5C5NA

Structure of sars-3cl protease complex with a phenyl-beta-alanyl (r,s)-n-decalin type inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Fused-ring structure of N-decalin as a novel scaffold for SARS 3CL protease inhibitors
rcsb
source organism Human sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 81
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 5c5nA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c5nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c5nA02
2WYGA 3HGNA 2A4QA 3UR6A 4UFEH 1G3CA 1SGRE 5DP7A 3MH7A 1P03A 1NTPA 4B1TA 2HVXA 2ODYB 3TK6A 2BOHB 1HIAB 2LNCA 4ABAA 8GCHG 3BV9B 2ZA5A 3NK8A 5LPRA 1O32A 3GDVA 1Z71A 5JB8S 2VVCA 2IJOB 1A5GH 1OX1A 2ANYA 3OU0A 2HPQH 2A31A 2FZZA 3RXCA 2FTLE 1A3EH 1F5RA 1QJ6B 2SNWA 3SGAE 2FOBA 5E2PA 1O5DH 2ZEBA 1GHBG 1TRNA 1YP9A 2ZFFH 2W7SA 1DDJA 8ESTE 1N6XA 2A7HA 2GCTB 3A8AA 1QR3E 1C2LA 1JMOH 1NROH 3SU3A 4IC5A 2AERH 2NU3E 1E38B 3SUEA 2SGPE 4XBCA 4K60A 4CR5A 1W0YH 5DK1A 1ZTLA 2QXHA 4YLUA 2H5CA 3M3TA 4AFZA 2BLVA 3E0NB 2EI6A 2R9PA 1OWHA 1GG6B 1FPHH 1EZSC 3PLBA 2PTNA 2H9TH 4JK6A 1TYNA 3MO9A 2P8OB 3A7ZA 5DJ7A 1Q2WA 1UVPA 3KEEA 1TA2A 1GMHF 4CRAA 4I33A 1Z1IA 2BDBA 3EDXB 3RXLA 3MOCA 2VGCC 1UMAH 1TNLA 1V2TT 3MHWU 4GSOA 1C5NH 3VEQB 1YKTA 3RXQA 3PYHA 4Y8YA 2BDCA 3SQEE 3AVZA 5FPSA 3RU4T 1G30B 2Z9KA 1IQJA 3M5MA 4Q7XA 3A81A 4MNWA 1ESTA 3VFEA 5C1UA 3E90B 1C9TA 2ZHQH 1GBIA 1X7AC 1YPHC 3S9BA 1UVOA 5AFYH 1BBRE 1CGJE 3SJIA 3UNRA 1UK2A 3VB4A 1NT1A 4NFFA 3PMJA 1BOQA 1ELFA 1ACBE 1S5SA 1DWCH 3SBKA 2ZCKP 1C5XB 1U6QA 3SV2H 2QF3A 1GBLA 3PLKA 3ZZ8A 1AE8H 3VPKA 1W7XH 5EQQA 1TLDA 1GJ8B 5PTPA 2FOMB 1IQFA 3SJKA 3RP2A 1EZXC 4TYDA 1QURH 1RTLA 2C3SA 2BDIA 1DUAA 4YOIA 3VGCB 4D8NA 1Y3YA 6ESTA 1T7CA 3W94A 4AFUA 1AQ7A 1PJPA 3URCA 3U1IB 4NSVA 2Q6DA 2UWLA 1C9PA 4MVNA 4SGBE 3ZV8A 3RMMH 1GI9B 2GP9B 1PPBH 1PFXC 1MTNC 2ZGJA 2F9UA 3PWCA 4KKDA 1FNIA 2A4GA 1HYLA 1SOTA 2ZPQA 3ZVAA 1DVAH 2QYIA 1Z8GA 2CF8H 1CVWH 3PMBB 5A0CA 3F68H 1QBOA 2BQ6B 3S69A 3UIRA 3GY3A 1CQQA 2GT7A 4CBNA 3P95A 1Q31A 3MFJA 1GJ5H 1YPHE 1ESAA 3BEIB 2O8UA 2BZ6H 4IN2A 2A5KA 1ESBA 1TABE 2FLBH 1C5SA 2BVSH 3SGBE 1EQ9A 1TBRH 3S7KB 2PR3A 3HK3B 1OWDA 2GCHF 1DSUA 2B7DH 1RFNA 2AS9A 2PFEA 1RJXB 1GJDB 4X1RU 4WH8A 1XXFA 4KTSA 3MU0A 3U8OH 1TMBH 1A3BH 4X6OA 3SI3H 2H6MA 1NPMA 1QGFA 1YPGH 3WY8A 4GCHF 4OS4A 1DUEA 1UTOA 3MNCA 2TGDA 1FV9A 3F1SB 3L6PA 4RN6A 1TRMA 5DPAA 2P59A 4ABGA 2JETB 1AWFH 1EPTC 1ELGA 1JIMA 3A7TA 3H7OA 1FIWA 3M5LA 2R3UA 1CSOE 1P8VC 1K1OA 1ZMLA 4Y76A 1IHTH 3DFLA 5C5NA 1VGCC 1AB9B 1CGHA 1VITH 3GDUA 3ZZCA 2J94A 1TNGA 1TOMH 2ODPA 1ELCA 2XBWA 4PROA 3ZZ5A 1WQVH 2FO9A 1BBRH 2FI5E 3A8BA 1ANBA 3GCNA 1LKAA 1IQEA 1TGBA 3UR9A 3T27A 5GDSH 1C5LH 1B0FA 2ZTZA 3MH5A 5E0HA 2ZFTA 3PM3A 1F2SE 1QHRB 2WPMS 2H2ZA 2HNTC 3NUMA 5L6NH 1GBAA 1BTYA 1EXFA 2ESTE 1NN6A 4YTAA 1G32B 2BD2A 1O3GA 2CN0H 2VWMA 3GCHC 1DFPA 4TWYA 1HAXB 3NZIA 2FLRH 2OC8A 4CR9A 4AZ2B 2UUJB 4B73A 1BHXF 1WU1A 4DCDA 5FBEA 1YBWA 1AKSB 1EOLA 1HGTH 1H4WA 1UTKA 1LVYA 3T29A 4Q7ZA 4X8SH 5DP4A 1GI6A 2VIWA 1CO7E 1TBZH 1GHWH 1C4U2 1C2GA 2ZU3A 1NRPH 1ZSKA 1GCTC 3HKIB 1FY5A 3A88A 4Y8XA 3LU9B 1WTGH 4NZLA 9LPRA 2FOHA 1QJ7B 1BTWA 4NFEA 1H8IH 4K1EA 4X8TH 1GHYH 4FVBA 3MU1A 4B2CA 1KSNA 4FUBA 3TJVA 6CHAC 3RU4D 2ZP0H 1TX8A 3ZZBA 4Z0KA 3QDZB 1C1RA 5F8TA 2GT8A 4BAKB 1SHHB 1Y8TA 1CA8B 1LTOA 1O2JA 4NIXA 2HLCA 3G01A 1F0UA 3URDA 1FIZA 3U9AH 1BBRK 1EP5A 1BHXB 4HFPB 2VJ1A 3BTFE 1O2XA 3P70B 1HAOH 1SPJA 4J2YB 1SL3A 1OP2A 1GHAG 1ZPCA 2NU2E 2F9BH 3QZRA 2HNTE 1S84A 3DHKH 3PLPA 1BT7A 1GMHG 2XBYA 1OKXA 2XC4A 4BAMB 3DA9B 3RXEA 1SC8U 3BG8A 2Y5FA 1BRBE 1OWKA 1IQGA 4D9RA 3BTME 1EJNA 5EXMA 2XYAA 3FP7E 1JRTA 3QTVH 1QFKH 1YCPH 2HNTF 3ZZ3A 4YT7H 1P11E 5TJXA 2ZWLH 1O2QA 1BB0B 1UTPA 1A0HB 1P2OA 3E1XB 2WV4A 2BD9A 4Y11E 2WYJA 1ZSLA 4I8GA 2F9PA 1F92A 3I29A 3A85A 4OS5A 1EAUA 1YLCA 4ZROA 2G00A 3QX5H 1O2GH 1KLTA 1PPZA 2F9VA 2PUQH 1TNHA 4NIVA 2QXIA 4MPXA 4UDWH 3UY9A 1KIGH 1BTPA 3MO3A 3BTKE 1HJAB 4CRDA 1DXPA 1BZXE 3F6UH 1RTKA 1SFQB 4B2BA 2ZPSA 5ESBA 4K69A 2O8MA 3RXKA 1IQMA 1AN1E 4IMZA 1PPFE 3N7OA 4KP0A 4DURA 3RLWH 1QBVH 2F91A 2ZU2A 2OUAA 1J15A 2YNAA 4BANB 2XC0A 1YCPM 2ZHFH 3GY8A 1VJAU 5B6OA 4AG2A 1DWDH 1HJ9A 1O3DA 2GZ8A 3UOUA 4DJZB 5F6MA 2CV3A 1CT2E 2FODA 5C2ZA 4JCNA 1BMNH 3SV6A 1GDUA 1MBQA 4FU9A 4NA8A 1K21H 1PPEE 2Z3EA 2OD3B 2J2UA 2ZDVH 5AFZH 2Y82A 5L2YH 2FYQA 3EGKH 3S9CA 3LKWA 5I46H 3BG4C 1GI3A 2W26A 3MU4A 5DGJA 1L4DA 1SI5H 5C67A 1GDNA 1DY9A 1HCGA 1P2JA 1GJAB 1YCPK 4A5TS 2CF9H 1D6RA 1NO9H 3UNQA 1S6HA 1O3HA 1QB1A 3M35A 3D23A 1D3PB 1O3EA 1OWIA 2Y5HA 1K22H 3TH2H 1OWJA 2ZF0H 1O3OA 1AD8H 2C90B 3TJNA 2P3TB 4GVUA 2GX4A 2FOAA 4BAHB 1P2IA 4Q80A 1GBJA 3H5CB 2AMPA 2GCHG 2EI7A 4NA7A 4GLYA 3TVJB 1OYTH 2TPIZ 1ORFA 1AGJA 2A5AA 5JBAS 2WPKS 2BM2A 3P92A 5ESTE 1C1OA 4WMEA 2K7XA 4JZ1A 3RMLH 1QL8A 1V2PT 2SGFE 1UHBA 1RGQA 4R8TB 5CHAB 4X8UH 4GCHG 4BNRA 2GCTC 1O3MA 1T8NA 1MBMA 1PQ7A 5A09A 3ATIA 1TX6A 4XBBA 1SGFA 1HAZB 1SG8B 1RIWB 2ZHWH 1NY22 4AORA 5A2MH 4K3JA 4X1SU 2A7JA 1GI0A 2QGRA 3PTNA 4WMDA 1QTFA 1QL9A 3RXFA 3T2NA 1L1NA 3RLYH 3A82A 1GG6C 3ENSB 3S0NA 1TGSZ 1A0LA 1GHZA 2P8OC 