5C55A

Crystal structure of the y138f mutant of c.glutamicum n-acetylneuraminic acid lyase in complex with pyruvate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
307
structure length
307
Chain Sequence
TFTGVIPPVMTPLHADGSVDVESLRKLVDHLINGGVDGLFALGSSGEAAFLTRAQRKLALTTIIEHTAGRVPVTAGVIETTTARVIELVEDALEAGAEGLVATAPFYTRTHDVEIEEHFRKIHAAAPELPLFAFNIPVSVHSNLNPVMLLTLAKDGVLAGTKDSSGNDGAIRSLIEARDDAGLTEQFKILTGSETTVDFAYLAGADGVVPGLGNVDPAAYAALAKLCLDGKWAEAAALQKRINHLFHIVFVGDTSHMSGSSAGLGGFKTALAHLGIIESNAMAVPHQSLSDEETARIHAIVDEFLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Y138F mutant of C.glutamicum N-acetylneuraminic acid lyase in complex with pyruvate
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase/N-acetylneuraminate lyase
total genus 115
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c55A00
1JR1A 5CPLA 3W7QA 1JRCA 3N73A 4BI5A 1OFRA 3P61A 1Q6RA 4G1KA 4EIVA 1O60A 3P62A 3LLFA 4UXDA 4WUIA 4C1LA 5D2TA 5E1QA 3F03K 2V2DA 1D9EA 2RDUA 3UY7A 2Z1BA 1OHLA 1SZNA 3B0VC 4NJJA 2B7PA 3UWWA 3EWWA 4RZ4A 1YPIA 4OBTA 2HSAA 3CWNA 3H53A 3NR0A 3B06A 3UWVA 1Q6QA 2VEKA 2JKAA 4LRTA 4NUWA 5AHNA 2DZWA 3SGZA 3LBMA 3EX4A 2VEIA 5KINA 1AL8A 3GIYA 1C9DA 3KVMA 3NM1A 5F2IA 4UFJA 4KFOA 3LX9A 3FOKA 3B0PA 2G96A 4QISA 1KM3A 3LDVA 3I6RA 1RD5A 3LERA 1AW2A 2ZZ2A 5BMXA 2D73A 3UWQA 1G69A 3M6YA 4U4MA 4WQ6A 1TPH1 4AVFA 3SGUA 4NT0A 5CPNA 1BEUA 2QUVA 5D09A 3R2GA 1KV8A 1XC4A 1ZAJA 3L21A 1VR6A 4K8EA 3EX6A 1LBLA 4AHOA 3C2RA 3G24A 1Q45A 1XBZA 1O95A 1FCVA 1NF0A 4GUGA 3SECA 3W2KA 1W31A 1VC4A 5D38A 1ZFJA 1F6KA 3G1YA 2OZ0A 1KBIA 2ZZ3A 1SR9A 1NF7A 2FQIA 4LU0A 1I2PA 2GUUA 4JDBA 2YYTA 2JGYA 2YW4A 2BWGA 1TREA 2HMCA 3M5XA 4IMFA 3BARA 1GVFA 1T96A 2J24A 4NNAA 5AYXA 1S5VA 4WXZA 2P1FA 4MFEA 5BW6A 2IQTA 3W9ZA 4O0ZA 4IJBA 3P5ZA 3LXBA 2PCQA 3QH2A 3ZWSA 5AHMA 3W83A 4XBSA 1HL2A 3GXPA 4LS1A 2NXHA 1R2RA 3IVSA 3B8DA 1G4PA 1W0MA 1ICQA 4LVFA 4M5PA 4ML9A 3LRKA 4OV4A 4AWTA 4RXFA 3W1RA 4O16A 5D33A 5IBXA 2G5WA 4HNNA 4MY1A 2WQPA 1RQHA 3HGJA 3PY2A 1TRDA 3CC1A 1LBFA 3QW3A 4ZZ9A 3IIOA 3Q58A 3LTSA 3LLDA 3PUOA 4DO5A 2A6LA 1XFBA 4JTHA 4HSOA 4X22A 2E6AA 3W1UA 3RU6A 1TIMA 4CQAA 2DP3A 4ICNA 5K9CA 1GZGA 2FLIA 3GDLA 4YCOA 3TSDA 2V82A 2TSYA 3LCIA 3NQ2A 2ZA1A 1VCGA 5EY5A 5LNRA 1PHWA 3C2EA 3EWBX 1JUEA 3E9AA 3FJ6A 1ONRA 1VCVA 4LY8A 5DXYA 2B7OA 3P84A 3STCA 4FNQA 2VFGA 1QOPA 1OX4B 1DOSA 4O52A 5C5YA 1OVDA 1FDJA 2VC6A 5K3VA 3NPVA 4PL2A 3I65A 3NPXA 4PCFA 1MEHA 3EXSA 1KM2A 4Q33A 1U5JA 1QPNA 3W07A 3FFSA 2GJNA 2E1DA 4LVBA 1D3GA 4GUFA 3EX1A 5CGQA 3U8GA 3NL5A 3I7QA 2I14A 2C14A 4O4WA 3TE9A 3IEBA 3TUUA 3N34A 4NJHA 3MBFA 4MZYA 4JIQA 5F4XA 3CB8A 2ZRXA 3FS2A 4JTGA 3W2UA 5D02A 1I2OA 4NX5A 4NJGA 1FWNA 1XXXA 5EPDA 4IXXA 2V30A 2VFEA 2CFFA 1WBHA 1V5XA 3PUEA 4O13A 2TMDA 4O10A 3HO8A 3HJZA 3NAVA 1LZOA 5K4XA 1WAUA 3W7IA 1KM0A 3O16A 3O8AA 2DZTA 1KW1A 4FXRA 3V75A 4AF0B 3NPWA 5FF4A 2V2HA 3DFPA 2ALDA 2NXIA 2ATMA 1R30A 2ZZ7A 1KFKA 1K8YA 1SZFA 4ONVA 5K2ZA 3HG4A 3L68A 4UTWA 1JRBA 5BOOA 2FPTA 3HBLA 1TO3A 4JD4A 4NX0A 2YW3A 3M43A 2E68A 1KFCA 2E5CA 1KTBA 3OHIA 3MO7A 3W87A 5AOUA 1H1ZA 3F4NA 1RVGA 1SSDA 3W74A 3QZEA 3LXAA 1WOAA 3NDOA 2CZFA 3PG9A 4FNTA 4FNSA 1I8JA 4BI7A 1LM1A 3C8FA 1ZJIA 1CI1A 1Q6OA 3DFTA 1GVRA 1DORA 4FB7A 5I3GA 4K38A 4MLRA 5HWJA 3P80A 4QJ1A 4Y90A 1EEPA 2WNZA 2ZZ5A 3TXZA 2WJZA 4L4MA 2CLIA 4GRSA 4XZ9A 2Y7FA 1Z41A 2RFGA 2CZ5A 4AXKA 5J5DA 3GVGA 1GPWA 4JS3A 4RV8A 3IVUA 5G4EA 3SFKA 1KM1A 3G1XA 4IOTA 4WD0A 1SSGA 1YTKA 4AHPA 2B7QA 4DQWA 4N9CA 2E6DA 2Q8ZA 1EX5A 4N2YA 4DPPA 3A22A 4IPIA 4UTUA 4UTIA 3UY8A 1SZGA 1T99A 3TXVA 1LDCA 2AGKA 3CTLA 1TTQA 4N9EA 4IMDA 3O63A 1JCNA 1OFAA 3BGJA 3GB6A 1A5CA 2QCEA 4OWGA 4M7TA 2DJLA 4NZFA 4UR8A 1O5XA 1A53A 2EPHA 3TMLA 2J88A 1OG0A 1W56A 4QNEA 5D05A 4AEOA 5AN7A 4RX0A 2QCCA 4UTLA 2WPBA 5E93A 1IXOA 3UWUA 3EWUA 5G1TA 5LHFA 2TPSA 2EGZA 4LNYA 1TQXA 2HS6A 1OX6A 4YL2A 4M7SA 4N9BA 4O1DA 1O94A 1GTEA 3FLUA 4R33A 5KTLA 1GT8A 2ZRZA 4ZMGA 3BG9A 4CNNA 5G2HA 1XL9A 2B0MA 3HGRA 5A8GA 3SR7A 3NXFA 4JTEA 4E2BA 1Y0EA 1W3IA 3L5LA 4MPQA 4MUZA 3W88A 4LVGA 3LV5A 2PE4A 3C6CA 5HINA 4AB4A 1VCFA 4O8RA 4O53A 1VH7A 3W7LA 2ZDRA 3QMTA 2A4AA 3R8RA 4WY0F 2O7QA 1W5MA 1TMHA 2C15A 3ANYA 3EB2A 3GAKA 3LCWA 3TW7A 4UTTA 3S9YA 4M19A 3LI1A 1Z42A 4UFLA 4O12A 4FIRA 3L5AA 3TCEA 4OV9A 3W7PA 2JGQA 3PBVA 3W71A 1X1OA 2TYSA 5L6UA 4QSHA 1FWWA 5TIMA 4WY0B 1NVMA 2QUUA 1HFBA 2A21A 1JVNA 2FFCA 3HQ1A 1JCLA 3NQEA 4NZJA 3MJYA 1A5SA 2QDHA 2QAFA 2CWNA 1QR7A 4JTIA 2DZPA 3PR2A 4DPQA 4BFAA 2RHGA 2FIQA 3W23A 3LM7A 4P61A 2E09A 1G6CA 2FPYA 4Y9AA 3S5NA 4E2DA 1OF6A 3MYPA 4AH7A 4NVTA 5LNVA 2J27A 1PL9A 4O1BA 1TPC1 3W7CA 1ML1A 1UJPA 3WK3A 2A7NA 1PE1A 3FYOA 2DU2A 3VKJA 1M7PA 3FKKA 3BW4A 2X2GA 1L6SA 4BF9A 1GVOA 2RDWA 1TPFA 3KVJA 4UMBA 5F2GA 3M5ZA 1YTDA 3NM3A 2QR6A 1LYXA 1QCWA 4Z1AA 5MHBA 2VFFA 4GFSA 3GXNA 1H50A 1X7FA 5DCEA 1ZENA 4DO6A 3LHYA 3O1NA 3QYQA 4AAJA 3G22A 3P8IA 2VFDA 4O14A 1RZMA 5DBTA 4MFDA 1K7EA 1QPQA 4R34A 1FXQA 2Z0IA 3ZFHA 4WXYA 3CIWA 1WXJA 1VPXA 3EWXA 3RLVA 5I3KA 2HTMA 4UCGA 1GOXA 3DKJA 4RXGA 5HULA 4YXGA 2ZTJA 1QOQA 3C0JA 3T55A 1O5KA 4MJZA 5D30A 5K9DA 1N7KA 3FYPA 3C4UA 5HQEA 2R91A 1QNVA 5AHEA 4M6QA 3TH6A 1JULA 