5C5NA

Structure of sars-3cl protease complex with a phenyl-beta-alanyl (r,s)-n-decalin type inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fused-ring structure of N-decalin as a novel scaffold for SARS 3CL protease inhibitors
rcsb
source organism Human sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
total genus 81
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 5c5nA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c5nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c5nA02
3E90B 4IMZA 1RD3B 2HNTF 1IQGA 3LGVA 1BIOA 1UCYK 3LU9B 4RKJB 4WMEA 4YT6H 1SGFG 3RXGA 4XFQA 4Y8YA 1C1MA 3LJOA 5TCCA 4ZKSU 1GGDC 1HAVB 4ABDA 3TH3H 2HLCA 4X6OA 5JB8S 2VVCA 2A1DB 4AYVB 1TMUH 4MLFB 1TBRH 1TIOA 2ALVA 5GWZA 1HIAB 1CHOF 1E38B 5JBTA 1C5LH 2PKAA 1J8AA 3SJKA 4HZHA 4E7RG 3T2NA 1AWHB 1P2IA 1TRMA 1EZQA 2V35A 3M7QA 4YOJA 4B75A 4E7NA 2ZDVH 3ATIA 1WQSA 3LGYA 1P57B 1XUFA 2EC9H 2FI4E 2ILNA 2P8OB 3DFLA 3OTJE 1LKBA 5DK1A 1V2WT 1THPB 2G4TA 4Q7XA 5FPTA 2J94A 3B9FH 3KNXA 1CT2E 2QYIA 4ZKOU 1MD7A 2JH5D 2OC1A 1UVUH 5EW1H 1S0QA 1T32A 2SGAA 1EKBB 2FEQH 1AMHA 4WY3A 1K1PA 1PJPA 1H9HE 1OOKB 1SQAA 4WVPE 4HFPB 1TGSZ 5K7RA 5GDSH 2QV1A 2A32A 1PQ8A 2AS9A 1H8DH 2NU1E 3QO6A 4K8BA 1QBNA 1RXPA 1XVOA 2J34A 5ABWA 1YCPH 1UJ1A 1FAXA 1LHFH 3SV2H 4F4OC 1LTOA 1RIWB 4E05H 2QGRA 1SGTA 1S0RA 1CVWH 6ESTA 2W7SA 3H5CB 1IQHA 1GCDA 3L33A 3PV4A 3U8RH 2Z3EA 5AVDA 1O3IA 3VFEA 2VIVA 1VCWA 8ESTE 1BHXF 4A92A 1GHVH 2XBYA 4X8SH 1QJ6B 4MNXA 4ABIA 3ZV8A 2UWLA 1EAIA 2J4IA 2ALPA 3VB4A 3SNBA 1JIRA 1EAUA 1ORFA 1V2TT 3ATLA 4IC5A 2GZ7A 2BD7A 1ETSH 3GDVA 5CHAB 2GZ8A 3SJ8A 2I6SA 2XC4A 1TGCA 4O3TA 1QA7A 3B8JA 2ODPA 1P09A 2H6MA 1MTNB 3O8RA 1LVMA 4FUFA 3EA7A 2Z3DA 2F9NA 2STAE 5F03A 1QR3E 2G8TA 4X8TH 3T62A 4CR9A 1Q31A 5HYOA 5DGJA 3U8TH 1A7SA 1Y8TA 1SFQB 3IITA 3M35A 2ZDAH 1GBAA 1VJAU 3SI3H 3LT3A 5AF9H 3VB3A 3F9FA 1O2KA 4A1XA 1HAZB 2PUQH 1K9OE 4Y6DA 5EODA 3A80A 3A7VA 2ZECA 4BTIB 2BX4A 1C2HA 1EOLA 1QBVH 3BTFE 2VIPA 1GI1A 4YTAA 2BVXH 1L4ZA 2W7UA 5H4IB 1YCPK 2OD3B 1HCGA 3URCA 1MMJN 3T27A 1QB1A 2QXGA 2PSYA 1GMCG 2C8XB 2ZC9H 1O2SA 2ZEBA 1FAKH 3ODDA 1HBTH 1C1OA 2ZQ2A 3QTOH 2WYJA 3A82A 1VJ9U 1OP2A 1FIWA 2WUCA 4OS2A 1EP6A 2SGFE 1XUKA 1GJ7B 1BT7A 2BLWA 1C1WH 4BXWA 2GCHF 3AW1A 3CENA 4D8NA 5GJ4B 1P9SA 4O03A 5DP4A 2WUBA 5T6GA 4K8YA 1T4UH 4FU7A 1ZR0A 3A7TA 4UE7H 4Q80A 3M61U 1KIGH 3W95A 1LPZB 2QY0B 4FUEA 1SSXA 2ZCLP 1O3HA 1GDNA 2GCTC 2Z9JA 1SLXB 3OY5U 4MNVA 5HXFA 1SPJA 1V2UT 3BEIB 4GCHG 1K1NA 1WYKA 3M5LA 4KTSA 3PLKA 1OWKA 1BJUA 3KHVA 2GKVE 3GCNA 1P10A 5A8ZA 3UOPA 2BVSH 2VB0A 1MKXK 1ZRKA 2PTCE 3RXMA 2AMQA 1J17T 3MMGA 1QL8A 2BDHA 4GHTA 2AGIX 2ZWLH 1G3BA 3CP7A 1NRRH 3ZZ5A 2FM2A 1W12U 5DJ7A 1MTSA 1MZDA 3QLPH 1J15A 1HIAA 5FCRA 1O2VA 1QNJA 3P8NA 1C5MD 4IC6A 1BMMH 4BAKB 1NZQH 3SUGA 1WV7H 2FI5E 3U8OH 1TMTH 1HAYB 4DJZB 3A8AA 5JYIA 3PROA 4K69A 3KQBA 3OX7U 1YKTA 3BSQA 1Y3VA 3SHAH 4YLUA 1GJDB 1E37B 4GPGA 1S6HA 3MHWU 1YF4A 3V12A 1EJAA 3NPSA 2EEKA 3MU4A 3SW2B 4A6LA 3EQ0H 2J95A 3RMOH 7ESTE 3MU5A 1G3EA 5EPNA 1J14A 1FQ3A 1LHDH 5C2ZA 3RXHA 3HGPA 1ZZZA 1F0UA 6LPRA 4OS1A 5L30H 4Q7ZA 3SU4A 3T26A 5A0BA 2CF9H 1O30A 1GVLA 1GJ6A 1NU9A 2TGAA 1VITF 1E34B 4YZUA 1Z8IB 1NPMA 4K2YA 5E8EH 1QBOA 3BF6H 4PROA 2R3YA 3QGNB 4ASHA 3SV6A 1SGPE 4X8VH 3UFAA 1EX3A 4U2WA 1A61H 1AD8H 2BD9A 2FPZA 3P17H 4BOHA 4YESB 5J4QA 5J4SA 