4A1TA 8LPRA 1MCVA 2BZAA 2BY7X 2GMTB 2P3FH 4D76A 2KAIA 1TOCB 5HMAA 2K1QA 4VGCB 4E7NA 2W5EA 3VB6A 1TMUH 1FQ3A 3F9EA 4E7RG 1GI7B 1HB0B 2PLXA 2G51A 1G3DA 3D65E 3EA9A 1V2NT 2QXGA 1N1LA 4Y7BA 1LMWB 1O2ZA 1PPGE 2ZHDA 4WJG2 5GIBA 4CH8B 1MKXH 1TONA 1HBTH 3SU1A 1G3EA 1LQEA 3VXFH 2BLOA 3SNDA 2GTBA 1K1MA 4OS7A 3GY7A 1FY8E 2B5TB 1FZZA 2BQ7B 3T25A 1ZJDA 3QK1A 2XBXA 4Y0ZE 2AYWA 2VIDA 5TCCA 2VWNA 4JMYA 1KLIH 2VIVA 1O30A 1NESE 3CS0A 1C1PA 4R0IA 2BXUH 4F49A 1FY4A 1W14U 1DICA 1ZLRA 1PPCE 4FUCA 1TQ0B 4HZHA 2EA3A 3MWIU 2BY8X 1EPTA 1V2KT 1GI5A 2W3KA 2XC5A 2IOTA 1SQOA 3ZZDA 2F9OA 2PSYA 3VXEH 4H6TA 3LJOA 1NU7B 1C5PA 3GCTG 5FXLA 3VGCC 2OQ5A 1C2MA 2OBOA 3QUMP 1BQYA 5FPYA 2OC0A 1J16A 1XKAC 2FOEA 1RD3B 1FAXA 1NFXA 2ANMH 1O3PB 4AGKA 2GDEH 1C2HA 3P8GA 3BSQA 3TJUA 3NWUA 4CRBA 2FOFA 5C20A 5BRRE 1AUJA 1P2QA 5LPFA 3KQDA 4FUFA 2JH5D 1O2MA 3PMAB 2ZQ2A 2BDHA 2CXVA 3UQOA 2OLGA 3MNBA 1OOKB 1O5GH 3ATLA 1GJ7B 2FX6A 1GMDF 1Y3VA 2VINA 1WQSA 3MMGA 3PTBA 5IDKA 2OC1A 1XX9A 1O2PA 4B75A 4NIWA 1HFDA 4XE4A 1MKXK 4FUHA 3P8NA 1MCTA 2J34A 4UFFH 4NWLA 3RXDA 5LGOA 2GZ7A 4X0WU 2ZQ1A 1GL0E 3ESTA 1SMFE 3QN7A 3V7TA 2ALVA 3EE0B 2A1DB 5DG6A 3SI4H 1E34B 1XUFA 1SBWA 4K5ZA 3ITIA 1GHAF 3KQBA 2ZU1A 1C5UA 4GUXA 3SV8A 4B76A 5I25A 4AB9A 2BX4A 2C8ZB 1V2RT 1DLEA 3RXOA 1TB6H 2D1JA 1ABIH 2ZHEH 1C5RA 2JETC 1FY3A 4YOJA 2C8WB 2QN5T 5HXFA 2PKAB 3U69H 1FAKH 4DG4A 1C5YB 1AVWA 1AB9C 8KME2 2Z9LA 1P3CA 3PB1E 5JB9S 1TWXB 1C4V2 2BVXH 1GBBA 1KLJH 4ZKRU 3GISB 2JH6D 2V6NA 4Y79A 1C1QA 1UO6A 1G2MA 2FXRA 1QRZA 4A92A 1ELEE 3FZZA 1TPSA 4U2WA 4X1NU 2Y81A 5A0AE 3A86A 2P93A 1O2KA 5E2OA 1TRYA 1C2IA 1PYTC 4DOQA 4YM9A 3LGTA 1EOJA 4KGAA 1ZRBA 2GVFA 1E36B 1MTVA 3K2UA 3ODFA 3RXRA 2ANKH 1CHOF 1QNJA 1MD7A 1AVXA 1SQAA 1ZTJA 4GAWA 5JDUB 4XOJA 1P05A 5AHGH 4NWKA 3SQHE 1TX7A 1BMAA 2A2QH 3HATH 5EXNA 1ZJKA 1K1LA 1L2EA 3K65B 2VH0A 3EYDA 1BJUA 4UE7H 2BYAX 2FOGA 1E35B 2AMQA 1QQ4A 4WY3A 1T4UH 1GJ4H 3KHVA 4BTIB 2R2WU 1O3CA 1KDQA 1O3LA 4XSKU 3UQVA 2RA0A 2BDGA 1Z8JB 2RCEA 2SGDE 1BMLA 3BTQE 3RXMA 1Y3WA 3A8DA 1BJVA 4DIHH 3NKKA 5GXPA 4YESB 1P01A 4AN7A 1N8OB 1OSSA 3ZZ7A 1HLTH 2PWXA 1H9HE 1AO5A 1WUNH 3LH3A 1DPOA 2BD4A 5FPTA 4INKA 1ARBA 1NRNH 2O8LA 1SR5C 5EPNA 1A4WH 2Y6TA 1A5HA 2FOCA 3FP6E 1HAIH 3IITA 4J1YA 1NRQH 3LGUA 1L1JA 1SFIA 4IS5A 1T32A 1A5IA 1AE5A 4SGAE 1P2KA 3TGJE 1LHGH 1UTQA 1T31A 1AVGH 1O33A 1GCDA 1GL1A 1DM4B 5T6FA 3NXPA 5JYIA 3LGVA 5F8XA 2VU8E 4I7YH 1HNEE 1MH0A 1Y5UT 3A7WA 3SHAH 4KELA 1V3XA 1S83A 3M37A 1AU8A 1HDTH 4NCYA 4NG9H 1K2I1 3RC5A 3D62A 1AFQB 2GV6A 3KQEA 3SOSA 1YF4A 1XUKA 4UD9H 1HIAA 1EJMA 1DY8A 1GDQA 2NWNA 2V3HH 4ZMAH 4LXBH 1GPZA 1IQHA 1FI8A 2H1UA 3V3MA 5E0JA 4DT7B 3LC3A 3M5OA 1ZPBA 2UWOA 1D4PB 2G4UA 2VVVA 4IN1A 1C5QA 4E05H 2IPHA 4CRFA 1SLXB 1AMHA 3Q76A 4KTUA 2Z9GA 3QGNB 1HJAC 4ABIA 1ZTKA 2XTTB 1EJAA 3Q3XA 2EI8A 1SLVB 1DE7H 1BCUH 1LKBA 1L0ZA 3B23B 5T6GA 2WUBA 4M7GA 5K0HA 2QY0B 4B2AA 2PHBA 1LQDB 5F8ZA 3SNAA 1MTWA 1SGYE 2BY9X 1QQUA 1HXFH 2ZU4A 1GMCF 1F5LA 1ZR0A 2R3YA 2Q1JA 2C8YB 3MU5A 1NRRH 4JK5A 2XWBI 3KL6A 2JH0D 4IW4E 1GGDB 5JBTA 2H9HA 3UPEA 3U8TH 4ASHA 1K9OE 2OQUA 4MTBA 2QAAA 1H1BA 2RA3A 4DGJA 4HTCH 5FHTA 4ZXXH 2FTMA 5GJ4B 1MU8B 5EG4A 7KMEH 1D3DB 1LDTT 5E0GA 3K6YA 4MPUA 3GY5A 1P12E 1GMDG 4NIYA 1HRTH 2Y5GA 1LHCH 5FAHA 2XNIA 1O35A 3GOVB 3TITA 1PYTD 3MYWA 1D6WA 1MD8A 2BB4A 5J4SA 2C8XB 4FUIA 3UFAA 2W3IA 4Y8ZA 4Y71A 2ZDAH 2A4OA 4TY6A 3F9GA 2BLQA 4ABDA 4Y0YE 2XBVA 7GCHF 5EQRA 9ESTA 2NU1E 4UFGH 1J9CH 4ISLA 3GCTF 3ZVGA 1NM6A 4Y6DA 1P9UA 4K8YA 1S82A 3C1KA 3TPIZ 1LPZB 3TH3H 3EA8A 1XVMA 1C4Y2 2DE9A 4I31A 5FCKA 2Y80A 4AFQA 3RXAA 3SU4A 4TPYA 1SGEE 5CHAC 4WWYA 4ZKSU 3SJ8A 1DANH 1O3FA 2I6QA 3QZQA 3ATMA 1TPPA 2QF0A 1GI4A 2B0FA 2FDAA 1L1GA 1GBDA 1TE0A 1BA8B 2AGGX 1EKBB 2XRCA 5GPIB 4BOHA 3B9FH 1ZZZA 4CHAB 4DY7B 1RIWC 3A83A 5A8YA 3AAUA 3SJ9A 1DWBH 2NU4E 2GV7A 3BTWE 2ZZUH 5C3NA 2HPPH 3M5NA 1B7XB 4YZUA 2HGTH 4BXWA 1TMTH 1QA0A 2PKSB 1UTNA 2ZC9H 1UVUH 2ZIQH 1MAXA 1BMMH 4CREA 1TPOA 1KYNA 1KXEA 3Q3KA 4K8BA 1QB9A 3SU2A 2GMTC 1UJ1A 3LGWA 4WVPE 1SGTA 2G8TA 3SU0A 1ABJH 2UUYA 1O5EH 1QBNA 2TRMA 3GY2A 3LDXH 3KN2A 4VGCC 1F7ZA 3RM2H 2O9QA 1Z6JH 2H5DA 3M36A 1BTUA 3PWBA 1CHOG 1UCYE 2GDDA 4GPGA 4AYVB 2CJIA 1JIRA 3SU6A 2D26C 4BTUB 2SGQE 1GBCA 2ZO3H 2XCNA 2ASUB 3KCGH 2TGPZ 1F0RA 3ZYEA 1C2JA 4O9VA 1P02A 2Y7XA 2ZPRA 1AHTH 3GYMA 3RC6A 1O3JA 2ZI2H 2R0KA 3TK9A 3R3GB 4JZIA 3KNXA 2SGAA 1CBWB 1YPLH 3E16B 1A0JA 3R0FA 1P06A 1SB1H 1YPMH 1O2HA 4I8KA 2F3CE 3RXGA 1W11U 1L4ZA 2J9NA 2A45B 1Z6EA 3SO3A 2ZG0H 2VNTA 5EODA 1ETSH 1GJBB 1SGIB 4JYVH 3JZ2B 4QT8C 3V13A 1QA7A 1C1TA 1QRXA 4MG3A 5E8EH 1WTHD 3ZV9A 4OS6A 4JZFH 1EX3A 1VJ9U 3BTEE 4WF8A 3UNSA 1AUTC 2G81E 2BDAA 2RG3A 4D9QA 2Q6FA 4RKOB 3E6PH 4AG1A 1XMNB 2AH4X 1ZGVA 2PW8H 1O39A 1IQIA 4JZEH 2OP9A 2XXLA 4FU8A 1YM0A 3AAVA 1BTHH 1YPEH 3P6ZB 1C2EA 2THFB 1QRWA 1WYKA 1TGTA 4BXSA 4FUJA 1O2SA 3TGKE 1TQ7B 1K1IA 1MKWH 4WXIA 2Z9JA 1FXYA 1VZQH 2Z7FE 1SSXA 2Z3DA 1W10U 4I8HA 1LHFH 2BTCE 4MDSA 4MNVA 2ZDKA 4X2VA 3SNCA 1EZQA 4NSYA 2FS9A 3VB7A 4CBOA 1S81A 1OP0A 1OXGA 2SNVA 1TPAE 1YLDA 4HI3A 3H7TA 3LH1A 5FX5A 1AKSA 1CA0C 1FY1A 1KXCA 4MNYA 3RXBA 4INLA 5L2ZH 