA 3WG6A 2V2HA 3SJNA 3U3HA 1QPKA 3JU2A 3KWXA 2QV4A 3WMBA 5A6TC 1S38A 4AX6A 4OBRA 3WD0A 2PBOA 1EIBA 3M0VA 4AZCA 4HA4A 2ZA2A 4DQWA 4NX0A 1VGAA 5I0DA 2EO7A 5H8PA 3M43A 3C52A 4DF1A 4JHOA 3H6OA 5CC7A 2G3FA 5DBUA 4PTDA 1KCZA 5A8OA 4WXZA 1Q3NA 2VJXA 3W72A 3DFHA 4WY0F 4RUBA 1NOWA 4CQCA 2DVXA 2JEPA 1H7XA 4G9PA 4X9SA 2ADAA 3WD1A 1EJUC 4JQ2A 4AB4A 2MANA 3M0KA 2YZ5A 3IJLA 2WKLA 1G5AA 5JH1A 3S6DA 1X7FA 1VS1A 1W5MA 1Z3NA 2BXYA 3CH9A 5K9DA 3C0SA 3VCCA 1QI3A 3NXLA 2PI6A 3ARRA 5BW6A 1IXPA 3KAOA 2EGZA 2ZZ2A 5AVNA 1GVSA 4OUEA 1Z42A 5KTLA 1KRBC 2NX1A 1MVYA 4BF7A 1DWJM 3CK5A 3CZJA 3QRHA 1Q65A 1UR9A 1EHNA 1FHLA 1XCXA 4ACYA 2CERA 5MKGA 5A6BD 4NAFB 2QCFA 4S23A 1UCWA 2HJPA 2C3ZA 2Q71A 1GG0A 2WMIA 4M6QA 3QC3A 4HNTA 1HKMA 2IPWA 4MJZA 5M17A 2DY3A 1GW9A 1MFVA 5M5DA 1PUDA 3S2JA 4HYWA 4PR4A 2RDXA 3H2MA 2X2GA 1MSSA 3WF0A 3WF3A 3G22A 2PE4A 4IP4A 4JTUA 4LV9A 1W32A 4LY4A 1X1OA 4UR9A 3R43A 1NDZA 2QNEA 2J47A 3GS6A 3M0LA 2OZTA 1DJIA 1TJRA 3H53A 1PX3A 3O15A 2CFFA 3BL3A 3DG7A 5HXMA 3M41A 3NO3A 3R0KA 5XIMA 1SYTA 4BZYA 1JDAA 2BGNE 2E9MA 3SY1A 1XKYA 1JYXA 3BLPX 1XIBA 2WSPA 4K8GA 5CCZA 5KSWA 2VDGA 4F3HA 4QEHA 1K6WA 1WCGA 4O0QA 2QDEA 1CTNA 2OFJA 4C7GA 1OT1A 3RJYA 3MA8A 1UJPA 4HNVA 3QPYA 1TYGA 4HU8A 4Q8PA 1UQZA 2A85A 4J5NA 1XLHA 4OBTA 3VIMA 1QATA 2YCLB 4Z2HA 5LYRA 1R3RA 3LXAA 4MB1A 1NVMA 2XSXA 1G67A 3BV7A 3MDWA 5U4NA 2O4MA 1THFD 4BJHA 1JPIA 3UR5A 2I57A 5C7HA 4WJEA 4CNTA 2OGJA 3UZJA 1VD6A 3I7QA 3S2NA 4X22A 1Q7QA 5T8GA 4S3FA 3SUWA 5AFDA 1IEWA 1RLDA 3AALA 1H7WA 5I02A 3FDKA 1REQB 3W27A 4HU3A 3RX2A 3WJYA 3CTTA 4B92A 3D5HA 4Q8MA 3PJTA 3QOKA 1UQYA 4W5ZA 1K7XA 2RDWA 3S1GA 