1NRNH 2ZCKP 1KTTB 1O35A 4AX9H 2OINA 4YOGA 1V3XA 1SGYE 4FU9A 3SUFA 3DD2H 2H5CA 3E16B 1WAYB 1C9PA 1GDUA 1SGRE 1C5NH 1KXFA 1MCTA 4FUIA 4I8GA 2O8UA 2QIQA 2FOEA 2SGDE 5E0HA 3ENSB 3KGPA 4X6PA 3RXIA 4O3UA 5L2ZH 1GHBF 1NROH 3UQOA 3ZZ7A 4X1NU 1L1JA 2WV5A 2BXUH 2ZHDA 2OBQA 3MTYA 1WOFA 4DY7B 2BLOA 2G81E 5TCAA 1WTHD 3ZVFA 1A0HB 1GBBA 1ELCA 2BXTH 3GICB 3LOXA 1FY3A 1T8OA 1O31A 3FVFB 4LXBH 3GCTG 1MAYA 5A09A 4IBLH 4MNWA 1C1TA 1O3BA 1GG6B 1V2PT 4Y0ZE 5E0JA 1BQYA 1ABJH 1IQKA 4GAWA 3LGTA 3QGJA 1NTPA 4NFFA 2Z9KA 3VPKA 4MPVA 1BBRK 3GCOA 1S85A 4NG9H 3TLOA 1ANBA 4INKA 1NRQH 3PM3A 4FXGH 2ZU4A 1GHYH 1J9CH 2FOGA 2GV7A 1D6RA 1LDTT 2ZGCA 2BB4A 1TAWA 1YM0A 1K1IA 4FVDA 1RGQA 4K60A 4AORA 4ZH8A 1K22H 3S9AA 1C5QA 2XXLA 2GT8A 3ODFA 1CSOE 1A5HA 1GJCB 1PPHE 3RXJA 3F1SB 1V2OT 5LPFA 1BRCE 1HFDA 2A2QH 3BG8A 1SBWA 1GI6A 2ZDKA 2WPJS 1CBWB 2R3UA 1B5GH 1AFQB 1UTMA 1WU1A 5DP5A 1S82A 1GBIA 1ZJDA 1TPAE 1TMBH 5F6MA 4WWYA 1PPBH 4X2XA 2ZHQH 1P2MA 1F5RA 1O3NA 1E35B 1O2XA 3PLBA 1AUJA 4X2WA 2ZIQH 5BPEA 4NCYA 1KTSB 1SLWB 3BTME 4FUHA 1DSTA 3A89A 1TFXA 4X8UH 3V13A 1K2I1 2BYAX 2G4UA 1VITH 2WYGA 2BY8X 5GPIB 4DIHH 5A2MH 2ZO3H 2P3FH 1MTNC 3MNSA 2BQ6B 1Z6JH 2BOKA 1SQOA 1OSSA 1ESBA 3HKIB 3LONA 2F9OA 1AHTH 3RDZA 4I32A 1O36A 1X7AC 2UUKB 4FUGA 6GCHF 1C1UH 1O3DA 2AGGX 2BY6X 2F9BH 3TPIZ 1SGIB 3ZZBA 2HPPH 2BQ7B 3RXCA 1FZZA 3MWIU 3QK1A 1DUEA 1JOUB 3A8DA 1TPSA 2Y6TA 1GI0A 4KP0A 1GHXH 1BMAA 1A3BH 2SGPE 3PWCA 2H9EH 3CS7A 2TGPZ 2H9HA 4SGAE 1WBGB 4DG4A 4X2VA 1TRYA 2PW8H 1GHAF 4LZ1H 1XUJA 1DVAH 4U32A 2FS9A 3RM0H 2H2ZA 3A81A 1TONA 5EQRA 2PKSB 1DOJA 3GY3A 2PFEA 2Z9LA 1IHTH 2O8MA 3MI4A 1AKSB 1GWAA 3MNXA 1DICA 1NRSH 8LPRA 3SU0A 3SU6A 3ZV9A 1XKAC 2BOHB 5F8ZA 3M5OA 4R0IA 4ZHLU 1F5LA 4SGBE 3Q3YA 1DY9A 1G36A 2FLBH 3QWCH 2P59A 3U9AH 1AU8A 1HAOH 2B7DH 2IPHA 3HK3B 1QB9A 1P2QA 2G55A 1MAXA 4ZROA 1HJ8A 1S6FA 1UCYE 3GY6A 3PYHA 4TWYA 2PR3A 5BRRE 1TBQH 4Y8XA 1BRAA 4OS7A 1KXBA 5FXLA 1TNJA 1TNKA 2G51A 1ZPZA 2PUXB 4AB8A 1YPJH 1UTQA 2Q6FA 4BXSA 2H1UA 1VR1H 1EXFA 4FU8A 1ZOMA 2ESTE 1SOTA 4WH6A 1TE0A 3T29A 3V7TA 2ZP0H 2AIQA 1P2KA 2O9QA 1QHRB 4J1YA 4OS5A 4AYYB 3MH6A 2VWOA 1FIZA 2FS8A 2W3KA 1IQFA 1BTUA 4NZQA 4BTUB 1O2UA 2TPIZ 1YCPM 2W3IA 2ZU1A 3PWBA 3S9BA 3ZZ8A 3KIDU 2C8YB 2FTMA 1BB0B 2LIZA 3RU4D 1CA0C 4MTBA 1HV7A 2QAAA 2CGAA 1L2EA 4VGCB 1UTNA 2ZFTA 4AN7A 5EU8A 1NO9H 1GJAB 4ISIH 2FP7B 4NSVA 2Z9GA 2A5AA 1O0DH 3AAUA 3PMAB 3MH7A 1PYTC 1CHOG 1TX8A 3E1XB 3VB7A 1N6XA 4TPIZ 1DT2A 4BAHB 1Z8JB 2KAIB 2XWAA 3ATMA 2P16A 5EGMA 2VWLA 4NWLA 4UD9H 5T6FA 2CHAC 2FYQA 1O5EH 4DVAU 4Y8ZA 5DP8A 5TJXA 3NWUA 1QRWA 1C4U2 4HI3A 3JZ2B 3DT0H 1F5KU 3RXLA 2ZI2H 5B6OA 1C1VH 1TNHA 1AB9C 4AG2A 3MNCA 1O3GA 3Q76A 1Q3XA 3RXOA 3VEQB 4Z6AH 3M3VA 3TH2H 3MYWA 1MKWH 1QJ7B 1AE8H 1ESTA 1GI9B 2PLXA 1L1GA 3FAOA 4KTUA 1GMHG 5HM2A 3P8FA 2BLQA 1TBZH 1C9TA 3Q77A 1DE7H 1TPOA 4ISOA 1PQ5A 1B0FA 3I78A 4DT7B 3EA9A 1FDPA 1MUEB 2CHAB 1FJSA 5JPMH 2M5TA 2PSXA 4XSKU 1TX6A 1P12E 1V2MT 2ZGBH 4TYDA 1NC6A 4BAOB 1D3QB 1NESE 3SJIA 1IHSH 1YP9A 1TALA 2GVFA 2F3CE 1TNGA 2B9LA 1YBWA 1KYNA 4AG1A 1HYLA 3E0NB 1XX9A 3HATH 3SORA 4K1EA 1FPCH 1PFXC 1Z7KA 4A5TS 2WPLS 1GBCA 3DUXH 1GJ9B 3K6YA 5A0AE 2SFAA 1EAWA 1SG8B 1C5XB 2ZGJA 1FY5A 3GYLB 1THRH 3M5NA 4H6SB 1GBEA 3A7YA 1W0YH 1AQ7A 1LVOA 1DSUA 1TOCB 1V2RT 2J38A 3MU0A 1PQAA 1ZMJA 2BQWB 3UIRA 4BAQB 1O2PA 3ZZ4A 2BMGB 3KEEA 1C4Y2 