3A7VA 3I78A 4ZXYH 3ZZ9A 5DO4H 1O36A 2ZTYA 1NC6A 1DITH 1RS0A 1KXFA 4THNH 2FWWA 1P2MA 1J14A 3Q77A 3T26A 1FPCH 1YPKH 5IYTA 1ZMNA 1TFXA 1JRSA 2M5TA 1XVOA 1KTTB 1MAYA 2OXSA 2P94A 3UUZA 1O2OA 1UCYH 2OINA 4Q2KA 1BDAA 4FUGA 4NA9H 4OGYA 4AFSA 2QV1A 3BTGE 1QB6A 4ABHA 3U8RH 3P8FA 2DUCA 2ZCLP 3QWCH 4GHQA 4FUDA 3RXJA 2VB0A 2Y7ZA 3MNXA 1YC0A 1XUGA 3FZDA 4NZQA 1KXDA 2O8TA 1GMCG 1A7SA 2AGEX 5GCHF 3TLOA 4ZH8A 2BY6X 1MTSA 2HALA 1SVPA 2V35A 4D7FA 3F9HA 5C1XA 4HGCA 1V2QT 2A0QB 1ZHPA 1THSH 2SFAA 5DP8A 1SGQE 1C5TA 1P10A 4ISHH 1OPHB 1AFEH 1MKWK 1N6YA 1O37A 1P9SA 3MO6A 4ZHLU 1QCPA 1O3IA 4B71A 1LVMA 3V0XA 1O2RA 4X1PU 1ELTA 4O3UA 3RXIA 1OS8A 4AX9H 1LVBA 5EW2H 2FESH 1F0TA 3OYPA 3E91A 3O8BA 5DP6A 3LONA 2AIQA 5DP3A 1ELVA 1XXDA 2XCFA 3M7UA 4ISOA 3T62A 1G3BA 4FU7A 2PGBB 7GCHG 1W8BH 5EXLA 3M7TA 4ZUHA 2QCYA 2R2MB 1ZHMA 1FUJA 1HAYB 2Z9IA 1OP8A 5FBIA 1K28D 1E0FD 2FS8A 2AFQB 2CHAB 4UFDH 1EATA 1F0SA 3BIUH 2NU0E 4K1TA 3M3VA 1O5CB 1N8OC 1RXPA 5A8ZA 1O5BB 2CMYA 3JZ1B 3DFJA 3K6ZA 4MPVA 2TIOA 4A7IB 3PO1B 4X6MA 3LPRA 4WMFA 2TGTA 2H9EH 1Y3UA 2XW9A 1GI1A 4MLFB 3L3TA 1MTUA 3HK6B 2ZFQH 1IHSH 1GBKA 4MNXA 2AEIH 1O3NA 2BY5X 1XUHA 4Y7AA 1HJ8A 1Y59T 4H4FA 1CHGA 3BF6H 1V2VT 3AW1A 2IN2A 1A1RA 1Y3XA 2P95A 1Z7KA 3BEFB 1CA0B 5HGGA 3ZVEA 3A7XA 2Z6BD 3SZNA 3GY4A 3SJOA 1AY6H 3QLPH 4A6LA 1SGPE 1CT4E 1V2UT 1KXAA 1C5WB 3KQCA 1HUTH 1JXPA 1SGCA 2STAE 2UUKB 3E3TA 3NCLA 1P0SH 1O38A 3ZVCA 1J8AA 1AFQC 1TAWA 1P09A 3UREA 1B0EA 1EB2A 1PQ8A 1IQLA 3SUGA 2GGVB 2ZFRH 2GD4B 4B74A 2SGEE 3T28A 2G55A 4UONA 1GBEA 3TJOA 1LPGB 1Y5AT 1Y5BT 2ANWA 1S85A 2VWLA 1LO6A 2QIQA 4ABJA 2A7CA 4MQAA 1CT0E 1A2CH 1MZDA 4X1QU 1A61H 2G5NA 4ABEA 3PMHB 2BMGB 1BRAA 4AB8A 2Q6GA 3STJA 3M7QA 3KF2A 1AWHB 2V0BA 1D3QB 5EW1H 3SU5A 5LH8A 5DKMA 1KTSB 3FAOA 4RSPA 2VWOA 2AMDA 5C1YA 1C5OH 1T8LA 1SHYA 1C2DA 2J38A 4LZ4B 1H8DH 4ISNA 1JWTA 2P16A 2QA9E 1GVZA 2OCVB 4BTTB 5DP9A 3IG6B 1NRSH 2PV9B 3EBNA 4XFQA 2C4FH 1FJSA 1XM1A 1ZOMA 1VCQA 6GCHF 1GGDC 1NS3A 1O5FH 2R0LA 5SGAE 1O0DH 1O3AA 3DUXH 2ZDLA 1FMGA 2ULLA 1GHVH 3AASA 1O5AB 5EU8A 2LPRA 2GKVE 2BVRH 1NU9A 3BTHE 1GJ9B 1WOFA 2PTCE 3M3SA 2J95A 1VITF 1ELDE 1W3CA 1GBMA 2BD5A 2PUXB 3BN9A 4XDEA 1ZSJA 3RXSA 1HXEH 1SGDE 1IQKA 1IQNA 3BTTE 3KIDU 1SLWB 1GVLA 2BX3A 3SNEA 4ABBA 1DX5M 1MMJN 4JZDH 3RXTA 5HM9A 1ZPZA 2OC7A 1HV7A 1IOEA 1UTLM 1BRUP 3SN8A 2QXJA 1TNIA 1HPGA 3GICB 4FUEA 2WPHS 1GJ6A 1ELBA 1H9IE 1DT2A 3O8CA 1G9IE 1DXWA 1M9UA 3RDZA 3TK5A 2ZGHA 4TWWA 1EAIA 1J17T 1V2ST 3E0PB 4A1VA 1LCYA 1EP6A 1HAGE 4O97A 3ATWA 3ZYDA 1CE5A 4X8VH 5ETXA 1FDPA 1E37B 1O2UA 3A8CA 2VVUA 4OS2A 4ZAEA 3EAJA 3BTDE 3NPSA 4CHAC 1QY6A 2F83A 3HKJB 4IBLH 1ETTH 1OWEA 2TGAA 2ZGBH 1T8OA 2ILNA 5GCHG 1EAXA 2PKSC 3RU4E 3SGQE 3M61U 3AW0A 3VB3A 1HAHH 3OSYA 4X2WA 2BHGA 3A80A 1ZYOA 5JBBS 1JOUB 2G4TA 3STIA 2A4RA 1O2WA 2FIRH 4CRGA 5CMXH 3PV4A 1W7GH 4ESTE 3A7YA 3ATKA 1V2WT 2BQWB 2FX4A 3I77A 3S9AA 1NFYA 4WH6A 3LT3A 2HWLB 2A5IA 1THRH 3ELAH 3RMNH 4RKJB 2A2XH 1EZUC 3DD2H 3QGJA 3EQ0H 5T6DA 2BLWA 2VGCB 1DSTA 4OS1A 4X2XA 3UWJH 3Q3YA 5TCAA 4U01A 1G36A 1FONA 1KXBA 1T8MA 1K1PA 1BRCE 2ZCHP 1W12U 1AZZA 1CBWC 2Z94A 4U32A 1O2TA 3TH4H 1O2YA 2ZDMA 4AOQA 1XUIA 4YOGA 1B5GH 1V2MT 1TNKA 1VR1H 2ZECA 4Y10E 1TIOA 1OYQA 3VB5A 1PQAA 1Q3XA 2TBSA 3TGIE 5J4QA 1WAYB 2PKAA 4DIIH 2ZU5A 1NFWA 1GWAA 2PSXA 2VIOA 1RRKA 1F5KU 1UHBB 4O03A 3HGPA 4ISIH 4TPIZ 4O3TA 2ZGCA 3A89A 1ANEA 3Q00A 2YNBA 2ZKSA 3RUOA 1A46H 4JYUH 1GBFA 5JPMH 5JBCS 2I6SA 1DOJA 3D49H 1FN6A 1UK4A 1LHEH 1GVKB 2G5VA 3SV7A 1GI2A 2WPIS 1C1SA 5EQSA 3A84A 1C1MA 1P3EA 1W0ZU 3LGYA 4INHA 3SUDA 1V2LT 1ARCA 4YO9A 1MQ6A 3UWIA 1P04A 1ZGIA 2ZFSA 1C1NA 4ZHAA 2FI3E 3O8DA 3MH4A 1MTNB 2LIZA 4CH2B 2ZDNA 3RXUA 3LGIA 5CE1A 1TGNA 5FCRA 1MUEB 1C5VA 1K1JA 1O3BA 1FN8A 4IGDA 1CU1A 1FLEE 2KAIB 3RC4A 7LPRA 5EOKA 1G37A 4XBDA 1TNJA 2CGAA 3LOXA 1P2NA 3HPTB 4LZ1H 4D7GA 1AZ8A 2WV5A 3K9XB 5EGMA 5AF9H 1RTFB 8GCHF 5A0BA 1SOZA 2Z3CA 2ZFPH 4I8JA 1EUFA 3ZZAA 3IWMA 1VCWA 4YLQH 1ELAA 1PPHE 2PGQB 2C93B 1WSSH 1D3TB 1BTXA 4X6NA 1UVSH 3ZZ4A 1BIOA 3LC5A 4FVDA 2B8OH 1GHXH 3GY6A 3TNTA 1GHBF 3E8LA 2FPZA 3W95A 2JKHA 1T4VH 1GBHA 3SUFA 3U98H 5FX6A 1TALA 2OBQA 3F9FA 5T3HA 3QTOH 2G52A 2FMJA 3OY6U 1BUIA 1IAUA 4JYTA 1C1UH 1EPTB 5AVDA 1AIXH 4E06H 1UK3A 4ZKOU 1V2OT 6GCHG 2HRVA 1ZHRA 1MZAA 1C2KA 1HAVB 2UWPA 1VGCB 3DT0H 5HM2A 2J92A 3V12A 1UTJA 3LJJA 3UOPA 4UEHH 1O2NA 3RMOH 5EPYA 3KGPA 4AYYB 3CENA 2BXTH 1VITG 4BAQB 1MQ5A 2BDYA 4LK4A 4FXGH 2RDLA 2FP7B 1ANCA 4KTCA 3TNSA 4YT6H 3TU7H 1UTMA 3ODDA 1K1NA 3RXPA 5GWZA 4H6SB 4NGAH 1C2FA 2J4IA 3U1JB 1YYY1 3GCHB 6LPRA 2BD8A 5C5OA 3FVFB 2CHAC 3C27B 2WUCA 5F03A 1O34A 2ZNKH 1V2JT 4IC6A 1Z8RA 5ABWA 1QJ1B 3QO6A 5G4BA 1EASA 3PO1C 1DLKB 3MNSA 1Z1JA 3RM0H 1BITA 1GCTB 1PQ5A 3ZVFA 4TY7A 3GYLB 4DVAU 4AGJA 2D2DA 5K7RA 4K1SA 2AGIX 4Z6AH 1EB1H 2WINI 2A32A 4I8LA 1TGCA 1LVOA 3CP7A 1H9LB 4Q7YA 2VIQA 6CHAB 2VIPA 2QC2A 1VCPA 3BEUA 3P8OA 4F4OC 1HAPH 4LOYH 2FYRA 3FFGA 1BTZA 2D8WA 3SV9A 1YPJH 3A87A 4U30A 5L30H 1C5ZB 3TIUA 4ABFA 2BD3A 1O31A 7ESTE 5LPEA 3UTUH 1ZMJA 1S6FA 2F9NA 3SNBA 3MH6A 3ZVBA 1WV7H 2V3OH 3SORA 4IMQA 2ZTXA 1QIXB 4CRCA 2ODQA 2WPLS 1WBGB 2AIPA 2UUFB 3SW2B 4MPWA 5HYOA 2W7UA 1TA6A 1CGIE 2XWAA 2FM2A 3OY5U 4OGXA 1TBQH 3RXHA 1W2KH 3EA7A 4I32A 1THPB 4X2YA 3FANA 2GZ9A 3S7HB 1NFUA 2STBE 2B9LA 3ZZ6A 3SHCH 4K2YA 1ETRH 1SGFG 1AI8H 1INCA 5DP5A 1Z8IB 2BD7A 1S0RA 5H4IB 1P57B 2O8WA 1O2IA 1SLUB 1XKBC 1UVTH 4X6PA 2VH6A 1JBUH 1KDQB 3GCOA 5A8XA 1DWEH 1SGNE 1C1WH 2FI4E 2YOLA 2BOKA 1S0QA 1D9IA 1WCZA 4ZKNU 1ANDA 3GDSA 3CS7A 2P3UB 1W13U 2DE8A 3LIWA 1QL7A 2ALPA 1O2VA 2HOBA 3MI4A 3MU8A 2EC9H 3ZVDA 1C5MD 4ZHMU 4H42U 2FEQH 3OX7U 1GBTA 1YGCH 3O8RA 1LPKB 2WPJS 1G2LA 3MTYA 3B8JA 3PROA 3FP8E 1ID5H 4A1XA 3RXVA 1O3KA 5BPEA 1MU6B 1ZRKA 1LHDH 2OTVA 4GHTA 1EAWA 1SQTA 1C1VH 1O2LA 1NZQH 2ZGXH 3OTJE 4BAOB 1UCYK 3BIVH 4DW2U 2EEKA 3L33A 3T5FH 1GI8B 1KY9A 3BG4B 4WXVA 1V6DA 1GJCB 1DS2E 1HAVA 1XUJA 3P17H
