5C5LA

Crystal structure of staphylococcal nuclease variant delta+phs t62e / l125e at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
130
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFEKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLERKAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62E / L125E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c5lA00
2RBMA 2LKVA 1STBA 2F0HA 3OSOA 5F2DA 1AEXA 5NUCA 5E3FA 5C4ZA 1EY9A 1A3VA 2F0TA 4F8MA 3C1EA 1ENAA 4R8NA 5I9PA 2QDBA 4K14A 1STAA 2F0SA 4ME5A 1II3A 2PW5A 2F3WA 2EYPA 1SNQA 2O4XA 4H7BA 1STYA 4J6HA 1EYDA 1SYCA 5CV5A 3C1FA 3EJIA 1STNA 2F0JA 3NUCA 5KRUA 1EY7A 3H6MA 2F0KA 4K5VA 4YIJA 4K5WA 5DEHA 4KV6A 3RUZA 5HGTA 2M00A 2KHSA 2NUCA 5IGBA 4KD4A 3LX0A 2F0PA 3HZXA 2F3VA 3R3OA 1STGA 3E5SA 5HURA 4IALA 5IGDA 2EY5A 1A3UA 3SR1A 1SYGA 1EY4A 5EKLA 5C5LA 1TT2A 3QOJA 1SNCA 3NQTA 3T16A 5I6YA 2F0FA 2F0QA 5IGFA 1KABA 2F0MA 5K5PA 4PMBA 3SK8A 1ENCA 4E6IA 2EYFA 3MVVA 3P1HA 3OWFA 4HMIA 3NHHA 3TP7A 3V2TA 2EYMA 5I6WA 5KEEA 3TP8A 1A2TA 1F2ZA 1JOKA 4I65A 4ODGA 2PQEA 2F0DA 3NXWA 4EVOA 4K8JA 4QMGA 2EY6A 2PYKA 3D4DA 4K5XA 2EYOA 1A3TA 3DHQA 3ITPA 3VA5A 4KTAA 5CR3A 4KY7A 4B9WA 2PZWA 5JAVA 3S9WA 3SXHA 2F0WA 2F0IA 3U9OA 1RKNA 2EYHA 4PMCA 3BDLA 4B9XA 3MXPA 1U9RA 4HMJA 1TR5A 5CV4A 3SHLA 4N9PA 3DMUA 1EY5A 3EROA 4ZUIA 3TMEA 4K2KA 4N9TA 5IIFA 2F0LA 2ENBA 3SK6A 1KDAA 2EY1A 4HTHA 5J39A 4KY5A 1EYCA 4K8IA 5KIXA 5C5MA 4DFAA 1SYEA 4ZUJA 4F7XA 4PNYA 3TP5A 4KJOA 5CV8A 4TRDA 5C6AA 4MIUA 3D6CA 5I9OA 2PZUA 3PMFA 2HQEA 2KQ3A 5E1FA 1SNOA 5EGTA 3TP6A 1NUCA 5DAUA 1NSNS 1EYAA 4ID6A 1SNPA 1KDCA 4KHVA 5IOCA 5J1ZA 2OEOA 4NKLA 2F0OA 2RKSA 5KYIA 5CC4A 2SNSA 1SNDA 3QB3A 1F2MA 1STHA 2F0NA 4G57A 5KYLA 5ISRA 3MEHA 3T13A 1JORA 5M9OA 4LAAA 1SNMA 1EY8A 4NDXA 4S3SA 1EY0A 1KDBA 5IGCA 2PZTA 1JOQA 1EQVA 3MHBA 4IZ8A 4QF4A 5CV7A 1A2UA 4DF7A 5C3XA 5CGKA 3D8GA 3ERQA 4KJNA 1SYFA 3P75A 4QB4A 4EQNA 1F2YA 2EYLA 2F0GA 1SYBA 2PW7A 2RDFA 1SYDA 1KAAA 5KGUA 2EXZA 1IHZA 1EY6A 2EY2A 2EYJA 2SOBA 3QOLA 3NK9A 4IUNA 1TQOA 4NP5A 3HEJA 3SK5A 5C3WA 5C4HA 3D4WA 5IGGA 4K6DA 4KY6A 5J22A 3OMGA 5EKKA 2F0EA 4RKBA 4WORA 2WACA 1EZ8A 2OF1A 3SK4A 1JOOA 3EVQA 5JOBA 4EQOA 4RKLA 5IGEA 4OL7A 4WRDA 3BDCA 2OXPA 5CV6A 4ZQ3A 4K2LA 3OMCA 4KD3A 3NP8A 2SNMA 5CV9A 4J1MA 4NMZA 3MZ5A 4DGZA 4DU9A 5IODA 1EZ6A 2F0VA 2F0UA 4EQPA
chains in the Genus database with same CATH superfamily
4DV1Q 2KUMA 3H3VH 2HQLA 4DV3L 2I5LX 4K14A 3OIPA 1XMOL 1KXLA 2XWBB 2YTVA 3VR5A 1A0IA 3T1HL 3KLWA 1SYCA 4BBRB 1RL2A 2D0PA 3CW2C 2ALYB 3HOUB 1Q8IA 5IGDA 1Q7YC 4DUZQ 1TT2A 3WDNA 2PCFB 4X66Q 3OPOA 3KDFA 1GUGA 3NENA 4C3HH 3J80c 3NE5B 2HHHL 1TWCH 1OTCA 3TP8A 2CCZA 1A2TA 1YNJC 1KAWA 2F0DA 2PQAA 3TN2A 4OONA 4BBRG 1KNEA 3HOUG 4HSPA 1IBLL 4EQ5A 4JOIA 4I7AA 3AB9A 2PPBC 4MTKA 5M5XB 4UAIA 2IT1A 3D6WA 3NBHB 4RMFA 4IJHA 2ENBA 2CWAA 2Z6BA 3SVMA 4DV2Q 1CHQD 4XQNA 4LF5L 1PZKD 4M8AA 4JI2L 1NY4A 5L37A 2ZJRA 3I4MB 4JVZA 1ZKOA 5A2QE 4X64Q 2DY8A 1PXUA 1MBYA 1SNDA 2G5DA 3PIOA 1Z7TA 1K8OA 1ZYRD 4P74A 4S3SA 3J80E 1VQJA 2CVRA 2EJGC 1XNRQ 5C3XA 4QUFA 4DV5Q 2F0GA 3QWNA 3RLFA 4GOPC 5K36G 1IBKL 1GHJA 2KCCA 2LS01 4BS9A 2M9VA 3NBIA 1CQFA 4B3TQ 1D1KA 1XTCD 4DA2A 3KF8A 1PLFA 3L9AX 4CKEA 2OF1A 1J5EQ 3EVQA 3KYHC 4EQOA 4TVAB 2UU9L 3A5ZB 1AE3A 4YWLA 1M4VA 4DR4Q 2KEDA 1GXDC 5IODA 4J1MA 4H13C 1LTLA 4OWWB 1ICFB 1JCKB 2F0HA 1WTRA 3DLLA 1HR0W 2LXJA 1AEXA 5LHY1 4DXGA 1K28A 4HCSA 4IPCA 1QZHA 1V1PA 1R9TH 5FJ8G 2XIWA 2HD3A 2CWPA 2O4XA 3CC7A 3GTPH 3JAME 2R3ZA 1HJPA 1QNUA 1IKMA 3S15B 2ZJQA 1WCMB 5LL6S 3S17H 4GNXC 4HJAA 2FMMA 3A7AB 3CRKC 1SJHD 4LMQD 3MFGA 5HY6A 2GA4B 4GOPA 1HZAA 4DV0L 4PMBA 2N55A 2EZVA 4R4CA 2B2VC 2NVYB 2B2WC 1PYSB 2EYMA 1VMPA 1Y1VG 1JOKA 4LFBL 1D5ZC 4DAMA 4C56C 2VL6A 1VQ9A 3OW7A 4IFDI 1HFGA 1BR9A 1MSGA 4OGQC 2EE1A 1P8LA 4LUOA 1WCMG 1FJGL 3CCRA 4IPHA 3WOFA 5IWAL 4DK6C 5BN4A 4HSVA 1LTRD 5EBCA 1CSQA 5IYCG 1FGBD 1X3PA 3KDFB 1EY5A 3HOWH 4K2KA 2F4VL 2P5ZX 1EIYB 3GTMH 1RTNA 1HPCA 3ZJYC 3J81j 2L15A 4DFAA 5IT9c 4PNYA 2C9OA 3LGJA 4MIUA 4CDEC 1NAPA 3NTHA 4C3JB 2BDOA 1L1OC 4GNXA 4DR5Q 1TWAH 2D5DA 1HQRD 3GV6A 1LYLA 1SN8A 3IKJA 2WFWA 4FF3A 1STHA 1DGSA 2N49A 1JORA 4JG2A 4XQJA 2AWNA 2B2VA 4FDBA 1D5XC 4QIWE 1EQVA 2XWJB 1XPOA 1VDZA 3STBC 4RH6A 1SYBA 5KNDA 1HUNA 4MNOA 3BYYB 1S40A 1J6QA 3HG9A 3S1QH 2ZXOA 5CYUA 1HTPA 4C3JG 3IFTA 1KQSA 1VQ8A 2LY7A 1VQ6A 1E2WA 1JOOA 1UEBA 3DEOA 5FO8B 1O7IA 2CQAA 3GTJH 3HOVG 1EZ6A 2RHQB 5IP7H 1TS4A 1FNWA 3TS2A 3I2ZA 1PH4A 3K81C 2JP1A 3RNUA 1QE6A 2B2UA 2CKZB 3JC66 4LFAQ 3U9SA 2Z8LA 3CMEA 4R8IA 1K8MA 3RLOA 1QVFA 2F3WA 2AQ2B 2NN6I 3CC4A 3L2PA 1GVPA 1E3PA 2Z1CA 4C2MH 1STNA 1B2TA 2IX0A 1C4QA 5JVH3 4IQZA 3Q24A 4JI4L 1N33L 1TXYA 2B8GA 4ZAIA 1HZBA 1WTVA 2UXDQ 1Q1EA 1UE1A 2F0PA 2EY5A 1SYGA 4YY3L 4A3KH 3MXGA 2AQ1B 3T16A 1DCZA 2K7VA 5E4XA 2F0QA 2Q8IB 3U58A 4DK3C 3PUZA 5K5PA 4WJ3M 1OXUA 2K32A 1VQOA 4ZCKA 4A3CG 2D62A 4KK7A 2BOSA 2A6ED 4K8JA 4DNRB 1A8VA 1A3TA 3J81c 5T1GA 5J3BA 4FVMA 1FD7D 5D65A 4IO9A 1LTAD 4LF6L 4JBMA 2F0WA 5I2XA 2Q8RE 3WOEA 4JI7L 4XIGS 4P71A 2NZ1D 4GOPB 1S5FD 1EUJA 4N9PA 4RCNA 4ZUIA 5GAHC 1PTOD 5G3LF 2FFKB 4MTNA 4DNTB 5JEAH 1IBMQ 3CHBD 2QGQA 5EQ0A 1U5KA 2UXBL 5JJKA 2PZUA 3PMFA 2KQ3A 4KKSA 5H1SE 3GTOH 4JC0A 1QCBD 1NSNS 1EWIA 1HNWL 4GLAC 4RA8A 1ILQA 2D0OA 3PUXA 3S1NH 1F2MA 4RWSC 5KYLA 1PTOH 3DWAA 2Z0SA 1FGUA 1JE4A 4A93H 2N8NA 4RGMA 4Y7NH 3RN5A 5IGCA 2B63H 4IZ8A 2WAQG 3J7YW 3ERQA 4JI3Q 2EYLA 1HA6A 5IY0A 5C3EG 3P20A 4O1NA 5IYDH 4GNXB 3W1GA 1MJCA 1U4LA 1XNQQ 1NBWA 3GV3A 4KD3A 1TWCB 4L6TB 3PO2H 3UE1A 1STBA 1I94Q 2PI2E 2UUBL 4LF9L 4BBSB 1EU3A 2E2IB 4AYBE 2QKIC 4JYAL 5C4ZA 4HIDA 1I4PA 1ENAA 4OHJA 3S14H 1STAA 2H5XA 2LMCB 3SEBA 2MJ8A 1STYA 4RAUC 1X3GA 5M3FH 3NUCA 3GTQH 2JA7B 2WINB 1EL0A 3BVMA 4C3HG 2M00A 4HN7A 2X69A 2D9UA 2F3VA 4BY7H 1STGA 2V4DA 3UDXA 4J15A 3SR1A 3M4PA 4A3BH 2JA6H 4BBSG 1SDFA 1B44D 3EIVA 2AUJD 3M4OH 2B2YC 2L0CA 1CI3M 1ESRA 4DV6L 1I4GA 3S2DH 3TP7A 2A8VA 1L1OB 3CCQA 3H91A 1C8CA 3KF6A 1MJEA 3I8ZA 1K8AC 4XT1B 4H0LC 2MP1A 3U50C 1ML0D 3PGZA 3H09A 4DR2L 4B9WA 3VA7A 3J81L 2NVTH 2PZWA 5JAVA 3SXHA 4CBVA 4DNIA 4L5TA 3BS1A 4QIWB 1XX8A 2PI2A 4CDCC 4B9XA 2N78A 3SE0A 1ENFA 3OTOL 1M90C 2A6EC 3F2UA 1EFID 2JA9A 2F0LA 1KDAA 4DK0A 1L0XB 4DR7L 5C5MA 2NWGA 4KJOA 1HUMA 2HQEA 5DAUA 3ULLA 2IY5B 1GUWA 2A69D 2E5LQ 2VUMB 2SNSA 1QUQA 2F0NA 1NR4A 5M9OA 1BDOA 4B3ML 3DM3A 5D3DA 3DWPA 3HKSA 3VYTA 5CV7A 4KJNA 2B2TC 3J80i 4A75A 3L3OC 5KGUA 4ZLTF 3GTKH 4QCLA 4A3IH 4QY7A 2Q2TA 2K33A 2QCPX 1IXRA 1PDQA 4DR3L 2K5WA 4A3DH 1ZXTA 1XMQQ 1EQTA 3K57A 1I50H 1YITA 1V43A 1HR0Q 3K8AA 1M8AA 1JR0D 3H0GH 2L9HA 1E22A 1PH2A 4JV5Q 2K52A 4IFDH 3KK7A 1X32A 1Z47A 4X3TA 4XT3B 3K6OA 5G3LD 4C3IB 1SNQA 4Z9CB 1KD1C 4O2DA 1LM0A 1QVCA 4XQQA 3BZDB 3A5UA 3KUPA 4PG3A 4BY1B 2F0KA 3GTMB 4A3MH 2NUCA 4IURA 4NXML 3U4VA 1E24A 2B2TA 3NEMA 2Z4HA 2VW9A 4JI6L 3R2TA 4JK1C 4JI1L 3J7AV 4UPAA 1EOTA 1GUSA 5ELOA 1S3OA 1IYJB 2E2JH 4I65A 3CPFA 1IYVA 4UY8C 2OQ0A 2ZXPA 4YHHL 1Q12A 4DV1L 1DJRD 3QJYA 3IFDA 4V190 3HOWG 3FKIH 2DUDA 3TS0A 1F9RA 2XRSD 2WKCA 2K5DA 1SFOH 3S1QB 2K03A 1AE2A 2R7ZH 1TR5A 4OXPA 1G51A 1GUOA 4HTHA 5FK9C 1H9KA 5JPMC 5KIXA 1VQKA 2PNHA 4UDUC 2K28A 3GTGH 3GTJB 4DUZL 3KF6B 1OXXK 4FYDA 4X66L 2NYZD 1PVOA 4DAVA 2JQOA 4KI0A 2PMZB 1YVCA 2IW3A 1EY8A 3FRPB 1JWUD 1W6KA 1YEZA 1JJCB 1Q90A 2NN6H 3A8JE 3CCJA 1PH9A 1J9OA 2IX3A 5TSSA 2J7ZA 2A6HD 2A69C 1QOHA 1JJ2A 4IUTA 1YJ9A 1HHVA 1HZCA 3NK9A 4IPDA 3NQIA 3SK5A 3CCMA 5C3WA 1Q1BA 3MXUA 4KY6A 2A5HA 2BA1A 5EKKA 2F0EA 1S5BD 4RKBA 5IP7G 1WTWA 1CK1A 1LLRD 5JOBA 5FLMH 3CXCA 4DV7L 4WRDA 1AN8A 4DV2L 4ZQ3A 1EEID 4DUYQ 5CBEE 1G8ZD 3K5OA 2F1MA 5NUCA 4X65Q 2NVQH 4A3LH 1SE2A 2RCNA 4JI5Q 1WJJA 3QG1A 1II3A 4ME5A 4YCWA 3KLSA 1NR2A 5DNFA 1O7YA 4A3KG 1S5DD 2AKWB 1I3QB 1XNRL 4YIJA 4ME3A 4DV5L 1X55A 2E76C 1DZ1A 3MFYA 1T5EA 3M3YH 3NQTA 4JOIC 5JVG3 2X6LA 4B3TL 3GTOB 2FINB 1IKLA 1NNXA 1J5EL 1N34Q 4IUVA 1DM0B 2E74C 4DR4L 1PTOB 4NB3A 4OO1H 2QDLA 1HNZL 2F4IA 2WKDA 4MHEA 4A93B 4A3FH 4Y7NB 3PO3H 4OIKA 3VA5A 1N32Q 1VQLA 1BF4A 4GZYC 1B4OA 5I2YA 5JEAG 2J0TD 3ND9A 2EJFC 2K6AA 2EYHA 3V05A 1VQHA 4A3JH 3CPWA 5J39A 4KY5A 4GN4B 1IL2A 1LABA 1VQFA 4FF1A 1Z6HA 1B53A 3HOXH 1EOVA 1VQMA 1SNOA 4A93G 4L5RC 1K83B 3KLSX 2B63G 5J1ZA 1DOLA 5FLXE 3TBIB 1B8AA 3GDEA 4A3EH 3S1MH 1TWFB 4CJ0B 4LAAA 2CH4W 4CDFC 5IYDG 1ASZA 5M3FB 3TREA 1B3AA 4YWMA 4DK1A 1CZGA 5C4JB 5M5YH 5DM73 1EY6A 2I0QA 4WFN3 5LMUQ 5C44H 4HCEA 1C7YA 3J7A5 1FR3A 3J81i 3OOCA 2NVXH 1LT4D 1QB5D 3JAMc 4K2LA 2A6HC 3CCVA 1VQNA 3S24A 3NP8A 4HIOA 3I73A 3S1RH 4O0AA 3AMUA 2LKVA 3ER0A 5M3FG 2R92H 5JEAJ 2IHEA 3I70A 1NJIC 1GHKA 3IAYA 