1UTPA 3TH4H 1GBKA 1ZHRA 2B8OH 1DX5M 4XBCA 2ODQA 1NN6A 2HNTC 1JRTA 1KXDA 2PKAB 2XCNA 2FX4A 1O3CA 1A3EH 2GD4B 3C27B 2ZHWH 2VWMA 3EDXB 1A2CH 1HXEH 1NT1A 1BRUP 4AFQA 1C5YB 3SJOA 4ABGA 1ANCA 3GOVB 3A7ZA 2UWPA 2FMJA 2WPMS 1C2MA 2GT7A 2A5KA 1HJAC 1ZSKA 2BDYA 4ABAA 1W14U 3ZZ9A 1DUAA 4JZDH 1BA8B 3SNAA 2BM2A 3P6ZB 1P01A 1PPCE 3OSYA 4NIYA 3A88A 5EXNA 1PQ7A 2GZ9A 1G3DA 2TGDA 3SQEE 2XC5A 3M7UA 2QC2A 4DIIH 4GCHF 1G30B 4H4FA 4JZEH 3SOSA 1RRKA 4Y7AA 1KXCA 1QL7A 1ZHMA 3MNBA 1ZMLA 1FONA 1P3CA 2FODA 9ESTA 5C3NA 2A5IA 3TGIE 1K28D 3DA9B 3N7OA 1QFKH 1GJ8B 1HGTH 4E06H 1KXEA 1MU8B 2KAIA 1FXYA 2V6NA 2VINA 5EOKA 1SMFE 1HJAB 4YT7H 4O97A 2Z7FE 4NSYA 1Z6EA 5AHGH 1KLTA 5F8XA 2P8OC 3M37A 3SBKA 1LHEH 1YC0A 4YOIA 2BY7X 3UPEA 2Y5HA 4JZIA 1UCYH 1LPKB 1ZLRA 3FZZA 4NGAH 2BD2A 1EP5A 1A0LA 1KY9A 2FOFA 1EZXC 2QF3A 1KDQA 2HGTH 1LVBA 2PHBA 3RC4A 3OYPA 1BTXA 3LH3A 1LQEA 3RU4E 1O3JA 1P2JA 3QZQA 3BEUA 1T31A 1ELDE 1TX7A 3I77A 2YNBA 5GIBA 4ABFA 1QJ1B 1UHBB 1FMGA 5DP3A 5HM9A 1GI4A 3RLYH 1DXPA 1P2OA 3LGIA 4UFDH 4X1SU 1OX1A 3RLWH 2YNAA 1RIWC 1C2EA 2D1JA 3VXFH 2XRCA 1GMDG 4X6MA 2VIOA 1FV9A 1D3DB 1LKAA 1MBQA 1O2GH 1ETTH 1OYTH 2C3SA 3WY8A 1PPEE 3MO9A 3BTHE 1HAGE 1TB6H 4Y10E 1O5AB 3QUMP 3UNRA 1N1LA 3KQDA 3P8OA 4KGAA 4XOJA 2GV6A 4GHQA 1A0JA 1RTLA 1CO7E 4MPWA 5JB9S 1P11E 2EI6A 2VIDA 3JZ1B 1GHWH 3E0PB 4AGJA 5CHAC 1DXWA 3FFGA 4D7FA 3EYDA 2P3UB 3K6ZA 2F9PA 4ZXXH 4ESTE 1Z8GA 1NFUA 2G5VA 1WQVH 3MO6A 2FIRH 4I8JA 1OS8A 2ZDLA 2EA3A 1L1NA 1C1PA 2NWNA 2XYAA 1QGFA 1SGFA 3RP2A 1MKXH 2H5DA 3VB5A 4CRDA 1GI3A 1GJ4H 1MQ6A 2FDAA 1UO6A 4TWWA 1GBMA 3RMNH 3RXAA 3TGJE 2JETC 3OY6U 1GBHA 1UK4A 2LPRA 3ESTA 1EPTC 1S84A 2TIOA 3SO3A 1BBRH 5C1UA 3QDZB 2FOHA 2ZDMA 3TU7H 1ETRH 2FX6A 1ELVA 3A86A 5FCKA 1ANDA 2NU0E 1Q2WA 5A0CA 2ZPRA 1SOZA 1FY1A 2Z6BD 3NCLA 1YPKH 1CA0B 1JMOH 3SNDA 2ZTYA 1HB0B 3SHCH 5AFYH 3RXVA 4JZ1A 2BDAA 4THNH 1TGBA 5LPEA 2JETB 2C4FH 1ZHPA 1UTOA 1P0SH 3TK9A 2QCYA 2ASUB 1A5GH 2OXSA 1JIMA 1O5DH 1T8LA 5C5OA 3H7TA 1BTPA 8GCHG 1RTFB 1ZGVA 2FO9A 1GDQA 1XUIA 3BTTE 2AERH 1H9IE 1BUIA 1GL0E 1QQ4A 4TY7A 1MBMA 2NU3E 1C2GA 3P70B 2R2MB 2WV4A 3IG6B 3A83A 1EPTA 2DE9A 1YGCH 2V0BA 2XBWA 3BTDE 4J2YB 1MQ5A 5C1YA 3BG4B 5T3HA 4YM9A 1HAVA 3O8DA 1AB9B 2OQUA 1K1MA 1MTWA 3S7KB 3PMJA 5DPAA 1BTYA 3E3TA 3GCTF 3VGCC 3UNSA 1TQ7B 1C2IA 1CQQA 1ZJKA 5GCHG 3BTQE 2FI3E 2GCTB 3D65E 3TIUA 3PTNA 1G3CA 1OYQA 3TVJB 3LC3A 3NK8A 1TNIA 3ZVDA 5K0HA 3GDSA 2PTNA 1DWDH 1PPZA 4AFZA 1AFEH 1C1NA 1BDAA 2LNCA 1W8BH 1V2ST 1XXDA 3SUEA 4ZAEA 3B23B 2O8TA 1VCPA 2ANWA 1QIXB 3BEFB 5L2YH 4ISLA 1CGHA 1ELEE 2FOMB 4MPXA 2CF8H 2PGBB 1OPHB 1QL9A 5HGGA 1GHZA 3VGCB 1HAXB 3LPRA 1G2MA 3KQEA 4QT8C 4UFGH 3K65B 2JH0D 2GP9B 4DOQA 3KQCA 3RXPA 3UREA 5EG4A 4CBOA 4X0WU 2D2DA 1SHYA 1RTKA 1GL1A 1O5CB 1C2DA 2XTTB 1O2MA 1O3LA 3FP8E 4XDEA 3DFJA 3ZZCA 3VB6A 1N8OC 3NZIA 4K1TA 5FBEA 1YPGH 4WMDA 4OS6A 4Y11E 2FTLE 2SNWA 1MTVA 2GGVB 2GDDA 1ESAA 4Z0KA 1ARCA 2W5EA 2VVUA 3UOUA 2ZCHP 2XBXA 2ZGXH 4FUBA 4B2BA 1ACBE 1GHBG 2CMYA 1IQIA 2ANYA 1ELTA 1FY8E 1C1QA 3PB1E 1BHXB 1RFNA 3Q00A 4XBBA 4MDSA 1AZZA 1DS2E 3SU5A 4TPYA 5IYTA 8KME2 1N8OB 5F8TA 4AOQA 2OUAA 3AASA 1TQ0B 1TYNA 1C2KA 3SJ9A 1SLVB 3SU2A 1IQEA 4NIWA 1LHGH 2H9TH 1W11U 4WXVA 1RS0A 2BX3A 2WPKS 1O33A 2NU2E 4X1RU 3RXFA 3W94A 1CE5A 4F49A 2TGTA 3C1KA 4FUCA 2HRVA 1O38A 4BTTB 1WUNH 1SGEE 1BMNH 1C5WB 1QURH 1WTGH 3ZYEA 