chains in the Genus database with same CATH superfamily
2WYGA 3HGNA 2A4QA 3UR6A 4UFEH 1G3CA 1SGRE 5DP7A 3MH7A 1P03A 1NTPA 4B1TA 2HVXA 2ODYB 3TK6A 2BOHB 1HIAB 2LNCA 4ABAA 8GCHG 3BV9B 2ZA5A 3NK8A 5LPRA 1O32A 3OE7D 3GDVA 1Z71A 5JB8S 2VVCA 2IJOB 1A5GH 1OX1A 2ANYA 3OU0A 2HPQH 2A31A 2FZZA 3RXCA 2FTLE 1A3EH 1F5RA 1QJ6B 2SNWA 3SGAE 2FOBA 5E2PA 1O5DH 2ZEBA 1GHBG 1TRNA 1YP9A 2ZFFH 2W7SA 1DDJA 8ESTE 1N6XA 2A7HA 2GCTB 3A8AA 5C0UA 1QR3E 3DCLA 1C2LA 1JMOH 2F43B 1NROH 3SU3A 4IC5A 2AERH 2NU3E 1E38B 3SUEA 2SGPE 4XBCA 4K60A 4CR5A 1W0YH 5DK1A 1ZTLA 2QXHA 4YLUA 2H5CA 3M3TA 4AFZA 2BLVA 3E0NB 2EI6A 2R9PA 1OWHA 1GG6B 1FPHH 1EZSC 3PLBA 2PTNA 2H9TH 4JK6A 1TYNA 3MO9A 2P8OB 3A7ZA 5DJ7A 1Q2WA 1UVPA 3KEEA 1BMFD 1GMHF 1TA2A 4CRAA 4I33A 1Z1IA 2BDBA 3EDXB 3RXLA 3MOCA 2VGCC 5T1VA 1UMAH 1TNLA 1V2TT 3MHWU 4GSOA 1C5NH 3VEQB 1YKTA 3RXQA 3PYHA 4Y8YA 2BDCA 3SQEE 3AVZA 5FPSA 3RU4T 1G30B 2Z9KA 1IQJA 3M5MA 4Q7XA 3A81A 4MNWA 1ESTA 3VFEA 5C1UA 3E90B 1C9TA 2ZHQH 1GBIA 1X7AC 1YPHC 3S9BA 1UVOA 5AFYH 3N7DA 1BBRE 1CGJE 3SJIA 3UNRA 1UK2A 2WV9A 3VB4A 1NT1A 4NFFA 3PMJA 1BOQA 1ELFA 1ACBE 1S5SA 1DWCH 3SBKA 4B6EA 2ZCKP 1C5XB 1U6QA 3SV2H 2QF3A 1GBLA 3PLKA 3ZZ8A 1AE8H 3VPKA 1W7XH 2XNDD 5EQQA 1TLDA 1GJ8B 5PTPA 2FOMB 1IQFA 3F2HA 3SJKA 3RP2A 1EZXC 4TYDA 1QURH 1RTLA 2C3SA 2BDIA 1DUAA 1NBME 4YOIA 3VGCB 4D8NA 1Y3YA 6ESTA 1T7CA 3W94A 4AFUA 1AQ7A 1H8HD 1PJPA 3URCA 3U1IB 4NSVA 2Q6DA 2UWLA 1C9PA 4MVNA 4SGBE 3ZV8A 2WHXA 1GI9B 3RMMH 2GP9B 1PPBH 1PFXC 1MTNC 2ZGJA 2F9UA 3PWCA 4KKDA 4ACBA 1FNIA 2A4GA 1HYLA 4P02A 1SOTA 2ZPQA 3ZVAA 1DVAH 2QYIA 1Z8GA 2CF8H 1CVWH 2V3MA 3PMBB 5A0CA 3F68H 1QBOA 2BQ6B 3S69A 3UIRA 3GY3A 1CQQA 2GT7A 4CBNA 3P95A 1Q31A 3MFJA 1GJ5H 5HKKD 1YPHE 1ESAA 3BEIB 2O8UA 2BZ6H 4IN2A 2A5KA 1ESBA 1TABE 2FLBH 1C5SA 2BVSH 3SGBE 1EQ9A 1TBRH 3S7KB 2PR3A 3HK3B 1OWDA 2GCHF 1DSUA 2B7DH 1RFNA 2AS9A 2PFEA 1RJXB 1GJDB 4X1RU 4WH8A 1XXFA 5DN6D 4KTSA 3MU0A 3U8OH 1TMBH 1A3BH 4X6OA 3SI3H 2H6MA 1NPMA 1QGFA 1YPGH 3WY8A 4GCHF 4OS4A 1DUEA 1UTOA 3MNCA 2TGDA 1FV9A 3F1SB 3L6PA 4RN6A 1TRMA 5DPAA 2P59A 4ABGA 2JETB 1AWFH 1EPTC 1ELGA 1JIMA 3A7TA 3H7OA 1FIWA 3M5LA 2R3UA 1CSOE 1P8VC 1K1OA 1ZMLA 4Y76A 1IHTH 3DFLA 5C5NA 1VGCC 1AB9B 1CGHA 1VITH 3GDUA 3ZZCA 2J94A 1TNGA 1TOMH 2ODPA 1ELCA 2XBWA 4PROA 3ZZ5A 1WQVH 2FO9A 1BBRH 2FI5E 3A8BA 1ANBA 3GCNA 1LKAA 4RT0A 1IQEA 1TGBA 1VKYA 3UR9A 3T27A 5GDSH 1C5LH 1B0FA 2ZTZA 3MH5A 3W1EA 4Q4LA 5E0HA 2ZFTA 3PM3A 1F2SE 1QHRB 2WPMS 2L6OA 2H2ZA 2HNTC 3NUMA 5L6NH 1GBAA 1BTYA 1EXFA 2ESTE 1NN6A 4YTAA 1G32B 2BD2A 1O3GA 5EJZA 2CN0H 3FN8A 2VWMA 3GCHC 1DFPA 4TWYA 1HAXB 3NZIA 2FLRH 2OC8A 4CR9A 4AZ2B 2UUJB 4B73A 1BHXF 1WU1A 4DCDA 5FBEA 1YBWA 1AKSB 1EOLA 1HGTH 1H4WA 1UTKA 1LVYA 3T29A 4Q7ZA 4X8SH 5DP4A 1GI6A 2K8IA 2VIWA 1CO7E 1TBZH 1GHWH 1C4U2 1C2GA 2ZU3A 1NRPH 1ZSKA 1GCTC 3HKIB 1FY5A 3A88A 4Y8XA 3LU9B 1WTGH 4NZLA 9LPRA 2FOHA 1QJ7B 1BTWA 4NFEA 1H8IH 4K1EA 4X8TH 1GHYH 4FVBA 3MU1A 4B2CA 1KSNA 4FUBA 3TJVA 6CHAC 3RU4D 2ZP0H 1TX8A 3ZZBA 4Z0KA 3QDZB 1C1RA 5F8TA 2GT8A 2KM0A 4BAKB 1SHHB 1Y8TA 1CA8B 1LTOA 1O2JA 4NIXA 2HLCA 2VBCA 3G01A 1F0UA 3URDA 1FIZA 3U9AH 1BBRK 1EP5A 1BHXB 4HFPB 2VJ1A 3BTFE 1O2XA 3P70B 1HAOH 1SPJA 4J2YB 1SL3A 1OP2A 1GHAG 1ZPCA 2NU2E 2F9BH 3QZRA 2HNTE 1S84A 3DHKH 3PLPA 1BT7A 1GMHG 2XBYA 1OKXA 2XC4A 4BAMB 5KECA 3DA9B 3RXEA 1SC8U 3BG8A 2Y5FA 1BRBE 1OWKA 1IQGA 3F0PA 3BTME 4D9RA 1EJNA 5EXMA 2XYAA 3FP7E 1JRTA 3QTVH 1QFKH 1YCPH 2HNTF 3ZZ3A 4YT7H 1P11E 5TJXA 2RDEA 2ZWLH 1O2QA 1BB0B 1W0KD 1UTPA 1A0HB 1P2OA 3E1XB 2WV4A 2BD9A 4Y11E 3F2GA 2WYJA 4RI0A 1ZSLA 4I8GA 2F9PA 1F92A 3I29A 3A85A 4OS5A 1EAUA 1YLCA 4ZROA 2G00A 3QX5H 1WDIA 1O2GH 1KLTA 1PPZA 2F9VA 3KYFA 2PUQH 1TNHA 4NIVA 2QXIA 4MPXA 4UDWH 3UY9A 1KIGH 1BTPA 2YMSB 3BTKE 1HJAB 3MO3A 4CRDA 1DXPA 1BZXE 3F6UH 1RTKA 1SFQB 4B2BA 2ZPSA 5ESBA 4K69A 2O8MA 3RXKA 1IQMA 1AN1E 4IMZA 1PPFE 3N7OA 4KP0A 4DURA 3RLWH 1QBVH 2F91A 2ZU2A 2OUAA 1J15A 2YNAA 4BANB 2XC0A 1YCPM 2ZHFH 3GY8A 1VJAU 5B6OA 4AG2A 1DWDH 1HJ9A 1O3DA 2GZ8A 3UOUA 4DJZB 5F6MA 2CV3A 1CT2E 2FODA 5C2ZA 4JCNA 1BMNH 3SV6A 4TT3D 1GDUA 1MBQA 4FU9A 4NA8A 1K21H 1PPEE 2KCPA 2Z3EA 2OD3B 2J2UA 2ZDVH 5AFZH 2Y82A 5L2YH 2FYQA 1E1RD 3EGKH 3S9CA 3FOAA 3LKWA 5I46H 3BG4C 1GI3A 2W26A 3MU4A 5DGJA 1L4DA 1SI5H 5C67A 1GDNA 1DY9A 1HCGA 1P2JA 1GJAB 1YCPK 4A5TS 2CF9H 1D6RA 1NO9H 3UNQA 1S6HA 1O3HA 1QB1A 3KQ5A 3M35A 3D23A 1D3PB 