3NG3A 4PA8A 4BWLA 2EHHA 4HN4A 1NSJA 3RNDA 1UCWA 4HNTA 2Q8LA 5G4WA 3THQA 4JX6A 3ATYA 3QFEA 5FEXA 4HPXA 5CPMA 1HO4A 5FI8A 3QPYA 4AWUA 1YADA 5H91A 4UTWC 4RKAA 1ICSA 1K3UA 3GDRA 3QMSA 5HR7A 2Y89A 1VHCA 1GQNA 3TKFA 3CIXA 3LXCA 5EYWA 2NLIA 1MO0A 1HUVA 2DJXA 3NL3A 4A29A 3HGSA 6ALDA 2QCLA 3W76A 4TX9A 5HUPA 2H3DA 3N19B 3DFNA 1X1ZA 2JK2A 3P5YA 1OFPA 2X1UA 3KRZA 2YR1A 4UFMA 1TCDA 2QJGA 3LHZA 2R8WA 1Z48A 1IXNA 1MEIA 2ZZ1A 5F4SA 1WBJA 2DZUA 4N6FA 1FUYA 1KFEA 2R14A 4JTSA 4LS0A 1OFOA 4NNCA 3DFOA 2A7RA 1LRNA 3VFLA 2OT0A 1LP6A 3A23A 5BRBA 3S5OA 3S1XA 1YDVA 2H3BA 3OVQA 1PV8A 3W1PA 5DXXA 4H6KA 1H7RA 3HG3A 4MY8A 3NNTA 1W5OA 4RCXA 3LHWA 3WJSA 1FWSA 1MSSA 4XKYA 1R47A 2CLKA 2B7NA 2WSYA 3ZR4A 4S2CA 5C55A 4WOQA 2QCHA 2CU0A 3C61A 1TPB1 3UZJA 2Y63A 3CPRA 3DI1A 2ZZ6A 5F1UA 1WOBA 2VFHA 1IIHA 2BZNA 1L6YA 1ZNNA 3E49A 1R46A 3G8EA 3TROA 5KMYA 4PODA 3NGJA 1OYCA 3M9YA 3NQ8A 3CM4A 3QM3A 4UFHA 2W6RA 2WSQA 1EA0A 4QNWA 1AK5A 5U4NA 2PRLA 5HNRA 2OCZA 3PSVA 3QRHA 5EA9A 5BNKA 1C8VA 1LROA 4FIQA 2PURA 1YDOA 3NQDA 4PH6A 2H90A 4UTMA 3DFQA 4MJMA 5LGZA 3OA3A 2EKCA 2CLHA 2GOUA 1TV7A 3M5YA 2QJHA 3USBA 4JTLA 3NEVA 3PULA 1EP3A 1OFQA 1W54A 1BTMA 1F76A 1M5WA 1JQVA 2WNNA 1H7PA 3TC7A 5IM51 4IMGA 4YCPA 2QDGA 2ZRWA 2ZRUA 2NZLA 2Y62A 5LNSA 3GLCA 3W84A 3BG5A 2A5HA 1ZHAA 3G1DA 2Y7EA 3GKFA 3NZ1A 4HNUA 4X3ZA 5FF3A 1I2QA 3PWAA 4GBUA 1JCMP 2V81A 2CLEA 3I68A 4MOZA 3KAOA 2CLLA 4CLMA 4CCCA 3CHVA 1F73A 4O54A 3Q94A 4UUIA 1PVNA 3HOJA 1WYIA 3O05A 4NQ1A 5CZSA 4E0CA 1U83A 3SIZA 1ME9A 1MXSA 3LTYA 5F2LA 3UYCA 2WKJA 1KBJA 4DF2A 4JY9A 3IRDA 3PS7A 3F4WA 3PSWA 3IIXA 2QEZA 4LUIA 4IQLA 4EF9A 3LCXA 2ABAA 4NJKA 1W8SA 5FEZA 1WV2A 3TSBA 1OJXA 5CKSA 1YYAA 4MZ1A 5KZDA 2DZXA 2OX1A 1SO6A 3L2IA 3RFAA 3HPSA 1LCOA 2ZA3A 1I2RA 1DQXA 4EVZA 1DVJA 4KFNA 5FEPA 4O19A 1P1XA 1QO2A 2GJLA 3LV6A 2J9ZA 3MHGA 2X1TA 3G18A 2GVLA 2YDAA 3W7NA 1EPXA 2YYUA 3T78A 4GUIA 4K36A 1H63A 5DN1A 1H7WA 5TBOA 4JN6A 4I7VA 3NL2A 1A50A 3TQKA 3FA5A 1ALDA 1G67A 1VQTA 3DH7A 3L66A 4NU7A 2QAPA 3M41A 4IX2A 3TAKA 1KV5A 2GPTA 4EOUA 3IIZA 5FESA 3M44A 2Y7GA 3TDFA 2I1OA 5T26A 2VXNA 4MLJA 3EX2A 1G4TA 3NVTA 3MP4A 3O06A 4UTHA 2QUTA 1K02A 5I3FA 3GR7A 2C3ZA 2E5BA 3O15A 1AMKA 4KFPA 5AHFA 3S5YA 4DBDA 4HHPA 1Z44A 3M0ZA 4JYDA 4NXKA 4O50A 4O15A 3I7RA 3STFA 2GQAA 2YFOA 5AYYA 3KFTA 3PM6A 2BXVA 4OE7A 4Z1CA 3G0UA 2ISSA 3QQ0A 2Y61A 4ORIA 3UPWA 3PG8A 2Y88A 3OVRA 4IX0A 3E96A 5I3JA 4RLIA 1OFDA 3P8JA 5CZTA 2YZRA 3GX9A 5HWNA 1UB3A 3QQ1A 3GDMA 5HUOA 2NX3A 1IXQA 1FCUA 4MYXA 3W85A 1YTEA 3W7RA 3B05A 3EKLA 4O4VA 1UUOA 5BMWA 5SWUA 5D2WA 1K8XA 4TU1A 2NV1A 3W72A 4WOZA 2ISWA 3W7HA 4UR7A 2E6FA 3MI3A 3NZRA 1UUMA 4UIOA 1LORA 4ZL1A 2BSLA 3KVLA 2QCNA 2YFNA 4ZQNA 1DKWA 1KA9F 4MZ8A 1JCJA 3RLUA 4ZQRA 3T7VA 2FB3A 5G2WA 2AAMA 3HG2A 3W2MA 3C2FA 1G4EA 3MP5A 3S5ZA 4Z0JA 5AC8A 4JX4A 4RK8A 3O6CA 3QMRA 4K39A 1VYRA 3PB0A 1K8ZA 5HWMA 1FY6A 4ZQCA 4JIPA 2CLFA 4K7VA 1JUKA 5K4ZA 3MUXA 4LW7A 4LV9A 3OIXA 1XKYA 5EL1A 3W1MA 1G7VA 4OQVA 2W79A 3UWZA 3P67A 1CX9A 4A2SA 3EWZA 3LI0A 2X1RA 3LCFA 1TRIA 1P4CA 3FJLA 3W7DA 4HKPA 3VNDA 4C1KA 3VE7A 4X2RA 2ZZ4A 1WA3A 1YXDA 1ZALA 4LT9A 2CLMA 3BW3A 3CQ0A 2FTPA 5D37A 5CSRA 4LV4A 5J5RA 5E0KA 4L4LA 3GDTA 3DBPA 3F1QA 3O6DA 3RK8A 4K7YA 3P74A 1XUZA 3AO0A 3GZ3A 3W2LA 1C29A 2NWRA 1TJPA 1YPFA 3KRUA 1TV5A 5K7JA 1BWLA 1FXPA 1GG1A 2H6RA 3ELFA 3A5FA 1RR2A 1I4NA 4PFMA 5LSMA 5D04C 2KZHA 2ZYFA 3TAOA 4TMBA 3W1AA 8TIMA 2Y7DA 1OYBA 1SO3A 1E51A 3L0GA 3TNOA 1G7UA 3CEPA 2FB2A 1KM5A 2Z2UA 1TPDA 5AFDA 3ZWTA 1XDLA 3W1NA 4LS2A 1J4EA 3UQNA 5CG7A 3WJWA 1XM3A 1CW2A 3G1SA 2E6YA 3MHFA 4D2JA 4EF8A 2DORA 1ADOA 2NV2A 7TIMA 5C2XA 4QQ3A 2VOMA 4LVDA 4XBKA 4XUGA 5CZJA 2Z6JA 4JY8A 1N8FA 3I7SA 3PB2A 1H7NA 1QDSA 1SW3A 5DCBA 1OX4A 4LTSA 4E38A 5D32A 1SW7A 4GUHA 1FDYA 3MI6A 2A2IA 1JCXA 3NQMA 5KSWA 4HT3A 4O1CA 4R53A 2XN1A 4AMAA 4FX6M 3JS3A 4DF1A 1PCWA 3OEXA 4DELA 4Z08A 1FCQA 1W3TA 3QSTA 1VS1A 3DZ1A 4M6VA 4HNVA 3W1LA 3W73A 3S6DA 1H60A 3C56A 1FQ0A 3DAQA 1RQBA 4CNPA 3MI2A 1FX6A 1FWRA 5CPOA 1QMLA 3LBCA 4Z1DA 3W7EA 3W6YA 4DBEA 3NQVA 4FX8A 1ME7A 4I9AA 1W37A 3LB0A 2ZTKA 4J9JA 5I3IA 1ZCOA 1K7FA 2RDTA 3S42A 4I7WA 4ZQMA 2GQ8A 3N9SA 5F2MA 5HMSA 5FEWA 3S8HA 3BLIA 4ORMA 3TIMA 1H61A 5ABTA 3EXTA 3TJXA 3L9CA 2GVGA 2V5LA 4PL1A 4ADUA 2J9XA 1S5WA 3SY5A 1FDZA 1QPOA 3U6WA 2QCDA 3W2JA 4BI6A 2CW6A 3ABSA 5DELA 5IBXC 2QF7A 3G8RA 3GK0A 3R5EA 5DBUA 3TV8A 2C13A 1UBSA 1KTCA 3NQFA 4TR9A 1LOQA 2RKXA 3THAA 1P0NA 2Q3RA 3P82A 3QC3A 4TIMA 3TJLA 1ZAHA 4YWIA 2YGYA 3EXRA 3W1XA 1TTPA 2Y70A 3FKRA 3STGA 4JTJA 4JDYA 1KFJA 3MW7A 3GNDA 2E77A 2QCGA 1EB3A 4JR5A 1JQXA 1KLZA 1P5BA 1JCYA 4IXHA 3WJXA 4CCDA 3QJAA 3A21A 1EWDA 5DLCA 2JKPA 5G2IA 4N02A 1B4EA 2ZBTA 2VEMA 4ALDA 4KWVA 3P60A 3EEGA 4U28A 1XI3A 3OVPA 1T0OA 3B04A 4JTTA 3CU2A 3HPXA 3W7KA 4N4PA 3M1ZA 5KZMA 3UD6A 1W5NA 1EWEA 4FXSA 3TX9A 1TPUA 2PRHA 1OK4A 3GXTA 1LLWA 3W75A 5G1YA 3ABOA 1THFD 2VKZG 4R7JA 3L5MA 3QSRA 3LGEA 1B4KA 2TRSA 1T8XA 1H1YA 4DEFA 1DJNA 3VI2A 1QFEA 2JBMA 1W5QA 3MBDA 4O57A 1AG1O 4CNOA 3UZ5A 3SZ8A 2V5BA 5F4WA 3T44A 5GVJA 5L9FA 4Q4KA 4IPJA 4DXVA 5CZ0A 3TQVA 2Y6ZA 3BLEA 2G95A 2F84A 3MP3A 5H2ZA 3LCLA 5AHLA 3HMJG 3N2MA 3TA6A 1SUXA 4IMCA 5LGXA 