3HKJB 2ZQ1A 1EZSC 1DWBH 5FX6A 2AEIH 2XCFA 2ZA5A 1UVSH 3F9EA 4Y0YE 4NZLA 3TJUA 1P05A 2Y5GA 3L6PA 3SZNA 4I7YH 1VGCB 3F9HA 4CRCA 1THSH 2R0LA 3ATWA 1EB2A 1W0ZU 1TPPA 4I8LA 1W7XH 5EW2H 3LH1A 3D23A 1C1SA 2A45B 1K1OA 1ELFA 1SGQE 3SNCA 2I6QA 3TJNA 2BDGA 1SR5C 1Y3UA 4A1TA 4ZMAH 4I8KA 4H42U 3UR6A 4NIXA 1BBRE 1JBUH 1E0FD 4Q7YA 3RUOA 4INLA 5DP9A 1C5SA 1TA2A 5I46H 2VWNA 1C5VA 1UVPA 6CHAB 3I29A 4IN2A 4YLQH 1IQMA 1GMCF 2Y80A 4B1TA 2A4QA 2J9NA 9LPRA 1DITH 4WH8A 1CBWC 3AAVA 1AVWA 5I25A 1D9IA 1SB1H 4JYVH 3ZZAA 2CV3A 1W13U 1W7GH 1EOJA 3GY5A 3STIA 1ZPBA 1B7XB 3A84A 3TK6A 1GBLA 3FANA 1BZXE 2FXRA 2BLVA 3LKWA 1C5OH 3SU3A 3TJVA 1H8IH 3R3GB 2O8LA 2QXIA 3URDA 3HK6B 2Z94A 1O2RA 1NY22 3OU0A 2UUJB 1NFWA 2QF0A 1ZRBA 2F91A 3SI4H 5EXLA 3F6UH 3A8CA 3U1JB 1T8MA 2BD5A 2G5NA 3RXQA 2FOAA 1ZSLA 4GLYA 3MO3A 1O3FA 3STJA 2YOLA 1YPLH 2Y5FA 1EPTB 5CMXH 3T28A 4XBDA 1O5GH 5LPRA 3PTBA 5DKMA 5C20A 1C5RA 1TGTA 3T5FH 2A0QB 4D9RA 1SGNE 4CR5A 1EJNA 3O8CA 2HPQH 3ITIA 2A4OA 1V2VT 2CXVA 3S7HB 2A7CA 2RA0A 1HLTH 4H6TA 3RXDA 2THFB 1GMDF 1AGJA 2BD4A 2RCEA 2XBVA 1A5IA 1Y5BT 1BTHH 3RM2H 3PMHB 1GJ5H 2XC0A 3P92A 4NA8A 1IQNA 2ODYB 4ABJA 1XXFA 2EI7A 3UNQA 1K1JA 2PKSC 3NXPA 4U01A 3A87A 3D62A 1VZQH 1BMLA 5JBBS 4ISNA 1P8VC 3S9CA 2Q6GA 1HDTH 4IS5A 1GHAG 1OWJA 1O2IA 2Y7XA 2ZHFH 3L3TA 1BITA 4GSOA 1A4WH 2BDCA 1K1LA 1DANH 5SGAE 3BG4C 2A7JA 1BCUH 1ZPCA 3IWMA 2RG3A 4Y71A 3GDUA 6GCHG 1CGIE 1Z71A 2RA3A 4RN6A 3SUDA 3ZVEA 2P95A 1SC8U 1MZAA 1C5ZB 3TNSA 1GCTC 3LGWA 3TJOA 5A8YA 2ZGHA 3K9XB 4WXIA 5AFZH 3BTGE 1IQJA 4JZFH 4RSPA 1ZTLA 3BTEE 1W10U 4D9QA 2BDIA 5DP7A 1G37A 3ELAH 3A7WA 1FN8A 1V2JT 4UFFH 2AGEX 1XMNB 2BDBA 2A7HA 5E2OA 2ZFPH 1YPMH 1GBTA 3HPTB 3RXEA 4DW2U 3GISB 4GUXA 2ANMH 1O3KA 1H9LB 1LMWB 4D76A 2Y7ZA 1YPHE 3QZRA 1TNLA 4MNYA 1TA6A 7KMEH 1LQDB 3SQHE 4VGCC 4WF8A 2ULLA 3KCGH 5G4BA 1DLKB 2BZAA 1GMHF 1P3EA 1D3TB 5GXPA 5E2PA 1O2NA 4DURA 1U6QA 4OGYA 2GTBA 1FN6A 1C5TA 2BHGA 1AY6H 1OP0A 3S69A 1MD8A 2J92A 3MOCA 1OXGA 1C5UA 1INCA 2OC8A 3SU1A 3F9GA 2VH6A 1FPHH 3MFJA 4X2YA 1G9IE 1G32B 4I31A 1O3MA 3ZZ6A 2FESH 1UTJA 4INHA 2AYWA 2WPIS 4A7IB 4AFUA 1ZYOA 3ZVAA 4UFEH 4K5ZA 1E36B 1HAHH 2K7XA 1AN1E 3EGKH 4B2AA 5C5NA 4NWKA 4OGXA 1YPEH 2VNTA 2G00A 2VU8E 4B71A 1KSNA 2OLGA 2ZPQA 5ETXA 1Y3WA 1GVKB 1DLEA 1EZUC 3RC6A 7LPRA 1TRNA 3SV8A 2ZFRH 2AFQB 1B0EA 1D4PB 1HNEE 1P02A 1C2FA 1EB1H 3SNEA 4WMFA 1GBFA 2FOBA 4GVUA 3QX5H 4JMYA 4DGJA 3T25A 3RMMH 1BTWA 2C93B 1AWFH 3A7XA 3U98H 7GCHG 2R0KA 3SGBE 1HPGA 3UWJH 2C90B 1C2LA 1FLEE 1DDJA 4CBNA 4Q2KA 3UR9A 3UQVA 2SGEE 5ESBA 1UTKA 2ZFFH 1O2TA 1F7ZA 4CH2B 2AMDA 5CE1A 3M3TA 1BTZA 3EAJA 2IJOB 4FVBA 1VGCC 3ZVBA 3FP7E 2XNIA 1MU6B 4Y79A 2STBE 5JDUB 2A31A 4I33A 1FNIA 3BIVH 1V6DA 1ELAA 3QN7A 4CRGA 4AFSA 3CS0A 4D7GA 1ZMNA 1PPGE 3PO1C 3RXKA 4UDWH 1O2QA 2BD8A 1GI2A 2VH0A 2FOCA 1D6WA 1NFYA 1C4V2 2GCHG 3ZVCA 5ESTE 1V2QT 4CRAA 4ZHMU 1QRXA 2JH6D 1FI8A 1AKSA 1A46H 3TNTA 2C8WB 2GMTC 2IOTA 1O37A 1O34A 2QXJA 2PWXA 2ZTZA 4CRFA 2GX4A 4UEHH 1T8NA 2EI8A 4IGDA 4KTCA 1FUJA 1DWEH 1HJ9A 3MU8A 1SLUB 3SGAE 4DCDA 4AB9A 2V3HH 4CHAB 5DO4H 1NFXA 2Q6DA 3RC5A 1J16A 1AIXH 3LIWA 1C5PA 3BV9B 2OC7A 1EAXA 3O8BA 1HAPH 2QN5T 2CJIA 1P03A 1P06A 2WINI 3KN2A 3P95A 5T6DA 2AMPA 1O3PB 2BY5X 3AW0A 1O5FH 4KELA 1D3PB 4B73A 1SVPA 3U69H 1Y3YA 1ARBA 1QY6A 1CT0E 1G2LA 1PYTD 4ISHH 4CRBA 2Z3CA 2D26C 2HOBA 3RXBA 5L6NH 1ZTKA 