4DV4Q 4ILWA 1EY9A 2F0TA 4DXFA 4LF8Q 2A73B 2IJ0A 2QDBA 3OWEB 1WOCA 2WAQE 1NMGA 1V8QA 1LTGD 2PNRC 2PW5A 3ULJA 4BY7G 2I46A 2R7DA 2E2HH 4H7BA 3CQZH 4AIMA 1X65A 3TDQA 4AQYQ 2UUCQ 1C0AA 3KJPA 3R3OA 4ULLA 3J7ZC 5C4XH 2L12A 1EY4A 1PTOF 3PF4A 3KJOA 3QOJA 3H3VC 2YYZA 4IN3A 4GKJQ 1LT3D 2B3GA 1KABA 4RGNA 3MAQA 1WTPA 3AFQA 5IE8A 3K58A 1HQMC 2YU9B 1NMFA 3HOYH 2BH8A 3AEVA 1Y1VB 1VQEA 2ZTDA 1TWHH 3ITPA 4H44C 3VR4A 4G7ZC 1EIGA 2R93H 3VYRA 3SGIA 2Y0SB 1QVGA 3HRZC 1WFQA 4LFAL 1R4PB 5A2QL 3MXPA 1B3QA 4A3IB 5FO7B 2PO4A 3DMUA 5EPJA 3TMEA 1I4RA 5A35A 2MO0A 4RFBA 1SYEA 4CJ2C 2UXDL 1U4RA 1YHAA 2RSOA 2IWHA 3A56A 3E0JA 3J80L 1H95A 2MHVA 1GUNA 1NUCA 3G6JB 1J8IA 4TKOB 4FO2A 2FHTA 2Y0SG 3I4NH 1VQGA 2KHIA 1D7QA 1LTSD 5CBAE 3HOZH 2FXQA 2HT1A 4A3IG 1AH9A 1KDBA 2PZTA 4IOAA 3N52A 4QF4A 5M5WB 3S16B 2E2DC 4A3DG 2AQ3B 1Q3LA 4WJWA 3RN2A 1YIJA 1HNXL 4G7HC 1LT5D 2PQAB 1F9PA 4YCUA 4WORA 2B2UC 3SK4A 2EVBA 2UUAQ 1JB7A 1AFPA 4IFDG 3CKIB 1FNUA 5CV9A 1YJNA 4DU9A 3JAML 1JICA 1HRJA 2TMPA 2JYOA 3HOVB 1B9NA 4PZ8A 3I55A 2SDFA 1X9NA 1WTHA 1AZQA 3QIAA 3QR8A 3W1BA 1VF5C 2XVSA 1LO5D 2Q2HA 1IW7D 3QO2A 1ZYRC 1RTOA 4Y52H 5HGTA 1IBKQ 3LX0A 1RIPA 3AYHB 1CA5A 3BZKA 3F2CA 1XWEA 3KLRA 2UU9Q 3P1HA 1EFWA 3V2TA 1XNQL 4DN4M 3ICEA 1CKOA 1RF2D 5LMNQ 1BCPD 3D4DA 3BVGA 3ERSX 1I94L 2R7ZG 1R4QB 3KF8B 2EDGA 4Q5VA 3K7AH 4GKKQ 1PHJA 4IPGA 2B39A 2ZJPA 2AUKA 2EIFA 1K73C 1UUPA 2ES2A 1U9RA 5CV4A 4IFDJ 5IIFA 1VQPA 1N36Q 1DXMA 3X3NA 4C1NK 1EYCA 1SLJA 5LL6X 1E0BA 2HIVA 1O80A 4M1UB 1QWYA 1S72A 1V1PB 1NCVA 2N88A 2FJ2A 2JA8H 1RHPA 1IYUA 2NN6G 2OEOA 3MEFA 2RVLA 2RKSA 2CH4A 4TSSA 4LJZC 3DM1A 4KKUA 2B29A 3BZCA 4UP9A 5C0XI 1VQ7A 1W6JA 2KCMA 4JI8Q 1LV9A 3SDZA 1JOQA 2L5TA 2EJMA 3A8IE 4LF7Q 1A2UA 5CGKA 2WAQB 2RDFA 5FLMG 3W3AA 3HEJA 1DOMA 4DR1Q 1OXVA 5C3EB 2EQSA 5IT9L 1Y8PB 3RD4A 1IL8A 1EZ8A 5ELNA 4WJ4A 1HFNA 5IGEA 2RDGA 4OL7A 5IP9H 1H9SA 1DD2A 4GLXA 2CW0D 3VYSA 1PH3A 1KL9A 3NPPA 2UXCQ 2EPBA 3CRLC 1TWGH 2K14A 3M4QA 4A3FB 2R61A 5ELBA 1I6HH 1TS2A 2ZM6Q 2E5LL 1C48A 3S2HH 1CTMA 1HZ9A 3GO5A 4DAYA 3PV0A 2NZOA 1G91A 4J8QA 4O42A 3CF5A 4P73A 4ABNA 2ICIA 1CKMA 3G6EA 4RGTA 4KD4A 3I72A 4C3HB 2RHSB 3AFPA 1BO0A 1ONLA 1X3QA 2AWOA 3HOUH 4OO1G 5I6YA 4MZ9A 2PMZE 3HOXB 4HIMA 4A3FG 1K0RA 3PO3G 4E6IA 1BOSA 4FF2A 3ND8A 5KEEA 1UEAB 2JSOA 3DXJC 4RGOS 4KHPL 4A3JG 3BDOA 1BNZA 3DHQA 4OWTB 4LFCQ 4KY7A 2Z4IA 4NW2A 3URYA 2MFIA 3C46A 4JV5L 4IOCA 3K59A 5DM63 2AHOB 4P72A 2XTIA 1D8LA 1SMYD 1W3SA 4XTCS 3E9HA 2K5NA 3HOXG 1MKHA 4JI4Q 2BE5D 1XYIA 1QJOA 3K0XA 4A3EG 2QILA 4TRDA 4L8JA 3K5MA 4BA2I 4K0KQ 5EKIA 2EXDA 1KDCA 3D31A 4HEDA 3H15A 4ALPA 3A54A 2KEEA 3I4MH 3QB3A 5D14A 5BN5A 2A74C 1OXTA 1K3RA 3CQZB 3EFXD 3KBXA 1EQRA 3NTKA 1WYDA 4QB4A 2YTYA 4U68A 4LF6Q 2OTJA 1SYDA 1IHZA 3S9WA 4NP5A 2FMCA 4LK1C 2VQEL 3C2PA 3D4WA 1FNVA 2JE6I 4YCVA 3TEHB 1G6ZA 5ELDA 1PTOC 3EA6A 1S5ED 2JEBI 3OMCA 3IRBA 3CD6A 1B9MA 4DGZA 3PSIA 4B3RQ 2R6GA 1R9TB 1E2VA 3GTPB 1Z9FA 5AJ3Q 2TSSA 1ASYA 1Q81C 2L4NA 4JBKA 4IUUA 1CFMA 4CKCA 3GP7A 3PF5A 2V1CC 1Y8OB 3RR5A 1N9WA 3K0YA 5C4XG 3S17B 5EJWA 4LF4Q 2F0JA 2K1BA 3RZDH 4MN3A 2MPMA 1OO9B 2WB1E 3H6MA 5DEHA 1H9SB 1JQYD 2ATWA 2G9HD 1RD9D 2K4KA 3CCUA 4JPBW 1JMCA 3HOYG 1D1IA 3LNNA 2IX1A 1SNCA 3R2IA 3S15H 2BH2A 4DAYB 5IYCH 3NXWA 3ULPA 3UI2A 1RJTA 1F2LA 4K5XA 3I7FA 3T1YQ 2NVYH 2Z9HA 2K5HA 1UAPA 2KCNA 2A68D 3HOWB 4JI5L 1BBXC 3JAMi 1SSOA 4LWCA 2O5IC 4FXGC 2VS1A 1LACA 3H94A 1H9RA 5GAEC 4OX9Q 4JBJA 4N9TA 3HFZB 1TWAB 2MUYA 1O78A 3W2DA 3I4NG 1WTOA 5C6AA 1K3BC 1SMYC 2JK8A 4R9WA 2KENA 1ET6A 1FL0A 4ID6A 1F9QA 1KIXA 1EIHA 1PFNA 3E0EA 1L2FA 2DN8A 2BE5C 1N34L 3FP9A 3MEHA 4C3JH 1TY0A 3I90A 4HR7B 3AU7A 4IJLA 1U4PA 1DYQA 4DR2Q 4HJ5A 3A74A 2K01A 3F2DA 2XRQD 1SYFA 4HIKA 1RODA 2NB0A 5C4HA 1PFSA 2E8GA 3EBEA 4JI0Q 3BYTB 3L7ZC 5GROA 3BDCA 2CQOA 1A6XA 4N8FA 3MZ5A 2VY3A 1I6VC 2Y0SE 1EWHA 2R7FA 1QZGA 1CM9A 1W2BA 4C2MB 4F8MA 1JE5A 1H9JA 3K7AB 4R4QA 2LFNA 1PH8A 2NTSA 1CKNA 2RCFA 3C1FA 5KRUA 1HH2P 4A3KB 5D3IB 4K5VA 3RUZA 3FVQA 1BCPB 1QUQB 3FEWX 4ZK9B 1K9MC 2F03A 1CZWA 1A3UA 5LMUL 5EKLA 1PZID 1GM5A 4HJ8A 2L55A 1AZPA 1LT6D 2F0MA 1PA6A 4NXNQ 3MVVA 4X64L 2K75A 5I6WA 3K7UC 3TRZA 1MD2D 4ODGA 3M85A 5DLQE 3FPUB 1X3FA 2O2LD 5C0XH 5COYA 1EIFA 1G6PA 1N8RC 4DV4L 4LF8L 4B3SQ 4KN4C 3O13A 5FLXc 4HMJA 2JA8G 1O7ZA 5CMDA 1DOKA 4DAPA 1PRTF 2KA7A 2HCIA 4CHTB 2OCEA 2A68C 4AQYL 2UUCL 4ZUJA 4F7XA 3M7GA 1BKBA 4RG1A 2IPKD 5I9OA 3S1NB 1TVXA 4JI1Q 1HXYD 4FP5D 4GKJL 1SNPA 2B63B 2F0OA 4KN7C 3T51B 3RZOH 4G57A 5ISRA 4BXXH 2I5HA 2DGYA 1UE6A 1I6HB 4YHHQ 1SEBD 3S2HB 1ESFA 1XJVA 1EY0A 3MHBA 4CGYB 4JCVE 4GS3A 3D8GA 4X3KA 1GD7A 3P75A 2BA0A 5IP9G 2JA5H 4RHRA 4R1JA 1MHWC 1MI2A 3BVZA 3F8TA 1SXTA 1YBYA 2WB1B 2B8FA 2WACA 3PO2B 4FXKC 2OXPA 3EQLC 2KECA 2VZAA 5EPLA 2H4OA 3VDYA 4CKBA 1F2YA 3S14B 3CCLA 2NBFA 5EBDA 4X62Q 2KJXA 3GTQB 5I9PA 5ELFA 1BCPF 2F0SA 1LTTD 2DNEA 4BBSH 2XN9C 2E2IH 2VQFQ 4BY7B 2WB1G 2ZTCA 1EYDA 2Q2UA 3PO2G 3NTIA 4A3BB 3EJIA 2JA6B 3I4OA 1KLGD 3M4OB 1ET9A 2KHSA 1JB3A 3NWTA 1SE8A 3S2DB 4IALA 4IUQA 1YHQA 1PV4A 4QQBX 1I4QA 1SE4A 4UP7A 2JA7H 4LNQA 5ELCA 3R93A 3OW2A 5IGFA 4DV7Q 1M1KC 1ENCA 3I56A 2EYFA 4HMIA 4DR5L 3M4YA 3PUYA 2UUAL 1FVIA 2NVTB 3G48A 1PMRA 2PQEA 4QMGA 1CKNB 2L1BA 4A3BG 3STBD 2JA6G 4KTAA 5FKAC 5CR3A 4PZ7A 1V1OA 4R4TA 1KLUD 3MA2B 3K80C 3Q6SA 4OWXB 4R4IA 4CDDC 2F0IA 1PFMA 5FLXL 4DR6Q 3EROA 5BR8Q 4K8IA 4QL5A 4APVA 3I4MG 3TP5A 1V1QA 4V0BA 5E1FA 5KNCA 3G71A 1K8GA 4DV3Q 3HKZE 5FO9B 1WD1A 1X54A 3UDGA 1XMOQ 1B70B 1A15A 1HNZQ 2ZTEA 3OIQA 1PYBA 1JJGA 3T1HQ 4NDXA 1X56A 3Q8DA 3TSSA 1P16A 4BWGB 1CQVA 5LMNL 3GTKB 2KBNA 5JJZA 3UE0A 2VUMH 3ZYYX 3PUWA 2O5JC 3I91A 3RZDB 2SEBD 1KNAA 4GKKL 4A3DB 3VR2A 2EY2A 1Y8NB 1I50B 3A0JA 4A76A 2GVBA 2KOLA 3T4AC 5IYBH 4K6DA 1C9OA 2X6GA 4I7ZC 4YWKA 2JXMB 3N6RA 3H0GB 1A63A 2LXKA 1N36L 4QGUA 2HHHQ 1KRSA 1SRUA 4NMZA 2WIIB 3QOLA 2F0VA 1U4MA 4EQPA 4PQXA 3DEPA 4L63B 5CORA 1IBLQ 3EN2A 4FF4A 1B50A 2WP8J 1A3VA 3C1EA 3G4SA 3Q22A 1NE3A 1Q8KA 4A3MB 1PRTD 4JI8L 1RDPD 3H0GG 4G4KA 4LF7L 4LF5Q 1FYCA 1A62A 5IGBA 1HA5A 4KV6A 4JI2Q 1EWCA 4C3IH 2F3IA 1IBML 2OT2A 4TQUS 1CHPD 1D5MC 3PIO3 4DR1L 3PUVA 4BY1H 2E2JB 3A7LA 3CCEA 1E1OA 3W5OA 3OWFA 4P75A 3FPPA 3FKIB 3GQBA 4A3MG 3CAMA 1EEFD 3E9IA 4EVOA 4RHSA 2ZXRA 2EY6A 1SFOB 2UXCL 2R7ZB 2QEXA 2ZM6L 4DPGA 3X3MA 4JI3L 1PH6A 1E7ZA 2B2WA 1G291 3BDLA 3SHLA 3GTGB 5ELEA 2DY7A 3CCSA 1QG7A 2CFMA 3FKIG 1YI2A 2HUGA 4G7OC 1TY2A 5CV8A 1GUTA 3NELA 2K5VA 2M2LA 4KHVA 5IOCA 1XXGA 3D4RA 1MIUA 1SNMA 4XDXA 1S4ZA 1LTBD 1ICWA 5IT9E 2QEJC 4K6LA 4LFCL 1KHIA 2D2CC 1L1OA 2EYJA 2SOBA 3HP3A 2K5QA 4JW0A 5JPNC 5J22A 4DV0Q 1CT1D 1VS0A 5E7NA 1BUVT 3E3XA 1Y1WH 3GTLH 2NVQB 5GQOA 3A8KE 1DONA 3WWVA 4A3GH 4LFBQ 4RCOA 2EOTA 2RBMA 4AH6A 3OSOA 4UP8A 4HJ7A 2KVMA 4K0KL 5M3MH 2QA4A 1FJGQ 1GKHA 4X6AH 2ICEC 4NPSA 1XPRA 5IWAQ 4KMUC 3D0FA 3TZUA 4J6HA 2F4VQ 4BA1I 3ONAB 3M3YB 3UDIA 2LSSA 4A3LG 1YNXA 1TS3A 3J7AF 3LWUA 1HNXQ 2DJGC 2C5CA 3A55A 2OTLA 4A4IA 3E5SA 5HURA 4F88A 5C5LA 1PRTC 3RLNA 1I3QH 2F0FA 1CUKA 3PIPA 5C0XG 4OEMB 3CC2A 4QJFA 5E4WC 3PO3B 3NHHA 1TS5A 1JWMD 3OHXC 3VR3A 1F2ZA 5HGQA 3RZOB 1GJXA 1XTDA 1XPUA 2A1AA 3H3VI 3HKZB 4B3RL 4A3JB 1YJWA 1PH7A 1YZ6A 1SJED 5AJ3L 3TZDA 4OO1I 4EX5A 1WD0A 1U0LA 4U673 4IUPA 2Q8TA 4BBRH 2ID0A 4PMCA 2JA5B 4LF4L 1Y69U 1GOZA 2OQKA 4H02A 2KHJA 4R4OA 1PH1A 1IW7C 2RF4A 3VR6A 1XMQL 1G2TA 4KLKA 2IHFA 1PH5A 1SMXA 1HR0L 2BDNA 3J81E 3L0OA 4BXXG 1VQCA 4A3EB 3HKZG 3S1MB 2L11A 3UDFA 1I4XA 1WI5A 1EYAA 4NKLA 5KYIA 2F52A 1K0SA 4FXDA 1KTKA 1L0WA 1D6EC 1K83H 1UNSA 5M5YB 2JA5G 2K50A 1OXSC 2QF7A 5C44B 3CMAA 2RDHA 3T1YL 1BCPC 1N33Q 1Q86C 4EGVA 2PW7A 1TWFH 4POFA 2NVXB 2YV5A 1S5CD 4ZRZA 1HTLD 3TP6A 5M5XH 4IUNA 5C0XJ 4YY3Q 2YTXA 3MXNA 2JN4A 1UWVA 3OMGA 3Q23A 3S1RB 2NTTA 5AFWA 2Z6KC 5C4JH 4OX9L 3MC0B 2QW7A 5I4DA 2R92B 2K04A 1GO3E 5K36H 1UE7A 1YHBA 4PZ6A 2AMCB 4F87A 1SROA 1SAPA 1EQQA 2PYKA 2F0UA 4L5QA 2J4XA 5C44G 4N8X1 2E2HB 1LUZA 1BVSA 4HJ9A 2XSCA 3RMHA 3TQYA 3PIP3 1X3EA 4JI7Q 1MSHA 2Q2IA 1KC8C 2EYPA 4L5SA 2JA7G 5C4XB 5CV5A 1SBBB 1B7YB 1EY7A 2R92G 2VB2X 4K5WA 3BU2A 3FDTA 3HZXA 4ZYSA 2UXBQ 5FJ8H 4CJ1B 2VB3X 3HOYB 1HNWQ 1JC7A 3E6ZX 1Q46A 1AP0A 4JI0L 1TWHB 2OWOA 2ASBA 3D3RA 2Z6KA 2R93B 1SE3A 1BQQT 1NTGA 5JJLA 1VQAA 4GN5A 2VXWA 2CW0C 1ZEQX 1VQDA 1EU4A 1T5XD 1PFBA 3G7LA 2YU9H 1TIID 1CSPA 1Y1VH 1VMCA 1YNND 2B2YA 3OYYA 3U9OA 4FNFA 4B08A 1WTXA 4X3SA 2GN5A 2HDMA 1VQIA 1UE5A 4GLVB 3IL8A 3FMCA 2EY1A 1WCMH 2KCTA 2MQHA 2R93G 4HAEA 3I4NB 3T53B 4DUYL 1O7LA 2UUBQ 1I5FA 1WTQA 4LF9Q 3HOZB 2C35B 4JYAQ 1KRTA 2E75C 2VUMG 4X65L 2I07B 4NXNL 1Q82C 4POGA 1VQ4A 3VYUA 4KHPQ 1T9HA 2RQXA 1X6OA 4XYQA 4DKAC 5IYBG 4Q0FA 1I4HA 2WV6D 1TKWB 4DF7A 3V96A 2DJFC 5EPKA 3I4LA 3F1ZA 2EXZA 2RSNA 1BBUA 5IGGA 1TQOA 2ZT9C 4B3SL 5M5WH 3S16H 4QUCA 3HOZG 1MGSA 1SR3A 3NWSA 4C1NI 4DV6Q 1PRTB 4PMWA 2XGTA 4RKLA 1VQBA 2IL8A 1D2BA 1AW7A 3AQQA 2NZHA 2SNMA 5GAGC 1EYGA 1E2ZA 3T56B 3MWYW 2K05A 4XXEA 3BJUA 5F2DA 5E3FA 1JWSD 1N32L 4R8NA 4JBWA 3HOVH 4GN3B 2N3SA 4C3IG 1V9PA 2DNCA 1Y14B 2MNAA 3OTOQ 3MXNB 1BBWA 1E1TA 3PCOB 2MO1A 1IZ6A 5JJIA 3MTSA 4BY1G 1QILA 4OELB 1VQ5A 4DR7Q 2MGSA 1F9SA 1YNJD 5LMNW 2VQEQ 3M7NA 5EAYA 2BCOA 2VNUD 3M9BA 5GADC 1F77A 4P2CB 1BXTA 3HGBA 4PV1C 3NBHA 1STEA 3SK8A 2JJQA 3F2BA 3PQIA 2A19A 5BN3A 3CP0A 2CHBD 3CU7A 4B3MQ 3BG3A 1ILPA 2EYOA 1VCIA 4X62L 1PYWD 1WVLA 1G2SA 4A3CH 1L0YB 3DWQA 1VF7A 4AYBB 2H1EA 1RKNA 2VQFL 3KBGA 3R8BA 3KFUA 4DR3Q 2HDLA 5FOBB 3SK6A 2JA8B 4X3UA 1PZJD 1Y1WB 3GTLB 4LUZA 1YNNC 4A3GB 2I5MX 3D6CA 5EGTA 3DUZA 2RA4A 4ZKBB 2GVAA 5CC4A 2XNAC 5M3MB 1LTID 4AYBG 3T13A 1H9MA 1CA6A 1HCZA 3HS0C 3GD7A 1QNKA 3I3CA 4LW1A 4OIJA 3K5LA 4XYOA 4LUVA 4KHZA 4UHVA 4EQNA 1JT8A 4NXMQ 2G9DA 1Y1WG 3P7JA 1KAAA 2HIXA 2HCCA 4A3GG 1B1ZA 3K5NA 3C3LA 3FHWA 3KOJA 4JI6Q 4DR6L 5T1IA 3NSWA 3U4ZA 4KKTA 5M3MG 5BR8L 3Q0AA 1TWGB 5CV6A 3B6YA 1TU2B 1RCVD 5C3EH 2JEAI 3LWEA 4ZKCB 5KNBA