1J5TA 2UV8G 1OABA 4XTIA 4NXSA 3TW6A 3PUDA 4A21A 1NFBA 4CQ8A 3BLFA 3SW6A 3A9IA 5DCDA 3LRMA 4AHQA 3OBKA 1IXPA 4LVAA 5F1VA 1SFJA 1EP1A 3WK1A 3S1VA 1EIXA 3ZS4A 3UXDA 4GNJA 3GAYA 2V2CA 3DHDA 3QW4B 1J2WA 1XBVA 3HIJA 5HR6A 1EUAA 4KWWA 4B5NA 4X9SA 3IGUA 1KFLA 5HJLA 3K30A 2QCMA 1YXYA 3G3MA 3UPBA 1SPQA 2C0AA 3DGRA 1Q3NA 3H55A 1IIGA 2C19A 1S5TA 2A1YA 4QAIA 3UWYA 3W70A 1RQEA 3TMQA 1VLIA 1NAL1 1LOSA 3EWYA 3RMJA 2OT1A 3PBWA 1X8FA 4K8HA 5LZLA 3BPWA 1OK6A 2V0TA 3TR2A 3FEMA 1VYSX 3IIPA 5AYZA 1H7OA 2WSRA 1H5YA 2A6NA 5EBUA 3W1QA 4JGDA 1DL3A 1HG3A 4S1FA 1WQ5A 1WDWA 3W1TA 5C6MA 2Q3OA 2CZEA 3DXIA 4WX2A 3BO9A 3DKLA 1UASA 3W7GA 1GTHA 2VFIA 3LHVA 3TFXA 4MIMA 1PS9A 3FIGA 3HG5A 1TTJA 1L9WA 1VJIA 3VCRA 1LTDA 3TQ0A 3BV4A 4JEQA 3NQGA 4O11A 1B3OA 1QPRA 3GKAA 5AHIA 1LRQA 1M7OA 1O4UA 4KKXA 4H4IA 3S1WA 1SQ7A 3PC0A 4GE8A 4CCEA 4JYFA 1NEYA 4ADTA 3HPZA 1DBTA 5D2XA 1KFBA 4FO4A 4MKNA 3WJZA 3M47A 4JXCA 2Z6IA 1VGAA 1F05A 3MMTA 2GVJA 1XBXA 4P2VA 3B03A 1F7BA 1W3NA 3WK2A 3S1UA 1WX0A 2YXGA 4I7UA 2XFWA 1TPEA 4OT7A 2QKFA 3UXAA 4AF0A 4ZQOA 2O7SA 4ZQPA 2FPVA 3STEA 3EX3A 3NQCA 3M16A 3BW2A 3DI0A 2C18A 2XN2A 3GYEA 1IGSA 2HS8A 3N14A 3G1AA 3P7YA 4N4QA 3R89A 3A5VA 1W1ZA 2VEPA 2CZDA 1EUNA 4Z1BA 3O07A 1F2JA 4ADSA 3BG3A 1G4SA 2W0UA 5LNWA 3G0XA 1VZWA 2LLEA 3W7JA 1ICPA 1X6UA 4UTKA 3DHFA 4OU1A 5DY3A 1F74A 3M7WA 3WFAA 3KRSA 2RH9A 1KTNA 1JJKA 2BLEA 3R13A 4O1AA 4UTJA 4DO4A 3B4UA 3WJYA 4HPJA 1TJRA 1TYGA 3KOFA 4GWEA 3EKZA 4LUJA 5U7SA 1R2SA 1K7XA 4PEKA 1XBYA 1AW5A 2ZRYA 4RZ6A 1TPVA 1L6WA 4JTKA 4K6AA 1KM6A 3B0UX 4WJEA 1SZEA 2ZQ0A 3IGXA 2ZFAA 2R94A 5LHEA 3NPUA 2H8ZA 3MHUA 4FNUA 3C2OA 3G1HA 3IIVA 5A5WA 1HO1A 4IMEA 1YLVA 3Q2DA 1ZAIA 2G97A 2QCDB 3S0CA 1H62A 3RF9A 2AQWA 2NUXA 3CWOX 4LC8A 3PVFA 3D0CA 4O0KA 1A5BA 3NO5A 2PC4A 4XKYB 4XQ6A 2ZCGA 5EKYA 4XTDA 3NQ7A 1FWTA 4FHAA 5KITA 1K03A 4FNRA 3N3MA 1F6PA 1EP2A 5TQLA 3C3NA 3PAJA 4GJ1A 3AJXA 3NQAA 3PF3A 4N6EA 4RR4A 2WO5A 1OYAA 3C52A 2JKEA 1S3HA 3ABQA 3MYOA 3BK0A 3CT7A 4LC6A 3G1FA 2ZA2A 1QWGA 3VE9A 1GVQA 1LBMA 3GNNA 4MY9A 2ZRVA 1GG0A 1KLYA 5AC7A 4BK9A 3GR8A 3O6YX 4FEZA 1BKSA 2FJKA 1LLZA 2A85A 1B57A 3DENA 4PC8A 2F7FA 1RPXA 4YMZA 3HF3A 4UC5A 3L0KA 2J6XA 1JUBA 2FDSA 3N2XA 3SJ3A 2CLOA 1SFLA 5D03A 2X1SA 4DF0A 5C54A 1I2NA 2OJPA 1FBAA 3IVTA 2C16A 3G3DA 3M5VA 2DZVA 4N9DA 2V9DA 3L0NA 5FF0A 1TB3A 2J9YA 3KHJA 2XN0A 1DQWA 4POCA 3MWAA 2YPIA 1SW0A 3G0SA 1GYLA 3U2OA 2WV8A 4UMAA 3W3OA 1GWJA 3ABRA 4Y96A 2OMAA 4UTTC 2I9EA 4Z0SA 1SO4A 1XCFA 2YSWA 3SSJA 3E12A 4UNLA 4Q32A 2V8ZA 1KM4A 2E5DA 4UFIA 5D2YA 2P10A 4LRSA 4NNBA 3L65A 3NYZA 1IF2A 3P81A 3QF0A 2WNQA 4H3DA 3TU9A 4K37A 3V1PA 2NUWA 2X30A 3OG3A 1H51A 1P0KA 2C1HA 2EAWA 4XWUA 3TSMA 4IGHA 1A5AA 3BGGA 4IUOA 3NQ6A 4GUJA 2Y85A 5DY2A 3HB9A 2VENA 4WY0A 1F5ZA 2GQ9A 1TV8A 1VLWA 2C6QA 4Y6GA 4TO8A 4LOCA 4BR1A 1XDMA 4JTUA 3GDKA 2DZSA 3QPZA 3E0IA 3SI9A 1R2TA 2PRMA 3NA8A 4TMCA 3UNDA 3W7MA 4UMCA 1GEQA 4EWND 4A22A 3LRLA 3LHTA 1AL7A 2EF9A 1PCKA 3KXQA 1DHPA 1OFBA 1B9BA 1XUUA 2WOQA 3DU0A 2QCFA 2X16A 5AC6A 4Y8FA 3R12A 2P0OA 4MVAA 3E02A 3NL6A 1Q6LA 3L67A 3LCHA 5KZEA 3T4CA 1OFEA 2NX1A 4WZHA 4FF7A 1I45A 4GXMA 3TK7A 5G5IA 4PTNA 4AWSA 3TC6A 5D2VA 3WK0A 3JR2A 3N9RA 1V7YA 1HTIA 3W7OA 1VHNA 1ME8A 2VELA 5I3HA 1YDNA 4O17A 4HSNA 2QJIA 1SO5A 1MEWA 3T40A 3LCGA 3Q37A 4OHQA 1D3HA 4QIUA 5FF7A 4RJEA 1PIIA 3LTPA 4QM1A 1RV8A 3IGSA 1GYNA 3BVJA 4A3UA 5AB3A 2YCEA 3JRKA 3CEUA 3IV3A 3LHUA 3YPIA 2YX0A 1QAPA 3QEZA 4LWWA 5K9XA 1DV7A 4HIBA 1OX5A 4A2RA 4JNMA 3NOEA 1OF8A 2H8XA 3PBUA 5LNUA 1SU5A 4CQ9A 4JYEA 4GC4A 4JICA 1VRDA 3W2NA 3KVKA 2NWSA 4O18A 4NJIA 4RZ5A 3INPA 1M6JA 2NXGA 1H7XA 1GVSA 3DFSA 1L2UA 4JX5A 2A7PA 5LKYA 2NX9A 1QO5A 3PBYA 1LOLA 1PHQA 4S2BA 5CSSA 4OGZA 3CLMA 2BTMA 4YLWA 2ISVA 4QITA 3A24A 1FCBA 1AW1A 1YXCA 3LOTA 4FX7A 3C2VA 4JTFA 3KX6A 4M6PA 1TTIA 4FNPA 2ATSA 2ABBA 2A0NA 3H54A 3TFCA 6TIMA 1TPWA 2BX7A 3W22A 1TQJA 1LRTA 3W86A 5EMUA 4UFKA 1N55A 5FF2A 1DJQA 4W9TA 2NUYA 4MYAA 2B4GA 1MZHA 1ZY9A 4IWWA 1TSIA 1GJPA 4UNKA 3ATZA 3G1VA 4BWLC 1BWKA 4ZVJA 3HGOA 4O28A 1VYPX 1W5PA
chains in the Genus database with same CATH superfamily
1XIFA 1VBHA 3N73A 3OVGA 4C7GA 4RNHA 4ZODA 2VR2A 3W00A 4QG6A 2E9MA 3NZGA 4PUWA 2A3EA 2RDUA 1U5HA 4G7EB 4V15A 2D0GA 4QSFA 3EWWA 3URQA 4W84A 2J8GA 3SBFA 1ZJAA 3H53A 3NR0A 3UERA 3EX4A 2OSWA 3OW1A 4XZLX 3NM1A 4KFOA 2JQXA 4GI4A 3FOKA 1TKKA 2PFHA 4AY8A 4FF5A 1KM3A 4C6IA 1YRRA 1UD3A 3LERA 2D73A 3UWQA 1K1DA 4U4MA 4WQ6A 3MA8A 4NT0A 2DIKA 3GH4A 3LD5A 4GQGA 3QFWA 3ALGA 3R2GA 2VR4A 1VP5A 1XC4A 2PWEA 3RPDA 2X7VA 9XIAA 3GM8A 4YVVA 4AHOA 3C2RA 1Q45A 2JEQA 1O95A 5I79A 1E6QM 1NF0A 4GUGA 3W2KA 3AHYA 1W31A 1ESWA 1F6KA 1ZL1A 1SR9A 2I17A 4LU0A 5HMFA 2EG8A 1BVZA 2YW4A 3PK7A 3ONBA 1NU5A 2VUYA 3M5XA 1DJXA 1ZQ5A 4UBPC 2HVMA 4XAPA 1XPYA 3W27A 5FJIA 2QS8A 3P5ZA 3QH2A 5IFTA 1VFSA 1AQMA 4ZXLA 4XBSA 1HL2A 1S3TC 3BAJA 1R2RA 1JFXA 1G4PA 4HB7A 4ML9A 4NI3A 4O16A 2W92A 4C6CA 1WZAA 5LIUX 1UWQA 3UG8A 1C8QA 1XYMA 3PY2A 3MMDA 3GTNA 1LBFA 4ZZ9A 3W38A 3GG1A 1UR2A 3ZT7A 4KGLA 1EJ7L 2A6LA 2ZWZA 1XIMA 5I06A 1XYFA 1Z3NA 4FAMA 2E6AA 3W1UA 3RU6A 1TIMA 1RJQA 1BD0A 2FLIA 1O6IA 3GDLA 4YCOA 1UR0A 2QMKA 2O0TA 2YLAA 3AIVA 3LCIA 4ENLA 