1BJVA 3GYMA 4NA9H 4IN1A 2R2WU 3FZDA 3EE0B 4B2CA 3TGKE 4CHAC 2ZDNA 1YYY1 1O3OA 2BTCE 2F83A 1QCPA 2HNTE 2JKHA 3GY2A 5PTPA 1O2WA 4X1PU 4ZHAA 4B74A 1K21H 1TLDA 1LPGB 1NS3A 1Z8RA 2ZFQH 1MKWK 3RXTA 4ZUHA 4MVNA 4R8TB 5E0GA 3QTVH 2BY9X 3UUZA 2ZZUH 1W2KH 4ZKRU 1BOQA 1UVTH 2XWBI 2DE8A 2BZ6H 2G52A 4MG3A 5FPYA 4X1QU 2ZU3A 4CH8B 1PPFE 3SN8A 1LCYA 1OWHA 2OC0A 3PLPA 4LOYH 1S83A 2FLRH 3ZZ3A 4A1VA 1AI8H 2ZF0H 1KLIH 5EPYA 1BRBE 4JK6A 3LDXH 3D49H 2Y81A 3DHKH 1VITG 2A4RA 3GCHB 1JWTA 2R9PA 4JYUH 2BD3A 2P3TB 1XVMA 2BVRH 1P04A 1LVYA 1W3CA 1TOMH 3HGNA 2RDLA 1DM4B 4MQAA 1V2KT 1FY4A 2ANKH 1EQ9A 4NA7A 2QXHA 3R0FA 1F2SE 3RXSA 1CT4E 3M3SA 3Q3XA 1EJMA 1AVXA 4M7GA 1O3EA 2VJ1A 3TITA 1Y59T 1F0TA 1F0SA 2ZHEH 4IMQA 2C8ZB 1T7CA 2ZNKH 1O3AA 2OTVA 3P8GA 1S5SA 3SGQE 1NRPH 4UONA 1O2OA 3BTKE 4I8HA 2AH4X 1TABE 2J2UA 6CHAC 2P93A 4FUJA 1IAUA 3GCHC 1AVGH 4NFEA 1DY8A 2A2XH 2TBSA 3SV7A 1OWIA 3V3MA 1XUHA 2W26A 1AUTC 1DFPA 1SL3A 1UTLM 4TY6A 1V2NT 2P94A 3H7OA 1L4DA 3UWIA 3M5MA 3BTWE 3GY4A 8GCHF 1O2HA 1T4VH 1A1RA 1YLDA 2FZZA 2GDEH 2OQ5A 2NU4E 1GJBB 1GPZA 1H4WA 1HUTH 4ZKNU 5IDKA 4U30A 3E91A 4FUDA 3EBNA 3A85A 1SGCA 2ZPSA 3ZYDA 3RMLH 1SQTA 1SFIA 2XW9A 1GI8B 1WSSH 1YPHC 2HVXA 2VIWA 1LHCH 1CU1A 1QQUA 3LGUA 1QB6A 1RJXB 2VVVA 5HMAA 1ZSJA 1ABIH 4BNRA 2B0FA 1EUFA 3RXUA 1AE5A 3LJJA 2FYRA 1O2ZA 1UK2A 1XM1A 4KKDA 5FX5A 2K1QA 4O9VA 1QRZA 1Y5AT 1F0RA 1JRSA 5LGOA 2DUCA 4K1SA 1Z1IA 1ZGIA 2ZKSA 3RU4T 1XKBC 1KXAA 3SV9A 1C2JA 2FWWA 2AIPA 3Q3KA 2PV9B 3U1IB 1UHBA 4NIVA 5EQSA 4HTCH 2HWLB 1JXPA 3M7TA 4HGCA 2UUFB 1GVZA 5LH8A 3GY8A 2UUYA 1LO6A 1NM6A 1NU7B 1F92A 1O2YA 3VXEH 1TGNA 5A8XA 1HXFH 3BIUH 1O5BB 1GBJA 3E8LA 1XUGA 5EQQA 1EASA 3MH5A 3K2UA 3KL6A 1QA0A 1O2LA 2ZU2A 1ZTJA 5JBAS 2WPHS 5C1XA 1TWXB 1DWCH 1WCZA 4ABHA 1SI5H 1IOEA 1HRTH 2OCVB 3ZVGA 3PMBB 1H1BA 1S81A 2F9UA 5DP6A 2IN2A 3TK5A 2VGCB 3GY7A 1SGDE 2Z9IA 5FBIA 4B76A 3A8BA 1L0ZA 3E6PH 1Z1JA 2Q1JA 2O8WA 3M36A 3F68H 4LK4A 4ABEA 1C1RA 2ZU5A 4YO9A 4ZXYH 2ZTXA 1GCTB 2CN0H 1O2JA 4Y76A 3EA8A 4ABBA 4X6NA 2SNVA 1ELGA 2F9VA 1OKXA 2VGCC 1QTFA 3UTUH 4OS4A 4LZ4B 1OP8A 1Y5UT 1GG6C 4WJG2 1Y3XA 1P2NA 3V0XA 1ID5H 1O39A 1KLJH 3BN9A 3RXRA 1MCVA 3PO1B 1AO5A 1N6YA 1KDQB 5C67A 4JK5A 1OWDA 4RKOB 4IW4E 3G01A 4CREA 5FHTA 2V3OH 2VIQA 2OP9A 1MH0A 2ZFSA 1CGJE 4BANB 4K3JA 4Y7BA 2GMTB 3AVZA 3NKKA 3ZZDA 3LC5A 2B5TB 4AZ2B 1GBDA 4AGKA 2ZG0H 4BAMB 1IQLA 1UK3A 5FAHA 2QA9E 4JYTA 5JBCS 1ANEA 4XE4A 1YLCA 2OBOA 2UWOA 5FPSA 3S0NA 3FP6E 5DG6A 1UVOA 1AFQC 2D8WA 1GGDB 1HAIH 1GI7B 2A4GA 2Y82A 3UY9A 1VCQA 1SHHB 4JCNA 1OWEA 1DPOA 2HALA 1ELBA 2TRMA 1CHGA 2SGQE 3ATKA 3MU1A 1O32A 1V2LT 1GI5A 1M9UA 7GCHF 1CA8B 1AZ8A 1MTUA 3MH4A 3NUMA 1P9UA 3KF2A 1EATA 5EXMA 2PGQB 5GCHF 4MPUA 1UMAH
chains in the Genus database with same CATH superfamily
3E90B 4IMZA 1H8ED 1RD3B 2HNTF 1IQGA 3LGVA 1BIOA 1UCYK 3LU9B 4RKJB 4WMEA 4YT6H 1SGFG 3RXGA 4XFQA 4Y8YA 1C1MA 3LJOA 5TCCA 4ZKSU 1GGDC 1HAVB 4ABDA 3TH3H 2HLCA 4X6OA 5JB8S 2VVCA 2A1DB 4AYVB 1TMUH 4MLFB 1TBRH 1TIOA 2ALVA 5GWZA 1HIAB 1CHOF 1E38B 5JBTA 1C5LH 2PKAA 1J8AA 3SJKA 4HZHA 4E7RG 3T2NA 1AWHB 1P2IA 1TRMA 2K0QA 1EZQA 2V35A 3M7QA 4YOJA 4B75A 3FO8D 4E7NA 2ZDVH 3ATIA 1WQSA 3LGYA 1P57B 1XUFA 2EC9H 2FI4E 2ILNA 4OM9A 2P8OB 3DFLA 3OTJE 1LKBA 5DK1A 1V2WT 1THPB 2G4TA 4Q7XA 5FPTA 2J94A 3B9FH 3KNXA 1CT2E 2QYIA 4ZKOU 1MD7A 2JH5D 2OC1A 1UVUH 5EW1H 1S0QA 