3TOPA 3S1XA 3V1HA 3L0KA 4R5EA 4TVDA 4A3HA 3GUGA 4KW2A 1P5BA 4H7ZA 1GYMA 1Y0EA 3UWYA 1EPXA 3LSCA 3O7UA 3PBMA 2CZEA 1JCMP 3AISA 4WHBA 1PKYA 3S83A 2NUXA 3LK6A 5FF4A 1I9CB 3GVGA 3HQOA 3LEPA 4FNRA 3KTSA 4KH2A 1TKKA 4WJXA 4E4UA 1JL8A 3POHA 3TAOA 4PTVA 3LHWA 3H2CA 1QNQA 4ZL1A 2HISA 1TZZA 4CKQA 4IPLA 1ZB5A 5I03A 2ZX6A 1SPQA 2PDIA 3W53A 1B9ZA 1XW8A 3E0FA 4LWWA 3CUIA 1JGMA 4PSRA 2BZNA 3IAQA 4FOKA 3MBDA 1XYCA 4A4AA 3VIHA 3PULA 4JL1A 3W7LA 1W3IA 1US2A 3DFPA 2H9AB 5F1VA 3M0HA 1HQTA 1R3WA 4RCXA 3ID7A 4UBPC 2BHZA 4L6OA 2ICSA 3EGJA 1C8VA 2C0HA 4DZIA 1DJZA 1OFAA 3SZ8A 3H24A 5D02A 3IAPA 3CYJA 1LBMA 2FHBA 2BOGX 3W1TA 3BG9A 4IQEA 5HULA 1MW3A 3LMZA 3GTNA 5A2CA 4B9YA 3R7MA 3PSVA 3SRDA 3DFOA 4C6OA 4M6PA 4Q7BA 3BPWA 1GT8A 1GKRA 4H04A 1JULA 4PSPA 3C61A 4B3ZA 2J9XA 5D2TA 1B4EA 1H51A 2HBXA 2V5JA 2AOSA 3FA5A 2I1OA 3EB3A 3E02A 4Q4OA 3S0CA 1QW7A 1SO4A 4L61A 4EOUA 3U0HA 3TQPA 3MPGA 1F4AA 4NI8A 2FPYA 1XLLA 1BYBA 3VKDA 1VBGA 1XGDA 3OU8A 3H2AA 4URIA 2FKPA 2BS9A 4CU8A 3GRIA 2NLYA 1F07A 4IJBA 5FOOA 1PKMA 2GQ8A 2A3EA 1S5NA 3LS9A 4LYPA 5A2BA 5HPCA 4EKJA 3TWBA 4U5KA 1EL3A 5AC5A 3NSNA 4JFSA 3F5JA 5U7SA 3TFXA 3WELA 1SJCA 3U7VA 1M7JA 1EH9A 1RV8A 3W7CA 3G1DA 4GX8A 1W9BM 1ENUA 3VX1A 1MQRA 3PVFA 3TH6A 2OSWA 1UH3A 3H7RA 3L0GA 3TU9A 1ZJIA 3URQA 1PTGA 4QQ3A 3IK4A 3N3MA 3P60A 3QH2A 3TC7A 1XDLA 1ODZA 4LALA 3TN3A 2A0NA 1QI0A 2GSJA 2Z2AA 2RH9A 1EJRC 4XUGA 2Z29A 1KV8A 3B9NA 3DFTA 1JCTA 2OB3A 3KBJA 4QSHA 4A2RA 1C29A 4NUWA 1HO1A 3L4VA 3OBAA 5I77A 3GWQA 2D2HA 4XD3A 1NWSA 7REQB 4LCSA 1YX1A 3ME3A 2PTXA 3K4DA 2YIHA 1TUXA 3S8HA 4NNCA 3TEVA 1VRDA 4JHMA 4H8UA 3AHXA 1E0VA 1LLOA 