3U2ZA 4HA4A 1WZKA 1VCGA 2VRJA 1LL7A 4M82A 2YIHA 2CLPA 4L4PA 3QV9A 3WEMA 1H09A 1QI4A 3TYUA 3P84A 3STCA 5A69A 2C79A 3QR0A 2E8YA 5G1MA 3DG3A 2OEKA 2Y5EA 5D4YA 4PL2A 3I65A 3NPXA 1KM2A 4S3AA 1TJ1A 4Q33A 3BLOA 9CGTA 1QPNA 4WR3A 1H1NA 3IAPA 3PZVA 1JGMA 4CD6A 1BF6A 5CPTA 3R8GA 4LVBA 1D3GA 4ZENA 3MUAA 4Q4OA 3LG3A 4JL2A 4GQRA 1A3WA 4HHLA 3VIJA 1GOQA 3T0BA 4AIOA 5C9ZA 3N12A 2C14A 1TA3A 2BY1A 2VGBA 1HJSA 1HL8A 3AC0A 2NV9A 2O9PA 4PB5A 1V7AA 5FJOA 5LXXA 5F4XA 1IR1A 3AICA 3CB8A 3W2UA 3ENLA 2IKJA 4NJGA 1FWNA 4IXXA 2V30A 2D2JA 4ZE4A 1GQLA 1DWIM 2CFFA 3JVAA 3HO8A 3H4GA 3NAVA 2BMBA 1LZOA 3FHQA 1RH9A 2GSHA 1CZ1A 4FXRA 2BY2A 2Y8UA 1AVAA 5REQB 3DFPA 3NPWA 2NXIA 2ATMA 4FOKA 7A3HA 2ZXBA 4HNCA 1SZFA 1K8YA 1QBAA 1P7TB 3BMXA 3P0XA 3UPMA 1J0HA 2PDHA 1JRBA 5BOOA 3SY1A 1E9IA 4AYGA 3IJQA 4DWDA 1TO3A 3UWEA 4QS6A 4NX0A 2YW3A 1JPHA 4M24A 3ZLFA 4AZ7A 1XLBA 4RE3A 3QOMA 1X8CA 1R3SA 3GIQA 4L64A 3F4NA 1RVGA 3QZEA 4KW2A 3LXAA 1WOAA 2CZFA 2ICSA 3H12A 1LM1A 1XLMA 2TAAA 3C8FA 1ZJIA 3VKDA 3DUGA 3WNKA 1DORA 1MQRA 1TV4A 4Y90A 4R5EA 4W7WA 4W5UA 2Q09A 1IEXA 2WJZA 2AQOA 2CLIA 4XZ9A 3AMGA 2J7FA 4TQTA 2WM0A 4K1WA 2CZ5A 4AXKA 3BAWA 3SFKA 3U0HA 1SGJA 4IOTA 2WBKA 1PTDA 3NFUA 4WD0A 4WVXA 4DQWA 4HYRA 4N9CA 3V0SA 2J7EA 1T99A 3TXVA 1OGBA 1LDCA 4ICCX 3VGBA 1J0JA 4D6JA 3BL3A 1JCNA 5A95A 2OLAA 1ZUAX 4M7TA 4NZFA 1AUSL 1O5XA 4UR8A 1XS2A 3V5FA 2PBGA 2QYGA 2J88A 4H9VA 1LT8A 5AN7A 2NVCA 1HW6A 2Y4SA 2FKPA 1RBOB 4AD2A 5H8MA 4D1JA 2VZUA 2WPBA 4ATLA 4W93A 1IXOA 3UWUA 3EWUA 5LHFA 4LNYA 1ECEA 5HAOA 1TQXA 4DI8A 2E0PA 1REQA 3BZJA 1O94A 1GTEA 5G2HA 3I6EA 3NXFA 2FVMA 1Y0EA 4MPQA 4MUZA 1OT1A 2G41A 4OTKA 2DQWA 2GFTA 5HINA 4AB4A 1VCFA 4GZJA 1H49A 3GFZA 2W27A 3A4XA 3QMTA 4CQCA 2A4AA 1JZ6A 2VGFA 2XVPA 4WY0F 1K6WA 1U33A 1ENUA 1TMHA 2C15A 2WLZA 3FY1A 3R43A 1JGIA 4ZSTA 5FACA 2GDUA 1REQB 9XIMA 2Z7KA 1S2UA 5A2BA 2V69A 1HZYA 4JTAA 4FIRA 1R6WA 1N8IA 1QNQA 3VGHA 1QASA 2D3LA 1EJRC 5D9NA 4WY0B 1BXNA 1K8CA 2PDLA 2QUUA 3T0DA 1WNOA 2FFCA 1QRQA 4NZJA 3MJYA 1TELA 2DZPA 4D6DA 3RXZA 4ERAA 2VDGA 3S5NA 1OF6A 4HPHA 3LPGA 4PMYA 4HMEA 4MWAA 1LG2A 3TCSA 1ISZA 2A7NA 1QW9A 1UD4A 4HTBA 1GOKA 1BLIA 1L2QA 3FKKA 2A3AA 4Q4QA 2X2GA 4G7EA 1M04A 4BF9A 1GVOA 2D3NA 3BZGA 1TPFA 4JFUA 5F2GA 5C9WA 1XYLA 2QIWA 4J7RA 1UH2A 5HJYA 3F2BA 1LYXA 1X7IA 4DB7A 3GXNA 3EA1A 4EAMA 1X7FA 2BHZA 3EWDA 3VOIA 2PP3A 1OADA 3HQOA 4WGHA 3VKBA 3UXKA 4MFDA 4Q8NA 4R34A 3QPEA 3VIMA 1XRSA 3CIWA 2ZC8A 3GW0A 4L7ZA 2RGLA 3RLVA 5I3KA 4UCGA 3RR1A 4RXGA 5HULA 1QOQA 4L1WA 3GBDA 3A12A 4F48A 3E0WA 3V16A 4PTWA 1N7KA 3CL8A 2R91A 2Y8KA 1QNVA 1EQCA 2EHHA 1NSJA 1LUCB 3W6LA 1VBJA 2Q8LA 4J3XA 3G1RA 4IG2A 2YXOA 3VMOA 5CPMA 6CGTA 4UTWC 4A05A 3VGDA 5HR7A 1GQNA 4AVNA 3CIXA 2P8BA 3CZLA 4NZCA 3RPTA 6ALDA 1W1PA 3SCTA 1X1ZA 1W1A1 3ECQA 1TCDA 3GO2A 2QJGA 2YDSA 1XQKA 3LHZA 4AZCA 1DWHM 1O7AA 2R8WA 3LZ3A 1MEIA 1PZ2A 4TVUA 1I60A 2WC7A 1XIHA 1XIDA 1ITCA 1S5MA 3UYIA 2V3DA 1YQ2A 2CITA 2AKMA 3NSXA 3OVQA 1PV8A 4GYKA 4KRUA 3E3HA 4NAFA 1M41A 2EEXA 4XD6A 4Z2JA 4MY8A 1W5OA 4JHZA 3V7PA 1NP0A 1Y7VA 4XKYA 1EIBA 4S2CA 2QCHA 2DW7A 3C61A 1RVKA 3WLLA 5C0QA 3CPRA 2W63A 3U7VA 3AFBA 3E49A 1B2YA 3E1F1 1L6FA 1LQ0A 2OR2A 3VX0A 1PDYA 4FSAA 5HNRA 3VOHA 3QRHA 4KH2A 5JQ9A 5BNKA 1C8VA 4J3WA 1RALA 1BVWA 2J62A 3GTIA 3P14A 3DFQA 3PTKA 1W17A 2XJ7A 3KWSA 2QJHA 4DVOA 3WNPA 3NEVA 3PULA 3CQHA 1O1ZA 1MRAA 4NAFB 3KCOA 4H9XA 1W9UA 4B5SA 1H7PA 3TC7A 3SO7A 5CC7A 4H9MA 2OX4A 3GUWA 2A3CA 4H2CA 3SURA 4RDZA 3M7SA 2MNRA 2Y7EA 3H2OA 4G7FA 4HNUA 4X3ZA 5D9PA 1XH2A 3PWAA 4GBUA 4YTSA 1JCMP 3VNMA 4MOZA 3UA3A 4EXAA 4IHCA 4P8WA 3KAOA 3SB0A 4CLMA 4CCCA 1F73A 3CPGA 4D6IA 3Q94A 2O4MA 4HK7A 3D46A 3HOJA 3NQBA 3B8TA 2YZ5A 2Y5JA 3SIZA 3T0TA 1MXSA 4IGNA 3WF1A 3TZNA 5BXPA 3UYCA 1KBJA 4JY9A 3IRDA 4AX6A 1RLCL 1RCOB 2QEZA 4LUIA 3UJRA 4IQLA 1W8SA 2W3ZA 3TSBA 2YBTA 5CKSA 5CGMA 1KBKA 2DZXA 4HOZA 1X6NA 1DQXA 5DFAA 4EVZA 5M1TA 1ZBKA 4XKMA 4WCJA 4O19A 1V02A 4Q4MA 1P1XA 1KQYA 5E0FA 2J9ZA 3G18A 2GVLA 4U5KA 3BXWA 4PN2A 5DN1A 1H7WA 4PFHA 3M0JA 4HHMA 2GL5A 4JN6A 4I7VA 4C1NB 3NL2A 3ZVIA 4NZ5A 1VQTA 3L66A 4NU7A 3BQ6A 4G56A 4K2SA 4IX2A 3TAKA 1JAKA 5T26A 4DWSD 3KBJA 1EO7A 1G4TA 3GNPA 4O8AA 3O06A 4FR1A 1R3TA 5I3FA 2CHOA 3GR7A 2ZKMX 3AMLA 4F2TA 3RJXA 5A6MA 2WVTA 3GIPA 4JYDA 4NXKA 3AIQA 4O50A 4TTUA 2GQAA 3NSMA 3K4DA 1JYXA 3KFTA 3PM6A 6XIAA 3OLGA 3G0UA 2ISSA 3QQ0A 1SJBA 3MKCA 3CUGA 3DFYA 1EJTC 4XAGA 5I3JA 3P8JA 1VIWA 5CBJA 2YZRA 1R85A 3WEZA 1CBGA 4TTGA 2NX3A 4Y8EA 3MANA 4B2DD 3CUIA 1R7AA 1JPMA 1XRTA 4AD4A 1Q6CA 1DYSA 4FLRA 3EKLA 3VD5A 5B7ZA 5BMWA 1K8XA 4R7WA 3T2QA 2NV1A 3KP1A 2PU1A 4WOZA 1RUSA 4PTVA 1ZBCA 1UUMA 4ZL1A 1DXFA 1ECQA 2YFNA 4GJJA 1T5AA 4ZQNA 1DKWA 1DIOA 4IIFA 3VILA 3GFYA 4F79A 7PTDA 1X38A 3IAQA 3MY9A 1G4EA 5BXSA 2OELA 5AC8A 4JX4A 4Q7BA 1KD0A 1J2BA 2VX6A 4DRSA 2A3BA 3S4TA 4C1NA 3LK6A 3S47A 2CLFA 2VL4A 2PZNA 3OIXA 3DYPA 3PWIA 3TEVA 4A2SA 1CB7B 2X1RA 4LFYA 4CQBA 4HKPA 3WEOA 1HKWA 2I16A 1RHCA 4TXEA 4X2RA 2ZZ4A 4AVOA 1ZALA 4JFWA 2CLMA 4RPPA 3CQ0A 1EDGA 1KGWA 4IQDA 1ADSA 1BPLB 1Q5MA 2IPJA 5ABHA 1M53A 3OODA 4K7YA 4QGCA 3P74A 3WQ6A 4Q8VA 3LSBA 3KRUA 5K7JA 1BWLA 1M03A 2OPJA 1Q6EA 1LWIA 4MWAB 4I8YA 3ES7A 4W8LA 3TYEA 