1T32A 2SGAA 1EKBB 2FEQH 3OEED 1AMHA 4WY3A 1K1PA 1PJPA 1H9HE 1OOKB 1SQAA 4WVPE 4HFPB 1WDIA 1TGSZ 3N7EA 5K7RA 5GDSH 1YY3A 2QV1A 2A32A 1PQ8A 2AS9A 1H8DH 2NU1E 3QO6A 4K8BA 1QBNA 1RXPA 1XVOA 2J34A 5ABWA 1YCPH 1UJ1A 1FAXA 1LHFH 3SV2H 4F4OC 1LTOA 1RIWB 3UAIC 4E05H 2QGRA 1SGTA 3SYJA 1S0RA 1CVWH 2GJGA 6ESTA 2W7SA 2F43B 3H5CB 1IQHA 1GCDA 3L33A 3PV4A 3U8RH 2Z3EA 5AVDA 1O3IA 3VFEA 2VIVA 1VCWA 5F53A 8ESTE 1BHXF 4A92A 1GHVH 2XBYA 4X8SH 1QJ6B 4MNXA 4ABIA 3ZV8A 2UWLA 1EAIA 2J4IA 2ALPA 3NRLA 3VB4A 3SNBA 1JIRA 1EAUA 1ORFA 1V2TT 3ATLA 4IC5A 2GZ7A 2BD7A 1ETSH 3GDVA 5CHAB 2GZ8A 3SJ8A 2I6SA 2XC4A 1TGCA 2CK3D 4O3TA 1QA7A 2YMSD 3B8JA 2ODPA 1P09A 2H6MA 1MTNB 3O8RA 1LVMA 4FUFA 3EA7A 2Z3DA 2F9NA 2STAE 5F03A 1QR3E 2G8TA 4X8TH 3T62A 4CR9A 1Q31A 5HYOA 5DGJA 3U8TH 1A7SA 1Y8TA 2K8IA 1SFQB 3IITA 3M35A 2ZDAH 1GBAA 1VJAU 3SI3H 3LT3A 5AF9H 3VB3A 3F9FA 1O2KA 4A1XA 1HAZB 2PUQH 1K9OE 4Y6DA 5EODA 2J97A 3A80A 3A7VA 2ZECA 4BTIB 2BX4A 1C2HA 1EOLA 1QBVH 3BTFE 2VIPA 1GI1A 4YTAA 2BVXH 1L4ZA 2W7UA 3N99A 5H4IB 1YCPK 2OD3B 1HCGA 3URCA 1MMJN 3T27A 2JIZD 1QB1A 2QXGA 2PSYA 1GMCG 2C8XB 2ZC9H 1O2SA 2ZEBA 1FAKH 3ODDA 1HBTH 1C1OA 2ZQ2A 3QTOH 2WYJA 3A82A 1VJ9U 1OP2A 1FIWA 2WUCA 4OS2A 3KYGA 1EP6A 2SGFE 1XUKA 1GJ7B 1BT7A 2BLWA 1C1WH 4BXWA 2GCHF 2YMSC 3AW1A 2W6JD 3CENA 4D8NA 5GJ4B 1P9SA 4O03A 5DP4A 2WUBA 5T6GA 4K8YA 4RT1A 2WZQA 3DSOA 1T4UH 4FU7A 1ZR0A 3A7TA 4UE7H 4Q80A 3M61U 1KIGH 3W95A 1LPZB 2QY0B 4FUEA 1SSXA 2ZCLP 1O3HA 1GDNA 2GCTC 2Z9JA 1SLXB 3OY5U 4MNVA 5HXFA 1SPJA 1V2UT 3BEIB 4GCHG 2HLDD 1K1NA 1WYKA 3M5LA 4KTSA 3PLKA 1OWKA 1BJUA 3KHVA 2GKVE 2PP6A 3GCNA 1P10A 4TT3D 5A8ZA 3UOPA 2BVSH 2VB0A 1MKXK 1ZRKA 2W6ID 2PTCE 3RXMA 3VG8A 2AMQA 1J17T 3MMGA 1QL8A 2BDHA 4GHTA 2AGIX 2ZWLH 1G3BA 3CP7A 1NRRH 3ZZ5A 2FM2A 1W12U 5DJ7A 1MTSA 1MZDA 3QLPH 1J15A 1HIAA 5FCRA 1O2VA 1QNJA 3P8NA 1C5MD 4IC6A 1BMMH 4BAKB 1NZQH 3SUGA 1WV7H 2FI5E 3U8OH 1TMTH 1HAYB 4DJZB 3A8AA 5JYIA 3PROA 4K69A 3KQBA 3OX7U 4FOUC 1YKTA 3BSQA 1Y3VA 5KEDA 3SHAH 4YLUA 1GJDB 1E37B 4GPGA 1S6HA 3MHWU 1YF4A 3V12A 1EJAA 3NPSA 2EEKA 3MU4A 3SW2B 4A6LA 3EQ0H 2J95A 5C94A 3RMOH 7ESTE 3MU5A 1G3EA 5EPNA 1J14A 1FQ3A 1LHDH 5C2ZA 3RXHA 3HGPA 1ZZZA 1F0UA 6LPRA 4OS1A 5L30H 4Q7ZA 3SU4A 3T26A 5A0BA 2CF9H 1O30A 1GVLA 1GJ6A 1NU9A 2TGAA 1VITF 1E34B 4YZUA 1Z8IB 1NPMA 4K2YA 5E8EH 1QBOA 3BF6H 4PROA 2R3YA 3QGNB 4ASHA 2QF5A 3SV6A 1SGPE 4X8VH 3UFAA 1EX3A 4U2WA 1A61H 1AD8H 2BD9A 2FPZA 3P17H 4BOHA 4YESB 5J4QA 2KFWA 1NRNH 5C0UA 5J4SA 2ZCKP 1KTTB 1O35A 4AX9H 2OINA 4YOGA 1V3XA 1SGYE 4FU9A 3SUFA 3DD2H 2H5CA 3E16B 1WAYB 1C9PA 1GDUA 1SGRE 1C5NH 1KXFA 1MCTA 4FUIA 4I8GA 2O8UA 2QIQA 2FOEA 2SGDE 2KCOA 5E0HA 3ENSB 3KGPA 4X6PA 3RXIA 4O3UA 4XRNA 5L2ZH 1GHBF 1NROH 3UQOA 3ZZ7A 1S6LA 4X1NU 1L1JA 2WV5A 2BXUH 2ZHDA 2OBQA 3MTYA 1WOFA 3PV2A 4DY7B 2BLOA 2G81E 5TCAA 1WTHD 3ZVFA 1A0HB 1GBBA 1ELCA 2BXTH 3GICB 3MQKC 3LOXA 1FY3A 5GNDA 1T8OA 1O31A 3FVFB 4LXBH 5IK2D 1YWUA 3GCTG 1MAYA 5A09A 4IBLH 4MNWA 1C1TA 1O3BA 1GG6B 1V2PT 4Y0ZE 5E0JA 1BQYA 1ABJH 1IQKA 4GAWA 3LGTA 3QGJA 2KX4A 1NTPA 4NFFA 2Z9KA 3VPKA 4MPVA 1BBRK 3GCOA 1S85A 4NG9H 3TLOA 1ANBA 4INKA 1NRQH 3PM3A 4FXGH 2ZU4A 1GHYH 1J9CH 2FOGA 2GV7A 1D6RA 1LDTT 2ZGCA 2BB4A 1TAWA 1YM0A 1K1IA 4FVDA 1RGQA 4K60A 2JDID 4AORA 4ZH8A 4F55A 1K22H 3S9AA 1C5QA 2XXLA 2GT8A 3ODFA 1CSOE 1A5HA 1GJCB 1PPHE 3RXJA 3F1SB 1V2OT 5LPFA 1BRCE 