1AODA 3T0CA 1V0KA 1CGVA 4CVWA 2VC9A 1CYGA 3W7JA 1N8IA 3APYA 4OOUA 3BGGA 2HV5A 2I9EA 2VYOA 5DCBA 3LYEA 2WVTA 3QV6A 3NIYA 3UJRA 2C91A 4FX8A 2C7FA 3FHAA 1VFOA 2DZWA 3ITXA 4IZGA 2EJ1A 3RITA 3LXCA 2E8ZA 3ZSSA 4QP0A 1TJ1A 5DT5A 5FEPA 3ES8A 2VGGA 3RCYA 2DVUA 4HNLA 3EAUA 1RUSA 3AS1A 5HMSA 3CIWA 4Z1CA 4IF2A 2FGBA 4IMCA 3LHUA 1RH9A 3TA6A 4J1OA 1QPOA 3KXQA 1NH6A 1OCJA 5DBTA 1UHVA 3L5MA 4JN6A 3W22A 3OJGA 1JDCA 3WNKA 1C90A 5CZTA 4NRRA 1E9YB 3HPFA 5HNUA 2FJUB 3NDZA 2J78A 5C9RA 1YTDA 3M6DA 1PKNA 2AGTA 4H00A 2H90A 5HNRA 1S2VA 2E5CA 4XUYA 1Z44A 2ASHA 4YMZA 1B3OA 1BXNA 2V68A 2BASA 1QK2A 2P3EA 4TQTA 2CIPA 5HMFA 1WDSA 4CNSA 3LZ3A 4JTCA 1EJVC 3N2XA 1XYFA 4O8RA 1XRSA 3DZ1A 2BODX 3NNTA 4Q4QA 3W1AA 5KZDA 4NZ1A 2CXEA 3K1DA 4O19A 1EKOA 4BEQA 1PX8A 4Q33A 3DC0A 4MFDA 1F9CA 1UMYA 5CC6A 3CUFA 4ZSTA 4C65A 3CH0A 3CQIA 3B40A 2PWGA 5C9UA 1A49A 2PDWA 5ABFB 2YCIX 1FWCC 4UNIA 2Y4SA 5AVHA 3HGRA 1QRQA 1YE6A 4UTKA 2OODA 4W89A 3DDMA 1ZAIA 3CHEA 5E1QA 1DL3A 3BQ5A 4C6KA 4MIMA 4GY7A 4ACZA 1SSGA 3AMDA 1JDFA 5AC4A 1F8IA 3VZXA 3PNZA 3VILA 3HO8A 3W7DA 1J18A 4RZ4A 5EMJA 1R3QA 5BOOA 3R6IA 1SFSA 3AYRA 1EDTA 1HX0A 3ALGA 2ZRVA 3HQNA 2VEMA 3GW0A 4JTJA 3TTEA 3NJ3A 2DDXA 5EYWA 3G8RA 4UIOA 3M5VA 1LM1A 2GJXA 3JS3A 4GBDA 1WBJA 2OJPA 1Q6CA 3GD6A 5FEWA 4US5D 3E6EA 2CBVA 4EPEC 2J75A 4BQ3A 4LJ3A 1XH1A 1IQ8A 5HQEA 4S3EA 2X09A 4ZOAA 1KRAC 3C2EA 3I4KA 4M8UA 4A8RA 3L68A 3OGSA 3GYEA 1GK8A 1RXOB 1IR1A 3IARA 2E77A 1CDGA 2YCEA 4D6DA 6ALDA 3R0UA 2UY3A 9RUBA 5I7GA 3GU9A 1JZ3A 1XD1A 3G1HA 1UP2A 1H63A 1R3YA 5ABTA 3UZZA 2FZBA 2BGQA 4RV3A 2QAFA 1D3HA 1OT2A 2ISWA 3W87A 5I24A 2PCQA 1GOKA 3F2CA 1Y7VA 