1O3EA 1OWIA 2Y5HA 1K22H 3TH2H 1OWJA 2ZF0H 1O3OA 1AD8H 2K0QA 2C90B 3TJNA 2P3TB 4GVUA 2GX4A 2FOAA 4BAHB 1P2IA 4Q80A 1GBJA 3H5CB 2AMPA 2GCHG 2EI7A 4NA7A 4GLYA 3TVJB 1OYTH 2TPIZ 1ORFA 1AGJA 2HVYB 2A5AA 5JBAS 2WPKS 2BM2A 3P92A 5ESTE 1C1OA 4WMEA 2K7XA 4JZ1A 3RMLH 1QL8A 1V2PT 3UAIC 2SGFE 1UHBA 1RGQA 3H09A 4R8TB 5CHAB 1UW7A 4X8UH 4GCHG 4BNRA 2GCTC 2QF4A 1O3MA 1T8NA 1MBMA 1PQ7A 5A09A 3ATIA 1TX6A 4XBBA 1SGFA 1HAZB 1SG8B 1RIWB 2ZHWH 1NY22 4FOUC 4AORA 5A2MH 4K3JA 4X1SU 2A7JA 2W6JD 1GI0A 2QGRA 3PTNA 4WMDA 1QTFA 1QL9A 3RXFA 3T2NA 1L1NA 3RLYH 3A82A 1GG6C 3KYGA 3ENSB 3S0NA 1TGSZ 1A0LA 1GHZA 2P8OC 4A1TA 8LPRA 1MCVA 2BZAA 2BY7X 2GMTB 2P3FH 4D76A 2KAIA 1TOCB 5HMAA 2K1QA 4VGCB 4E7NA 2W5EA 3VB6A 1TMUH 1FQ3A 3F9EA 4E7RG 1GI7B 1HB0B 2PLXA 2G51A 1G3DA 1H8ED 2KR7A 3D65E 3EA9A 1V2NT 2QXGA 1N1LA 4Y7BA 1LMWB 1O2ZA 1PPGE 2ZHDA 4WJG2 5GIBA 4CH8B 1MKXH 1TONA 5KGOA 1HBTH 3SU1A 1G3EA 1LQEA 3VXFH 2BLOA 3SNDA 2GTBA 1K1MA 4OS7A 3GY7A 1FY8E 1FX0B 2B5TB 1FZZA 2BQ7B 3T25A 1ZJDA 3QK1A 2XBXA 4Y0ZE 2AYWA 2VIDA 5TCCA 2VWNA 4JMYA 1KLIH 2VIVA 1O30A 1NESE 3CS0A 1C1PA 4R0IA 3PV2A 2BXUH 4F49A 1FY4A 1W14U 1DICA 1ZLRA 3OEHD 1PPCE 4FUCA 1TQ0B 4HZHA 2EA3A 3MWIU 3F2FA 2BY8X 1EPTA 1V2KT 1GI5A 2W3KA 2XC5A 2IOTA 1SQOA 3ZZDA 2F9OA 2PSYA 3VXEH 4H6TA 3LJOA 1NU7B 1C5PA 3GCTG 5FXLA 3VGCC 2OQ5A 1C2MA 2OBOA 3QUMP 1BQYA 5FPYA 2OC0A 1J16A 1XKAC 2FOEA 1RD3B 1FAXA 1NFXA 2ANMH 1O3PB 4AGKA 2GDEH 1C2HA 3P8GA 3BSQA 3TJUA 3NWUA 4CRBA 2FOFA 5C20A 5BRRE 1AUJA 1P2QA 5LPFA 3KQDA 4FUFA 2JH5D 1O2MA 3PMAB 2ZQ2A 2BDHA 2CXVA 3UQOA 2OLGA 3MNBA 1OOKB 1O5GH 3ATLA 1GJ7B 2FX6A 1GMDF 1Y3VA 4Q63A 2VINA 1WQSA 3MMGA 3PTBA 5IDKA 2OC1A 1XX9A 1O2PA 4B75A 4NIWA 1HFDA 4XE4A 1MKXK 3DSPA 4FUHA 3P8NA 1MCTA 2J34A 4UFFH 4NWLA 3RXDA 5LGOA 2GZ7A 4X0WU 2ZQ1A 3NRLA 1GL0E 3ESTA 1YLNA 1SMFE 3QN7A 3V7TA 2ALVA 3EE0B 2A1DB 5DG6A 3SI4H 1E34B 1XUFA 1SBWA 4K5ZA 3ITIA 1GHAF 3KQBA 2ZU1A 1C5UA 4GUXA 3SV8A 4B76A 5I25A 4AB9A 2BX4A 2C8ZB 1V2RT 1DLEA 3RXOA 1TB6H 2J98B 2D1JA 1ABIH 2ZHEH 1C5RA 2JETC 1FY3A 3FO8D 4YOJA 2C8WB 2QN5T 5HXFA 2PKAB 3U69H 1FAKH 4DG4A 1C5YB 1AVWA 1AB9C 8KME2 2Z9LA 1P3CA 3PB1E 5JB9S 1TWXB 1C4V2 2BVXH 1GBBA 1KLJH 4ZKRU 3GISB 2JH6D 2V6NA 4Y79A 1C1QA 1UO6A 1G2MA 2FXRA 1QRZA 4A92A 1ELEE 3FZZA 1YWUA 1TPSA 4U2WA 4X1NU 2Y81A 2XOKD 5A0AE 3A86A 2P93A 1O2KA 5E2OA 1TRYA 1C2IA 1PYTC 2QE7D 4DOQA 4YM9A 3LGTA 1EOJA 4KGAA 1ZRBA 3AK5A 2GVFA 1E36B 1MTVA 3K2UA 3ODFA 3RXRA 2ANKH 1CHOF 1QNJA 1MD7A 1AVXA 1SQAA 1ZTJA 4GAWA 5JDUB 4XOJA 1P05A 5AHGH 4NWKA 3SQHE 1TX7A 1BMAA 2A2QH 3HATH 5EXNA 1ZJKA 1K1LA 1L2EA 3K65B 2VH0A 3UB0A 3EYDA 1BJUA 4UE7H 2BYAX 2FOGA 1E35B 2AMQA 1QQ4A 4WY3A 1T4UH 1GJ4H 3KHVA 4BTIB 2R2WU 1O3CA 1KDQA 1O3LA 4XSKU 3UQVA 2RA0A 2BDGA 1Z8JB 2RCEA 2SGDE 1BMLA 3BTQE 3RXMA 1Y3WA 3A8DA 1BJVA 4DIHH 3NKKA 5GXPA 4YESB 2LP6A 1P01A 4AN7A 1N8OB 1OSSA 3ZZ7A 1HLTH 5EJLA 2QF5A 2J5UA 2PWXA 1H9HE 1AO5A 5CDFE 1WUNH 3LH3A 1DPOA 2BD4A 5FPTA 4INKA 1ARBA 1NRNH 2O8LA 1SR5C 5FL7D 5EPNA 1A4WH 2Y6TA 1A5HA 1YY3A 2FOCA 3FP6E 1HAIH 3IITA 4J1YA 1S6LA 1NRQH 3LGUA 1L1JA 1SFIA 4IS5A 1T32A 1A5IA 1AE5A 3VG8A 4SGAE 1P2KA 3TGJE 1LHGH 1UTQA 1T31A 1AVGH 1O33A 1SQRA 1GCDA 3SYJA 1GL1A 1DM4B 5T6FA 3NXPA 5JYIA 3LGVA 5F8XA 2VU8E 4I7YH 1HNEE 1MH0A 1Y5UT 3A7WA 3SHAH 4KELA 1V3XA 1S83A 3M37A 1AU8A 1HDTH 4NCYA 4NG9H 1K2I1 3RC5A 3D62A 1AFQB 2GV6A 3KQEA 3SOSA 1YF4A 1XUKA 4UD9H 1HIAA 1EJMA 1DY8A 1GDQA 2NWNA 2V3HH 4ZMAH 4LXBH 1GPZA 1IQHA 4ZCNA 2WZQA 1FI8A 4B6FA 2H1UA 3V3MA 5E0JA 4DT7B 3LC3A 3M5OA 1ZPBA 2UWOA 1D4PB 2G4UA 2VVVA 4IN1A 1C5QA 4E05H 2IPHA 4CRFA 1SLXB 1AMHA 3Q76A 4KTUA 2Z9GA 2YMSC 3QGNB 1HJAC 4ABIA 1ZTKA 2XTTB 1EJAA 3Q3XA 2EI8A 1SLVB 1DE7H 1BCUH 1LKBA 1L0ZA 3B23B 5T6GA 2WUBA 4M7GA 5K0HA 2QY0B 4B2AA 2PHBA 2F4LA 1LQDB 5F8ZA 3SNAA 1MTWA 1SGYE 2BY9X 1QQUA 1NBMD 1HXFH 2ZU4A 1GMCF 1F5LA 1ZR0A 2R3YA 2Q1JA 2C8YB 3MU5A 1NRRH 4JK5A 2XWBI 3KL6A 2JH0D 4IW4E 4RT1A 3PRDA 2J98A 1GGDB 5JBTA 2H9HA 3UPEA 3U8TH 4ASHA 2RFKC 1K9OE 2OQUA 4MTBA 2QAAA 1H1BA 2RA3A 4DGJA 4HTCH 2J97A 5FHTA 4ZXXH 2FTMA 5GJ4B 1COWD 1MU8B 5EG4A 7KMEH 1D3DB 1LDTT 5E0GA 3K6YA 4MPUA 3GY5A 1P12E 1GMDG 4NIYA 1HRTH 4I86A 2Y5GA 1LHCH 5FAHA 2XNIA 1O35A 3GOVB 3TITA 1PYTD 3MYWA 1D6WA 1MD8A 2BB4A 5J4SA 2C8XB 4FUIA 3UFAA 2W3IA 4Y8ZA 4Y71A 2ZDAH 2A4OA 4TY6A 3F9GA 2BLQA 4ABDA 4Y0YE 5EJ1A 2XBVA 7GCHF 5EQRA 9ESTA 5IK2D 2NU1E 4UFGH 1J9CH 4ISLA 3GCTF 3ZVGA 1NM6A 4Y6DA 1P9UA 4K8YA 1S82A 3C1KA 3TPIZ 1LPZB 3TH3H 3EA8A 1XVMA 1C4Y2 2DE9A 4I31A 5FCKA 2Y80A 4AFQA 3RXAA 3SU4A 4TPYA 1SGEE 5CHAC 4WWYA 4ZKSU 3SJ8A 1DANH 1O3FA 2I6QA 3QZQA 3ATMA 1TPPA 2QF0A 1GI4A 2B0FA 2FDAA 1L1GA 1GBDA 1TE0A 1BA8B 2AGGX 1EKBB 2XRCA 5GPIB 4BOHA 3B9FH 1ZZZA 4CHAB 4DY7B 1RIWC 3A83A 5A8YA 3CNRA 3AAUA 3SJ9A 1DWBH 2NU4E 2GV7A 3BTWE 2ZZUH 5C3NA 2HPPH 3M5NA 1B7XB 4YZUA 2HGTH 4BXWA 2IPQX 1TMTH 1QA0A 2PKSB 1UTNA 2ZC9H 1UVUH 2ZIQH 1MAXA 1BMMH 4CREA 1TPOA 1KYNA 1KXEA 3Q3KA 3EE7A 1QB9A 4K8BA 3SU2A 2GMTC 1UJ1A 3LGWA 4WVPE 1SGTA 2G8TA 3SU0A 1ABJH 2UUYA 1O5EH 4ACAA 1QBNA 2TRMA 3GY2A 3LDXH 3KN2A 4VGCC 1F7ZA 3RM2H 2O9QA 1K0HA 1Z6JH 2H5DA 3M36A 1BTUA 3PWBA 1CHOG 1UCYE 2GDDA 4GPGA 4AYVB 