1HFDA 2A2QH 3BG8A 1SBWA 1GI6A 1QZ8A 2ZDKA 2WPJS 1CBWB 2R3UA 1B5GH 1AFQB 1UTMA 1WU1A 5DP5A 1S82A 1GBIA 1ZJDA 5DSFA 1TPAE 1TMBH 5F6MA 4WWYA 1PPBH 4X2XA 2ZHQH 1P2MA 1F5RA 1O3NA 1E35B 1O2XA 3PLBA 1AUJA 4X2WA 2ZIQH 5BPEA 4NCYA 3F0OA 1KTSB 1SLWB 3BTME 4FUHA 1DSTA 3A89A 1TFXA 4X8UH 3V13A 1K2I1 2BYAX 2G4UA 1VITH 2WYGA 2BY8X 5GPIB 4DIHH 5A2MH 2ZO3H 2P3FH 1MTNC 3MNSA 2BQ6B 1Z6JH 4ASUD 2BOKA 1SQOA 1OSSA 1ESBA 3HKIB 3LONA 2F9OA 1AHTH 3RDZA 4I32A 1O36A 3GS9A 1X7AC 2UUKB 4FUGA 6GCHF 1C1UH 2JJ2D 1O3DA 2AGGX 2BY6X 2F9BH 3TPIZ 1SGIB 3ZZBA 5DN6D 2HPPH 2BQ7B 3RXCA 1FZZA 3MWIU 3QK1A 1DUEA 1JOUB 3A8DA 1TPSA 2Y6TA 1GI0A 4KP0A 1GHXH 1BMAA 1A3BH 2WHXA 2SGPE 3PWCA 2H9EH 3CS7A 2TGPZ 2H9HA 4SGAE 1WBGB 4DG4A 4X2VA 1TRYA 2PW8H 1GHAF 4LZ1H 1XUJA 1DVAH 4U32A 2FS9A 3RM0H 5EIYA 2H2ZA 3A81A 1TONA 5EQRA 3F2GA 2PKSB 1DOJA 3GY3A 2PFEA 2Z9LA 1IHTH 2O8MA 3MI4A 1AKSB 1GWAA 3MNXA 1DICA 1NRSH 8LPRA 3SU0A 3SU6A 3ZV9A 1XKAC 2BOHB 5F8ZA 3M5OA 4R0IA 4ZHLU 1F5LA 4SGBE 3Q3YA 1DY9A 1G36A 2FLBH 3QWCH 3PRDA 2P59A 3U9AH 1AU8A 1HAOH 2B7DH 2IPHA 4RT0A 3EE7A 3HK3B 1QB9A 1P2QA 2G55A 1MAXA 4ZROA 1HJ8A 1S6FA 1UCYE 3GY6A 4ACBA 3PYHA 4TWYA 2PR3A 5BRRE 1TBQH 4ZCNA 4Y8XA 4ACAA 1BRAA 4OS7A 1KXBA 5FXLA 1TNJA 1TNKA 2G51A 1ZPZA 2PUXB 4AB8A 1YPJH 1UTQA 2Q6FA 4BXSA 2H1UA 1VR1H 1EXFA 4FU8A 1ZOMA 2ESTE 1H8HD 1SOTA 4WH6A 1TE0A 3T29A 3V7TA 2ZP0H 2AIQA 1P2KA 2RDEA 2O9QA 1QHRB 3KQ5A 4J1YA 4OS5A 4AYYB 3MH6A 2VWOA 1FIZA 2FS8A 2W3KA 1IQFA 3W1EA 1BTUA 4NZQA 4BTUB 1O2UA 2TPIZ 1YCPM 2W3IA 4YXWD 2ZU1A 3PWBA 3S9BA 3ZZ8A 3KIDU 2C8YB 2FTMA 1BB0B 2LIZA 3RU4D 1CA0C 4MTBA 1HV7A 2QAAA 2CGAA 1L2EA 4VGCB 1UTNA 2ZFTA 4AN7A 1E1RD 5EU8A 1NO9H 1GJAB 4ISIH 2FP7B 4NSVA 2Z9GA 2A5AA 1O0DH 1KMHB 3AAUA 3PMAB 3MH7A 1PYTC 1CHOG 1TX8A 3E1XB 3VB7A 1N6XA 4TPIZ 1DT2A 4BAHB 1Z8JB 2KAIB 2XWAA 3ATMA 1E79D 2P16A 5EGMA 2VWLA 4NWLA 4UD9H 5T6FA 2CHAC 2FYQA 1O5EH 4DVAU 4Y8ZA 5DP8A 5TJXA 3NWUA 1QRWA 1C4U2 4HI3A 3JZ2B 3DT0H 1F5KU 3RXLA 2ZI2H 5B6OA 1C1VH 1TNHA 1AB9C 4AG2A 3MNCA 3CNRA 5HKKD 1O3GA 3Q76A 1Q3XA 3RXOA 3VEQB 4Z6AH 3M3VA 2IJD1 3TH2H 3MYWA 1MKWH 1QJ7B 3KYFA 1AE8H 1ESTA 1GI9B 2PLXA 1L1GA 3FAOA 4KTUA 1GMHG 5HM2A 3PV5A 2IPQX 3P8FA 2BLQA 1TBZH 1C9TA 3Q77A 1DE7H 1TPOA 4ISOA 1PQ5A 1B0FA 3I78A 4DT7B 3EA9A 1FDPA 1MUEB 2CHAB 1FJSA 5JPMH 2YMSB 2M5TA 2PSXA 4XSKU 1TX6A 1P12E 1V2MT 2ZGBH 4TYDA 1NC6A 4BAOB 1D3QB 1NESE 3SJIA 1IHSH 1YP9A 1TALA 2GVFA 2F3CE 1TNGA 2B9LA 1YBWA 1MABB 1KYNA 4AG1A 1HYLA 3E0NB 1XX9A 3HATH 3SORA 4K1EA 1FPCH 1PFXC 1Z7KA 4A5TS 2WPLS 1GBCA 3DUXH 1GJ9B 3K6YA 5A0AE 2SFAA 1EAWA 1SG8B 1C5XB 4FETA 2ZGJA 1FY5A 3GYLB 1THRH 3M5NA 4H6SB 1GBEA 3A7YA 1W0YH 1AQ7A 1LVOA 1DSUA 1TOCB 1V2RT 2J38A 3MU0A 1PQAA 1ZMJA 2BQWB 3UIRA 4Q63A 4BAQB 1O2PA 3ZZ4A 2BMGB 3KEEA 1C4Y2 1UTPA 3TH4H 1GBKA 1ZHRA 2B8OH 1DX5M 4XBCA 2ODQA 1NN6A 2HNTC 1JRTA 1KXDA 2PKAB 2XCNA 2FX4A 1O3CA 1A3EH 2GD4B 3C27B 2ZHWH 2VWMA 3EDXB 1A2CH 1HXEH 1NT1A 1BRUP 4AFQA 1C5YB 3SJOA 4ABGA 1ANCA 3GOVB 3A7ZA 2UWPA 2FMJA 2WPMS 1C2MA 2GT7A 2A5KA 1HJAC 1ZSKA 2BDYA 4ABAA 1W14U 3ZZ9A 1DUAA 4JZDH 1BA8B 3SNAA 2BM2A 3P6ZB 1P01A 1PPCE 3OSYA 4NIYA 2KCPA 3A88A 5EXNA 1PQ7A 2GZ9A 1G3DA 2TGDA 3SQEE 2XC5A 3M7UA 2QC2A 4DIIH 4GCHF 1G30B 4H4FA 4JZEH 3SOSA 1UW7A 1RRKA 4Y7AA 1KXCA 1QL7A 1ZHMA 3MNBA 1ZMLA 1FONA 1P3CA 2FODA 9ESTA 5C3NA 2A5IA 3TGIE 1K28D 3DA9B 2LELA 3N7OA 1QFKH 1GJ8B 