1O5KA 3MU7A 3GK0A 3GU2A 4X0NA 1BXBA 4IFOA 3AIRA 1J5SA 3WBEA 4LW7A 2WZTA 3RX3A 3VTRA 1I2NA 4A05A 1EJSC 2C13A 5IXEA 2C0AA 2H6RA 4X3ZA 4XBSA 3KL3A 1RJQA 3ARWA 5LHEA 1FHDA 3ICJA 1XUUA 2Y7FA 1MDLA 2KZHA 4JIPA 4ZTXA 1AQHA 4H83A 2YZRA 3MSRA 1QCWA 4MWAE 2HNEA 5K7JA 4NNBA 4NILA 3A3WA 3BVJA 4NYYA 5EU9A 1TPH1 4I8DA 4F79A 1FWDC 1A80A 2YR1A 4ZTYA 1L2UA 4PUJA 4Q4RA 4XBJA 4GC3A 4RXFA 3EYPA 4U33A 4JR5A 4KF1A 1FWRA 3ITVA 5D09A 1BWVA 2PPGA 1KTCA 3VZZA 1GVEA 1UR4A 1WDQA 5IRPA 1EDGA 1MO0A 2UY5A 2E0PA 3CT2A 4RL3A 2VOTA 5I3FA 4QJ4B 4QAWA 1TPDA 2OYLA 4FZIA 4D6HA 1I8JA 3WQVA 2E25A 2G96A 3QBUA 3EWXA 4AD5A 4GUFA 3RO6A 4O1EA 3MV01 1X96A 3LA4A 3CHFA 3GG8A 1D7KA 2FJKA 2P1FA 5D2YA 3NQ8A 3OLGA 3ECQA 5FD0A 1OFQA 2PC8A 4C5ZA 3MJYA 3V5OA 3QGVA 2EPKX 3STPA 3Q94A 3SDOA 3S3GA 1JYWA 4JYFA 2PWHA 3ZT7A 1AUSL 5ECVA 5FL0A 5DEZA 2IXVA 5KZ6A 4ROPA 4FALA 2ALRA 2GK1A 1IIGA 4L56A 4IFKA 1MXGA 3WLSA 4U31A 2J7CA 4J3SA 2AQOA 5DCDA 3ZLGA 2VNCA 3H23A 3KBVA 2E09A 2YFNA 3MYPA 3MJMA 1ZS2A 4JICA 2I14A 4RDZA 1UWTA 3PNUA 1H0GA 4GGBA 1X7IA 2A21A 3UPBA 4Z2IA 9XIAA 3SGGA 3WK1A 5D8ZA 5A8QA 3PZVA 4YVXA 2BV9A 3OQ8A 3VNDA 2NQZA 1JXKA 4D1JA 2EJAA 4GHRA 4HJWA 2Z28A 1EGZA 1XBVA 5HANA 4TTGA 1VFSA 2B7NA 3NSMA 2NUWA 4AC7C 1TTQA 3EX4A 2OWCA 4C6JA 4ZE4A 3MZNA 1OF6A 3N9KA 3JZUA 4DPQA 3W6LA 3T7VA 1JPDX 2Y6ZA 2Y61A 2GQ3A 2PODA 1BKHA 3CPRA 4D8AA 3CBWA 1WDDA 1J8VA 3E5BA 3QEZA 1ZP3A 2CETA 4DNMA 3ONBA 4FLRA 1VR6A 4CNNA 1XLGA 1DQWA 3LENA 3COTA 4IJCA 4MUPA 2Q8ZA 5DRCA 4IQJA 3TP4A 3IIOA 2W91A 4XZMX 4V27A 5C2GA 1R6WA 4JTIA 2ACUA 1RLCL 2CPUA 1JZ7A 1EC9A 4V33A 2NQHA 3WQ4A 4ZFCA 4YIWA 4MTVA 4GYJA 3WO8A 