1KMHB 2CJIA 1JIRA 3SU6A 2D26C 4BTUB 2SGQE 1GBCA 2ZO3H 2XCNA 2ASUB 3KCGH 2TGPZ 1F0RA 2KX4A 3ZYEA 1C2JA 4O9VA 1P02A 2Y7XA 2ZPRA 1AHTH 3GYMA 3RC6A 1O3JA 2ZI2H 2R0KA 3TK9A 3R3GB 4FETA 4JZIA 2CK3D 3KNXA 2SGAA 1CBWB 1YPLH 2KCAA 3E16B 1A0JA 3R0FA 1P06A 1SB1H 1YPMH 1O2HA 4I8KA 2F3CE 3RXGA 1W11U 1L4ZA 2J9NA 2A45B 1Z6EA 3SO3A 2ZG0H 2VNTA 5EODA 1ETSH 1GJBB 1SGIB 2KCOA 3JZ2B 3PV5A 4JYVH 4QT8C 3V13A 1QA7A 1C1TA 1QRXA 4MG3A 5E8EH 1WTHD 2JIZD 3ZV9A 4OS6A 4JZFH 1EX3A 1VJ9U 3BTEE 4WF8A 3UNSA 2PP6A 1AUTC 2G81E 2BDAA 2RG3A 4D9QA 2Q6FA 4RKOB 3E6PH 4AG1A 1OHHD 1XMNB 2AH4X 1ZGVA 2PW8H 1O39A 1IQIA 4JZEH 2OP9A 2XXLA 4FU8A 1YM0A 3AAVA 1BTHH 1YPEH 3P6ZB 1C2EA 2THFB 1QRWA 1WYKA 1TGTA 2EQNA 4BXSA 4FUJA 1O2SA 3TGKE 1TQ7B 1K1IA 1MKWH 4WXIA 2Z9JA 1FXYA 1VZQH 3OFND 2Z7FE 1SSXA 2Z3DA 1W10U 4I8HA 1LHFH 2BTCE 4MDSA 4MNVA 2ZDKA 4X2VA 3SNCA 1EZQA 4NSYA 2FS9A 3VB7A 4CBOA 1S81A 1OP0A 1OXGA 2SNVA 1TPAE 1YLDA 4HI3A 3H7TA 3LH1A 5FX5A 1AKSA 1CA0C 1FY1A 1KXCA 4YXWD 4MNYA 3RXBA 4INLA 5L2ZH 3A7VA 3I78A 4ZXYH 3ZZ9A 5DO4H 1O36A 2ZTYA 1NC6A 1DITH 1RS0A 1KXFA 4THNH 1EFRD 2FWWA 1P2MA 1J14A 3Q77A 3T26A 1FPCH 1YPKH 5IYTA 1ZMNA 1TFXA 1JRSA 2M5TA 1XVOA 1KTTB 1MAYA 2OXSA 2P94A 3UUZA 1O2OA 1UCYH 2OINA 4Q2KA 1BDAA 4FUGA 4NA9H 4OGYA 4AFSA 2QV1A 3BTGE 2AHME 1QB6A 4ABHA 3U8RH 3P8FA 2DUCA 2ZCLP 3QWCH 4GHQA 2KCYA 4FUDA 2VB0A 3RXJA 2Y7ZA 4TSFD 3MNXA 1YC0A 1XUGA 3FZDA 4NZQA 1KXDA 2O8TA 1GMCG 1A7SA 2AGEX 5GCHF 3TLOA 4ZH8A 2BY6X 1MTSA 2HALA 1SVPA 2V35A 4D7FA 3F9HA 5C1XA 4HGCA 1V2QT 2A0QB 1ZHPA 1THSH 2SFAA 5DP8A 1SGQE 1C5TA 1P10A 4ISHH 1OPHB 1AFEH 2M2AA 1MKWK 1N6YA 1O37A 1P9SA 3MO6A 4ZHLU 1QCPA 1O3IA 4B71A 1LVMA 3V0XA 1O2RA 4X1PU 1ELTA 4O3UA 3RXIA 1OS8A 4AX9H 4P00A 1LVBA 5EW2H 2GJGA 2FESH 1F0TA 3OYPA 3E91A 3O8BA 5DP6A 3LONA 2AIQA 1E1QD 1ELVA 1XXDA 2XCFA 3M7UA 5DP3A 4ISOA 3T62A 1G3BA 4FU7A 2PGBB 7GCHG 1W8BH 5EXLA 3M7TA 4ZUHA 1WXRA 2QCYA 2R2MB 4Z1MD 1ZHMA 5C0TA 1FUJA 1HAYB 2Z9IA 1OP8A 5FBIA 1K28D 1E0FD 2FS8A 2AFQB 2CHAB 4UFDH 1EATA 1F0SA 3BIUH 2NU0E 4K1TA 3M3VA 1O5CB 1N8OC 3U28C 1RXPA 5A8ZA 1O5BB 2CMYA 3JZ1B 3DFJA 3K6ZA 4MPVA 2TIOA 2W6ID 3PO1B 4X6MA 4A7IB 3LPRA 4WMFA 2TGTA 2H9EH 1Y3UA 2XW9A 1GI1A 4MLFB 3L3TA 1MTUA 3HK6B 2ZFQH 1IHSH 1GBKA 4MNXA 2AEIH 1O3NA 2BY5X 1XUHA 4Y7AA 1HJ8A 1Y59T 4H4FA 1CHGA 3BF6H 1V2VT 3AW1A 2IN2A 1A1RA 1Y3XA 2P95A 1Z7KA 3BEFB 1CA0B 3DSOA 5HGGA 3WWBA 3ZVEA 3A7XA 2Z6BD 3SZNA 3GY4A 3SJOA 1AY6H 3QLPH 4A6LA 2HLDD 5C17A 1SGPE 1CT4E 1V2UT 1KXAA 1C5WB 3KQCA 1HUTH 1JXPA 1SGCA 2STAE 2UUKB 3E3TA 3NCLA 1P0SH 1O38A 3ZVCA 1J8AA 1AFQC 5HIYA 1TAWA 1P09A 3UREA 1B0EA 1EB2A 1PQ8A 1IQLA 3SUGA 2GGVB 2ZFRH 2GD4B 4B74A 2SGEE 3T28A 2G55A 4UONA 1GBEA 3TJOA 1LPGB 1Y5AT 1Y5BT 2ANWA 1S85A 2VWLA 5GNDA 4F55A 1LO6A 2QIQA 4ABJA 2A7CA 4MQAA 1CT0E 1A2CH 1MZDA 4X1QU 1A61H 2G5NA 4ABEA 3PMHB 2BMGB 1BRAA 4AB8A 2Q6GA 3STJA 3M7QA 3KF2A 1AWHB 2V0BA 1D3QB 5EW1H 3SU5A 5LH8A 5DKMA 1KTSB 3FAOA 4RSPA 2VWOA 4DT4A 2AMDA 5C1YA 1C5OH 1T8LA 1SHYA 1C2DA 2J38A 4LZ4B 1H8DH 4ISNA 1JWTA 2P16A 2QA9E 1GVZA 2OCVB 3F3BA 4BTTB 5DP9A 3IG6B 1NRSH 2PV9B 3EBNA 4XFQA 2C4FH 1FJSA 1XM1A 1ZOMA 1VCQA 6GCHF 1GGDC 1NS3A 1O5FH 2R0LA 5SGAE 1O0DH 1O3AA 3DUXH 2ZDLA 1FMGA 2ULLA 4F48B 1GHVH 3AASA 1O5AB 5EU8A 2LPRA 2GKVE 2BVRH 1NU9A 3BTHE 1GJ9B 1WOFA 2PTCE 3M3SA 2J95A 1VITF 1ELDE 1W3CA 1GBMA 2BD5A 2PUXB 3BN9A 4XDEA 1ZSJA 3RXSA 1HXEH 1SGDE 1IQKA 1IQNA 3BTTE 3KIDU 3SZEA 3FKSD 1SLWB 1GVLA 2BX3A 3SNEA 4ABBA 1DX5M 1MMJN 4JZDH 3RXTA 5HM9A 3N99A 1ZPZA 2OC7A 1HV7A 1IOEA 1UTLM 1BRUP 3SN8A 2QXJA 1TNIA 1HPGA 3GICB 4FUEA 2WPHS 1GJ6A 1ELBA 1H9IE 4ASUD 1DT2A 3O8CA 1G9IE 1DXWA 1M9UA 3RDZA 3TK5A 2ZGHA 4TWWA 1EAIA 1J17T 1V2ST 3E0PB 4A1VA 1LCYA 1EP6A 1HAGE 4O97A 3ATWA 3ZYDA 1CE5A 4X8VH 5ETXA 3N7EA 1FDPA 1E37B 2LELA 1O2UA 3A8CA 4OM9A 2VVUA 4OS2A 4ZAEA 3EAJA 3BTDE 3NPSA 2EY4C 4CHAC 1QY6A 2F83A 3HKJB 4IBLH 1ETTH 1OWEA 2TGAA 2ZGBH 1T8OA 2ILNA 5GCHG 1EAXA 2PKSC 3RU4E 3SGQE 3M61U 3AW0A 3VB3A 1HAHH 3OSYA 3OAAD 4X2WA 2BHGA 5KEDA 3A80A 1ZYOA 5JBBS 1JOUB 2G4TA 3STIA 2A4RA 1O2WA 2FIRH 4CRGA 5CMXH 3PV4A 1W7GH 4ESTE 3A7YA 3ZIAD 5C94A 3ATKA 1V2WT 2BQWB 2FX4A 1MABB 3I77A 3S9AA 1NFYA 4WH6A 3LT3A 2HWLB 2A5IA 1THRH 3ELAH 3RMNH 4RKJB 2JJ2D 2A2XH 5EIYA 1EZUC 3DD2H 3QGJA 3EQ0H 5T6DA 2BLWA 2VGCB 1DSTA 4OS1A 4X2XA 3UWJH 3Q3YA 5TCAA 4U01A 1G36A 1FONA 1KXBA 1T8MA 1K1PA 1BRCE 2ZCHP 1W12U 1AZZA 1CBWC 2Z94A 4U32A 1O2TA 3TH4H 1O2YA 2ZDMA 4AOQA 1XUIA 4YOGA 1B5GH 1V2MT 1TNKA 1VR1H 2ZECA 4Y10E 1TIOA 1OYQA 3VB5A 1PQAA 1Q3XA 2TBSA 3TGIE 5J4QA 1WAYB 2PKAA 4DIIH 2ZU5A 1NFWA 1GWAA 2PSXA 2VIOA 1RRKA 1F5KU 1UHBB 4O03A 3HGPA 4ISIH 4TPIZ 4O3TA 2ZGCA 3A89A 1ANEA 3Q00A 2YNBA 2ZKSA 3RUOA 1A46H 4JYUH 3WWFA 1GBFA 5JPMH 5JBCS 2I6SA 1DOJA 3D49H 1FN6A 1UK4A 1LHEH 1GVKB 2G5VA 3SV7A 1GI2A 2WPIS 1C1SA 5EQSA 3A84A 1C1MA 3PRBA 1P3EA 1W0ZU 3LGYA 4INHA 3SUDA 1V2LT 1ARCA 4YO9A 1MQ6A 3UWIA 1P04A 1ZGIA 4XD7D 2ZFSA 1C1NA 4ZHAA 2FI3E 3O8DA 3MH4A 1MTNB 2LIZA 4CH2B 2ZDNA 3RXUA 3LGIA 5CE1A 1TGNA 5FCRA 1MUEB 1C5VA 1K1JA 1O3BA 1FN8A 4IGDA 1CU1A 1FLEE 2KAIB 3RC4A 7LPRA 5EOKA 1G37A 5CHBA 4XBDA 1TNJA 2CGAA 3LOXA 1P2NA 3HPTB 5B6LA 4LZ1H 