chains in the Genus database with same CATH topology
2KUMA 4K14A 3OIPA 2XWBB 3VR5A 1SYCA 4BBRB 3HOUB 1Q8IA 5IGDA 1TT2A 3WDNA 2PCFB 3OPOA 1GUGA 3NE5B 3TP8A 1A2TA 1YNJC 2F0DA 3TN2A 1KNEA 4HSPA 3AB9A 2PPBC 5M5XB 4UAIA 2IT1A 3D6WA 2ENBA 3SVMA 1CHQD 4XQNA 1PZKD 4M8AA 3I4MB 1ZKOA 5A2QE 2DY8A 1PXUA 1MBYA 1SNDA 1Z7TA 1K8OA 1ZYRD 4S3SA 3J80E 2CVRA 2EJGC 5C3XA 4QUFA 2F0GA 3QWNA 3RLFA 5K36G 1GHJA 2KCCA 2LS01 4BS9A 2M9VA 3NBIA 1CQFA 1D1KA 1XTCD 4DA2A 3KF8A 1PLFA 3L9AX 4CKEA 2OF1A 3EVQA 4EQOA 1M4VA 2KEDA 1GXDC 5IODA 4J1MA 4H13C 1JCKB 2F0HA 1WTRA 1AEXA 5LHY1 4DXGA 4HCSA 1V1PA 2XIWA 2O4XA 3JAME 2R3ZA 1QNUA 1IKMA 3S15B 1WCMB 5LL6S 2FMMA 3A7AB 3CRKC 1SJHD 4LMQD 3MFGA 2GA4B 4PMBA 2N55A 2EZVA 2B2VC 2NVYB 2B2WC 2EYMA 1VMPA 1JOKA 1D5ZC 4C56C 3OW7A 4IFDI 1HFGA 1BR9A 1MSGA 4OGQC 2EE1A 3WOFA 5BN4A 4HSVA 1LTRD 5EBCA 1FGBD 1X3PA 1EY5A 4K2KA 1RTNA 1HPCA 4DFAA 4PNYA 2C9OA 4MIUA 1NAPA 3NTHA 4C3JB 2BDOA 2D5DA 1HQRD 3GV6A 3IKJA 4FF3A 1STHA 1JORA 4XQJA 2AWNA 2B2VA 1D5XC 1EQVA 2XWJB 1VDZA 4RH6A 1SYBA 5KNDA 1HUNA 3BYYB 3HG9A 2ZXOA 5CYUA 1HTPA 4C3JG 3IFTA 2LY7A 1E2WA 1JOOA 3DEOA 5FO8B 2CQAA 1EZ6A 1TS4A 1FNWA 2JP1A 1QE6A 2B2UA 3U9SA 2Z8LA 4R8IA 1K8MA 2F3WA 2AQ2B 2NN6I 2Z1CA 1STNA 1B2TA 2IX0A 1C4QA 5JVH3 4IQZA 3Q24A 2B8GA 4ZAIA 1WTVA 1Q1EA 2F0PA 2EY5A 1SYGA 3MXGA 2AQ1B 3T16A 1DCZA 2K7VA 5E4XA 2F0QA 2Q8IB 3PUZA 5K5PA 1OXUA 2K32A 2D62A 4KK7A 2BOSA 2A6ED 4K8JA 4DNRB 1A3TA 5T1GA 4FVMA 1FD7D 5D65A 1LTAD 2F0WA 5I2XA 2Q8RE 3WOEA 4XIGS 2NZ1D 1S5FD 4N9PA 4RCNA 4ZUIA 1PTOD 5G3LF 2FFKB 4DNTB 5JEAH 3CHBD 5EQ0A 2PZUA 3PMFA 2KQ3A 4KKSA 1QCBD 1NSNS 4RA8A 1ILQA 3PUXA 1F2MA 4RWSC 5KYLA 1PTOH 3DWAA 1JE4A 4RGMA 5IGCA 4IZ8A 3J7YW 3ERQA 2EYLA 1HA6A 3P20A 4O1NA 1U4LA 3GV3A 4KD3A 1TWCB 4L6TB 1STBA 4BBSB 1EU3A 2E2IB 2QKIC 5C4ZA 1I4PA 1ENAA 4OHJA 1STAA 2LMCB 3SEBA 2MJ8A 1STYA 4RAUC 3NUCA 2JA7B 2WINB 1EL0A 3BVMA 4C3HG 2M00A 4HN7A 2X69A 2D9UA 2F3VA 1STGA 2V4DA 3SR1A 1SDFA 1B44D 2AUJD 2B2YC 2L0CA 1CI3M 1ESRA 1I4GA 3TP7A 3H91A 1C8CA 3I8ZA 4XT1B 4H0LC 2MP1A 1ML0D 3H09A 4B9WA 3VA7A 3J81L 2PZWA 5JAVA 3SXHA 4CBVA 3BS1A 4QIWB 1XX8A 4B9XA 3SE0A 1ENFA 2A6EC 3F2UA 1EFID 2F0LA 1KDAA 4DK0A 1L0XB 5C5MA 2NWGA 4KJOA 1HUMA 2HQEA 5DAUA 1GUWA 2A69D 2VUMB 2SNSA 2F0NA 1NR4A 5M9OA 1BDOA 5D3DA 3DWPA 3VYTA 5CV7A 4KJNA 2B2TC 3L3OC 5KGUA 4ZLTF 4QCLA 2K33A 2QCPX 1PDQA 2K5WA 1ZXTA 1EQTA 3K57A 1V43A 1M8AA 1JR0D 2L9HA 4IFDH 3KK7A 1X32A 1Z47A 4X3TA 4XT3B 3K6OA 5G3LD 4C3IB 1SNQA 4Z9CB 4XQQA 3BZDB 3KUPA 4BY1B 2F0KA 3GTMB 2NUCA 4IURA 2B2TA 2Z4HA 3R2TA 4JK1C 3J7AV 1EOTA 1GUSA 4I65A 1IYVA 2ZXPA 1Q12A 1DJRD 3QJYA 3IFDA 4V190 1F9RA 2XRSD 2WKCA 2K5DA 3S1QB 2K03A 1TR5A 1GUOA 4HTHA 5FK9C 1H9KA 5JPMC 5KIXA 4UDUC 2K28A 3GTJB 1OXXK 4FYDA 2NYZD 4DAVA 4KI0A 2PMZB 2IW3A 1EY8A 3FRPB 1JWUD 1W6KA 1Q90A 2NN6H 3A8JE 1J9OA 2IX3A 5TSSA 2J7ZA 2A6HD 2A69C 1QOHA 4IUTA 1HHVA 3NK9A 3NQIA 3SK5A 5C3WA 1Q1BA 3MXUA 4KY6A 2A5HA 2BA1A 5EKKA 2F0EA 1S5BD 4RKBA 1WTWA 1CK1A 1LLRD 5JOBA 4WRDA 1AN8A 4ZQ3A 1EEID 5CBEE 1G8ZD 3K5OA 2F1MA 5NUCA 1SE2A 3QG1A 1II3A 4ME5A 3KLSA 1NR2A 5DNFA 1O7YA 1S5DD 1I3QB 4YIJA 2E76C 1DZ1A 3MFYA 1T5EA 3NQTA 5JVG3 2X6LA 3GTOB 2FINB 1IKLA 4IUVA 1DM0B 2E74C 1PTOB 4OO1H 2F4IA 2WKDA 4MHEA 4A93B 4Y7NB 4OIKA 3VA5A 1BF4A 4GZYC 1B4OA 5I2YA 5JEAG 2J0TD 3ND9A 2EJFC 2K6AA 2EYHA 3V05A 5J39A 4KY5A 1LABA 4FF1A 1Z6HA 1B53A 1SNOA 1K83B 3KLSX 5J1ZA 1DOLA 5FLXE 3TBIB 1TWFB 4CJ0B 4LAAA 5M3FB 1B3AA 4DK1A 1CZGA 5C4JB 5DM73 1EY6A 4WFN3 4HCEA 1FR3A 3OOCA 1LT4D 1QB5D 4K2LA 2A6HC 3NP8A 3I73A 3AMUA 2LKVA 5JEAJ 3I70A 1GHKA 3IAYA 4ILWA 1EY9A 2F0TA 4DXFA 2A73B 2IJ0A 2QDBA 3OWEB 1V8QA 2PNRC 1LTGD 2PW5A 2I46A 4H7BA 3TDQA 3R3OA 4ULLA 2L12A 1EY4A 1PTOF 3QOJA 3H3VC 2YYZA 4IN3A 1LT3D 1KABA 4RGNA 3MAQA 1WTPA 3K58A 1HQMC 2YU9B 1Y1VB 3ITPA 4H44C 3VR4A 4G7ZC 1EIGA 3VYRA 2Y0SB 3HRZC 1R4PB 5A2QL 3MXPA 4A3IB 5FO7B 2PO4A 3DMUA 5EPJA 3TMEA 1I4RA 5A35A 4CJ2C 4RFBA 1SYEA 1U4RA 2RSOA 2IWHA 3A56A 3E0JA 3J80L 2MHVA 1GUNA 1NUCA 3G6JB 1J8IA 4TKOB 4FO2A 2FHTA 1LTSD 5CBAE 1KDBA 2PZTA 3N52A 4QF4A 5M5WB 3S16B 2E2DC 2AQ3B 1Q3LA 4WJWA 4G7HC 1LT5D 1F9PA 4WORA 2B2UC 3SK4A 2EVBA 1AFPA 4IFDG 3CKIB 1FNUA 5CV9A 4DU9A 3JAML 1JICA 1HRJA 2TMPA 2JYOA 3HOVB 1B9NA 2SDFA 1AZQA 3QIAA 1VF5C 2XVSA 1LO5D 1IW7D 3QO2A 1ZYRC 1RTOA 5HGTA 3LX0A 1CA5A 1XWEA 3KLRA 3P1HA 3V2TA 4DN4M 1RF2D 1BCPD 3D4DA 3BVGA 1R4QB 2EDGA 4Q5VA 2B39A 2AUKA 1UUPA 1U9RA 5CV4A 4IFDJ 5IIFA 1DXMA 3X3NA 4C1NK 1EYCA 5LL6X 1E0BA 1O80A 4M1UB 1QWYA 1V1PB 1NCVA 2N88A 2FJ2A 1RHPA 1IYUA 2NN6G 2OEOA 2RVLA 2RKSA 4TSSA 4LJZC 3DM1A 4KKUA 5C0XI 1W6JA 1LV9A 3SDZA 1JOQA 2L5TA 2EJMA 3A8IE 1A2UA 5CGKA 2WAQB 2RDFA 3W3AA 3HEJA 1DOMA 1OXVA 5C3EB 5IT9L 1Y8PB 3RD4A 1IL8A 1EZ8A 1HFNA 5IGEA 2RDGA 4OL7A 1H9SA 1DD2A 2CW0D 3VYSA 3NPPA 2EPBA 3CRLC 4A3FB 2R61A 5ELBA 1TS2A 1C48A 1CTMA 3GO5A 4DAYA 3PV0A 1G91A 4J8QA 4O42A 4ABNA 2ICIA 4RGTA 4KD4A 3I72A 4C3HB 1BO0A 1ONLA 1X3QA 2AWOA 4OO1G 5I6YA 3HOXB 4E6IA 1BOSA 4FF2A 3ND8A 5KEEA 1UEAB 2JSOA 3DXJC 4RGOS 3BDOA 1BNZA 3DHQA 4KY7A 2Z4IA 4NW2A 3URYA 3C46A 3K59A 5DM63 1SMYD 4XTCS 2BE5D 1XYIA 1QJOA 2QILA 4TRDA 4L8JA 3K5MA 4BA2I 5EKIA 1KDCA 3D31A 4HEDA 3A54A 2KEEA 3QB3A 5D14A 5BN5A 2A74C 1OXTA 3CQZB 3EFXD 3KBXA 3NTKA 4QB4A 4U68A 1SYDA 1IHZA 3S9WA 4NP5A 2FMCA 4LK1C 3C2PA 3D4WA 1FNVA 2JE6I 1G6ZA 5ELDA 1PTOC 3EA6A 1S5ED 2JEBI 3OMCA 1B9MA 4DGZA 2R6GA 1R9TB 1E2VA 3GTPB 2TSSA 2L4NA 4IUUA 1CFMA 4CKCA 3GP7A 1Y8OB 3K0YA 3S17B 5EJWA 2F0JA 2K1BA 4MN3A 2MPMA 1OO9B 3H6MA 5DEHA 1H9SB 1JQYD 2G9HD 1RD9D 1D1IA 3LNNA 2IX1A 1SNCA 3R2IA 3NXWA 3UI2A 1RJTA 1F2LA 4K5XA 1UAPA 2KCNA 2A68D 3HOWB 1BBXC 1SSOA 2O5IC 4FXGC 1LACA 3H94A 1H9RA 4N9TA 1TWAB 2MUYA 1O78A 3W2DA 1WTOA 5C6AA 1SMYC 4R9WA 1ET6A 4ID6A 1F9QA 1EIHA 1PFNA 2DN8A 2BE5C 3MEHA 1TY0A 3I90A 4HR7B 3AU7A 1U4PA 1DYQA 2K01A 2XRQD 1SYFA 1RODA 2NB0A 5C4HA 3BYTB 3L7ZC 3BDCA 1A6XA 3MZ5A 1I6VC 1EWHA 1CM9A 4C2MB 4F8MA 1H9JA 3K7AB 2LFNA 2NTSA 3C1FA 5KRUA 4A3KB 5D3IB 4K5VA 3RUZA 3FVQA 1BCPB 4ZK9B 3FEWX 2F03A 1CZWA 1A3UA 5EKLA 1PZID 2L55A 1AZPA 1LT6D 2F0MA 3MVVA 5I6WA 1MD2D 4ODGA 3M85A 3FPUB 2O2LD 5C0XH 5COYA 4KN4C 3O13A 4HMJA 1O7ZA 5CMDA 1DOKA 4DAPA 1PRTF 2KA7A 2HCIA 4CHTB 2A68C 4ZUJA 4F7XA 3M7GA 3S1NB 2IPKD 5I9OA 1TVXA 1HXYD 4FP5D 1SNPA 2B63B 2F0OA 4KN7C 3T51B 4G57A 5ISRA 1I6HB 1SEBD 3S2HB 1ESFA 1EY0A 3MHBA 4CGYB 4X3KA 3D8GA 3P75A 2BA0A 4RHRA 1MI2A 3BVZA 1SXTA 2WB1B 2B8FA 2WACA 3PO2B 4FXKC 2OXPA 3EQLC 2KECA 5EPLA 2H4OA 4CKBA 1F2YA 3S14B 2NBFA 5EBDA 2KJXA 3GTQB 5I9PA 5ELFA 1BCPF 2F0SA 1LTTD 2DNEA 2XN9C 4BY7B 1EYDA 3NTIA 4A3BB 3EJIA 2JA6B 1KLGD 3M4OB 1ET9A 2KHSA 1JB3A 3NWTA 3S2DB 4IALA 4IUQA 1I4QA 1SE4A 5ELCA 3R93A 5IGFA 1ENCA 2EYFA 4HMIA 3M4YA 3PUYA 2NVTB 1PMRA 2PQEA 4QMGA 2L1BA 4KTAA 5FKAC 5CR3A 1V1OA 1KLUD 3MA2B 3Q6SA 2F0IA 1PFMA 5FLXL 3EROA 4K8IA 3TP5A 4V0BA 5E1FA 5KNCA 5FO9B 1WD1A 1A15A 3OIQA 4NDXA 3TSSA 4BWGB 1CQVA 3GTKB 5JJZA 3ZYYX 3PUWA 2O5JC 3I91A 3RZDB 2SEBD 1KNAA 4A3DB 3VR2A 2EY2A 1Y8NB 1I50B 2KOLA 3T4AC 4K6DA 2X6GA 4I7ZC 2JXMB 3N6RA 3H0GB 4NMZA 2WIIB 3QOLA 2F0VA 4EQPA 1U4MA 4PQXA 3DEPA 4L63B 5CORA 4FF4A 1B50A 2WP8J 1A3VA 3C1EA 3Q22A 4A3MB 1PRTD 1RDPD 4G4KA 1FYCA 5IGBA 1HA5A 4KV6A 1EWCA 2OT2A 4TQUS 1CHPD 1D5MC 3PIO3 3PUVA 2E2JB 3A7LA 3OWFA 3FPPA 3FKIB 3GQBA 1EEFD 4EVOA 4RHSA 2ZXRA 2EY6A 1SFOB 2R7ZB 3X3MA 2B2WA 1G291 3BDLA 3SHLA 3GTGB 5ELEA 2DY7A 