2XZ9A 4YS1A 3HV9A 3RRXA 3POCA 3W71A 2WJEA 4MSSA 2FYMA 3OA5A 1BKSA 1K70A 1FCBA 3OBKA 4LYRA 1YHTA 3GKFA 3V0UA 2DSKA 4JY9A 4PUEA 1K03A 1NDYA 3GC5A 2E9LA 4ZXLA 3M5XA 4AWEA 1V7AA 5EKYA 3FN9A 4A2SA 1V6VA 1HP4A 4FNQA 3DEQA 4PL2A 1WXZA 3ZVHB 1O6IA 4ZR8A 4I3GA 3E2VA 1WOAA 4UTWC 1UH2A 1ML1A 1GHSA 1ALDA 4LVGA 4JXCA 1Z7AA 2E1WA 5GJNA 1ZAHA 1J79A 2ZX9A 1HN1A 4UR8A 4IIFA 4RJEA 3TN4A 3DHFA 4H7CA 7A3HA 4WKFA 5KETA 2FVKA 2KAUC 1O1HA 2E67A 1KA9F 1DQXA 1NWRA 4JEQA 2EHHA 4PTMA 1Q6RA 4DJEA 4S3DA 3BJTA 4PMNA 3PANA 1W1PA 4FNPA 3PPCA 5C71A 2VM8A 4RPQA 3B9DA 2Q8XA 4XD4A 3NVDA 1TWDA 1JCNA 4LBRA 3WEMA 2I9UA 4BK9A 2CHNA 2XHYA 4OOZA 3PZTA 2PTDA 4DWSA 4GVGA 3TR9A 3USBA 1MUMA 3KX6A 4JD4A 3WK3A 2WSQA 1I60A 3K1GA 1OCNA 3DENA 1SZNA 2NZLA 4O8AA 2GWNA 3KCLA 3FKKA 3PTDA 3DUGA 4ROQA 4XO6A 3GUWA 3O16A 2EEXA 3VM5A 2V8ZA 3PFRA 1Z8AA 4RDVA 3UZYA 3RN6A 3ZWSA 4TOQA 4WR3A 2QMJA 4HNUA 1FDJA 1WE5A 3I6RA 5D2WA 1ADSA 3FGCB 2G4JA 1AMKA 2OEMA 2G0WA 5D37A 2PDCA 4F9JA 2VDIA 1WYIA 5A94A 2D23A 2ISFA 2ZX5A 3BLEA 3B97A 3U2EA 5ABGA 4GUHA 1FHVA 4E3TA 4GYPA 4GA8A 5DMYA 3G3MA 3V5FA 5JIPA 1P43A 4U5IA 1HF6A 1SW7A 2X1UA 4LUIA 1MNZA 3CAQA 2J9ZA 2VT0A 5K9CA 3W1RA 4O1AA 1E4MM 1MUCA 2C18A 3U48A 3RK8A 3V0SA 4J3WA 3PZQA 1OIMA 3U7BA 3PWIA 4W85A 3B0VC 1TPC1 2QZRA 4FEZA 3T78A 1W17A 1OEPA 1EO7A 2NVDA 2RHGA 3UP8A 1A5LC 3EZ4A 2VFIA 1US0A 4PCTA 2XVGA 3IS4A 1UPPA 4PCNA 2BY2A 2HBVA 4Q22A 1P0BA 1Q6GA 2ATMA 3VNZA 4FOUA 3KM8A 2DJXA 4POCA 5H6HA 2BWGA 3AYSA 1ZBWA 1XKJA 4PB4A 3BV4A 5K4ZA 2XM1A 2PP3A 3VOJA 4LAUA 1A5NC 3B9OA 3HG4A 2QF8A 4AZCB 4U2ZA 3DKJA 4DXVA 3I3DA 3W25A 3L5LA 3KOYA 1BVWA 5BRPA 4CD4A 