5LSMA 3D6NA 2ZYFA 3TAOA 2VVSA 1Z9AA 3W1AA 2Y7DA 4PUMA 1E51A 2OOFA 3WQWA 5M03A 3T08A 2J7HA 2CC0A 3WQ4A 3VIGA 5HQLA 1XDLA 4LS2A 4J3ZA 2XPKA 1J4EA 3UQNA 5CG7A 2OEJA 5IHSA 3WJWA 2QJNA 1CW2A 3G1SA 3ZZ1A 2EJAA 1ADOA 1VD6A 5C2XA 2EQDA 1VF8A 2VOMA 4LVDA 4XUGA 1RAKA 1JXJA 3TYDA 3PB2A 1H7NA 2WHKA 1DJGA 1V8EA 4ASTA 1FDYA 1V0LA 1QU4A 3NQMA 4HT3A 4O1CA 1ZSXA 1E3XA 1JDAA 4AMAA 2WCSA 1V0KA 4EXBA 3SCPA 1KBLA 3UETA 3W1LA 3W73A 3SCSA 1H60A 5BCAA 3HZ3A 1RQBA 3RJYA 2QPXA 1QMLA 4HMDA 5BOEA 2HV5A 3W6YA 2RAGA 4FX8A 2AGTA 3VO0A 1ME7A 1JL8A 1W37A 3MMWA 1ZCOA 1E0UA 1K7FA 1P6BA 2GQ8A 3N9SA 3S8HA 3BLIA 3MVTA 3DOPA 4LALA 3BJFA 3VDHA 3L9CA 1J01A 2GVGA 2UWFA 4AC1X 2J9XA 1S5WA 4OJYA 1DEDA 1QPOA 3W2JA 3WYZA 2CW6A 2DZAA 1R3WA 4RPQA 3G8RA 1BVNP 2C13A 3T07A 5LA1A 4TR9A 3PPCA 3N2OA 3THAA 4OBSA 1JD7A 3FHAA 1ZAHA 2YGYA 4JTJA 3GNDA 2E77A 1P48A 4HGXA 1XW8A 4IXHA 3VIIA 3M46A 4H00A 1CGYA 3M0YA 2X1IA 4ZB2A 1B1YA 1XKJA 2JKPA 1SMDA 4LUYA 2OGYA 4QTGA 4U28A 4PSRA 4RE0A 3KDNA 3B8WA 4J35A 3AJ7A 5MKGB 2X2YA 3M1ZA 2ZXQA 1BYCA 1UJQA 3TR9A 2QF8A 1EWEA 1OK4A 3W75A 5G1YA 2YA1A 2YB1A 5IDIA 3T6CA 4JZ5A 5GQBA 3THUA 3LA4A 4WGXA 4DEFA 3VI2A 2UY2A 1EF2A 1E6NA 2JBMA 4LH8A 3BH4A 4DUVA 3MBDA 4O57A 4CNOA 1W9XA 4Q8OA 2OWCA 1JZ7A 2V5KA 1AA1B 5I03A 3LGDA 5GVJA 4PUUA 2ISFA 3PFMA 1UYQA 4K1GA 4BKNA 5CZ0A 1RBLA 2F84A 3LCLA 1YE6A 1NARA 2GSEA 4PUJA 3EA2A 1NWRA 2Z24A 2O56A 4HQVA 5EBAA 4CQ8A 3BLFA 3SW6A 2GJXB 3PJWA 4AHQA 1Z89A 1IXPA 1GYMA 3ZS4A 3UVIA 4FS9A 3LM3A 4J4KA 2HBVA 2FTYA 3B8VA 4I9TA 2GJRA 4QEHA 3KBWA 4IJRA 1EUAA 4X9SA 2QCMA 1YXYA 2POZA 2Z7GA 4LYKA 3B9AA 2C0AA 4KS0A 1A0EA 3DGRA 3EKGA 1VJSA 1TWWA 3S2MA 1ITUA 3UWYA 4HBKA 4Q8UA 3AYVA 4ZO6A 1XIGA 1E0TA 1IWAA 2OT1A 3ES8A 1D8CA 1X8FA 2HRWA 3BPWA 2FGLA 3OP2A 3TR2A 1OY0A 3FEMA 5CJ5A 5EBUA 3W1QA 1KKRA 5TD4A 1DL3A 2R1KA 5A8MA 1MVYA 2CZEA 3DXIA 1K9EA 1JI1A 4H04A 2VFIA 3CS2A 2YCJA 3WDPP 1CGTA 4MWAE 3TQ0A 2HK1A 1Q85A 5I09A 1B3OA 1QPRA 5RUBA 3AYTA 1LRQA 1EJXC 3ZXWA 4WDUA 4TVDA 3FV9A 1D2KA 3T4WA 1K77A 4ADTA 1E4MM 1UC5A 2E28A 4FO4A 4MKNA 3WJZA 4H9ZA 2Z6IA 1VGAA 1F05A 4HVXA 5EMYA 3MCOA 3A9BA 3E5BA 4KEUA 1UROA 1E9YB 4B9YA 1S2AA 3RLHA 1ZP4A 3TLQA 4ZQPA 3STEA 3NQCA 3H2EA 3DI0A 1E0VA 2C18A 3R10A 5M17A 2VX4A 2WBGA 3G1AA 3P7YA 2VCAA 4AUBA 2ZUNA 4W7VA 4EACA 4EPEC 2SFPA 1VEMA 3O07A 4ADSA 3BG3A 3KUMA 4M0XA 2LLEA 1B3VA 3W7JA 1W3HA 2VHLA 3LMYA 1X6UA 4EP8C 1XYBA 3RU8X 2P53A 2CKSA 3GDBA 5BXRA 5ABFA 4B3LA 6REQB 3M7WA 2YA0A 2OYMA 3BURA 4F40A 1JJKA 2DSZA 4O1AA 3WJYA 2FZ8A 3UG5A 1TJRA 4V27A 3KOFA 1ZB5A 1R2SA 1EF3A 4M3PA 2ZRYA 3UJ2A 3D47A 1YMYA 1I9CB 4K6AA 1J9YA 1KM6A 1HVXA 4WJEA 2ZQ0A 1TA3B 3KS6A 4NIRA 2WQDA 2PLCA 2D69A 2WW5A 8A3HA 1V02E 1XC6A 4RNIA 4IMEA 3FN9A 1FKWA 1PX4A 1ZAIA 3VFCA 1JDDA 1SZRA 2AQWA 2NUXA 3R1ZA 3COTA 4O0KA 2XUCA 3MDUA 1A5BA 2CBJA 4WKFA 3WD3A 5EKYA 1P6WA 4XTDA 1FWTA 3KZSA 1V6TA 2CIPA 2XIJA 3GTHA 5FL0A 2PCEA 3N3MA 1IYXA 2D1ZA 1F6PA 1XHGA 4NAEA 1EP2A 3WLJA 4XIMA 2F6KA 3WMLA 3GUGA 8RUCA 3RHGA 3CUFA 4NAEB 5XIMA 2WO5A 4KCWA 3C52A 2JKEA 1ZU8A 3TQPA 3DX5A 2DSUA 3ABQA 3MYOA 2VJXA 3W26A 5A6JA 1W9VA 2ZRVA 5DMMA 3VUPA 1SFSA 4LAZA 3GR8A 3O6YX 4IF2A 2OO0A 1BKSA 1LLZA 4H7ZA 2F7FA 2PTXA 3GTXA 4QJ5B 1JUBA 2FDSA 1MXDA 2PAJA 5LIYX 4ZSUA 4NILA 4BEQA 1I2NA 2OVLA 1HKMA 3G3DA 4Q8TA 3BMWA 3KHJA 3WD2A 4POCA 3G0SA 2WMJA 2PZ0A 1ZCCA 3R11A 4A8LA 4UMAA 3ABRA 4Y96A 4UTTC 3WF2A 1DHKA 5EMKA 3WH6A 3WIJA 1GORA 4UFIA 3FW6A 4LRSA 3UG3A 1XRVA 3MV01 1T7LA 2OQLA 1TUFA 1H51A 3BGGA 2BVTA 4O1EA 3QV7A 1XGEA 5DY2A 4GPNA 1QNSA 4WY0A 2CNCA 4FOJA 4Y6GA 2C6QA 1XPGA 4LOCA 4W87A 4I5UA 2QT3A 2PLJA 2DZSA 3M07A 3QPZA 1O12A 4A3QA 1R2TA 4GI8A 5BZAA 4UMCA 4WDWA 3IANA 5C9RA 4ERGA 2F61A 2PU0A 3MSDA 3WQEA 1OFBA 1GZJA 3L4VA 2QCFA 1W8GA 1NFGA 5AVNA 1Q6LA 4V1XA 5KZEA 2NQLA 1MYRA 5I02A 1J96A 1M01A 1V0NA 5M2FX 1I45A 3OGSA 4IIGA 3VNJA 3TC6A 1HTIA 3BJTA 3VOCA 5I3HA 4QEEA 1SJCA 2ZDSA 3TYCA 4O17A 2CYGA 2E9BA 2QJIA 4MKVA 1JDEA 3KTXA 1D3HA 5FF7A 3FGCB 1PUDA 1RV8A 1XIIA 3IGSA 1GYNA 2QIIA 3O9NA 4DZHA 3BVJA 4E4FA 1QI3A 4PR4A 4BF7A 5I0DA 2PWDA 4GH1A 1J8VA 3YPIA 3CZKA 3LU2A 2INEA 1QAPA 3QEZA 3SCVA 3KRBA 4GH3A 2OSYA 4JNMA 4LUTB 1UMLA 1UKOA 2XVNA 3C0LA 4JYEA 4AEEA 4GC4A 4AZCB 1VRDA 1WE5A 2J6VA 2VVNA 4IP7A 5I77A 1AFSA 4O18A 4DJFC 5MKGA 1GVSA 1T8QA 4HZ6A 3P93A 2P3EA 4PMNA 5KZ6A 1JG9A 1TZ9A 3CAQA 1B3WA 5AYIA 4K68A 5HDRA 4D6EA 3KHDA 2VC9A 1YXCA 3LOTA 2DUZA 4FX7A 1JZ4A 4JTFA 3Q65A 3IPWA 1F3TA 1EEXA 3NGFA 3SN0A 2A0NA 1TPWA 2BX7A 1H4PA 3W22A 2WLYA 1OCJA 4ZOBA 1Y8BA 5E6ZA 1FWDC 4W9TA 4MYAA 2VWTA 4BQ4A 1TSIA 1GJPA 5A8NA 5FJTA 3ITYA 4BWLC 1BWKA 3LQLA 3VOGA 1W5PA 2IW0A 5CPLA 4OECA 4BI5A 1OFRA 3P61A 1KXTA 4B92A 4EIVA 3P62A 5BU6A 2NW0A 4WUIA 4C1LA 5D2TA 2AAAA 2IUZA 4JN7A 2V2DA 1D9EA 3UY7A 2Z1BA 3TJ4A 3KP0A 2B7PA 4QP0A 4AIUA 3CIVA 3DG6A 2X0SA 3DC8A 3S6OA 3B06A 1DP0A 2VEKA 2JKAA 1A3HA 1AJ2A 2DQXA 3ORWA 5AHNA 1TE6A 4I5RA 2VEIA 3NOYA 3GIYA 1KXHA 1C9DA 2GGEA 3KCJA 3S9IA 4FR6A 3B0PA 1KO0A 4QISA 5LYRA 3QTGA 4LXFA 3I6RA 1DJIA 5BMXA 2GVYA 1TPH1 2QUVA 3C0SA 5D09A 1UZ4A 2G3FA 1RXOB 3L21A 2OYLA 4J3VA 1UBPC 1Q63A 1LBLA 3RLGA 3CH9A 2PD9A 4LYRA 2RUSA 5I6SA 2XM2A 3RCMA 3KBNA 3SECA 1Z8AA 4ACZA 