1QG7A 2HUGA 4G7OC 1TY2A 5CV8A 1GUTA 2M2LA 4KHVA 5IOCA 1XXGA 3D4RA 1SNMA 4XDXA 1S4ZA 1LTBD 1ICWA 5IT9E 2QEJC 4K6LA 2D2CC 2EYJA 2SOBA 3HP3A 2K5QA 5JPNC 5J22A 1CT1D 1BUVT 2NVQB 3A8KE 1DONA 4RCOA 2EOTA 2RBMA 3OSOA 2KVMA 2ICEC 4KMUC 3TZUA 4J6HA 4BA1I 3ONAB 3M3YB 1TS3A 3J7AF 3LWUA 2C5CA 3A55A 3E5SA 5HURA 4F88A 5C5LA 1PRTC 2F0FA 5C0XG 5E4WC 3PO3B 3NHHA 1TS5A 1JWMD 3OHXC 3VR3A 1F2ZA 3RZOB 1GJXA 3HKZB 4A3JB 1SJED 3TZDA 4OO1I 1WD0A 4U673 4IUPA 2Q8TA 2ID0A 4PMCA 2JA5B 1Y69U 1GOZA 1IW7C 3VR6A 1G2TA 2BDNA 3J81E 4A3EB 3S1MB 2L11A 1I4XA 1EYAA 4NKLA 5KYIA 4FXDA 1KTKA 1D6EC 1UNSA 5M5YB 1OXSC 2QF7A 5C44B 2RDHA 1BCPC 4EGVA 2PW7A 2NVXB 4ZRZA 1S5CD 1HTLD 3TP6A 4IUNA 5C0XJ 3MXNA 3OMGA 3Q23A 3S1RB 2NTTA 5AFWA 3MC0B 5I4DA 2R92B 2K04A 5K36H 4F87A 1SAPA 2PYKA 2F0UA 2J4XA 2E2HB 2XSCA 3RMHA 3PIP3 1MSHA 2EYPA 5C4XB 5CV5A 1SBBB 1EY7A 2VB2X 4K5WA 3FDTA 3HZXA 4ZYSA 4CJ1B 2VB3X 3HOYB 1JC7A 3E6ZX 1AP0A 1TWHB 3D3RA 2R93B 1SE3A 1BQQT 2VXWA 2CW0C 1ZEQX 1EU4A 1T5XD 1PFBA 3G7LA 1TIID 1YNND 1VMCA 2B2YA 3U9OA 4FNFA 4B08A 1WTXA 4X3SA 2HDMA 3IL8A 3FMCA 2EY1A 4HAEA 3I4NB 3T53B 1O7LA 1WTQA 3HOZB 2E75C 2I07B 3VYUA 2RQXA 4XYQA 4Q0FA 1I4HA 2WV6D 1TKWB 4DF7A 3V96A 5EPKA 3I4LA 2EXZA 2RSNA 5IGGA 1TQOA 2ZT9C 4QUCA 1MGSA 3NWSA 4C1NI 1PRTB 4PMWA 4RKLA 2IL8A 1D2BA 1AW7A 2SNMA 1E2ZA 3T56B 3MWYW 2K05A 4XXEA 5F2DA 5E3FA 1JWSD 4R8NA 4JBWA 4C3IG 2DNCA 3MTSA 1QILA 2MGSA 1F9SA 1YNJD 3M7NA 2BCOA 2VNUD 1F77A 4P2CB 1BXTA 3HGBA 4PV1C 3NBHA 1STEA 3SK8A 5BN3A 2CHBD 3CU7A 3BG3A 1ILPA 2EYOA 1VCIA 1PYWD 1WVLA 1G2SA 1L0YB 3DWQA 1VF7A 4AYBB 2H1EA 1RKNA 3KBGA 3R8BA 2HDLA 5FOBB 3SK6A 2JA8B 4X3UA 1PZJD 1Y1WB 3GTLB 1YNNC 4A3GB 3D6CA 5EGTA 3DUZA 2RA4A 4ZKBB 5CC4A 2XNAC 5M3MB 1LTID 3T13A 1H9MA 1CA6A 1HCZA 3HS0C 3GD7A 1QNKA 3I3CA 4OIJA 3K5LA 4XYOA 4KHZA 4EQNA 2G9DA 3P7JA 1KAAA 2HCCA 1B1ZA 3K5NA 3C3LA 5T1IA 3NSWA 4KKTA 3Q0AA 1TWGB 5CV6A 1TU2B 1RCVD 2JEAI 3LWEA 4ZKCB 5KNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RBM A;  2LKV A;  1STB A;  2F0H A;  3OSO A;  5F2D A;  1AEX A;  5NUC A;  5E3F A;  5C4Z A;  1EY9 A;  1A3V A;  2F0T A;  4F8M A;  3C1E A;  1ENA A;  4R8N A;  5I9P A;  2QDB A;  4K14 A;  1STA A;  2F0S A;  4ME5 A;  1II3 A;  2PW5 A;  2F3W A;  2EYP A;  1SNQ A;  2O4X A;  4H7B A;  1STY A;  4J6H A;  1EYD A;  1SYC A;  5CV5 A;  3C1F A;  3EJI A;  1STN A;  2F0J A;  3NUC A;  5KRU A;  1EY7 A;  3H6M A;  2F0K A;  4K5V A;  4YIJ A;  4K5W A;  5DEH A;  4KV6 A;  3RUZ A;  5HGT A;  2M00 A;  2KHS A;  2NUC A;  5IGB A;  4KD4 A;  3LX0 A;  2F0P A;  3HZX A;  2F3V A;  3R3O A;  1STG A;  3E5S A;  5HUR A;  4IAL A;  5IGD A;  2EY5 A;  1A3U A;  3SR1 A;  1SYG A;  1EY4 A;  5EKL A;  5C5L A;  1TT2 A;  3QOJ A;  1SNC A;  3NQT A;  3T16 A;  5I6Y A;  2F0F A;  2F0Q A;  5IGF A;  1KAB A;  2F0M A;  5K5P A;  4PMB A;  3SK8 A;  1ENC A;  4E6I A;  2EYF A;  3MVV A;  3P1H A;  3OWF A;  4HMI A;  3NHH A;  3TP7 A;  3V2T A;  2EYM A;  5I6W A;  5KEE A;  3TP8 A;  1A2T A;  1F2Z A;  1JOK A;  4I65 A;  4ODG A;  2PQE A;  2F0D A;  3NXW A;  4EVO A;  4K8J A;  4QMG A;  2EY6 A;  2PYK A;  3D4D A;  4K5X A;  2EYO A;  1A3T A;  3DHQ A;  3ITP A;  3VA5 A;  4KTA A;  5CR3 A;  4KY7 A;  4B9W A;  2PZW A;  5JAV A;  3S9W A;  3SXH A;  2F0W A;  2F0I A;  3U9O A;  1RKN A;  2EYH A;  4PMC A;  3BDL A;  4B9X A;  3MXP A;  1U9R A;  4HMJ A;  1TR5 A;  5CV4 A;  3SHL A;  4N9P A;  3DMU A;  1EY5 A;  3ERO A;  4ZUI A;  3TME A;  4K2K A;  4N9T A;  5IIF A;  2F0L A;  2ENB A;  3SK6 A;  1KDA A;  2EY1 A;  4HTH A;  5J39 A;  4KY5 A;  1EYC A;  4K8I A;  5KIX A;  5C5M A;  4DFA A;  1SYE A;  4ZUJ A;  4F7X A;  4PNY A;  3TP5 A;  4KJO A;  5CV8 A;  4TRD A;  5C6A A;  4MIU A;  3D6C A;  5I9O A;  2PZU A;  3PMF A;  2HQE A;  2KQ3 A;  5E1F A;  1SNO A;  5EGT A;  3TP6 A;  1NUC A;  5DAU A;  1NSN S;  1EYA A;  4ID6 A;  1SNP A;  1KDC A;  4KHV A;  5IOC A;  5J1Z A;  2OEO A;  4NKL A;  2F0O A;  2RKS A;  5KYI A;  5CC4 A;  2SNS A;  1SND A;  3QB3 A;  1F2M A;  1STH A;  2F0N A;  4G57 A;  5KYL A;  5ISR A;  3MEH A;  3T13 A;  1JOR A;  5M9O A;  4LAA A;  1SNM A;  1EY8 A;  4NDX A;  4S3S A;  1EY0 A;  1KDB A;  5IGC A;  2PZT A;  1JOQ A;  1EQV A;  3MHB A;  4IZ8 A;  4QF4 A;  5CV7 A;  1A2U A;  4DF7 A;  5C3X A;  5CGK A;  3D8G A;  3ERQ A;  4KJN A;  1SYF A;  3P75 A;  4QB4 A;  4EQN A;  1F2Y A;  2EYL A;  2F0G A;  1SYB A;  2PW7 A;  2RDF A;  1SYD A;  1KAA A;  5KGU A;  2EXZ A;  1IHZ A;  1EY6 A;  2EY2 A;  2EYJ A;  2SOB A;  3QOL A;  3NK9 A;  4IUN A;  1TQO A;  4NP5 A;  3HEJ A;  3SK5 A;  5C3W A;  5C4H A;  3D4W A;  5IGG A;  4K6D A;  4KY6 A;  5J22 A;  3OMG A;  5EKK A;  2F0E A;  4RKB A;  4WOR A;  2WAC A;  1EZ8 A;  2OF1 A;  3SK4 A;  1JOO A;  3EVQ A;  5JOB A;  4EQO A;  4RKL A;  5IGE A;  4OL7 A;  4WRD A;  3BDC A;  2OXP A;  5CV6 A;  4ZQ3 A;  4K2L A;  3OMC A;  4KD3 A;  3NP8 A;  2SNM A;  5CV9 A;  4J1M A;  4NMZ A;  3MZ5 A;  4DGZ A;  4DU9 A;  5IOD A;  1EZ6 A;  2F0V A;  2F0U A;  4EQP A; 
#chains in the Genus database with same CATH topology
 4DV1 Q;  2KUM A;  3H3V H;  2HQL A;  4DV3 L;  2I5L X;  4K14 A;  3OIP A;  1XMO L;  1KXL A;  2XWB B;  2YTV A;  3VR5 A;  1A0I A;  3T1H L;  3KLW A;  1SYC A;  4BBR B;  1RL2 A;  2D0P A;  3CW2 C;  2ALY B;  3HOU B;  1Q8I A;  5IGD A;  1Q7Y C;  4DUZ Q;  1TT2 A;  3WDN A;  2PCF B;  4X66 Q;  3OPO A;  3KDF A;  1GUG A;  3NEN A;  4C3H H;  3J80 c;  3NE5 B;  2HHH L;  1TWC H;  1OTC A;  3TP8 A;  2CCZ A;  1A2T A;  1YNJ C;  1KAW A;  2F0D A;  2PQA A;  3TN2 A;  4OON A;  4BBR G;  1KNE A;  3HOU G;  4HSP A;  1IBL L;  4EQ5 A;  4JOI A;  4I7A A;  3AB9 A;  2PPB C;  4MTK A;  5M5X B;  4UAI A;  2IT1 A;  3D6W A;  3NBH B;  4RMF A;  4IJH A;  2ENB A;  2CWA A;  2Z6B A;  3SVM A;  4DV2 Q;  1CHQ D;  4XQN A;  4LF5 L;  1PZK D;  4M8A A;  4JI2 L;  1NY4 A;  5L37 A;  2ZJR A;  3I4M B;  4JVZ A;  1ZKO A;  5A2Q E;  4X64 Q;  2DY8 A;  1PXU A;  1MBY A;  1SND A;  2G5D A;  3PIO A;  1Z7T A;  1K8O A;  1ZYR D;  4P74 A;  4S3S A;  3J80 E;  1VQJ A;  2CVR A;  2EJG C;  1XNR Q;  5C3X A;  4QUF A;  4DV5 Q;  2F0G A;  3QWN A;  3RLF A;  4GOP C;  5K36 G;  1IBK L;  1GHJ A;  2KCC A;  2LS0 1;  4BS9 A;  2M9V A;  3NBI A;  1CQF A;  4B3T Q;  1D1K A;  1XTC D;  4DA2 A;  3KF8 A;  1PLF A;  3L9A X;  4CKE A;  2OF1 A;  1J5E Q;  3EVQ A;  3KYH C;  4EQO A;  4TVA B;  2UU9 L;  3A5Z B;  1AE3 A;  4YWL A;  1M4V A;  4DR4 Q;  2KED A;  1GXD C;  5IOD A;  4J1M A;  4H13 C;  1LTL A;  4OWW B;  1ICF B;  1JCK B;  2F0H A;  1WTR A;  3DLL A;  1HR0 W;  2LXJ A;  1AEX A;  5LHY 1;  4DXG A;  1K28 A;  4HCS A;  4IPC A;  1QZH A;  1V1P A;  1R9T H;  5FJ8 G;  2XIW A;  2HD3 A;  2CWP A;  2O4X A;  3CC7 A;  3GTP H;  3JAM E;  2R3Z A;  1HJP A;  1QNU A;  1IKM A;  3S15 B;  2ZJQ A;  1WCM B;  5LL6 S;  3S17 H;  4GNX C;  4HJA A;  2FMM A;  3A7A B;  3CRK C;  1SJH D;  4LMQ D;  3MFG A;  5HY6 A;  2GA4 B;  4GOP A;  1HZA A;  4DV0 L;  4PMB A;  2N55 A;  2EZV A;  4R4C A;  2B2V C;  2NVY B;  2B2W C;  1PYS B;  2EYM A;  1VMP A;  1Y1V G;  1JOK A;  4LFB L;  1D5Z C;  4DAM A;  4C56 C;  2VL6 A;  1VQ9 A;  3OW7 A;  4IFD I;  1HFG A;  1BR9 A;  1MSG A;  4OGQ C;  2EE1 A;  1P8L A;  4LUO A;  1WCM G;  1FJG L;  3CCR A;  4IPH A;  3WOF A;  5IWA L;  4DK6 C;  5BN4 A;  4HSV A;  1LTR D;  5EBC A;  1CSQ A;  5IYC G;  1FGB D;  1X3P A;  3KDF B;  1EY5 A;  3HOW H;  4K2K A;  2F4V L;  2P5Z X;  1EIY B;  3GTM H;  1RTN A;  1HPC A;  3ZJY C;  3J81 j;  2L15 A;  4DFA A;  5IT9 c;  4PNY A;  2C9O A;  3LGJ A;  4MIU A;  4CDE C;  1NAP A;  3NTH A;  4C3J B;  2BDO A;  1L1O C;  4GNX A;  4DR5 Q;  1TWA H;  2D5D A;  1HQR D;  3GV6 A;  1LYL A;  1SN8 A;  3IKJ A;  2WFW A;  4FF3 A;  1STH A;  1DGS A;  2N49 A;  1JOR A;  4JG2 A;  4XQJ A;  2AWN A;  2B2V A;  4FDB A;  1D5X C;  4QIW E;  1EQV A;  2XWJ B;  1XPO A;  1VDZ A;  3STB C;  4RH6 A;  1SYB A;  5KND A;  1HUN A;  4MNO A;  3BYY B;  1S40 A;  1J6Q A;  3HG9 A;  3S1Q H;  2ZXO A;  5CYU A;  1HTP A;  4C3J G;  3IFT A;  1KQS A;  1VQ8 A;  2LY7 A;  1VQ6 A;  1E2W A;  1JOO A;  1UEB A;  3DEO A;  5FO8 B;  1O7I A;  2CQA A;  3GTJ H;  3HOV G;  1EZ6 A;  2RHQ B;  5IP7 H;  1TS4 A;  1FNW A;  3TS2 A;  3I2Z A;  1PH4 A;  3K81 C;  2JP1 A;  3RNU A;  1QE6 A;  2B2U A;  2CKZ B;  3JC6 6;  4LFA Q;  3U9S A;  2Z8L A;  3CME A;  4R8I A;  1K8M A;  3RLO A;  1QVF A;  2F3W A;  2AQ2 B;  2NN6 I;  3CC4 A;  3L2P A;  1GVP A;  1E3P A;  2Z1C A;  4C2M H;  1STN A;  1B2T A;  2IX0 A;  1C4Q A;  5JVH 3;  4IQZ A;  3Q24 A;  4JI4 L;  1N33 L;  1TXY A;  2B8G A;  4ZAI A;  1HZB A;  1WTV A;  2UXD Q;  1Q1E A;  1UE1 A;  2F0P A;  2EY5 A;  1SYG A;  4YY3 L;  4A3K H;  3MXG A;  2AQ1 B;  3T16 A;  1DCZ A;  2K7V A;  5E4X A;  2F0Q A;  2Q8I