2UY2A 1BRLA 3G6LA 1RD6A 2P0OA 4S3CA 3T6CA 1VFMA 3BG3A 4G2DA 1JQVA 3G1YA 4Q6XA 1C3FA 3Q65A 4UOJA 4I6KA 1KLYA 3ABRA 1XUZA 4ZA0A 4OV9A 2GDUA 2IS7A 4YVVA 3TR2A 1P4CA 1YYAA 4WDWA 5E70A 3IGSA 3L5AA 3URBA 3G0XA 4E3VA 3BAWA 1OX4A 4XV0A 4E6MA 2OO6A 1B4KA 4YTTA 4N2YA 5HAOA 1CGXA 1YW1A 1ZU8A 2QVNA 3WDRA 3WEZA 2VEGA 3CQ0A 3M0JA 2BVYA 2A7NA 3BAIA 3E49A 3LM3A 2HZGA 1KBKA 3LHZA 2JKEA 5JBDA 4NU7A 2B31A 3AMGA 3WLRA 2V5DA 2XFRA 3E0IA 3W0KA 3SQMA 1E1FA 1QJWA 5MKGB 3OOQA 4XIMA 4HPHA 3QHOA 4TVCA 3R2GA 3L4ZA 4IWWA 3ITOA 1PZ2A 2J7DA 2WMIB 3VIJA 1Q6EA 1SMAA 4H9MA 1E6QM 2VZVA 3LCGA 1O68A 3AC0A 5LNRA 4UTIA 2X8RA 3L9CA 4TMCA 3HTWA 1XIEA 2PDBA 4KESA 5E6ZA 3IANA 3URAA 4JIQA 4A8LA 1ZFJA 1EQCA 4LOCA 5CH9A 4W7WA 3ARQA 3FXGA 2VX4A 1VFTA 4GWEA 3B04A 3A24A 2CLPA 2ZUSA 2BSLA 3HPXA 3PZOA 3VIKA 4OVXA 4P5UA 5BYWA 1XCWA 4IMFA 2I5IA 1GZJA 5CQ1A 2CZVA 4W9TA 2GZXA 4DN1A 3MMDA 3E2QA 3VDGA 2VFFA 3N19B 1VBRA 4HSNA 3U5UA 3CO8A 2B81A 4WY0A 2RFGA 5AHLA 3PTKA 1D3CA 5D4YA 4GO9A 4K37A 1O95A 2PP1A 1EWEA 3MTWA 3LTSA 2NSXA 4DAIA 1XC4A 1RQEA 3AXXA 1UKPA 3VIGA 1MFUA 3MUIA 4XAFA 1LWIA 4RW3A 3IEBA 4LVFA 2VDHA 3WD4A 2EG8A 2OOFA 4FLQA 4JTAA 1MRAA 3CGTA 4L64A 3ARUA 1OGSA 3QLLA 3U9IA 4PZVA 3STEA 1VB9A 3BZJA 1J96A 1KXQA 3BUVA 3WLQA 3BLDA 4O16A 2CC0A 3WFZA 5DCEA 1VPYA 2P0IA 5AC7A 3LPGA 1KCLA 5IHSA 4BWLA 2ZRYA 2D2GA 1LYXA 5CPMA 1KXVA 1OYAA 3OVPA 5D30A 2FDMA 1E5JA 1G4SA 3T05A 1F74A 1AZ2A 2E1DA 3VI2A 5B7YA 2NLIA 1PCWA 1EXBA 3BMVA 4QNWA 4XD5A 3LGGA 4S2CA 2BLEA 2PDYA 3MQTA 4B9ZA 4G6CA 4CLMA 2WMKA 4K6AA 4PUMA 3DFSA 5A8PA 4LEQA 1E6NA 2QPSA 2CLKA 5C7VA 3IPWA 4F40A 4FP1A 1DWFM 3A22A 1FQ0A 4DM2A 