5D38A 1YBQA 1HGYA 3WLSA 3MZNA 3TNBA 1E70M 2GUUA 1XLEA 4JDBA 2BWGA 1YNPA 4MHBA 2HMCA 3SQSA 3BARA 1A0CA 1GVFA 1T96A 2J24A 4NNAA 4WKHA 2R24A 2PDBA 2VC7A 3K4WA 2P1FA 4MFEA 1LF1A 4PB3A 3LXBA 2A3HA 5AHMA 3TVAA 2WZHA 4LS1A 3PNZA 4AY7A 3ZLHA 1W0MA 4RDYA 4M5PA 4OV4A 4PCTA 5D33A 4YTRA 4UQBA 3HGJA 4PTXA 1TRDA 3SM0A 3CC1A 1ZP3A 3QW3A 3RM9A 1XGDA 2IS7A 4HSHA 4WIWA 3AS1A 5DEZA 3KBMA 3RN6A 3LLDA 3PUOA 4DO5A 4H19A 1YX1A 4HSOA 3V1HA 4CQAA 4ICNA 1RCXB 2ZX5A 5ABGA 1GZGA 1HP5A 2V82A 3QBUA 3BJSA 2QDEA 4I9MA 3WQPA 2ACQA 1UKQA 2TSYA 3WF4A 1QWKA 2CBVA 3CUZA 3T09A 2JF7A 5JH1A 4OOZA 3OZPA 5LNRA 3CT2A 1CGVA 1KGXA 3C2EA 1BXCA 4TVCA 1ONRA 3R79A 2VI0A 5CG0A 3PWGA 3DYOA 1GZ1A 4FNQA 1JFHA 2J7DA 4ZTXA 3IJ9A 5C5YA 1WDQA 1FDJA 1YKWA 5BOFA 4PGLA 3CHEA 1Q2SA 1J0YA 4S3EA 2V63A 4S3FA 4PCFA 4KT2A 4AIBA 1QNPA 1NDWA 2YXXA 7REQB 2VYOA 1FOBA 4WSJA 4C65A 2WJFA 4GUFA 5A6SA 3TYAA 3EX1A 4HYVA 3VD9A 3OZMA 4GGHA 5CGQA 3CV1A 2R82A 3U8GA 5JIPA 3I7QA 5E5CA 4AZIA 5CC6A 1U5VA 3W24A 3PZUA 3TE9A 4IZGA 4MZYA 4JIQA 5A8QA 3VCNA 4I6KA 4PMRA 3B9DA 2ZRXA 3TOPA 4W89A 1I2OA 2X0HA 3A6OA 1XXXA 4UZSA 1W32A 1JXKA 7REQA 4GI6A 1F3EA 1E1FA 4O13A 4O10A 1U30A 4BHYA 5K4XA 1WAUA 3W7IA 1KM0A 4L5ZA 3KEHA 1GGOA 2VR5A 1XH0A 1SMAA 3ZSTA 2ZUMA 3SEPA 4PE8A 1A5KC 3UEQA 2BDQA 1S39A 1M7XA 3C2YA 4LAOA 2ZZ7A 2OXNA 5K2ZA 3IK2A 3L68A 1UW9A 4XD5A 1NIUA 2ZUVA 4UOZA 2Z00A 2IPGA 2XH2A 2E5CA 4H83A 1DJZA 1F07A 3MO7A 3EWCA 4A8IA 5AOUA 1H1ZA 1SSDA 3AXXA 3L4YA 3NDOA 2VWSA 3VPLA 2GDVA 1I8JA 1R9XA 1KXVA 3D3AA 1CI1A 1HJVA 1NP2A 1DTNA 5HWJA 2BS9A 1EEPA 2WNZA 2ZZ5A 5D8WA 4J27A 3UCCA 1S38A 2Y7FA 1W1IE 5AY7A 2E9LA 4HHHA 4ERIA 4P5UA 1E5JA 1BTCA 5BWAA 4D72A 3IVUA 5E0CA 3VZXA 1HVQA 3G1XA 2MANA 3L12A 2ACRA 1TMLA 4AHPA 3PZTA 2B7QA 4DAFA 4JTQA 3KL0A 3WH8A 1QHPA 1HJQA 2D0HA 4N2YA 2D22A 1MNZA 4IPIA 3UY8A 1OGSA 3R25A 3VMNA 2DH2A 4XAFA 3MMUA 4N9EA 5HBFA 3GB6A 3QHMA 2QCEA 4OWGA 2FHCA 2P8CA 4PCSA 1A53A 3TMLA 3UGVA 4P7OA 3WBEA 1W1VA 4AEOA 5BRPA 4RX0A 4B16A 3HFTA 2IXUA 3FJ4A 5G1TA 1E4NA 4MADA 4KWOA 4P7NA 2PDGA 4YL2A 4DZAA 2PWHA 1OC6A 4DLMA 3WD0A 2XFFA 4N9BA 1M3UA 1GT8A 2ZRZA 3ZJ7A 4CNNA 4JIIX 2WB5A 5A8GA 3R4IA 4E2BA 3WG6A 1XLFA 2DVXA 4LVGA 1KWKA 2VEGA 3AHVA 3VDCA 4CNTA 1VH7A 2C1GA 3R8RA 2O7QA 2XFYA 3BGAA 1UR8A 3CB3A 3LCWA 1FWBC 1RPKA 4GY7A 4UTTA 3S9YA 3LI1A 4UFLA 4C6OA 2YBUA 3GYCA 3IGHX 3EZ4A 5HJXA 3TCEA 3BLLA 3BOXA 2JGQA 3BDKA 4NYYA 2TYSA 2P50A 5L6UA 1FWWA 1RP9A 5TIMA 4EANA 4IG2B 1NVMA 3PZGA 3NDYA 1DIEA 4DO7A 1JCLA 1A5SA 1E5NA 1QR7A 4JTIA 3I3DA 2BASA 4DPQA 4KCVA 2FIQA 2FPYA 4S3DA 4Y9AA 1R8LA 2Q71A 1RSCA 2Z29A 4NVTA 2J27A 1PL9A 4GXWA 4H1ZA 4O1BA 1TPC1 3W7CA 1ML1A 1UJPA 3CV7A 2I57A 3GHSA 2DU2A 1MMFA 3BANA 2PI6A 2QMJA 4ZCWA 3F4DA 5CEWA 2RDWA 2YBVA 4JPGA 2WHLA 3KVJA 1T6MA 2YL9A 1G9HA 2QR6A 2WWDA 4CVWA 4W4QA 3S3GA 5DT5A 1YPXA 3W6MA 2OOGA 3GXMA 2D20A 1ONEA 3VNIA 2C7FA 3LHYA 2UY4A 4HZ8A 3B9OA 4O14A 5DBTA 4WDXA 4J3TA 4UCFA 4WXYA 2FGBA 2ZXAA 4J28A 1SM9A 4JTCA 3TTEA 1VPXA 3AOFA 4GVFA 4D9PA 1GOXA 4EPDC 2ZTJA 3CASA 1IEIA 1H3GA 1O5KA 2BFGA 3W82A 4MJZA 3QN3A 4KBXA 1TCMA 1QNOA 4L9ZA 1FWIC 2F2HA 5AHEA 4PA8A 4BWLA 1S1RA 1UCWA 1RCQA 4XK2A 3NZQA 3OIHA 1QI5A 5G4WA 5FJJA 4I6VA 3THQA 1G0CA 3RUBL 2PWFA 2YCLA 5FEXA 4HPXA 1HO4A 1YADA 4ACYA 1GK8A 2NQ5A 3GDRA 3MZ2A 1VHCA 3TKFA 3SCRA 1IZJA 3ITTA 2WVVB 1MO0A 4PCNA 2DJXA 2XM1A 3NL3A 4A29A 2XIMA 3HGSA 2QCLA 2KAUC 3N2CA 3WNMA 1UOKA 3N19B 3F7JA 4HMCA 1OFPA 3KRZA 2YR1A 2FZDA 2ISDA 3NSNA 4EXQA 1WDRA 2E4TA 1Z48A 1IXNA 4AC7C 2ZZ1A 4QLLA 1Z7AA 3EPMA 1DXEA 3WF0A 1OFOA 1P7TA 3C5QA 8XIMA 3MSGA 3ABZA 1CYGA 3S5OA 1DWJM 1YDVA 1C3FA 3F2CA 4H6KA 1H7RA 3HG3A 4F8XA 2CLKA 2HNEA 4CD5A 3W0KA 4ICMA 5ECVA 4M8UA 3ARSA 2CU0A 2DW6A 1JZ3A 1TPB1 1IWBA 5XIAA 2Y63A 1PO9A 4XVEA 2ZZ6A 3NYDA 1WOBA 2BZNA 1QHOA 1ZNNA 1ZZMA 1OCBA 3NGJA 1OYCA 5HQMA 3ARWA 3CM4A 5CPQA 3BAYA 1TX2A 4UFHA 1AZ1A 2RGMA 1GOMA 2OQHA 4QNWA 2PTZA 4IIEA 2PRLA 2OKTA 4LY4A 1UA3A 3VNLA 1LROA 4U10A 1X96A 4D8LA 4FIQA 4DX3A 2PURA 1YDOA 3NQDA 4RNFA 2H90A 4MJMA 3R58A 4ZE5A 1XH1A 2GOUA 4FXFA 4AZ5A 4JTLA 2QV5A 5AC4A 1BTMA 1W1TA 1M1BA 3RX3A 2WMIA 5FJPA 1JQVA 3ARTA 3CLWA 1BAGA 4Q8PA 4YCPA 3WZ0E 4XZIA 4GFIA 1RK6A 4D1IA 3HQPA 2QGYA 3OB8A 2VQTA 3T8QA 3BG5A 1ZHAA 3UJSA 3H24A 1US3A 5FF3A 4JBRA 3EOUA 3PN8A 5A6BD 3I68A 2ZUSA 2CLLA 1E15A 3CHVA 3ITLA 4W88A 2QV4A 3CJPA 2BXZA 1WYIA 3O05A 4NQ1A 2RDXA 4Y9MA 4GC3A 1U83A 1PKNA 4US5A 1ME9A 2PDIA 1EJUC 3SCQA 1MXGA 3ZM8A 3TWAA 3OO2A 1VFHA 3LZ5A 3PSWA 3RILA 1CXHA 3VIPA 4EF9A 2ABAA 3NUKA 3N6HA 1XINA 3FK4A 4MZ1A 2OX1A 3FSUA 4G2DA 3L2IA 1UWAA 2ZA3A 3URAA 3JU2A 4KFNA 4CUCA 2FH6A 4DAIA 1QO2A 3LV6A 3MHGA 2X1TA 2YDAA 3KW3A 1EPXA 4B2DA 3NO3A 1E3ZA 2YYUA 3T78A 3N15A 1F8MA 2WPGA 1J18A 1E40A 2BY3A 1TX0A 3FNDA 3E2RA 1G67A 1J0IA 3DH7A 2VX7A 4YS1A 2YA2A 5FSEC 3M41A 1KV5A 3P6LA 3M44A 1MUWA 2L5HA 1QI2A 4UQEA 3AIRA 1XR2A 4MLJA 4UR9A 1XD0A 2DUAA 4OZOA 1PZ0A 1HKKA 2XSAA 2AOSA 5M5DA 1AMKA 4HCLA 5AHFA 4PBGA 3KZPA 4HHPA 4DJEC 3M0ZA 4YYCA 4ILSA 3UR8A 4O15A 5TNVA 1EJVC 2BXVA 4Z1CA 3FVMA 2WANA 3WUGA 4CKQA 3PG8A 3CBWA 3K4AA 3OVRA 4RLIA 1OFDA 3QQ1A 2RJHA 1M68A 1I1WA 5HUOA 4DUWA 2C1IA 2BVWA 1QATA 5H1WA 5DO8A 1IXQA 1IEVA 3CHFA 1FCUA 