B;  3U58 A;  4DK3 C;  3PUZ A;  5K5P A;  4WJ3 M;  1OXU A;  2K32 A;  1VQO A;  4ZCK A;  4A3C G;  2D62 A;  4KK7 A;  2BOS A;  2A6E D;  4K8J A;  4DNR B;  1A8V A;  1A3T A;  3J81 c;  5T1G A;  5J3B A;  4FVM A;  1FD7 D;  5D65 A;  4IO9 A;  1LTA D;  4LF6 L;  4JBM A;  2F0W A;  5I2X A;  2Q8R E;  3WOE A;  4JI7 L;  4XIG S;  4P71 A;  2NZ1 D;  4GOP B;  1S5F D;  1EUJ A;  4N9P A;  4RCN A;  4ZUI A;  5GAH C;  1PTO D;  5G3L F;  2FFK B;  4MTN A;  4DNT B;  5JEA H;  1IBM Q;  3CHB D;  2QGQ A;  5EQ0 A;  1U5K A;  2UXB L;  5JJK A;  2PZU A;  3PMF A;  2KQ3 A;  4KKS A;  5H1S E;  3GTO H;  4JC0 A;  1QCB D;  1NSN S;  1EWI A;  1HNW L;  4GLA C;  4RA8 A;  1ILQ A;  2D0O A;  3PUX A;  3S1N H;  1F2M A;  4RWS C;  5KYL A;  1PTO H;  3DWA A;  2Z0S A;  1FGU A;  1JE4 A;  4A93 H;  2N8N A;  4RGM A;  4Y7N H;  3RN5 A;  5IGC A;  2B63 H;  4IZ8 A;  2WAQ G;  3J7Y W;  3ERQ A;  4JI3 Q;  2EYL A;  1HA6 A;  5IY0 A;  5C3E G;  3P20 A;  4O1N A;  5IYD H;  4GNX B;  3W1G A;  1MJC A;  1U4L A;  1XNQ Q;  1NBW A;  3GV3 A;  4KD3 A;  1TWC B;  4L6T B;  3PO2 H;  3UE1 A;  1STB A;  1I94 Q;  2PI2 E;  2UUB L;  4LF9 L;  4BBS B;  1EU3 A;  2E2I B;  4AYB E;  2QKI C;  4JYA L;  5C4Z A;  4HID A;  1I4P A;  1ENA A;  4OHJ A;  3S14 H;  1STA A;  2H5X A;  2LMC B;  3SEB A;  2MJ8 A;  1STY A;  4RAU C;  1X3G A;  5M3F H;  3NUC A;  3GTQ H;  2JA7 B;  2WIN B;  1EL0 A;  3BVM A;  4C3H G;  2M00 A;  4HN7 A;  2X69 A;  2D9U A;  2F3V A;  4BY7 H;  1STG A;  2V4D A;  3UDX A;  4J15 A;  3SR1 A;  3M4P A;  4A3B H;  2JA6 H;  4BBS G;  1SDF A;  1B44 D;  3EIV A;  2AUJ D;  3M4O H;  2B2Y C;  2L0C A;  1CI3 M;  1ESR A;  4DV6 L;  1I4G A;  3S2D H;  3TP7 A;  2A8V A;  1L1O B;  3CCQ A;  3H91 A;  1C8C A;  3KF6 A;  1MJE A;  3I8Z A;  1K8A C;  4XT1 B;  4H0L C;  2MP1 A;  3U50 C;  1ML0 D;  3PGZ A;  3H09 A;  4DR2 L;  4B9W A;  3VA7 A;  3J81 L;  2NVT H;  2PZW A;  5JAV A;  3SXH A;  4CBV A;  4DNI A;  4L5T A;  3BS1 A;  4QIW B;  1XX8 A;  2PI2 A;  4CDC C;  4B9X A;  2N78 A;  3SE0 A;  1ENF A;  3OTO L;  1M90 C;  2A6E C;  3F2U A;  1EFI D;  2JA9 A;  2F0L A;  1KDA A;  4DK0 A;  1L0X B;  4DR7 L;  5C5M A;  2NWG A;  4KJO A;  1HUM A;  2HQE A;  5DAU A;  3ULL A;  2IY5 B;  1GUW A;  2A69 D;  2E5L Q;  2VUM B;  2SNS A;  1QUQ A;  2F0N A;  1NR4 A;  5M9O A;  1BDO A;  4B3M L;  3DM3 A;  5D3D A;  3DWP A;  3HKS A;  3VYT A;  5CV7 A;  4KJN A;  2B2T C;  3J80 i;  4A75 A;  3L3O C;  5KGU A;  4ZLT F;  3GTK H;  4QCL A;  4A3I H;  4QY7 A;  2Q2T A;  2K33 A;  2QCP X;  1IXR A;  1PDQ A;  4DR3 L;  2K5W A;  4A3D H;  1ZXT A;  1XMQ Q;  1EQT A;  3K57 A;  1I50 H;  1YIT A;  1V43 A;  1HR0 Q;  3K8A A;  1M8A A;  1JR0 D;  3H0G H;  2L9H A;  1E22 A;  1PH2 A;  4JV5 Q;  2K52 A;  4IFD H;  3KK7 A;  1X32 A;  1Z47 A;  4X3T A;  4XT3 B;  3K6O A;  5G3L D;  4C3I B;  1SNQ A;  4Z9C B;  1KD1 C;  4O2D A;  1LM0 A;  1QVC A;  4XQQ A;  3BZD B;  3A5U A;  3KUP A;  4PG3 A;  4BY1 B;  2F0K A;  3GTM B;  4A3M H;  2NUC A;  4IUR A;  4NXM L;  3U4V A;  1E24 A;  2B2T A;  3NEM A;  2Z4H A;  2VW9 A;  4JI6 L;  3R2T A;  4JK1 C;  4JI1 L;  3J7A V;  4UPA A;  1EOT A;  1GUS A;  5ELO A;  1S3O A;  1IYJ B;  2E2J H;  4I65 A;  3CPF A;  1IYV A;  4UY8 C;  2OQ0 A;  2ZXP A;  4YHH L;  1Q12 A;  4DV1 L;  1DJR D;  3QJY A;  3IFD A;  4V19 0;  3HOW G;  3FKI H;  2DUD A;  3TS0 A;  1F9R A;  2XRS D;  2WKC A;  2K5D A;  1SFO H;  3S1Q B;  2K03 A;  1AE2 A;  2R7Z H;  1TR5 A;  4OXP A;  1G51 A;  1GUO A;  4HTH A;  5FK9 C;  1H9K A;  5JPM C;  5KIX A;  1VQK A;  2PNH A;  4UDU C;  2K28 A;  3GTG H;  3GTJ B;  4DUZ L;  3KF6 B;  1OXX K;  4FYD A;  4X66 L;  2NYZ D;  1PVO A;  4DAV A;  2JQO A;  4KI0 A;  2PMZ B;  1YVC A;  2IW3 A;  1EY8 A;  3FRP B;  1JWU D;  1W6K A;  1YEZ A;  1JJC B;  1Q90 A;  2NN6 H;  3A8J E;  3CCJ A;  1PH9 A;  1J9O A;  2IX3 A;  5TSS A;  2J7Z A;  2A6H D;  2A69 C;  1QOH A;  1JJ2 A;  4IUT A;  1YJ9 A;  1HHV A;  1HZC A;  3NK9 A;  4IPD A;  3NQI A;  3SK5 A;  3CCM A;  5C3W A;  1Q1B A;  3MXU A;  4KY6 A;  2A5H A;  2BA1 A;  5EKK A;  2F0E A;  1S5B D;  4RKB A;  5IP7 G;  1WTW A;  1CK1 A;  1LLR D;  5JOB A;  5FLM H;  3CXC A;  4DV7 L;  4WRD A;  1AN8 A;  4DV2 L;  4ZQ3 A;  1EEI D;  4DUY Q;  5CBE E;  1G8Z D;  3K5O A;  2F1M A;  5NUC A;  4X65 Q;  2NVQ H;  4A3L H;  1SE2 A;  2RCN A;  4JI5 Q;  1WJJ A;  3QG1 A;  1II3 A;  4ME5 A;  4YCW A;  3KLS A;  1NR2 A;  5DNF A;  1O7Y A;  4A3K G;  1S5D D;  2AKW B;  1I3Q B;  1XNR L;  4YIJ A;  4ME3 A;  4DV5 L;  1X55 A;  2E76 C;  1DZ1 A;  3MFY A;  1T5E A;  3M3Y H;  3NQT A;  4JOI C;  5JVG 3;  2X6L A;  4B3T L;  3GTO B;  2FIN B;  1IKL A;  1NNX A;  1J5E L;  1N34 Q;  4IUV A;  1DM0 B;  2E74 C;  4DR4 L;  1PTO B;  4NB3 A;  4OO1 H;  2QDL A;  1HNZ L;  2F4I A;  2WKD A;  4MHE A;  4A93 B;  4A3F H;  4Y7N B;  3PO3 H;  4OIK A;  3VA5 A;  1N32 Q;  1VQL A;  1BF4 A;  4GZY C;  1B4O A;  5I2Y A;  5JEA G;  2J0T D;  3ND9 A;  2EJF C;  2K6A A;  2EYH A;  3V05 A;  1VQH A;  4A3J H;  3CPW A;  5J39 A;  4KY5 A;  4GN4 B;  1IL2 A;  1LAB A;  1VQF A;  4FF1 A;  1Z6H A;  1B53 A;  3HOX H;  1EOV A;  1VQM A;  1SNO A;  4A93 G;  4L5R C;  1K83 B;  3KLS X;  2B63 G;  5J1Z A;  1DOL A;  5FLX E;  3TBI B;  1B8A A;  3GDE A;  4A3E H;  3S1M H;  1TWF B;  4CJ0 B;  4LAA A;  2CH4 W;  4CDF C;  5IYD G;  1ASZ A;  5M3F B;  3TRE A;  1B3A A;  4YWM A;  4DK1 A;  1CZG A;  5C4J B;  5M5Y H;  5DM7 3;  1EY6 A;  2I0Q A;  4WFN 3;  5LMU Q;  5C44 H;  4HCE A;  1C7Y A;  3J7A 5;  1FR3 A;  3J81 i;  3OOC A;  2NVX H;  1LT4 D;  1QB5 D;  3JAM c;  4K2L A;  2A6H C;  3CCV A;  1VQN A;  3S24 A;  3NP8 A;  4HIO A;  3I73 A;  3S1R H;  4O0A A;  3AMU A;  2LKV A;  3ER0 A;  5M3F G;  2R92 H;  5JEA J;  2IHE A;  3I70 A;  1NJI C;  1GHK A;  3IAY A;  4DV4 Q;  4ILW A;  1EY9 A;  2F0T A;  4DXF A;  4LF8 Q;  2A73 B;  2IJ0 A;  2QDB A;  3OWE B;  1WOC A;  2WAQ E;  1NMG A;  1V8Q A;  1LTG D;  2PNR C;  2PW5 A;  3ULJ A;  4BY7 G;  2I46 A;  2R7D A;  2E2H H;  4H7B A;  3CQZ H;  4AIM A;  1X65 A;  3TDQ A;  4AQY Q;  2UUC Q;  1C0A A;  3KJP A;  3R3O A;  4ULL A;  3J7Z C;  5C4X H;  2L12 A;  1EY4 A;  1PTO F;  3PF4 A;  3KJO A;  3QOJ A;  3H3V C;  2YYZ A;  4IN3 A;  4GKJ Q;  1LT3 D;  2B3G A;  1KAB A;  4RGN A;  3MAQ A;  1WTP A;  3AFQ A;  5IE8 A;  3K58 A;  1HQM C;  2YU9 B;  1NMF A;  3HOY H;  2BH8 A;  3AEV A;  1Y1V B;  1VQE A;  2ZTD A;  1TWH H;  3ITP A;  4H44 C;  3VR4 A;  4G7Z C;  1EIG A;  2R93 H;  3VYR A;  3SGI A;  2Y0S B;  1QVG A;  3HRZ C;  1WFQ A;  4LFA L;  1R4P B;  5A2Q L;  3MXP A;  1B3Q A;  4A3I B;  5FO7 B;  2PO4 A;  3DMU A;  5EPJ A;  3TME A;  1I4R A;  5A35 A;  2MO0 A;  4RFB A;  1SYE A;  4CJ2 C;  2UXD L;  1U4R A;  1YHA A;  2RSO A;  2IWH A;  3A56 A;  3E0J A;  3J80 L;  1H95 A;  2MHV A;  1GUN A;  1NUC A;  3G6J B;  1J8I A;  4TKO B;  4FO2 A;  2FHT A;  2Y0S G;  3I4N H;  1VQG A;  2KHI A;  1D7Q A;  1LTS D;  5CBA E;  3HOZ H;  2FXQ A;  2HT1 A;  4A3I G;  1AH9 A;  1KDB A;  2PZT A;  4IOA A;  3N52 A;  4QF4 A;  5M5W B;  3S16 B;  2E2D C;  4A3D G;  2AQ3 B;  1Q3L A;  4WJW A;  3RN2 A;  1YIJ A;  1HNX L;  4G7H C;  1LT5 D;  2PQA B;  1F9P A;  4YCU A;  4WOR A;  2B2U C;  3SK4 A;  2EVB A;  2UUA Q;  1JB7 A;  1AFP A;  4IFD G;  3CKI B;  1FNU A;  5CV9 A;  1YJN A;  4DU9 A;  3JAM L;  1JIC A;  1HRJ A;  2TMP A;  2JYO A;  3HOV B;  1B9N A;  4PZ8 A;  3I55 A;  2SDF A;  1X9N A;  1WTH A;  1AZQ A;  3QIA A;  3QR8 A;  3W1B A;  1VF5 C;  2XVS A;  1LO5 D;  2Q2H A;  1IW7 D;  3QO2 A;  1ZYR C;  1RTO A;  4Y52 H;  5HGT A;  1IBK Q;  3LX0 A;  1RIP A;  3AYH B;  1CA5 A;  3BZK A;  3F2C A;  1XWE A;  3KLR A;  2UU9 Q;  3P1H A;  1EFW A;  3V2T A;  1XNQ L;  4DN4 M;  3ICE A;  1CKO A;  1RF2 D;  5LMN Q;  1BCP D;  3D4D A;  3BVG A;  3ERS X;  1I94 L;  2R7Z G;  1R4Q B;  3KF8 B;  2EDG A;  4Q5V A;  3K7A H;  4GKK Q;  1PHJ A;  4IPG A;  2B39 A;  2ZJP A;  2AUK A;  2EIF A;  1K73 C;  1UUP A;  2ES2 A;  1U9R A;  5CV4 A;  4IFD J;  5IIF A;  1VQP A;  1N36 Q;  1DXM A;  3X3N A;  4C1N K;  1EYC A;  1SLJ A;  5LL6 X;  1E0B A;  2HIV A;  1O80 A;  4M1U B;  1QWY A;  1S72 A;  1V1P B;  1NCV A;  2N88 A;  2FJ2 A;  2JA8 H;  1RHP A;  1IYU A;  2NN6 G;  2OEO A;  3MEF A;  2RVL A;  2RKS A;  2CH4 A;  4TSS A;  4LJZ C;  3DM1 A;  4KKU A;  2B29 A;  3BZC A;  4UP9 A;  5C0X I;  1VQ7 A;  1W6J A;  2KCM A;  4JI8 Q;  1LV9 A;  3SDZ A;  1JOQ A;  2L5T A;  2EJM A;  3A8I E;  4LF7 Q;  1A2U A;  5CGK A;  2WAQ B;  2RDF A;  5FLM G;  3W3A A;  3HEJ A;  1DOM A;  4DR1 Q;  1OXV A;  5C3E B;  2EQS A;  5IT9 L;  1Y8P B;  3RD4 A;  1IL8 A;  1EZ8 A;  5ELN A;  4WJ4 A;  1HFN A;  5IGE A;  2RDG A;  4OL7 A;  5IP9 H;  1H9S A;  1DD2 A;  4GLX A;  2CW0 D;  3VYS A;  1PH3 A;  1KL9 A;  3NPP A;  2UXC Q;  2EPB A;  3CRL C;  1TWG