1T5AA 4BQ4A 3BLIA 3PBYA 1EA9C 3VPLA 1W1YA 5BZAA 3HB9A 5CBJA 3WN6A 1R30A 4J4KA 1Q6DA 1KM0A 3GW3A 1QO2A 4YL2A 2PWVA 1WDPA 4JCMA 5HNTA 1VZWA 1UZ1A 3AU6A 4A8IA 3VOCA 1H7OA 1WDRA 3C8FA 2AL1A 1FKXA 2GDVA 1HNYA 3EPOA 2WMFA 4XIAA 1M04A 2ZXBA 8XIAA 2A79A 2YYUA 3GNRA 1FP8A 2RAGA 3N9SA 4BFAA 2V0TA 3NGFA 2PDHA 5EMLA 2ZZ6A 2Y5EA 3QN3A 1B9BA 2R1NA 4P8XA 1J11A 5AYIA 4XAYA 3LNMA 1ESWA 1H4PA 1E3ZA 2XPKA 3LUTA 4CNPA 4J7RA 4MWAA 4JHZA 4DXKA 1QOXA 2ZX7A 4D6FA 1N8WA 2DUZA 2ZUTA 1PVNA 3MZ2A 3NUKA 1HJWA 2ALDA 1EF3A 4UMAA 1ZBCA 5AECA 3EX3A 3OGRA 3LD5A 3FXYA 4LYQA 3CXOA 5CSSA 3FYYA 5CXPA 3AOFA 1QHPA 2VFGA 2GYIA 3B3DA 1VJSA 5J5DA 1RAKA 1E55A 4Q32A 1LRTA 5EL1A 1X1NA 4PMQA 3KVJA 3MANA 5D9MA 2A3LA 3Q67A 3LDVA 3HJEA 2A7PA 3EA3A 3SCOA 1O60A 4TR9A 4KGLA 2PRLA 5AZ1A 2C8NA 1CGYA 2ZUWA 3W00A 4O0ZA 1ITQA 1J0YA 2ISSA 1TVPA 1J4EA 4P7LA 1KQZA 4W88A 4FF5A 4LV4A 4QRNA 3M64A 3DN5A 3UYCA 1K9FA 2XVLA 2V5KA 4I5UA 4UTHA 1OG0A 4PBFA 4AUBA 1ZZMA 1PZ3A 1BFNA 2BTMA 1BSIA 3F7JA 3V0TA 5HATA 2X0HA 3LPPA 1O7AA 3L2LA 3FSTA 5G5IA 2E4TA 1DEDA 4YYCA 2QJNA 3BLLA 3PAJA 4B3KA 1GKQA 1AH0A 1BF2A 3PR2A 2A6LA 4C6IA 3RU8X 4D71A 1JR1A 3M47A 4RZ6A 1RALA 4RXGA 1KO0A 2ACSA 4K2SA 1UB3A 2VFHA 3TW7A 4WIWA 1YIXA 1MI3A 2DIEA 5D04C 2VP8A 4AY1A 2DFAA 3VZYA 3BOLA 3PB0A 3WLKX 4S1FA 4D2JA 3CS2A 1JZ4A 1MWOA 1YE4A 1TPVA 1UBPC 1PPIA 2ISDA 1EDQA 1B3VA 3IJ7A 3LRLA 3M44A 3AIEA 2YXGA 1VRXA 5HPOA 3OP2A 2J8FA 4DRSA 1E6RA 2IKHA 2QT3A 4PGLA 2W66A 4LCQA 4YTUA 3VKKA 3HGOA 4H9TA 3K2GA 1Y8BA 3PSWA 2J25A 2KX9A 3TJIA 1OFRA 2CLFA 1AJZA 4AG0A 2XIJA 5BMXA 1VF8A 2XN2A 3ARSA 4M24A 4IPJA 3JVAA 2C16A 1ZLPA 2VFDA 4P7OA 