3OEED 4D7GA 1AZ8A 2WV5A 3K9XB 5EGMA 5AF9H 1RTFB 8GCHF 5A0BA 1SOZA 2Z3CA 2ZFPH 4I8JA 1EUFA 3ZZAA 3IWMA 1VCWA 4YLQH 1ELAA 1PPHE 1W0JD 2PGQB 2C93B 1WSSH 1D3TB 1BTXA 4X6NA 1UVSH 3ZZ4A 1BIOA 3LC5A 4FVDA 2B8OH 1GHXH 2OK5A 3GY6A 3TNTA 1GHBF 3E8LA 2FPZA 3W95A 2JKHA 1T4VH 1GBHA 3SUFA 3U98H 5FX6A 1TALA 2OBQA 3F9FA 5T3HA 3QTOH 2G52A 2FMJA 3OY6U 1BUIA 1IAUA 4JYTA 1C1UH 1EPTB 5AVDA 1AIXH 4E06H 1UK3A 4ZKOU 1V2OT 6GCHG 2HRVA 1ZHRA 1MZAA 1C2KA 1HAVB 2UWPA 1VGCB 3DT0H 5HM2A 2J92A 3V12A 1UTJA 3LJJA 3UOPA 4UEHH 1O2NA 3RMOH 5EPYA 3KGPA 4AYYB 3CENA 2BXTH 1VITG 4BAQB 3MQKC 1MQ5A 2BDYA 4LK4A 4FXGH 2RDLA 2FP7B 1ANCA 4KTCA 3TNSA 4YT6H 3TU7H 3DSGA 1UTMA 2L74A 3ODDA 1K1NA 3RXPA 5GWZA 1QZ8A 2KFWA 4H6SB 4NGAH 1C2FA 2J4IA 3U1JB 2JJ1D 1YYY1 3GCHB 2YMSD 2BD8A 6LPRA 5C5OA 3FVFB 4M9FA 2CHAC 3C27B 2WUCA 5F03A 1O34A 5F53A 2ZNKH 1V2JT 4IC6A 1Z8RA 5ABWA 1QJ1B 1SKYE 3QO6A 5G4BA 1EASA 3PO1C 1DLKB 3MNSA 1Z1JA 3RM0H 1BITA 1GCTB 1PQ5A 3ZVFA 4TY7A 3GYLB 4DVAU 4AGJA 2D2DA 5K7RA 4K1SA 2AGIX 4Z6AH 1EB1H 2WINI 2A32A 4I8LA 1TGCA 1LVOA 3CP7A 1H9LB 4Q7YA 2VIQA 6CHAB 4AC9A 2VIPA 2QC2A 1VCPA 3BEUA 3P8OA 4F4OC 1HAPH 4LOYH 2FYRA 3FFGA 1BTZA 2D8WA 4HG6A 3SV9A 1YPJH 2V7QD 3A87A 4U30A 5L30H 1C5ZB 2WSSD 3TIUA 3WW7A 4ABFA 2BD3A 1O31A 2WPDD 7ESTE 5LPEA 3UTUH 1ZMJA 1S6FA 2F9NA 3SNBA 3MH6A 3ZVBA 1WV7H 2V3OH 3SORA 4IMQA 2ZTXA 1QIXB 4XRNA 4CRCA 2ODQA 2WPLS 1WBGB 2AIPA 2UUFB 3SW2B 4MPWA 5HYOA 2W7UA 1TA6A 1CGIE 2XWAA 2FM2A 3OY5U 4OGXA 1TBQH 3RXHA 1W2KH 3EA7A 4I32A 1THPB 2KZ4A 4X2YA 3FANA 2GZ9A 3S7HB 1NFUA 2STBE 2B9LA 3ZZ6A 1E79D 3SHCH 4K2YA 1ETRH 3GS9A 1SGFG 1AI8H 1INCA 5DP5A 1Z8IB 5DSFA 2BD7A 1S0RA 5H4IB 1P57B 2O8WA 1O2IA 5HIZA 1SLUB 1XKBC 1UVTH 4X6PA 2VH6A 1JBUH 1KDQB 3GCOA 5A8XA 1DWEH 2IJD1 1SGNE 1C1WH 2FI4E 2YOLA 2BOKA 1S0QA 1D9IA 1WCZA 4ZKNU 1ANDA 3GDSA 3CS7A 2P3UB 3F0OA 1W13U 2DE8A 3LIWA 1QL7A 2ALPA 1O2VA 2HOBA 3OTPA 3MI4A 3MU8A 2EC9H 3ZVDA 1C5MD 4ZHMU 4H42U 2FEQH 3OX7U 1GBTA 1YGCH 3O8RA 1LPKB 2WPJS 1G2LA 3MTYA 3B8JA 3PROA 3FP8E 1ID5H 4A1XA 2JDID 3RXVA 1O3KA 5BPEA 1MU6B 1ZRKA 1LHDH 2OTVA 4GHTA 1EAWA 1SQTA 1C1VH 1O2LA 1NZQH 2ZGXH 3OTJE 4BAOB 1UCYK 3BIVH 4DW2U 2EEKA 3L33A 3T5FH 1GI8B 1KY9A 3BG4B 4WXVA 1V6DA 1GJCB 1DS2E 1HAVA 1XUJA 3P17H
chains in the Genus database with same CATH topology
2WYGA 3HGNA 2A4QA 3UR6A 4UFEH 1G3CA 1SGRE 5DP7A 3MH7A 1P03A 1NTPA 4B1TA 2HVXA 2ODYB 3TK6A 2BOHB 1HIAB 2LNCA 4ABAA 8GCHG 3BV9B 2ZA5A 3NK8A 5LPRA 1O32A 3GDVA 1Z71A 5JB8S 2VVCA 2IJOB 1A5GH 1OX1A 2ANYA 3OU0A 2HPQH 2A31A 2FZZA 3RXCA 2FTLE 1A3EH 1F5RA 1QJ6B 2SNWA 3SGAE 2FOBA 5E2PA 1O5DH 2ZEBA 1GHBG 1TRNA 1YP9A 2ZFFH 2W7SA 1DDJA 8ESTE 1N6XA 2A7HA 2GCTB 3A8AA 1QR3E 1C2LA 1JMOH 1NROH 3SU3A 4IC5A 2AERH 2NU3E 1E38B 3SUEA 2SGPE 4XBCA 4K60A 4CR5A 1W0YH 5DK1A 1ZTLA 2QXHA 4YLUA 2H5CA 3M3TA 4AFZA 2BLVA 3E0NB 2EI6A 2R9PA 1OWHA 1GG6B 1FPHH 1EZSC 3PLBA 2PTNA 2H9TH 4JK6A 1TYNA 3MO9A 2P8OB 3A7ZA 5DJ7A 1Q2WA 1UVPA 3KEEA 1TA2A 1GMHF 4CRAA 4I33A 1Z1IA 2BDBA 3EDXB 3RXLA 3MOCA 2VGCC 1UMAH 1TNLA 1V2TT 3MHWU 4GSOA 1C5NH 3VEQB 1YKTA 3RXQA 3PYHA 4Y8YA 2BDCA 3SQEE 3AVZA 5FPSA 3RU4T 1G30B 2Z9KA 1IQJA 3M5MA 4Q7XA 3A81A 4MNWA 1ESTA 3VFEA 5C1UA 3E90B 1C9TA 2ZHQH 1GBIA 1X7AC 1YPHC 3S9BA 1UVOA 5AFYH 1BBRE 1CGJE 3SJIA 3UNRA 1UK2A 3VB4A 1NT1A 4NFFA 3PMJA 1BOQA 1ELFA 1ACBE 1S5SA 1DWCH 3SBKA 2ZCKP 1C5XB 1U6QA 3SV2H 2QF3A 1GBLA 3PLKA 3ZZ8A 1AE8H 3VPKA 1W7XH 5EQQA 1TLDA 1GJ8B 5PTPA 2FOMB 1IQFA 3SJKA 3RP2A 1EZXC 4TYDA 1QURH 1RTLA 2C3SA 2BDIA 1DUAA 4YOIA 3VGCB 4D8NA 1Y3YA 6ESTA 1T7CA 3W94A 4AFUA 1AQ7A 1PJPA 3URCA 3U1IB 4NSVA 2Q6DA 2UWLA 1C9PA 4MVNA 4SGBE 3ZV8A 3RMMH 1GI9B 2GP9B 1PPBH 1PFXC 1MTNC 2ZGJA 2F9UA 3PWCA 4KKDA 1FNIA 2A4GA 1HYLA 1SOTA 2ZPQA 3ZVAA 1DVAH 2QYIA 1Z8GA 2CF8H 1CVWH 3PMBB 5A0CA 3F68H 1QBOA 2BQ6B 3S69A 3UIRA 3GY3A 1CQQA 2GT7A 4CBNA 3P95A 1Q31A 3MFJA 1GJ5H 1YPHE 1ESAA 3BEIB 2O8UA 2BZ6H 4IN2A 2A5KA 1ESBA 1TABE 2FLBH 1C5SA 2BVSH 3SGBE 1EQ9A 1TBRH 3S7KB 2PR3A 3HK3B 1OWDA 2GCHF 1DSUA 2B7DH 1RFNA 2AS9A 2PFEA 1RJXB 1GJDB 4X1RU 4WH8A 1XXFA 4KTSA 3MU0A 3U8OH 1TMBH 1A3BH 4X6OA 3SI3H 2H6MA 1NPMA 1QGFA 1YPGH 3WY8A 4GCHF 4OS4A 1DUEA 1UTOA 3MNCA 2TGDA 1FV9A 3F1SB 3L6PA 4RN6A 1TRMA 5DPAA 2P59A 4ABGA 2JETB 1AWFH 1EPTC 1ELGA 1JIMA 3A7TA 3H7OA 1FIWA 3M5LA 2R3UA 1CSOE 1P8VC 1K1OA 1ZMLA 4Y76A 1IHTH 3DFLA 5C5NA 1VGCC 1AB9B 1CGHA 1VITH 3GDUA 3ZZCA 2J94A 1TNGA 1TOMH 2ODPA 1ELCA 2XBWA 4PROA 3ZZ5A 1WQVH 2FO9A 1BBRH 2FI5E 3A8BA 1ANBA 3GCNA 1LKAA 1IQEA 1TGBA 3UR9A 3T27A 5GDSH 1C5LH 1B0FA 2ZTZA 3MH5A 5E0HA 2ZFTA 3PM3A 1F2SE 1QHRB 2WPMS 2H2ZA 2HNTC 3NUMA 5L6NH 1GBAA 1BTYA 1EXFA 2ESTE 1NN6A 4YTAA 1G32B 2BD2A 1O3GA 2CN0H 2VWMA 3GCHC 1DFPA 4TWYA 1HAXB 3NZIA 2FLRH 2OC8A 4CR9A 4AZ2B 2UUJB 4B73A 1BHXF 1WU1A 4DCDA 5FBEA 1YBWA 1AKSB 1EOLA 1HGTH 1H4WA 1UTKA 1LVYA 3T29A 4Q7ZA 4X8SH 5DP4A 1GI6A 2VIWA 1CO7E 1TBZH 1GHWH 1C4U2 1C2GA 2ZU3A 1NRPH 1ZSKA 1GCTC 3HKIB 1FY5A 3A88A 4Y8XA 3LU9B 1WTGH 4NZLA 9LPRA 2FOHA 1QJ7B 1BTWA 4NFEA 1H8IH 4K1EA 4X8TH 1GHYH 4FVBA 3MU1A 4B2CA 1KSNA 4FUBA 3TJVA 6CHAC 3RU4D 2ZP0H 1TX8A 3ZZBA 4Z0KA 3QDZB 1C1RA 5F8TA 2GT8A 4BAKB 1SHHB 1Y8TA 1CA8B 1LTOA 