H;  2K14 A;  3M4Q A;  4A3F B;  2R61 A;  5ELB A;  1I6H H;  1TS2 A;  2ZM6 Q;  2E5L L;  1C48 A;  3S2H H;  1CTM A;  1HZ9 A;  3GO5 A;  4DAY A;  3PV0 A;  2NZO A;  1G91 A;  4J8Q A;  4O42 A;  3CF5 A;  4P73 A;  4ABN A;  2ICI A;  1CKM A;  3G6E A;  4RGT A;  4KD4 A;  3I72 A;  4C3H B;  2RHS B;  3AFP A;  1BO0 A;  1ONL A;  1X3Q A;  2AWO A;  3HOU H;  4OO1 G;  5I6Y A;  4MZ9 A;  2PMZ E;  3HOX B;  4HIM A;  4A3F G;  1K0R A;  3PO3 G;  4E6I A;  1BOS A;  4FF2 A;  3ND8 A;  5KEE A;  1UEA B;  2JSO A;  3DXJ C;  4RGO S;  4KHP L;  4A3J G;  3BDO A;  1BNZ A;  3DHQ A;  4OWT B;  4LFC Q;  4KY7 A;  2Z4I A;  4NW2 A;  3URY A;  2MFI A;  3C46 A;  4JV5 L;  4IOC A;  3K59 A;  5DM6 3;  2AHO B;  4P72 A;  2XTI A;  1D8L A;  1SMY D;  1W3S A;  4XTC S;  3E9H A;  2K5N A;  3HOX G;  1MKH A;  4JI4 Q;  2BE5 D;  1XYI A;  1QJO A;  3K0X A;  4A3E G;  2QIL A;  4TRD A;  4L8J A;  3K5M A;  4BA2 I;  4K0K Q;  5EKI A;  2EXD A;  1KDC A;  3D31 A;  4HED A;  3H15 A;  4ALP A;  3A54 A;  2KEE A;  3I4M H;  3QB3 A;  5D14 A;  5BN5 A;  2A74 C;  1OXT A;  1K3R A;  3CQZ B;  3EFX D;  3KBX A;  1EQR A;  3NTK A;  1WYD A;  4QB4 A;  2YTY A;  4U68 A;  4LF6 Q;  2OTJ A;  1SYD A;  1IHZ A;  3S9W A;  4NP5 A;  2FMC A;  4LK1 C;  2VQE L;  3C2P A;  3D4W A;  1FNV A;  2JE6 I;  4YCV A;  3TEH B;  1G6Z A;  5ELD A;  1PTO C;  3EA6 A;  1S5E D;  2JEB I;  3OMC A;  3IRB A;  3CD6 A;  1B9M A;  4DGZ A;  3PSI A;  4B3R Q;  2R6G A;  1R9T B;  1E2V A;  3GTP B;  1Z9F A;  5AJ3 Q;  2TSS A;  1ASY A;  1Q81 C;  2L4N A;  4JBK A;  4IUU A;  1CFM A;  4CKC A;  3GP7 A;  3PF5 A;  2V1C C;  1Y8O B;  3RR5 A;  1N9W A;  3K0Y A;  5C4X G;  3S17 B;  5EJW A;  4LF4 Q;  2F0J A;  2K1B A;  3RZD H;  4MN3 A;  2MPM A;  1OO9 B;  2WB1 E;  3H6M A;  5DEH A;  1H9S B;  1JQY D;  2ATW A;  2G9H D;  1RD9 D;  2K4K A;  3CCU A;  4JPB W;  1JMC A;  3HOY G;  1D1I A;  3LNN A;  2IX1 A;  1SNC A;  3R2I A;  3S15 H;  2BH2 A;  4DAY B;  5IYC H;  3NXW A;  3ULP A;  3UI2 A;  1RJT A;  1F2L A;  4K5X A;  3I7F A;  3T1Y Q;  2NVY H;  2Z9H A;  2K5H A;  1UAP A;  2KCN A;  2A68 D;  3HOW B;  4JI5 L;  1BBX C;  3JAM i;  1SSO A;  4LWC A;  2O5I C;  4FXG C;  2VS1 A;  1LAC A;  3H94 A;  1H9R A;  5GAE C;  4OX9 Q;  4JBJ A;  4N9T A;  3HFZ B;  1TWA B;  2MUY A;  1O78 A;  3W2D A;  3I4N G;  1WTO A;  5C6A A;  1K3B C;  1SMY C;  2JK8 A;  4R9W A;  2KEN A;  1ET6 A;  1FL0 A;  4ID6 A;  1F9Q A;  1KIX A;  1EIH A;  1PFN A;  3E0E A;  1L2F A;  2DN8 A;  2BE5 C;  1N34 L;  3FP9 A;  3MEH A;  4C3J H;  1TY0 A;  3I90 A;  4HR7 B;  3AU7 A;  4IJL A;  1U4P A;  1DYQ A;  4DR2 Q;  4HJ5 A;  3A74 A;  2K01 A;  3F2D A;  2XRQ D;  1SYF A;  4HIK A;  1ROD A;  2NB0 A;  5C4H A;  1PFS A;  2E8G A;  3EBE A;  4JI0 Q;  3BYT B;  3L7Z C;  5GRO A;  3BDC A;  2CQO A;  1A6X A;  4N8F A;  3MZ5 A;  2VY3 A;  1I6V C;  2Y0S E;  1EWH A;  2R7F A;  1QZG A;  1CM9 A;  1W2B A;  4C2M B;  4F8M A;  1JE5 A;  1H9J A;  3K7A B;  4R4Q A;  2LFN A;  1PH8 A;  2NTS A;  1CKN A;  2RCF A;  3C1F A;  5KRU A;  1HH2 P;  4A3K B;  5D3I B;  4K5V A;  3RUZ A;  3FVQ A;  1BCP B;  1QUQ B;  3FEW X;  4ZK9 B;  1K9M C;  2F03 A;  1CZW A;  1A3U A;  5LMU L;  5EKL A;  1PZI D;  1GM5 A;  4HJ8 A;  2L55 A;  1AZP A;  1LT6 D;  2F0M A;  1PA6 A;  4NXN Q;  3MVV A;  4X64 L;  2K75 A;  5I6W A;  3K7U C;  3TRZ A;  1MD2 D;  4ODG A;  3M85 A;  5DLQ E;  3FPU B;  1X3F A;  2O2L D;  5C0X H;  5COY A;  1EIF A;  1G6P A;  1N8R C;  4DV4 L;  4LF8 L;  4B3S Q;  4KN4 C;  3O13 A;  5FLX c;  4HMJ A;  2JA8 G;  1O7Z A;  5CMD A;  1DOK A;  4DAP A;  1PRT F;  2KA7 A;  2HCI A;  4CHT B;  2OCE A;  2A68 C;  4AQY L;  2UUC L;  4ZUJ A;  4F7X A;  3M7G A;  1BKB A;  4RG1 A;  2IPK D;  5I9O A;  3S1N B;  1TVX A;  4JI1 Q;  1HXY D;  4FP5 D;  4GKJ L;  1SNP A;  2B63 B;  2F0O A;  4KN7 C;  3T51 B;  3RZO H;  4G57 A;  5ISR A;  4BXX H;  2I5H A;  2DGY A;  1UE6 A;  1I6H B;  4YHH Q;  1SEB D;  3S2H B;  1ESF A;  1XJV A;  1EY0 A;  3MHB A;  4CGY B;  4JCV E;  4GS3 A;  3D8G A;  4X3K A;  1GD7 A;  3P75 A;  2BA0 A;  5IP9 G;  2JA5 H;  4RHR A;  4R1J A;  1MHW C;  1MI2 A;  3BVZ A;  3F8T A;  1SXT A;  1YBY A;  2WB1 B;  2B8F A;  2WAC A;  3PO2 B;  4FXK C;  2OXP A;  3EQL C;  2KEC A;  2VZA A;  5EPL A;  2H4O A;  3VDY A;  4CKB A;  1F2Y A;  3S14 B;  3CCL A;  2NBF A;  5EBD A;  4X62 Q;  2KJX A;  3GTQ B;  5I9P A;  5ELF A;  1BCP F;  2F0S A;  1LTT D;  2DNE A;  4BBS H;  2XN9 C;  2E2I H;  2VQF Q;  4BY7 B;  2WB1 G;  2ZTC A;  1EYD A;  2Q2U A;  3PO2 G;  3NTI A;  4A3B B;  3EJI A;  2JA6 B;  3I4O A;  1KLG D;  3M4O B;  1ET9 A;  2KHS A;  1JB3 A;  3NWT A;  1SE8 A;  3S2D B;  4IAL A;  4IUQ A;  1YHQ A;  1PV4 A;  4QQB X;  1I4Q A;  1SE4 A;  4UP7 A;  2JA7 H;  4LNQ A;  5ELC A;  3R93 A;  3OW2 A;  5IGF A;  4DV7 Q;  1M1K C;  1ENC A;  3I56 A;  2EYF A;  4HMI A;  4DR5 L;  3M4Y A;  3PUY A;  2UUA L;  1FVI A;  2NVT B;  3G48 A;  1PMR A;  2PQE A;  4QMG A;  1CKN B;  2L1B A;  4A3B G;  3STB D;  2JA6 G;  4KTA A;  5FKA C;  5CR3 A;  4PZ7 A;  1V1O A;  4R4T A;  1KLU D;  3MA2 B;  3K80 C;  3Q6S A;  4OWX B;  4R4I A;  4CDD C;  2F0I A;  1PFM A;  5FLX L;  4DR6 Q;  3ERO A;  5BR8 Q;  4K8I A;  4QL5 A;  4APV A;  3I4M G;  3TP5 A;  1V1Q A;  4V0B A;  5E1F A;  5KNC A;  3G71 A;  1K8G A;  4DV3 Q;  3HKZ E;  5FO9 B;  1WD1 A;  1X54 A;  3UDG A;  1XMO Q;  1B70 B;  1A15 A;  1HNZ Q;  2ZTE A;  3OIQ A;  1PYB A;  1JJG A;  3T1H Q;  4NDX A;  1X56 A;  3Q8D A;  3TSS A;  1P16 A;  4BWG B;  1CQV A;  5LMN L;  3GTK B;  2KBN A;  5JJZ A;  3UE0 A;  2VUM H;  3ZYY X;  3PUW A;  2O5J C;  3I91 A;  3RZD B;  2SEB D;  1KNA A;  4GKK L;  4A3D B;  3VR2 A;  2EY2 A;  1Y8N B;  1I50 B;  3A0J A;  4A76 A;  2GVB A;  2KOL A;  3T4A C;  5IYB H;  4K6D A;  1C9O A;  2X6G A;  4I7Z C;  4YWK A;  2JXM B;  3N6R A;  3H0G B;  1A63 A;  2LXK A;  1N36 L;  4QGU A;  2HHH Q;  1KRS A;  1SRU A;  4NMZ A;  2WII B;  3QOL A;  2F0V A;  1U4M A;  4EQP A;  4PQX A;  3DEP A;  4L63 B;  5COR A;  1IBL Q;  3EN2 A;  4FF4 A;  1B50 A;  2WP8 J;  1A3V A;  3C1E A;  3G4S A;  3Q22 A;  1NE3 A;  1Q8K A;  4A3M B;  1PRT D;  4JI8 L;  1RDP D;  3H0G G;  4G4K A;  4LF7 L;  4LF5 Q;  1FYC A;  1A62 A;  5IGB A;  1HA5 A;  4KV6 A;  4JI2 Q;  1EWC A;  4C3I H;  2F3I A;  1IBM L;  2OT2 A;  4TQU S;  1CHP D;  1D5M C;  3PIO 3;  4DR1 L;  3PUV A;  4BY1 H;  2E2J B;  3A7L A;  3CCE A;  1E1O A;  3W5O A;  3OWF A;  4P75 A;  3FPP A;  3FKI B;  3GQB A;  4A3M G;  3CAM A;  1EEF D;  3E9I A;  4EVO A;  4RHS A;  2ZXR A;  2EY6 A;  1SFO B;  2UXC L;  2R7Z B;  2QEX A;  2ZM6 L;  4DPG A;  3X3M A;  4JI3 L;  1PH6 A;  1E7Z A;  2B2W A;  1G29 1;  3BDL A;  3SHL A;  3GTG B;  5ELE A;  2DY7 A;  3CCS A;  1QG7 A;  2CFM A;  3FKI G;  1YI2 A;  2HUG A;  4G7O C;  1TY2 A;  5CV8 A;  1GUT A;  3NEL A;  2K5V A;  2M2L A;  4KHV A;  5IOC A;  1XXG A;  3D4R A;  1MIU A;  1SNM A;  4XDX A;  1S4Z A;  1LTB D;  1ICW A;  5IT9 E;  2QEJ C;  4K6L A;  4LFC L;  1KHI A;  2D2C C;  1L1O A;  2EYJ A;  2SOB A;  3HP3 A;  2K5Q A;  4JW0 A;  5JPN C;  5J22 A;  4DV0 Q;  1CT1 D;  1VS0 A;  5E7N A;  1BUV T;  3E3X A;  1Y1W H;  3GTL H;  2NVQ B;  5GQO A;  3A8K E;  1DON A;  3WWV A;  4A3G H;  4LFB Q;  4RCO A;  2EOT A;  2RBM A;  4AH6 A;  3OSO A;  4UP8 A;  4HJ7 A;  2KVM A;  4K0K L;  5M3M H;  2QA4 A;  1FJG Q;  1GKH A;  4X6A H;  2ICE C;  4NPS A;  1XPR A;  5IWA Q;  4KMU C;  3D0F A;  3TZU A;  4J6H A;  2F4V Q;  4BA1 I;  3ONA B;  3M3Y B;  3UDI A;  2LSS A;  4A3L G;  1YNX A;  1TS3 A;  3J7A F;  3LWU A;  1HNX Q;  2DJG C;  2C5C A;  3A55 A;  2OTL A;  4A4I A;  3E5S A;  5HUR A;  4F88 A;  5C5L A;  1PRT C;  3RLN A;  1I3Q H;  2F0F A;  1CUK A;  3PIP A;  5C0X G;  4OEM B;  3CC2 A;  4QJF A;  5E4W C;  3PO3 B;  3NHH A;  1TS5 A;  1JWM D;  3OHX C;  3VR3 A;  1F2Z A;  5HGQ A;  3RZO B;  1GJX A;  1XTD A;  1XPU A;  2A1A A;  3H3V I;  3HKZ B;  4B3R L;  4A3J B;  1YJW A;  1PH7 A;  1YZ6 A;  1SJE D;  5AJ3 L;  3TZD A;  4OO1 I;  4EX5 A;  1WD0 A;  1U0L A;  4U67 3;  4IUP A;  2Q8T A;  4BBR H;  2ID0 A;  4PMC A;  2JA5 B;  4LF4 L;  1Y69 U;  1GOZ A;  2OQK A;  4H02 A;  2KHJ A;  4R4O A;  1PH1 A;  1IW7 C;  2RF4 A;  3VR6 A;  1XMQ L;  1G2T A;  4KLK A;  2IHF A;  1PH5 A;  1SMX A;  1HR0 L;  2BDN A;  3J81 E;  3L0O A;  4BXX G;  1VQC A;  4A3E B;  3HKZ G;  3S1M B;  2L11 A;  3UDF A;  1I4X A;  1WI5 A;  1EYA A;  4NKL A;  5KYI A;  2F52 A;  1K0S A;  4FXD A;  1KTK A;  1L0W A;  1D6E C;  1K83 H;  1UNS A;  5M5Y B;  2JA5 G;  2K50 A;  1OXS C;  2QF7 A;  5C44 B;  3CMA A;  2RDH A;  3T1Y L;  1BCP C;  1N33 Q;  1Q86 C;  4EGV A;  2PW7 A;  1TWF H;  4POF A;  2NVX B;  2YV5 A;  1S5C D;  4ZRZ A;  1HTL D;  3TP6 A;  5M5X H;  4IUN A;  5C0X J;  4YY3 Q;  2YTX A;  3MXN A;  2JN4 A;  1UWV A;  3OMG A;  