2OQYA 3ANUA 1K8CA 1R7AA 3UETA 3L4YA 3IVTA 3SCWA 1RK5A 5IDIA 2VI0A 3G0SA 2BVTA 4QG8A 1WO2A 5E9XA 4M6UA 4ZSUA 3EOUA 2OXNA 3KTCA 4MM1A 2G97A 4HVXA 4HOXA 3N2CA 2ZZ4A 2BG5A 3GDBA 3WLOA 3BO9A 4ZQRA 3A9IA 1G7UA 5D38A 1EEXA 1NQKA 4S38A 1A5BA 3WH7A 1H0IA 1DHKA 4HZ8A 3H7UA 3RG6A 3C6CA 1US3A 1S2AA 2QV5A 4K7VA 3TWAA 3ABQA 2G3MA 4CU7A 1LG2A 3RU6A 3ZZ1A 2WB5A 2VRQA 1HTIA 4PMZA 1GCYA 3OZOA 3CHDA 2QPXA 2AQWA 2XGZA 3HURA 4LF2A 4GQ0A 5IHRA 3VMOA 3A13A 2BOEX 4JQ3A 3FDGA 1TWSA 1A5OC 1B54A 3ZJ6A 4GG9A 1FWIC 4F0HA 5F4SA 1KQYA 3T8QA 4JY8A 1GVYA 3ZXWA 4O57A 4RNIA 3A47A 4O14A 3GB6A 1IT0A 4AD2A 3AICA 3FKRA 1V0MA 4AEOA 1P7TA 4DBSA 1J9YA 3TOYA 2WC4A 3LCIA 4GZEA 1KBJA 5HNNA 2O0TA 5I09A 3QOMA 1JAEA 3RCMA 4X2RA 1PXGA 1FWHC 3C4UA 5A6AA 1YNYA 4RNJA 2Q02A 3KBMA 3T07A 3MI2A 4D6EA 4E4PA 1XM3A 5EMMA 3CAWA 2J9YA 3WJWA 1B2YA 2XIMA 3L65A 2ZC8A 3GZ3A 3SAZA 3ES7A 4ACZB 1DWAM 3VIOA 5HQLA 4PN2A 3VIIA 4MHBA 2V81A 3MMUA 2OT1A 1HL2A 3N25A 5KEZA 2RGLA 1I2RA 1PX4A 3PTMA 1NJJA 2IPGA 4GKTA 3GFZA 1TCDA 2O9RA 2QIIA 5HINA 2UY4A 3THDA 1B0IA 1HW6A 2F9RA 1OFBA 2WJDA 3BCJA 5AHNA 1H2JA 4DBEA 2G4FA 3AFBA 3CV2A 5GQBA 1QT1A 5I3HA 2GJXB 1K4HA 2IPJA 3PB2A 4QG9A 4CCZA 4GE8A 1XFCA 4HK7A 2W9MA 2D2JA 1XBYA 1W3HA 1KXTA 2PDGA 6CGTA 4D8LA 4YYFA 5EGRA 3NZPA 1UWUA 4AZBA 3AHTA 1KGWA 4MZYA 4LYKA 4ZQPA 4QIUA 3D6NA 2FQIA 3OZMA 1QUMA 1NARA 4Z17A 4PEEA 1CGWA 1J2WA 3Q45A 1Q13A 3E5PA 1E72M 1SUXA 3DXIA 2J13A 3NURA 3GG1A 3L2IA 1LBFA 5DX7A 4XG1A 1TQXA 9CGTA 3KVLA 3AXIA 3CMJA 3CPGA 1PDZA 5ABEA 4M1BA 1TMQA 2VCAA 2WLYA 3IJIA 2GVGA 2F61A 1JCJA 4QEEA 1GOQA 1UC5A 4RKAA 4ATDA 3TE9A 1O66A 3GH7A 5JIWA 5TBOA</