1O2JA 4NIXA 2HLCA 3G01A 1F0UA 3URDA 1FIZA 3U9AH 1BBRK 1EP5A 1BHXB 4HFPB 2VJ1A 3BTFE 1O2XA 3P70B 1HAOH 1SPJA 4J2YB 1SL3A 1OP2A 1GHAG 1ZPCA 2NU2E 2F9BH 3QZRA 2HNTE 1S84A 3DHKH 3PLPA 1BT7A 1GMHG 2XBYA 1OKXA 2XC4A 4BAMB 3DA9B 3RXEA 1SC8U 3BG8A 2Y5FA 1BRBE 1OWKA 1IQGA 4D9RA 3BTME 1EJNA 5EXMA 2XYAA 3FP7E 1JRTA 3QTVH 1QFKH 1YCPH 2HNTF 3ZZ3A 4YT7H 1P11E 5TJXA 2ZWLH 1O2QA 1BB0B 1UTPA 1A0HB 1P2OA 3E1XB 2WV4A 2BD9A 4Y11E 2WYJA 1ZSLA 4I8GA 2F9PA 1F92A 3I29A 3A85A 4OS5A 1EAUA 1YLCA 4ZROA 2G00A 3QX5H 1O2GH 1KLTA 1PPZA 2F9VA 2PUQH 1TNHA 4NIVA 2QXIA 4MPXA 4UDWH 3UY9A 1KIGH 1BTPA 3MO3A 3BTKE 1HJAB 4CRDA 1DXPA 1BZXE 3F6UH 1RTKA 1SFQB 4B2BA 2ZPSA 5ESBA 4K69A 2O8MA 3RXKA 1IQMA 1AN1E 4IMZA 1PPFE 3N7OA 4KP0A 4DURA 3RLWH 1QBVH 2F91A 2ZU2A 2OUAA 1J15A 2YNAA 4BANB 2XC0A 1YCPM 2ZHFH 3GY8A 1VJAU 5B6OA 4AG2A 1DWDH 1HJ9A 1O3DA 2GZ8A 3UOUA 4DJZB 5F6MA 2CV3A 1CT2E 2FODA 5C2ZA 4JCNA 1BMNH 3SV6A 1GDUA 1MBQA 4FU9A 4NA8A 1K21H 1PPEE 2Z3EA 2OD3B 2J2UA 2ZDVH 5AFZH 2Y82A 5L2YH 2FYQA 3EGKH 3S9CA 3LKWA 5I46H 3BG4C 1GI3A 2W26A 3MU4A 5DGJA 1L4DA 1SI5H 5C67A 1GDNA 1DY9A 1HCGA 1P2JA 1GJAB 1YCPK 4A5TS 2CF9H 1D6RA 1NO9H 3UNQA 1S6HA 1O3HA 1QB1A 3M35A 3D23A 1D3PB 1O3EA 1OWIA 2Y5HA 1K22H 3TH2H 1OWJA 2ZF0H 1O3OA 1AD8H 2C90B 3TJNA 2P3TB 4GVUA 2GX4A 2FOAA 4BAHB 1P2IA 4Q80A 1GBJA 3H5CB 2AMPA 2GCHG 2EI7A 4NA7A 4GLYA 3TVJB 1OYTH 2TPIZ 1ORFA 1AGJA 2A5AA 5JBAS 2WPKS 2BM2A 3P92A 5ESTE 1C1OA 4WMEA 2K7XA 4JZ1A 3RMLH 1QL8A 1V2PT 2SGFE 1UHBA 1RGQA 4R8TB 5CHAB 4X8UH 4GCHG 4BNRA 2GCTC 1O3MA 1T8NA 1MBMA 1PQ7A 5A09A 3ATIA 1TX6A 4XBBA 1SGFA 1HAZB 1SG8B 1RIWB 2ZHWH 1NY22 4AORA 5A2MH 4K3JA 4X1SU 2A7JA 1GI0A 2QGRA 3PTNA 4WMDA 1QTFA 1QL9A 3RXFA 3T2NA 1L1NA 3RLYH 3A82A 1GG6C 3ENSB 3S0NA 1TGSZ 1A0LA 1GHZA 2P8OC 4A1TA 8LPRA 1MCVA 2BZAA 2BY7X 2GMTB 2P3FH 4D76A 2KAIA 1TOCB 5HMAA 2K1QA 4VGCB 4E7NA 2W5EA 3VB6A 1TMUH 1FQ3A 3F9EA 4E7RG 1GI7B 1HB0B 2PLXA 2G51A 1G3DA 3D65E 3EA9A 1V2NT 2QXGA 1N1LA 4Y7BA 1LMWB 1O2ZA 1PPGE 2ZHDA 4WJG2 5GIBA 4CH8B 1MKXH 1TONA 1HBTH 3SU1A 1G3EA 1LQEA 3VXFH 2BLOA 3SNDA 2GTBA 1K1MA 4OS7A 3GY7A 1FY8E 2B5TB 1FZZA 2BQ7B 3T25A 1ZJDA 3QK1A 2XBXA 4Y0ZE 2AYWA 2VIDA 5TCCA 2VWNA 4JMYA 1KLIH 2VIVA 1O30A 1NESE 3CS0A 1C1PA 4R0IA 2BXUH 4F49A 1FY4A 1W14U 1DICA 1ZLRA 1PPCE 4FUCA 1TQ0B 4HZHA 2EA3A 3MWIU 2BY8X 1EPTA 1V2KT 1GI5A 2W3KA 2XC5A 2IOTA 1SQOA 3ZZDA 2F9OA 2PSYA 3VXEH 4H6TA 3LJOA 1NU7B 1C5PA 3GCTG 5FXLA 3VGCC 2OQ5A 1C2MA 2OBOA 3QUMP 1BQYA 5FPYA 2OC0A 1J16A 1XKAC 2FOEA 1RD3B 1FAXA 1NFXA 2ANMH 1O3PB 4AGKA 2GDEH 1C2HA 3P8GA 3BSQA 3TJUA 3NWUA 4CRBA 2FOFA 5C20A 5BRRE 1AUJA 1P2QA 5LPFA 3KQDA 4FUFA 2JH5D 1O2MA 3PMAB 2ZQ2A 2BDHA 2CXVA 3UQOA 2OLGA 3MNBA 1OOKB 1O5GH 3ATLA 1GJ7B 2FX6A 1GMDF 1Y3VA 2VINA 1WQSA 3MMGA 3PTBA 5IDKA 2OC1A 1XX9A 1O2PA 4B75A 4NIWA 1HFDA 4XE4A 1MKXK 4FUHA 3P8NA 1MCTA 2J34A 4UFFH 4NWLA 3RXDA 5LGOA 2GZ7A 4X0WU 2ZQ1A 1GL0E 3ESTA 1SMFE 3QN7A 3V7TA 2ALVA 3EE0B 2A1DB 5DG6A 3SI4H 1E34B 1XUFA 1SBWA 4K5ZA 3ITIA 1GHAF 3KQBA 2ZU1A 1C5UA 4GUXA 3SV8A 4B76A 5I25A 4AB9A 2BX4A 2C8ZB 1V2RT 1DLEA 3RXOA 1TB6H 2D1JA 1ABIH 2ZHEH 1C5RA 2JETC 1FY3A 4YOJA 2C8WB 2QN5T 5HXFA 2PKAB 3U69H 1FAKH 4DG4A 1C5YB 1AVWA 1AB9C 8KME2 2Z9LA 1P3CA 3PB1E 5JB9S 1TWXB 1C4V2 2BVXH 1GBBA 1KLJH 4ZKRU 3GISB 2JH6D 2V6NA 4Y79A 1C1QA 1UO6A 1G2MA 2FXRA 1QRZA 4A92A 1ELEE 3FZZA 1TPSA 4U2WA 4X1NU 2Y81A 5A0AE 3A86A 2P93A 1O2KA 5E2OA 1TRYA 1C2IA 1PYTC 4DOQA 4YM9A 3LGTA 1EOJA 4KGAA 1ZRBA 2GVFA 1E36B 1MTVA 3K2UA 3ODFA 3RXRA 2ANKH 1CHOF 1QNJA 1MD7A 1AVXA 1SQAA 1ZTJA 4GAWA 5JDUB 4XOJA 1P05A 5AHGH 4NWKA 3SQHE 1TX7A 1BMAA 2A2QH 3HATH 5EXNA 1ZJKA 1K1LA 1L2EA 3K65B 2VH0A 3EYDA 1BJUA 4UE7H 2BYAX 2FOGA 1E35B 2AMQA 1QQ4A 4WY3A 1T4UH 1GJ4H 3KHVA 4BTIB 2R2WU 1O3CA 1KDQA 1O3LA 4XSKU 3UQVA 2RA0A 2BDGA 1Z8JB 2RCEA 2SGDE 1BMLA 3BTQE 3RXMA 1Y3WA 3A8DA 1BJVA 4DIHH 3NKKA 5GXPA 4YESB 1P01A 4AN7A 1N8OB 1OSSA 3ZZ7A 1HLTH 2PWXA 1H9HE 1AO5A 1WUNH 3LH3A 1DPOA 2BD4A 5FPTA 4INKA 1ARBA 1NRNH 2O8LA 1SR5C 5EPNA 1A4WH 2Y6TA 1A5HA 2FOCA 3FP6E 1HAIH 3IITA 4J1YA 1NRQH 3LGUA 1L1JA 1SFIA 4IS5A 1T32A 1A5IA 1AE5A 4SGAE 1P2KA 3TGJE 1LHGH 1UTQA 1T31A 1AVGH 1O33A 1GCDA 1GL1A 1DM4B 5T6FA 3NXPA 5JYIA 3LGVA 5F8XA 2VU8E 4I7YH 1HNEE 1MH0A 1Y5UT 3A7WA 3SHAH 4KELA 1V3XA 1S83A 3M37A 1AU8A 1HDTH 4NCYA 4NG9H 1K2I1 3RC5A 3D62A 1AFQB 2GV6A 3KQEA 3SOSA 1YF4A 1XUKA 4UD9H 1HIAA 1EJMA 1DY8A 1GDQA 2NWNA 2V3HH 4ZMAH 4LXBH 1GPZA 1IQHA 1FI8A 2H1UA 3V3MA 5E0JA 4DT7B 3LC3A 3M5OA 1ZPBA 2UWOA 1D4PB 2G4UA 2VVVA 4IN1A 1C5QA 4E05H 2IPHA 4CRFA 1SLXB 1AMHA 3Q76A 4KTUA 2Z9GA 3QGNB 1HJAC 4ABIA 1ZTKA 2XTTB 1EJAA 3Q3XA 2EI8A 1SLVB 1DE7H 1BCUH 1LKBA 1L0ZA 3B23B 5T6GA 2WUBA 4M7GA 5K0HA 2QY0B 4B2AA 2PHBA 1LQDB 5F8ZA 3SNAA 1MTWA 1SGYE 2BY9X 1QQUA 1HXFH 2ZU4A 1GMCF 1F5LA 1ZR0A 2R3YA 2Q1JA 2C8YB 3MU5A 1NRRH 4JK5A 2XWBI 3KL6A 2JH0D 4IW4E 1GGDB 5JBTA 2H9HA 3UPEA 3U8TH 4ASHA 1K9OE 2OQUA 4MTBA 2QAAA 1H1BA 2RA3A 4DGJA 4HTCH 5FHTA 4ZXXH 2FTMA 5GJ4B 1MU8B 5EG4A 7KMEH 1D3DB 1LDTT 5E0GA 3K6YA 4MPUA 3GY5A 1P12E 1GMDG 4NIYA 1HRTH 2Y5GA 1LHCH 5FAHA 2XNIA 1O35A 3GOVB 3TITA 1PYTD 3MYWA 1D6WA 1MD8A 2BB4A 5J4SA 2C8XB 4FUIA 3UFAA