4MYXA 6XIMA 1YTEA 3TJIA 2CXGA 1WZMA 4TU1A 3CYVA 4P7RA 3W7HA 4UR7A 2ANUA 2X41A 3FCPA 4IPLA 3RG6A 2Z1KA 3NZRA 4F9JA 4UIOA 1LORA 1GNXA 4OUIA 5FOOA 2QCNA 1KA9F 2FB3A 5G2WA 3GH7A 5B80A 2AAMA 3HG2A 3W2MA 3C2FA 3EB4A 3MP5A 4XBJA 3G5EA 1JNEA 3HQNA 4H6QA 2I5GA 1AH4A 4HMNA 4JFSA 1IGWA 2HROA 3PTDA 1JUKA 5K4ZA 3MUXA 4LV9A 4C6LA 1I6NA 1V77A 3S1GA 3U5YA 1PYMA 1G7VA 3UWZA 3P67A 2Z28A 4WLCA 2HDJA 3EWZA 2A3LA 3FJLA 1ZRQA 3ITCA 3BW3A 1ZJHA 5CSUA 5D37A 3SQLA 3VAVA 1W3JA 3ARZA 1XUZA 3LSCA 1D3CA 2ON3A 2NWRA 4E6MA 4D8ZA 3WO8A 4TOQA 4C91A 1FXPA 3PBGA 2QVNA 3JZUA 4PMUA 2TODA 3ELFA 5CCZA 4AG0A 3AQUA 4IQJA 4PFMA 5JBDA 3N4EA 4EAYA 3FYYA 2XG9A 2ZICA 1XCWA 3POHA 3AUOA 1G7UA 1KM5A 1TPDA 1AQFA 1ODUA 1BRLA 5IHRA 4J1OA 4IICA 4BS0A 3AU6A 5IOBA 3MTWA 3OLDA 1B3XA 2E6YA 2DORA 2PTDA 2NV2A 2VURA 2VDHA 1J12A 3XIMA 5CPSA 4QQ3A 1ITXA 2J74A 2Z6JA 3QGKC 1N8FA 4V28A 1GKPA 1SW3A 1XSIA 3T81A 1K4HA 1OX4A 4E38A 5D32A 1DWAM 2BOGX 4R53A 3ANUA 2VTFA 1HX0A 1SFTA 4DF1A 3OEXA 4Z08A 4C60A 1V4YA 1W3TA 1YIXA 1VS1A 3GC2A 4HNVA 4HJWA 4DJFD 3S6DA 2OLHA 1XSKA 3G6LA 3MI2A 1XLHA 3LBCA 1WDDA 4QJ3B 2W62A 2GJXA 4DBEA 3S6TA 4K8GA 4I9AA 4QROA 1OM0A 1MQPA 4GKTA 3W37A 5I3IA 5CBIA 1DWFM 2RDTA 5ENLA 3R8HA 3E38A 3A64A 1EXPA 4RW3A 2ESCA 4CU7A 5ABTA 3EXTA 2KX9A 2V5LA 3GXIA 4PL1A 5FKYA 3SY5A 1JD9A 1FDZA 4AMCA 3DG7A 1P1MA 4BI6A 4LAKA 1BQGA 1LT7A 4GQ0A 3WY1A 4B5WA 2J25A 2QF7A 3B9EA 3WLHA 1AZ2A 2JIEA 4QE4A 3NQFA 1P0NA 3QC3A 3P82A 3H23A 3TJLA 3DC0A 3EXRA 5LIWX 1TR9A 3MW7A 4MNJA 2QCGA 4BJHA 1KLZA 4CCDA 3MKVA 3BCJA 2JEPA 4PULA 4X61A 4GNKB 3A21A 3I3EA 4BEUA 1H5VA 3LNMA 5DLCA 5G2IA 1UR9A 4N02A 1O1HA 2ZBTA 3GSMA 4IMAA 3HV8A 3SY8A 4QBXA 2X05A 1T0OA 3WH9A 3BAIA 2PUZA 3HPAA 7CGTA 2Y2WA 1FWHC 3MDWA 3TX9A 1GHSA 1VFOA 4FP1A 2HZGA 3EDKA 2VKZG 1R9ZA 3QSRA 4L56A 1RJPA 1H1YA 1DJNA 1GQKA 3BAKA 5CH9A 3PPGA 1UMYA 2J47A 4U5IA 8XIAA 5C9XA 3PZ9A 1AG1O 4DLFA 3UZ5A 4XSMA 3SZ8A 2J13A 4B4FA 4U3AA 3GWQA 2WHMA 2PGEA 1EH9A 3PAOA 4IPJA 5A6AA 4DXVA 1OWQA 2Y6ZA 1XLDA 5FCZA 5AHLA 4NRSA 5I7GA 3AU2A 3N2MA 1EYWA 3TA6A 3E2VA 2XZ7A 2UV8G 2CESA 1OABA 3U4AA 2ODOA 4XTIA 2CZVA 4MNKA 4ZOCA 3PJUA 4LX4A 4DJDC 3HU7A 3S5SA 1O66A 3LRMA 3OBKA 5F1VA 1EP1A 3WK1A 3UXDA 3GAYA 3DHDA 3QR1A 4GYJA 3IJ6A 4JKKA 1XBVA 3HIJA 3AALA 4KWWA 2W5FA 1UR4A 3CO8A 3IGUA 1PTGA 4QHRA 3K30A 2QGHA 4L1XA 1SR0A 3G3MA 3UPBA 1V3HA 2OWXA 1KCLA 3NXLA 1J93A 2A1YA 3WF3A 3SRHA 3W70A 1RQEA 3TMQA 5GJMA 3RMJA 3PBWA 2ZX6A 4K8HA 3VD3A 2HQAA 4K3ZA 4MB1A 3WENA 1VYSX 3KLKA 1H7OA 5AYZA 2WSRA 4H7VA 1HG3A 2HISA 4S1FA 3W1TA 2Q3OA 5PTDA 6REQA 1S5NA 4E3VA 1BQCA 2FMOA 3CZGA 4WX2A 4X63A 3W7GA 1GTHA 3LHVA 4MIMA 1PS9A 3FIGA 1KR0A 3ARUA 1L9WA 4UZUA 3BV4A 3B0YA 4O11A 3GKAA 5AHIA 1O4UA 4KKXA 3S1WA 1SQ7A 1UH4A 4XB3A 1B31A 1NEYA 2HJPA 3HPZA 5DRCA 1KRMA 1KFBA 3H26A 1F9CA 4JXCA 3VA8A 3MMTA 1OC7A 1F7BA 3LMZA 3WK2A 3S1UA 2YXGA 3EOSA 2XFWA 3LGGA 4GY0A 4KF1A 1S1PA 3CXOA 4OT7A 2D0FA 3UXAA 4ZQOA 2O7SA 4NKCA 2FPVA 3CV6A 3EX3A 4S3JA 2F6UA 4AD0A 3M16A 3BW2A 3GYEA 1IGSA 4CU6A 2FHFA 4V1YA 4N4QA 4DZ5A 1EUNA 5BROA 4UWMA 4Z1BA 3EEZA 5LNWA 2W0UA 3G0XA 4IFRA 3AXHA 4WRHA 3DHFA 4UTKA 1EZWA 1F74A 4A35A 4GYPC 3K8KA 1JYNA 4KEZA 5JBEA 1CGXA 2BLEA 2WCGA 1YE4A 1W6TA 3APYA 5CSYA 1UKSA 1US2A 4LUJA 5U7SA 3WBWA 5FD0A 4MG4A 1XBYA 3TN5A 4PMVA 3W53A 1C92A 1L6WA 4JTKA 5ECUA 4JL1A 2ZFAA 3N9KA 2R94A 2H8ZA 3MHUA 3KLLA 4FNUA 3C2OA 2CCRA 1CB2A 1V93A 3FDKA 4E5TA 5A5WA 1HO1A 1FH9A 3N4AA 2QCDB 3QZ6A 5G4HC 3U2EA 1L8NA 3O6AA 3JZEA 1U22A 3UR5A 3GNXA 4XQ6A 2ZCGA 1TE1A 2WXDM 5KITA 3S2NA 1G94A 1LLOA 1EC7A 7ENLA 1DXIA 3UP8A 3CQIA 2PLMA 1TVLA 2GYIA 3PF3A 1P43A 1HN1A 2E1WA 1IEQA 1ZBVA 2GDQA 2DT2A 4WHBA 3CWHA 1VEOA 4CEXC 3CT7A 3G1FA 3KBSA 2XDFA 3MVIA 4AZBA 3GS6A 4MWAC 1X98A 1GG0A 1KKOA 1W2VA 3DCPA 4BK9A 2H9AB 1PSCA 2FJKA 1RPXA 1TFVA 3SN4A 1MZRA 3SJ3A 1OQFA 1LL4A 5CAHA 5D03A 4OBRA 2X1SA 3I3BA 4H8UA 2OJPA 3IVTA 3FSTA 3I4KA 4JCLA 4P8XA 5FF0A 1TB3A 4ATWA 1VBUA 1DQWA 4TV5A 2PGWA 4URIA 2FGZA 1GYLA 3OGVA 3L2LA 3T0AA 1GWJA 3SRDA 4XISA 3K1DA 3EBVA 4OFCA 3FGCA 4GJIA 2E5DA 5IDZA 3FDGA 3NYZA 3QF0A 2WNQA 2XINA 1XGZA 4K37A 3V1PA 2X30A 4ZEPA 2C1HA 3V0TA 2BVYA 1GKRA 3URBA 4IUOA 3IUIA 3LENA 3BOFA 2PGRA 3N6JA 2Y85A 1H0IA 3GU9A 2GQ9A 3W02A 1UWSA 5HXMA 4IJCA 2XHYA 3WH7A 1KRBC 3VOFA 4NASA 1A5OC 3K2GA 3H2NA 1E9ZB 4TMCA 4W5ZA 4EWND 3LRLA 4IPNB 2V5CA 1DTUA 1Z32X 1BSIA 1XUUA 1UIOA 1XISA 4Y8FA 4ML4A 4V2XA 2BOFX 3QY8A 2VD9A 3NL6A 3V5OA 2Z1WA 1V3KA 2GWNA 1ZLPA 1LUCA 1TWDA 4D6CA 1VKFA 3T1GA 1V7YA 3W7OA 1EDQA 3GNRA 3MCNA 3GVRA 1LWHA 2VT0A 4H8VA 1MEWA 2CKRA 3T40A 4OHQA 3LYEA 3VM7A 4MDOA 3USZA 3B97A 4A3UA 5AB3A 3UT0A 4B91A 3JRKA 3CEUA 3IV3A 1R7OA 2HXUA 3W81A 4QCEA 3ICJA 1EJSC 2Z1XA 3H70A 4LWWA 2Q8XA 5CJMA 1OX5A 2FYMA 3NOEA 3PBUA 3WSUA 4RE4A 3SUWA 4CQ9A 4C5ZA 3CTTA 4GX9A 1R3YA 2XSXA 3NCOA 2NWSA 3BLPX 3INPA 1M6JA 1L2UA 4JX5A 3CHCA 1YEYA 3VK5A 1FFRA 1QPKA 2X42A 4EE9A 3HPFA 2GGIA 4YLWA 1FCBA 4ZOAA 4REQB 1AW1A 1KQZA 4YJ5A 3AHTA 5FAGA 4MWAD 4L6HA 3GXFA 2ATSA 2ABBA 3TFCA 4YNGA 6TIMA 3QY7A 5CXPA 2WK2A 1TQJA 1LRTA 3W86A 3M0LA 1FHLA 4UFKA 4WKAA 4AZ6A 4AFYA 2FZ9A 2B4GA 1MZHA 4XX6A 4P8VA 5A6KA 3WQVA 3V36A 3IJDA 3A4WA 1MW1A 4C6QA 2ZUUA 