3Q23 A;  3S1R B;  2NTT A;  5AFW A;  2Z6K C;  5C4J H;  4OX9 L;  3MC0 B;  2QW7 A;  5I4D A;  2R92 B;  2K04 A;  1GO3 E;  5K36 H;  1UE7 A;  1YHB A;  4PZ6 A;  2AMC B;  4F87 A;  1SRO A;  1SAP A;  1EQQ A;  2PYK A;  2F0U A;  4L5Q A;  2J4X A;  5C44 G;  4N8X 1;  2E2H B;  1LUZ A;  1BVS A;  4HJ9 A;  2XSC A;  3RMH A;  3TQY A;  3PIP 3;  1X3E A;  4JI7 Q;  1MSH A;  2Q2I A;  1KC8 C;  2EYP A;  4L5S A;  2JA7 G;  5C4X B;  5CV5 A;  1SBB B;  1B7Y B;  1EY7 A;  2R92 G;  2VB2 X;  4K5W A;  3BU2 A;  3FDT A;  3HZX A;  4ZYS A;  2UXB Q;  5FJ8 H;  4CJ1 B;  2VB3 X;  3HOY B;  1HNW Q;  1JC7 A;  3E6Z X;  1Q46 A;  1AP0 A;  4JI0 L;  1TWH B;  2OWO A;  2ASB A;  3D3R A;  2Z6K A;  2R93 B;  1SE3 A;  1BQQ T;  1NTG A;  5JJL A;  1VQA A;  4GN5 A;  2VXW A;  2CW0 C;  1ZEQ X;  1VQD A;  1EU4 A;  1T5X D;  1PFB A;  3G7L A;  2YU9 H;  1TII D;  1CSP A;  1Y1V H;  1VMC A;  1YNN D;  2B2Y A;  3OYY A;  3U9O A;  4FNF A;  4B08 A;  1WTX A;  4X3S A;  2GN5 A;  2HDM A;  1VQI A;  1UE5 A;  4GLV B;  3IL8 A;  3FMC A;  2EY1 A;  1WCM H;  2KCT A;  2MQH A;  2R93 G;  4HAE A;  3I4N B;  3T53 B;  4DUY L;  1O7L A;  2UUB Q;  1I5F A;  1WTQ A;  4LF9 Q;  3HOZ B;  2C35 B;  4JYA Q;  1KRT A;  2E75 C;  2VUM G;  4X65 L;  2I07 B;  4NXN L;  1Q82 C;  4POG A;  1VQ4 A;  3VYU A;  4KHP Q;  1T9H A;  2RQX A;  1X6O A;  4XYQ A;  4DKA C;  5IYB G;  4Q0F A;  1I4H A;  2WV6 D;  1TKW B;  4DF7 A;  3V96 A;  2DJF C;  5EPK A;  3I4L A;  3F1Z A;  2EXZ A;  2RSN A;  1BBU A;  5IGG A;  1TQO A;  2ZT9 C;  4B3S L;  5M5W H;  3S16 H;  4QUC A;  3HOZ G;  1MGS A;  1SR3 A;  3NWS A;  4C1N I;  4DV6 Q;  1PRT B;  4PMW A;  2XGT A;  4RKL A;  1VQB A;  2IL8 A;  1D2B A;  1AW7 A;  3AQQ A;  2NZH A;  2SNM A;  5GAG C;  1EYG A;  1E2Z A;  3T56 B;  3MWY W;  2K05 A;  4XXE A;  3BJU A;  5F2D A;  5E3F A;  1JWS D;  1N32 L;  4R8N A;  4JBW A;  3HOV H;  4GN3 B;  2N3S A;  4C3I G;  1V9P A;  2DNC A;  1Y14 B;  2MNA A;  3OTO Q;  3MXN B;  1BBW A;  1E1T A;  3PCO B;  2MO1 A;  1IZ6 A;  5JJI A;  3MTS A;  4BY1 G;  1QIL A;  4OEL B;  1VQ5 A;  4DR7 Q;  2MGS A;  1F9S A;  1YNJ D;  5LMN W;  2VQE Q;  3M7N A;  5EAY A;  2BCO A;  2VNU D;  3M9B A;  5GAD C;  1F77 A;  4P2C B;  1BXT A;  3HGB A;  4PV1 C;  3NBH A;  1STE A;  3SK8 A;  2JJQ A;  3F2B A;  3PQI A;  2A19 A;  5BN3 A;  3CP0 A;  2CHB D;  3CU7 A;  4B3M Q;  3BG3 A;  1ILP A;  2EYO A;  1VCI A;  4X62 L;  1PYW D;  1WVL A;  1G2S A;  4A3C H;  1L0Y B;  3DWQ A;  1VF7 A;  4AYB B;  2H1E A;  1RKN A;  2VQF L;  3KBG A;  3R8B A;  3KFU A;  4DR3 Q;  2HDL A;  5FOB B;  3SK6 A;  2JA8 B;  4X3U A;  1PZJ D;  1Y1W B;  3GTL B;  4LUZ A;  1YNN C;  4A3G B;  2I5M X;  3D6C A;  5EGT A;  3DUZ A;  2RA4 A;  4ZKB B;  2GVA A;  5CC4 A;  2XNA C;  5M3M B;  1LTI D;  4AYB G;  3T13 A;  1H9M A;  1CA6 A;  1HCZ A;  3HS0 C;  3GD7 A;  1QNK A;  3I3C A;  4LW1 A;  4OIJ A;  3K5L A;  4XYO A;  4LUV A;  4KHZ A;  4UHV A;  4EQN A;  1JT8 A;  4NXM Q;  2G9D A;  1Y1W G;  3P7J A;  1KAA A;  2HIX A;  2HCC A;  4A3G G;  1B1Z A;  3K5N A;  3C3L A;  3FHW A;  3KOJ A;  4JI6 Q;  4DR6 L;  5T1I A;  3NSW A;  3U4Z A;  4KKT A;  5M3M G;  5BR8 L;  3Q0A A;  1TWG B;  5CV6 A;  3B6Y A;  1TU2 B;  1RCV D;  5C3E H;  2JEA I;  3LWE A;  4ZKC B;  5KNB A; 
#chains in the Genus database with same CATH homology
 2KUM A;  4K14 A;  3OIP A;  2XWB B;  3VR5 A;  1SYC A;  4BBR B;  3HOU B;  1Q8I A;  5IGD A;  1TT2 A;  3WDN A;  2PCF B;  3OPO A;  1GUG A;  3NE5 B;  3TP8 A;  1A2T A;  1YNJ C;  2F0D A;  3TN2 A;  1KNE A;  4HSP A;  3AB9 A;  2PPB C;  5M5X B;  4UAI A;  2IT1 A;  3D6W A;  2ENB A;  3SVM A;  1CHQ D;  4XQN A;  1PZK D;  4M8A A;  3I4M B;  1ZKO A;  5A2Q E;  2DY8 A;  1PXU A;  1MBY A;  1SND A;  1Z7T A;  1K8O A;  1ZYR D;  4S3S A;  3J80 E;  2CVR A;  2EJG C;  5C3X A;  4QUF A;  2F0G A;  3QWN A;  3RLF A;  5K36 G;  1GHJ A;  2KCC A;  2LS0 1;  4BS9 A;  2M9V A;  3NBI A;  1CQF A;  1D1K A;  1XTC D;  4DA2 A;  3KF8 A;  1PLF A;  3L9A X;  4CKE A;  2OF1 A;  3EVQ A;  4EQO A;  1M4V A;  2KED A;  1GXD C;  5IOD A;  4J1M A;  4H13 C;  1JCK B;  2F0H A;  1WTR A;  1AEX A;  5LHY 1;  4DXG A;  4HCS A;  1V1P A;  2XIW A;  2O4X A;  3JAM E;  2R3Z A;  1QNU A;  1IKM A;  3S15 B;  1WCM B;  5LL6 S;  2FMM A;  3A7A B;  3CRK C;  1SJH D;  4LMQ D;  3MFG A;  2GA4 B;  4PMB A;  2N55 A;  2EZV A;  2B2V C;  2NVY B;  2B2W C;  2EYM A;  1VMP A;  1JOK A;  1D5Z C;  4C56 C;  3OW7 A;  4IFD I;  1HFG A;  1BR9 A;  1MSG A;  4OGQ C;  2EE1 A;  3WOF A;  5BN4 A;  4HSV A;  1LTR D;  5EBC A;  1FGB D;  1X3P A;  1EY5 A;  4K2K A;  1RTN A;  1HPC A;  4DFA A;  4PNY A;  2C9O A;  4MIU A;  1NAP A;  3NTH A;  4C3J B;  2BDO A;  2D5D A;  1HQR D;  3GV6 A;  3IKJ A;  4FF3 A;  1STH A;  1JOR A;  4XQJ A;  2AWN A;  2B2V A;  1D5X C;  1EQV A;  2XWJ B;  1VDZ A;  4RH6 A;  1SYB A;  5KND A;  1HUN A;  3BYY B;  3HG9 A;  2ZXO A;  5CYU A;  1HTP A;  4C3J G;  3IFT A;  2LY7 A;  1E2W A;  1JOO A;  3DEO A;  5FO8 B;  2CQA A;  1EZ6 A;  1TS4 A;  1FNW A;  2JP1 A;  1QE6 A;  2B2U A;  3U9S A;  2Z8L A;  4R8I A;  1K8M A;  2F3W A;  2AQ2 B;  2NN6 I;  2Z1C A;  1STN A;  1B2T A;  2IX0 A;  1C4Q A;  5JVH 3;  4IQZ A;  3Q24 A;  2B8G A;  4ZAI A;  1WTV A;  1Q1E A;  2F0P A;  2EY5 A;  1SYG A;  3MXG A;  2AQ1 B;  3T16 A;  1DCZ A;  2K7V A;  5E4X A;  2F0Q A;  2Q8I B;  3PUZ A;  5K5P A;  1OXU A;  2K32 A;  2D62 A;  4KK7 A;  2BOS A;  2A6E D;  4K8J A;  4DNR B;  1A3T A;  5T1G A;  4FVM A;  1FD7 D;  5D65 A;  1LTA D;  2F0W A;  5I2X A;  2Q8R E;  3WOE A;  4XIG S;  2NZ1 D;  1S5F D;  4N9P A;  4RCN A;  4ZUI A;  1PTO D;  5G3L F;  2FFK B;  4DNT B;  5JEA H;  3CHB D;  5EQ0 A;  2PZU A;  3PMF A;  2KQ3 A;  4KKS A;  1QCB D;  1NSN S;  4RA8 A;  1ILQ A;  3PUX A;  1F2M A;  4RWS C;  5KYL A;  1PTO H;  3DWA A;  1JE4 A;  4RGM A;  5IGC A;  4IZ8 A;  3J7Y W;  3ERQ A;  2EYL A;  1HA6 A;  3P20 A;  4O1N A;  1U4L A;  3GV3 A;  4KD3 A;  1TWC B;  4L6T B;  1STB A;  4BBS B;  1EU3 A;  2E2I B;  2QKI C;  5C4Z A;  1I4P A;  1ENA A;  4OHJ A;  1STA A;  2LMC B;  3SEB A;  2MJ8 A;  1STY A;  4RAU C;  3NUC A;  2JA7 B;  2WIN B;  1EL0 A;  3BVM A;  4C3H G;  2M00 A;  4HN7 A;  2X69 A;  2D9U A;  2F3V A;  1STG A;  2V4D A;  3SR1 A;  1SDF A;  1B44 D;  2AUJ D;  2B2Y C;  2L0C A;  1CI3 M;  1ESR A;  1I4G A;  3TP7 A;  3H91 A;  1C8C A;  3I8Z A;  4XT1 B;  4H0L C;  2MP1 A;  1ML0 D;  3H09 A;  4B9W A;  3VA7 A;  3J81 L;  2PZW A;  5JAV A;  3SXH A;  4CBV A;  3BS1 A;  4QIW B;  1XX8 A;  4B9X A;  3SE0 A;  1ENF A;  2A6E C;  3F2U A;  1EFI D;  2F0L A;  1KDA A;  4DK0 A;  1L0X B;  5C5M A;  2NWG A;  4KJO A;  1HUM A;  2HQE A;  5DAU A;  1GUW A;  2A69 D;  2VUM B;  2SNS A;  2F0N A;  1NR4 A;  5M9O A;  1BDO A;  5D3D A;  3DWP A;  3VYT A;  5CV7 A;  4KJN A;  2B2T C;  3L3O C;  5KGU A;  4ZLT F;  4QCL A;  2K33 A;  2QCP X;  1PDQ A;  2K5W A;  1ZXT A;  1EQT A;  3K57 A;  1V43 A;  1M8A A;  1JR0 D;  2L9H A;  4IFD H;  3KK7 A;  1X32 A;  1Z47 A;  4X3T A;  4XT3 B;  3K6O A;  5G3L D;  4C3I B;  1SNQ A;  4Z9C B;  4XQQ A;  3BZD B;  3KUP A;  4BY1 B;  2F0K A;  3GTM B;  2NUC A;  4IUR A;  2B2T A;  2Z4H A;  3R2T A;  4JK1 C;  3J7A V;  1EOT A;  1GUS A;  4I65 A;  1IYV A;  2ZXP A;  1Q12 A;  1DJR D;  3QJY A;  3IFD A;  4V19 0;  1F9R A;  2XRS D;  2WKC A;  2K5D A;  3S1Q B;  2K03 A;  1TR5 A;  1GUO A;  4HTH A;  5FK9 C;  1H9K A;  5JPM C;  5KIX A;  4UDU C;  2K28 A;  3GTJ B;  1OXX K;  4FYD A;  2NYZ D;  4DAV A;  4KI0 A;  2PMZ B;  2IW3 A;  1EY8 A;  3FRP B;  1JWU D;  1W6K A;  1Q90 A;  2NN6 H;  3A8J E;  1J9O A;  2IX3 A;  5TSS A;  2J7Z A;  2A6H D;  2A69 C;  1QOH A;  4IUT A;  1HHV A;  3NK9 A;  3NQI A;  3SK5 A;  5C3W A;  1Q1B A;  3MXU A;  4KY6 A;  2A5H A;  2BA1 A;  5EKK A;  2F0E A;  1S5B D;  4RKB A;  1WTW A;  1CK1 A;  1LLR D;  5JOB A;  4WRD A;  1AN8 A;  4ZQ3 A;  1EEI D;  5CBE E;  1G8Z D;  3K5O A;  2F1M A;  5NUC A;  1SE2 A;  3QG1 A;  1II3 A;  4ME5 A;  3KLS A;  1NR2 A;  5DNF A;  1O7Y A;  1S5D D;  1I3Q B;  4YIJ A;  2E76 C;  1DZ1 A;  3MFY A;  1T5E A;  3NQT A;  5JVG 3;  2X6L A;  3GTO B;  2FIN B;  1IKL A;  4IUV A;  1DM0 B;  2E74 C;  1PTO B;  4OO1 H;  2F4I A;  2WKD A;  4MHE A;  4A93 B;  4Y7N B;  4OIK A;  3VA5 A;  1BF4 A;  4GZY C;  1B4O A;  5I2Y A;  5JEA G;  2J0T D;  3ND9 A;  2EJF C;  2K6A A;  2EYH A;  3V05 A;  5J39 A;  4KY5 A;  1LAB A;  4FF1 A;  1Z6H A;  1B53 A;  1SNO A;  1K83 B;  3KLS X;  5J1Z A;  1DOL A;  5FLX E;  3TBI B;  1TWF B;  4CJ0 B;  4LAA A;  5M3F B;  1B3A A;  4DK1 A;  1CZG A;  5C4J B;  5DM7 3;  1EY6 A;  4WFN 3;  4HCE A;  1FR3 A;  3OOC A;  1LT4 D;  1QB5 D;  4K2L A;  2A6H C;  3NP8 A;  3I73 A;  3AMU A;  2LKV A;  5JEA J;  3I70 A;  1GHK A;  3IAY A;  4ILW A;  1EY9 A;  2F0T A;  4DXF A;  2A73 B;  2IJ0 A;  2QDB A;  3OWE B;  1V8Q A;  2PNR C;  1LTG D;  2PW5 A;  2I46 A;  4H7B A;  3TDQ A;  3R3O A;  4ULL A;  2L12 A;  1EY4 A;  1PTO F;  3QOJ A;  3H3V C;  2YYZ A;  4IN3 A;  1LT3 D;  1KAB A;  4RGN A;  3MAQ A;  1WTP A;  3K58 A;  1HQM C;  2YU9 B;  1Y1V B;  3ITP A;  4H44 C;  3VR4 A;  4G7Z C;  1EIG A;  3VYR A;  2Y0S B;  3HRZ C;  1R4P B;  5A2Q L;  3MXP A;  4A3I B;  5FO7 B;  2PO4 A;  3DMU A;  5EPJ A;  3TME A;  1I4R A;  5A35 A;  4CJ2 C;  4RFB A;  1SYE A;  1U4R A;  2RSO A;  2IWH A;  3A56 A;  3E0J A;  3J80 L;  2MHV A;  1GUN A;  1NUC A;  3G6J B;  1J8I A;  4TKO B;  4FO2 A;  2FHT A;  1LTS D;  5CBA E;  1KDB A;  2PZT A;  3N52 A;  4QF4 A;  5M5W B;  3S16 B;  2E2D C;  2AQ3 B;  1Q3L A;  4WJW A;  4G7H C;  1LT5 D;  1F9P A;  4WOR A;  2B2U C;  3SK4 A;  2EVB A;  1AFP A;  4IFD G;  3CKI B;  1FNU A;  5CV9 A;  4DU9 A;  3JAM L;  1JIC A;  1HRJ A;  2TMP A;  2JYO A;  3HOV B;  1B9N A;  2SDF A;  1AZQ A;  3QIA A;  1VF5 C;  2XVS A;  1LO5 D;  1IW7 D;  3QO2 A;  1ZYR C;  1RTO A;  5HGT A;  3LX0 A;  1CA5 A;  1XWE A;  3KLR A;  3P1H A;  3V2T A;  4DN4 M;  1RF2 D;  1BCP D;  3D4D A;  3BVG A;  1R4Q B;  2EDG A;  4Q5V A;  2B39 A;  2AUK A;  1UUP A;  1U9R A;  5CV4 A;  4IFD J;  5IIF A;  1DXM A;  3X3N A;  4C1N K;  1EYC A;  5LL6 X;  1E0B A;  1O80 A;  4M1U B;  1QWY A;  1V1P B;  1NCV A;  2N88 A;  2FJ2 A;  1RHP A;  1IYU A;  2NN6 G;  2OEO A;  2RVL A;  2RKS A;  4TSS A;  4LJZ C;  3DM1 A;  4KKU A;  5C0X I;  1W6J A;  1LV9 A;  3SDZ A;  1JOQ A;  2L5T A;  2EJM A;  3A8I E;  1A2U A;  5CGK A;  2WAQ B;  2RDF A;  3W3A A;  3HEJ A;  1DOM A;  1OXV A;  5C3E B;  5IT9 L;  1Y8P B;  3RD4 A;  1IL8 A;  1EZ8 A;  1HFN A;  5IGE A;  2RDG A;  4OL7 A;  1H9S A;  1DD2 A;  2CW0 D;  3VYS A;  3NPP A;  2EPB A;  3CRL C;  4A3F B;  2R61 A;  5ELB A;  1TS2 A;  1C48 A;  1CTM A;  3GO5 A;  4DAY A;  3PV0 A;  1G91 A;  4J8Q A;  4O42 A;  4ABN A;  2ICI A;  4RGT A;  4KD4 A;  3I72 A;  4C3H B;  1BO0 A;  1ONL A;  1X3Q A;  2AWO A;  4OO1 G;  5I6Y A;  3HOX B;  4E6I A;  1BOS A;  4FF2 A;  3ND8 A;  5KEE A;  1UEA B;  2JSO A;  3DXJ C;  4RGO S;  3BDO A;  1BNZ A;  3DHQ A;  4KY7 A;  2Z4I A;  4NW2 A;  3URY A;  3C46 A;  3K59 A;  5DM6 3;  1SMY D;  4XTC S;  2BE5 D;  1XYI A;  1QJO A;  2QIL A;  4TRD A;  4L8J A;  3K5M A;  4BA2 I;  5EKI A;  1KDC A;  3D31 A;  4HED A;  3A54 A;  2KEE A;  3QB3 A;  5D14 A;  5BN5 A;  2A74 C;  1OXT A;  3CQZ B;  3EFX D;  3KBX A;  3NTK A;  4QB4 A;  4U68 A;  1SYD A;  1IHZ A;  3S9W A;  4NP5 A;  2FMC A;  4LK1 C;  3C2P A;  3D4W A;  1FNV A;  2JE6 I;  1G6Z A;  5ELD A;  1PTO C;  3EA6 A;  1S5E D;  2JEB I;  3OMC A;  1B9M A;  4DGZ A;  2R6G A;  1R9T B;  1E2V A;  3GTP B;  2TSS A;  2L4N A;  4IUU A;  1CFM A;  4CKC A;  3GP7 A;  1Y8O B;  3K0Y A;  3S17 B;  5EJW A;  2F0J A;  2K1B A;  4MN3 A;  2MPM A;  1OO9 B;  3H6M A;  5DEH A;  1H9S B;  1JQY D;  2G9H D;  1RD9 D;  1D1I A;  3LNN A;  2IX1 A;  1SNC A;  3R2I A;  3NXW A;  3UI2 A;  1RJT A;  1F2L A;  4K5X A;  1UAP A;  2KCN A;  2A68 D;  3HOW B;  1BBX C;  1SSO A;  2O5I C;  4FXG C;  1LAC A;  3H94 A;  1H9R A;  4N9T A;  1TWA B;  2MUY A;  1O78 A;  3W2D A;  1WTO A;  5C6A A;  1SMY C;  4R9W A;  1ET6 A;  4ID6 A;  1F9Q A;  1EIH A;  1PFN A;  2DN8 A;  2BE5 C;  3MEH A;  1TY0 A;  3I90 A;  4HR7 B;  3AU7 A;  1U4P A;  1DYQ A;  2K01 A;  2XRQ D;  1SYF A;  1ROD A;  2NB0 A;  5C4H A;  3BYT B;  3L7Z C;  3BDC A;  1A6X A;  3MZ5 A;  1I6V C;  1EWH A;  1CM9 A;  4C2M B;  4F8M A;  1H9J A;  3K7A B;  2LFN A;  2NTS A;  3C1F A;  5KRU A;  4A3K B;  5D3I B;  4K5V A;  3RUZ A;  3FVQ A;  1BCP B;  4ZK9 B;  3FEW X;  2F03 A;  1CZW A;  1A3U A;  5EKL A;  1PZI D;  2L55 A;  1AZP A;  1LT6 D;  2F0M A;  3MVV A;  5I6W A;  1MD2 D;  4ODG A;  3M85 A;  3FPU B;  2O2L D;  5C0X H;  5COY A;  4KN4 C;  3O13 A;  4HMJ A;  1O7Z A;  5CMD A;  1DOK A;  4DAP A;  1PRT F;  2KA7 A;  2HCI A;  4CHT B;  2A68 C;  4ZUJ A;  4F7X A;  3M7G A;  3S1N B;  2IPK D;  5I9O A;  1TVX A;  1HXY D;  4FP5 D;  1SNP A;  2B63 B;  2F0O A;  4KN7 C;  3T51 B;  4G57 A;  5ISR A;  1I6H B;  1SEB D;  3S2H B;  1ESF A;  1EY0 A;  3MHB A;  4CGY B;  4X3K A;  3D8G A;  3P75 A;  2BA0 A;  4RHR A;  1MI2 A;  3BVZ A;  1SXT A;  2WB1 B;  2B8F A;  2WAC A;  3PO2 B;  4FXK C;  2OXP A;  3EQL C;  2KEC A;  5EPL A;  2H4O A;  4CKB A;  1F2Y A;  3S14 B;  2NBF A;  5EBD A;  2KJX A;  3GTQ B;  5I9P A;  5ELF A;  1BCP F;  2F0S A;  1LTT D;  2DNE A;  2XN9 C;  4BY7 B;  1EYD A;  3NTI A;  4A3B B;  3EJI A;  2JA6 B;  1KLG D;  3M4O B;  1ET9 A;  2KHS A;  1JB3 A;  3NWT A;  3S2D B;  4IAL A;  4IUQ A;  1I4Q A;  1SE4 A;  5ELC A;  3R93 A;  5IGF A;  1ENC A;  2EYF A;  4HMI A;  3M4Y A;  3PUY A;  2NVT B;  1PMR A;  2PQE A;  4QMG A;  2L1B A;  4KTA A;  5FKA C;  5CR3 A;  1V1O A;  1KLU D;  3MA2 B;  3Q6S A;  2F0I A;  1PFM A;  5FLX L;  3ERO A;  4K8I A;  3TP5 A;  4V0B A;  5E1F A;  5KNC A;  5FO9 B;  1WD1 A;  1A15 A;  3OIQ A;  4NDX A;  3TSS A;  4BWG B;  1CQV A;  3GTK B;  5JJZ A;  3ZYY X;  3PUW A;  2O5J C;  3I91 A;  3RZD B;  2SEB D;  1KNA A;  4A3D B;  3VR2 A;  2EY2 A;  1Y8N B;  1I50 B;  2KOL A;  3T4A C;  4K6D A;  2X6G A;  4I7Z C;  2JXM B;  3N6R A;  3H0G B;  4NMZ A;  2WII B;  3QOL A;  2F0V A;  4EQP A;  1U4M A;  4PQX A;  3DEP A;  4L63 B;  5COR A;  4FF4 A;  1B50 A;  2WP8 J;  1A3V A;  3C1E A;  3Q22 A;  4A3M B;  1PRT D;  1RDP D;  4G4K A;  1FYC A;  5IGB A;  1HA5 A;  4KV6 A;  1EWC A;  2OT2 A;  4TQU S;  1CHP D;  1D5M C;  3PIO 3;  3PUV A;  2E2J B;  3A7L A;  3OWF A;  3FPP A;  3FKI B;  3GQB A;  1EEF D;  4EVO A;  4RHS A;  2ZXR A;  2EY6 A;  1SFO B;  2R7Z B;  3X3M A;  2B2W A;  1G29 1;  3BDL A;  3SHL A;  3GTG B;  5ELE A;  2DY7 A;  1QG7 A;  2HUG A;  4G7O C;  1TY2 A;  5CV8 A;  1GUT A;  2M2L A;  4KHV A;  5IOC A;  1XXG A;  3D4R A;  1SNM A;  4XDX A;  1S4Z A;  1LTB D;  1ICW A;  5IT9 E;  2QEJ C;  4K6L A;  2D2C C;  2EYJ A;  2SOB A;  3HP3 A;  2K5Q A;  5JPN C;  5J22 A;  1CT1 D;  1BUV T;  2NVQ B;  3A8K E;  1DON A;  4RCO A;  2EOT A;  2RBM A;  3OSO A;  2KVM A;  2ICE C;  4KMU C;  3TZU A;  4J6H A;  4BA1 I;  3ONA B;  3M3Y B;  1TS3 A;  3J7A F;  3LWU A;  2C5C A;  3A55 A;  3E5S A;  5HUR A;  4F88 A;  5C5L A;  1PRT C;  2F0F A;  5C0X G;  5E4W C;  3PO3 B;  3NHH A;  1TS5 A;  1JWM D;  3OHX C;  3VR3 A;  1F2Z A;  3RZO B;  1GJX A;  3HKZ B;  4A3J B;  1SJE D;  3TZD A;  4OO1 I;  1WD0 A;  4U67 3;  4IUP A;  2Q8T A;  2ID0 A;  4PMC A;  2JA5 B;  1Y69 U;  1GOZ A;  1IW7 C;  3VR6 A;  1G2T A;  2BDN A;  3J81 E;  4A3E B;  3S1M B;  2L11 A;  1I4X A;  1EYA A;  4NKL A;  5KYI A;  4FXD A;  1KTK A;  1D6E C;  1UNS A;  5M5Y B;  1OXS C;  2QF7 A;  5C44 B;  2RDH A;  1BCP C;  4EGV A;  2PW7 A;  2NVX B;  4ZRZ A;  1S5C D;  1HTL D;  3TP6 A;  4IUN A;  5C0X J;  3MXN A;  3OMG A;  3Q23 A;  3S1R B;  2NTT A;  5AFW A;  3MC0 B;  5I4D A;  2R92 B;  2K04 A;  5K36 H;  4F87 A;  1SAP A;  2PYK A;  2F0U A;  2J4X A;  2E2H B;  2XSC A;  3RMH A;  3PIP 3;  1MSH A;  2EYP A;  5C4X B;  5CV5 A;  1SBB B;  1EY7 A;  2VB2 X;  4K5W A;  3FDT A;  3HZX A;  4ZYS A;  4CJ1 B;  2VB3 X;  3HOY B;  1JC7 A;  3E6Z X;  1AP0 A;  1TWH B;  3D3R A;  2R93 B;  1SE3 A;  1BQQ T;  2VXW A;  2CW0 C;  1ZEQ X;  1EU4 A;  1T5X D;  1PFB A;  3G7L A;  1TII D;  1YNN D;  1VMC A;  2B2Y A;  3U9O A;  4FNF A;  4B08 A;  1WTX A;  4X3S A;  2HDM A;  3IL8 A;  3FMC A;  2EY1 A;  4HAE A;  3I4N B;  3T53 B;  1O7L A;  1WTQ A;  3HOZ B;  2E75 C;  2I07 B;  3VYU A;  2RQX A;  4XYQ A;  4Q0F A;  1I4H A;  2WV6 D;  1TKW B;  4DF7 A;  3V96 A;  5EPK A;  3I4L A;  2EXZ A;  2RSN A;  5IGG A;  1TQO A;  2ZT9 C;  4QUC A;  1MGS A;  3NWS A;  4C1N I;  1PRT B;  4PMW A;  4RKL A;  2IL8 A;  1D2B A;  1AW7 A;  2SNM A;  1E2Z A;  3T56 B;  3MWY W;  2K05 A;  4XXE A;  5F2D A;  5E3F A;  1JWS D;  4R8N A;  4JBW A;  4C3I G;  2DNC A;  3MTS A;  1QIL A;  2MGS A;  1F9S A;  1YNJ D;  3M7N A;  2BCO A;  2VNU D;  1F77 A;  4P2C B;  1BXT A;  3HGB A;  4PV1 C;  3NBH A;  1STE A;  3SK8 A;  5BN3 A;  2CHB D;  3CU7 A;  3BG3 A;  1ILP A;  2EYO A;  1VCI A;  1PYW D;  1WVL A;  1G2S A;  1L0Y B;  3DWQ A;  1VF7 A;  4AYB B;  2H1E A;  1RKN A;  3KBG A;  3R8B A;  2HDL A;  5FOB B;  3SK6 A;  2JA8 B;  4X3U A;  1PZJ D;  1Y1W B;  3GTL B;  1YNN C;  4A3G B;  3D6C A;  5EGT A;  3DUZ A;  2RA4 A;  4ZKB B;  5CC4 A;  2XNA C;  5M3M B;  1LTI D;  3T13 A;  1H9M A;  1CA6 A;  1HCZ A;  3HS0 C;  3GD7 A;  1QNK A;  3I3C A;  4OIJ A;  3K5L A;  4XYO A;  4KHZ A;  4EQN A;  2G9D A;  3P7J A;  1KAA A;  2HCC A;  1B1Z A;  3K5N A;  3C3L A;  5T1I A;  3NSW A;  4KKT A;  3Q0A A;  1TWG B;  5CV6 A;  1TU2 B;  1RCV D;  2JEA I;  3LWE A;  4ZKC B;  5KNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...