1JR1A 1Q6RA 4G1KA 1WXYA 3N04A 2GK1B 3OLIA 1MW3A 4UXDA 1G01A 3NEHA 3TONA 1RY0A 4HOXA 3NZPA 1OHLA 2CPUA 4NJJA 3ZMRA 1Q8JA 7TAAA 4UB9A 1YPIA 4OBTA 1XLCA 3U4FA 3H7UA 4LRTA 4NF7A 2PP0A 1XX1A 5T91A 1JPDX 1P0BA 5A1AA 3H4XA 2DY3A 4D6GA 5KINA 1AL8A 2PEVA 3KVMA 1GOOA 4UFJA 4XZBA 5A8OA 2I7GA 3R0KA 2G96A 1RD5A 3WQGA 4I8DA 2ZZ2A 1G69A 3M6YA 3Q45A 1VJZA 3SGUA 5CPNA 1BEUA 2VZTA 3UF9A 4Z17A 2QZRA 4QE5A 2WMGA 3V4BA 3G24A 2XWDA 4MB3A 1V6XA 1XBZA 2GQ3A 6PTDA 1VC4A 4KIRA 2ZZ3A 1IR2A 2JGYA 3T8LA 4X9YA 2ZX8A 5EFDA 4B5TA 1XIEA 4XD4A 4H9YA 1QNRA 5AYXA 1S5VA 2NVAA 2WC3A 4Q7NA 3PNUA 3F2DA 5BW6A 2IQTA 3DIPA 3AAMA 4L1GA 4IJBA 4LQ1A 4D8AA 1NDVA 2VGIA 4YTQA 2VDIA 4HU4A 4LBRA 3GXPA 1E1CA 2NXHA 1W2PA 3BSGA 4B9ZA 3B8DA 3IVSA 3PHAA 5E9AA 4ZTYA 1ICQA 3LRKA 4AWTA 4RXFA 3W1RA 3VU2A 3CMJA 3VIOA 4GCXA 4HNNA 2WQPA 5A6TC 1Y5VA 3WELA 4LYQA 3TP4A 2ZE3A 1QW8A 1WAWA 4MAVA 1JPIA 3IJ8A 3IIOA 3GFXA 3LTSA 2PMQA 2VCBA 4JTHA 4PCPA 2PA6A 4X22A 1PPIA 2CERA 4LEFA 3MUIA 3U3HA 2DUXA 2UZ9A 4XZWA 1A49A 4IFOA 3B8UA 3NQ2A 4GX8A 3AYRA 5EY5A 2OODA 1QOXA 3IS4A 3EWBX 1JUEA 4IQEA 1BF2A 1VCVA 2WAGA 3PJTA 4ZB0A 5I78A 3A4JA 3ZYZA 1GQIA 3E0VA 2NVDA 1S2WA 3EOLA 1DOSA 4QFUA 2ALRA 3VABA 2V6AA 2VC6A 4GIRA 1MEHA 3EXSA 1R9YA 1U5JA 4Z2KA 3CUHA 3LLXA 5E6YA 1RY8A 1RA5A 2X0YA 1W1B1 2FMNA 3W07A 3FFSA 2GJNA 2XVGA 4C6JA 2E1DA 4E2VA 5IXEA 3UESA 4WF7A 3NL5A 9RUBA 2I14A 5I23A 2J8TA 3WUFA 2R1MA 4NJHA 4MUPA 1KRAC 3ITVA 3SRKA 4LNCA 5EPDA 3OYZA 1N2VA 4W86A 2VFEA 1WBHA 2TMDA 3VGEA 2V5DA 3B0XA 4KEMA 4F0KA 3HJZA 1QXLA 4RE2A 3O16A 1JYWA 3FVDA 3N29A 3O8AA 2DZTA 2OWWA 5HNUA 1KW1A 4GHRA 3GU2A 3V75A 4AF0B 2V2HA 2ALDA 1H11A 2BGNE 1KFKA 2R1PA 4LUSA 1A0DA 1WUFA 3HG4A 3XINA 4BA0A 2OGJA 4QDMA 4GYPA 1X1NA 4JD4A 3M43A 2E68A 3OZOA 4FLOA 3SSZA 4HYWA 1KFCA 4BQ5A 1KTBA 4L4OA 3O0KA 4V33A 1FWEC 5LXEA 1IZKA 3PG9A 4JN8A 4Y9PA 4KPLA 4BI7A 4JFTA 2BOEX 3TYBA 1WKEA 3RAOA 2GSJA 1UG6A 3DFTA 4MAZA 4FB7A 5I3GA 3K1GA 5AECA 3P80A 4QJ1A 1WO2A 3KE0A 3TXZA 4Y2WA 2ZXDA 4L4MA 4GRSA 3M0IA 3OLEA 4A6GA 5DANA 1E72M 4PB4A 5EMMA 5J5DA 4UOJA 1GPWA 2H9AA 4JS3A 5G4EA 3RR4A 2CETA 2YL5A 1SSGA 1YTKA 5D8ZA 4ES4A 1TWZA 2E6DA 4AZHA 5TAOA 3PTMA 5E9XA 1Q13A 2Q8ZA 4GVHA 1K9DA 1EX5A 2JFEX 3A22A 4UTUA 5EB8A 4ZXOA 1ISVA 5A8PA 2AGKA 1P6CA 2XU2A 2HVNA 4IMDA 3O63A 4Z2IA 2EJ1A 3BGJA 1A5CA 4JHOA 1NJJA 2QW5A 4DNHA 4NRRA 4Q4RA 1WDSA 5CAKA 3WMBA 1OG0A 1W56A 4QNEA 5D05A 4J40A 2QCCA 2Z4GA 2IPFA 5E93A 4S23A 3GH5A 1CGUA 1CPUA 2TPSA 3QR3A 4NI8A 1N82A 2YLLA 1UZDA 1FWCC 1XICA 3AS3A 3OTRA 4M7SA 4O1DA 3FLUA 4R33A 5KTLA 3MV11 4ZMGA 5A2AA 4JAWA 3VC5A 3HGRA 3SR7A 2PWGA 4JTEA 3RPMA 1W3IA 1CCWB 3GR4A 1Y5WA 2NQZA 1R87A 3SCUA 2ZDRA 3EDJA 2D2OA 1X97A 1W3KA 3AHZA 1W5MA 4PRTA 3ANYA 1GJWA 4LANA 4Q8QA 4R9XA 4W85A 3TW7A 3QV6A 1EGMA 4HPGA 2DSVA 1Z42A 2ZUTA 3A3HA 4O12A 2XIQA 1FTXA 2J66A 1OT2A 1YBQB 4LPCA 3L5AA 3EPOA 3WMCA 3EMQA 3W7PA 2BVDA 3PBVA 2OTDA 3RO6A 3GXDA 1XYCA 1GHRA 4U31A 1CLVA 3I6TA 2A21A 2G4FA 3HQ1A 3NQEA 4H8NA 3SAZA 4IISA 3R6IA 4Z2HA 4S39A 3W23A 3OQ8A 4GMEA 1G6CA 3SQMA 4E2DA 3OBAA 2IQDA 2DEPA 2Z2AA 4F0HA 2WMIB 3QYSA 1EKOA 3OU8A 3WK3A 4B90A 1M7PA 4TX8A 1V79A 3B3DA 4PUEA 3J7HA 4B5VA 1L6SA 4JIRA 1G1YA 4UMBA 1WZLA 3UNTA 4QDWA 3PBMA 1W3LA 4Z1AA 1R0MA 3KM8A 2AKZA 5DCEA 3M64A 4G9PA 3QYQA 3DDMA 4UQAA 1EA9C 4OVXA 3IACA 3P8IA 1I0DA 3ITXA 5CQ1A 1Y65A 3U57A 2J8FA 3CPUA 4PTMA 1K7EA 1QPQA 3ZLGA 1EPVA 1FXQA 2Z0IA 3M0KA 1WXJA 4LAMA 2HTMA 4YXGA 2JE8A 3C0JA 1EHNA 4D6FA 1R3QA 3FYPA 1F6YA 3C4UA 3H2MA 5HQEA 2OYKA 2B81A 1A5UA 1JULA 2GK1A 1C9WA 2EPMX 3NG3A 3IUDA 4A3RA 3RM8A 5HOSA 1K4GA 2OSXA 1QW7A 4JX6A 4G5DA 1C7TA 3WDJA 3VVGA 5HANA 5B7YA 3ONCA 3CGTA 4NZ1A 3QPYA 5FI8A 3V3WA 5H91A 4RKAA 1ICSA 1EFZA 4H6RA 3WMSA 3QMSA 2Y89A 2I5IA 4DI9A 3LXCA 4M51A 5I5RA 3WD1A 4F9DA 4FMVA 3W76A 1B30A 2H3DA 3VDAA 3DFNA 2DPEA 4U3CA 2JK2A 3P5YA 2YL8A 4UFMA 3FXYA 1UWUA 3SJNA 3VNYA 3GU1A 3BTNA 5F4SA 5HPOA 1WBJA 2DZUA 5A3HA 5CC3A 2OB3A 3CHDA 2R14A 4RDVA 4JTSA 2OG9A 4LS0A 4HA3A 3DFOA 3E2QA 2Q02A 1LRNA 4UQDA 2Q6ZA 4DUOA 5BRBA 1PZ3A 5GPRA 2XVKA 3FAWA 3WBAA 5DXXA 4GZ7A 4YWSA 3NNTA 2JALA 3WJSA 1FWSA 5HA7A 1R47A 2B7NA 2WSYA 3TOYA 4GG9A 1VEPA 1SJDA 1DPMA 5C55A 4F0SA 3QKZA 2Y24A 4AQLA 3UZJA 3DI1A 5F1UA 3BSHA 1IIHA 3JW7A 1L6YA 4F0MA 1R46A 3FA3A 3G8EA 5KMYA 4S3BA 3M9YA 3NQ8A 3DGBA 4GY1A 3PP7A 4WSHA 5CJNA 3QM3A 4I9JA 2W6RA 1FWAC 1AK5A 3F5LA 3IUHA 2NQHA 5A6BA 1UKPA 5EA9A 1NM9A 4UQ9A 2Q01A 3GC5A 4IGMA 1TV2A 4QS5A 1AJZA 1CTNA 2G0WA 2PWVA 5LGZA 2QHAA 3L4ZA 3CL7A 2EKCA 1B3ZA 3BAXA 4C6MA 1EP3A 2FFIA 1UA7A 1OFQA 1W54A 3UZYA 5FAJA 1F76A 1M5WA 3LQGA 2WMFA 3FA4A 3LBOA 1ZS2A 2WNNA 2WZTA 3RRAA 1CXFA 4IMGA 2QDGA 1Q65A 3C86A 3MSYA 2ZRWA 2ZRUA 4HPNA 2Y62A 1IT7A 3GHRA 1C7SA 1UR1A 5LNSA 3VIFA 2REQA 4CD4A 4IIDA 4KIEA 3G1DA 3GKFA 1XG3A 3NZ1A 4LUTA 4US6A 1I2QA 1PB0A 2YDQA 2HK0A 4IL0A 4KEVA 2C91A 3E0FA 2XIIA 4XO6A 5CBBA 3BSMA 4M1BA 3WQ5A 4O54A 1L0PA 1PVNA 4JNYA 5CZSA 4PMJA 3MUCA 4E0CA 4GIYA 4L80A 3LTYA 1E6ZA 4DF2A 3PS7A 4JTRA 2WVSA 1TR1A 3LCXA 5C2GA 1CWYA 3APGA 4NJKA 1OJXA 2J78A 1YYAA 2NQ9A 1QK0A 1SO6A 3REQB 3RFAA 4B4HA 3HPSA 4Y9NA 5D9OA 2G3MA 4N42A 1DVJA 2Z27A 1AMYA 1PWMA 4ZFMA 2GJLA 2J77A 4TV6A 3W7NA 4AW7A