1HGTH 4E06H 1KXEA 1MU8B 2KAIA 1FXYA 2V6NA 2VINA 5EOKA 1SMFE 1HJAB 4YT7H 4O97A 2Z7FE 4NSYA 1Z6EA 5AHGH 1KLTA 5F8XA 2P8OC 3M37A 3SBKA 1LHEH 1YC0A 4YOIA 2BY7X 3UPEA 2Y5HA 4JZIA 1UCYH 1LPKB 1ZLRA 3FZZA 4NGAH 2BD2A 1EP5A 1A0LA 1KY9A 2FOFA 1EZXC 2QF3A 1KDQA 4TSFD 2HGTH 1LVBA 2PHBA 3RC4A 3OYPA 1BTXA 3LH3A 1LQEA 3RU4E 1O3JA 1P2JA 3QZQA 3BEUA 1T31A 1ELDE 1TX7A 3I77A 2YNBA 5GIBA 4ABFA 1QJ1B 1UHBB 1FMGA 5DP3A 5HM9A 1GI4A 3RLYH 1DXPA 1P2OA 3LGIA 3OAAD 4UFDH 4X1SU 1OX1A 3RLWH 2YNAA 1RIWC 2J5UA 1C2EA 2D1JA 3VXFH 2XRCA 1GMDG 4X6MA 2VIOA 1FV9A 1D3DB 1LKAA 1MBQA 1O2GH 1ETTH 1OYTH 2C3SA 3WY8A 1PPEE 3MO9A 3BTHE 1HAGE 1TB6H 4Y10E 1O5AB 3QUMP 3UNRA 1N1LA 3KQDA 3P8OA 4KGAA 4XOJA 2GV6A 4GHQA 1A0JA 1RTLA 1CO7E 4MPWA 5JB9S 1P11E 2EI6A 2VIDA 3JZ1B 1GHWH 3E0PB 4AGJA 5CHAC 1DXWA 3FFGA 4D7FA 3EYDA 2P3UB 3K6ZA 2F9PA 4ZXXH 4ESTE 1Z8GA 1NFUA 2G5VA 1WQVH 3MO6A 2VBCA 2FIRH 4I8JA 1OS8A 2ZDLA 2EA3A 5CHBA 1L1NA 1C1PA 2NWNA 2XYAA 1QGFA 1SGFA 3RP2A 1MKXH 2H5DA 3VB5A 4CRDA 1GI3A 1GJ4H 1MQ6A 2FDAA 1UO6A 4TWWA 1GBMA 3RMNH 3RXAA 3TGJE 2JETC 3OY6U 1GBHA 1UK4A 2LPRA 3ESTA 1EPTC 1S84A 2TIOA 3SO3A 1BBRH 5C1UA 3QDZB 2FOHA 2ZDMA 3TU7H 1ETRH 2FX6A 1ELVA 3A86A 5FCKA 1ANDA 2NU0E 1Q2WA 5A0CA 2ZPRA 1SOZA 5B6LA 1FY1A 2Z6BD 4I86A 3NCLA 1YPKH 1CA0B 1JMOH 3SNDA 2ZTYA 1HB0B 3SHCH 5AFYH 3RXVA 4JZ1A 2BDAA 4THNH 1TGBA 5LPEA 2JETB 2C4FH 1ZHPA 2LP6A 5HIZA 1UTOA 1P0SH 3TK9A 2QCYA 2ASUB 1A5GH 2OXSA 1JIMA 1O5DH 1T8LA 5C5OA 3H7TA 1BTPA 8GCHG 1RTFB 1ZGVA 2V7QD 2FO9A 1GDQA 1XUIA 5EJ1A 3BTTE 2AERH 1H9IE 1BUIA 1GL0E 1QQ4A 4TY7A 3F0PA 3DCLA 1MBMA 2NU3E 1C2GA 3P70B 2R2MB 2WV4A 3IG6B 3A83A 1EPTA 2DE9A 1YGCH 2V0BA 2XBWA 3BTDE 4J2YB 1MQ5A 5C1YA 3BG4B 5T3HA 4YM9A 1HAVA 3O8DA 1AB9B 2OQUA 1K1MA 1MTWA 3DSPA 3S7KB 3PMJA 5DPAA 1BTYA 3E3TA 3GCTF 3VGCC 3UNSA 1TQ7B 1C2IA 1CQQA 1ZJKA 5GCHG 3BTQE 2FI3E 2GCTB 3D65E 3TIUA 3PTNA 1G3CA 1OYQA 3TVJB 3LC3A 3NK8A 1TNIA 3ZVDA 5K0HA 3GDSA 2PTNA 1W0KD 1DWDH 1PPZA 2XOKD 4AFZA 1AFEH 1C1NA 1BDAA 2LNCA 1W8BH 1V2ST 1XXDA 3SUEA 4ZAEA 3B23B 2O8TA 1VCPA 2ANWA 1QIXB 3BEFB 5L2YH 5EJLA 4ISLA 1CGHA 1ELEE 2FOMB 4MPXA 2CF8H 2PGBB 1OPHB 1QL9A 5HGGA 1GHZA 3VGCB 1HAXB 3LPRA 1G2MA 3KQEA 4QT8C 4UFGH 3K65B 2JH0D 2GP9B 4DOQA 3KQCA 3RXPA 3UREA 5EG4A 4CBOA 4X0WU 2D2DA 1SHYA 1RTKA 1GL1A 1O5CB 1C2DA 2XTTB 1O2MA 1O3LA 3FP8E 4XDEA 3DFJA 3ZZCA 3VB6A 1N8OC 3NZIA 4K1TA 2RFKC 5FBEA 1YPGH 4WMDA 4OS6A 4Y11E 2FTLE 2SNWA 1MTVA 2GGVB 2GDDA 1ESAA 4Z0KA 1ARCA 2W5EA 2VVUA 3UOUA 2ZCHP 2XBXA 2ZGXH 4FUBA 4B2BA 1ACBE 1GHBG 2CMYA 1IQIA 2ANYA 1ELTA 1FY8E 1C1QA 3PB1E 1BHXB 1RFNA 3Q00A 4XBBA 4MDSA 1AZZA 1DS2E 3SU5A 4TPYA 5IYTA 8KME2 1N8OB 5F8TA 4AOQA 2OUAA 3AASA 1TQ0B 1TYNA 1C2KA 3SJ9A 1SLVB 3SU2A 1IQEA 4B6EA 4NIWA 1LHGH 2H9TH 1W11U 4WXVA 1RS0A 2BX3A 2WPKS 1O33A 2NU2E 4X1RU 3RXFA 3W94A 1CE5A 4F49A 2TGTA 3C1KA 4FUCA 2HRVA 1O38A 3U28C 4BTTB 1WUNH 1SGEE 1BMNH 1C5WB 1QURH 1WTGH 3ZYEA 1VKYA 3HKJB 2ZQ1A 1EZSC 1DWBH 5FX6A 2AEIH 2XCFA 2ZA5A 1UVSH 3F9EA 4Y0YE 4NZLA 3TJUA 1P05A 2Y5GA 3L6PA 3SZNA 4I7YH 3OFND 1VGCB 3F9HA 4CRCA 1THSH 4P02A 2R0LA 3ATWA 1EB2A 1W0ZU 1TPPA 4I8LA 1W7XH 5EW2H 3LH1A 3D23A 1C1SA 2A45B 1K1OA 1ELFA 1SGQE 3SNCA 2F4LA 2I6QA 3TJNA 2BDGA 1SR5C 1Y3UA 4A1TA 4ZMAH 4I8KA 4H42U 3UR6A 4NIXA 1BBRE 1JBUH 1E0FD 2L6OA 4Q7YA 3RUOA 4INLA 5DP9A 1C5SA 1TA2A 5T1VA 5I46H 3FOAA 2VWNA 1C5VA 1UVPA 6CHAB 3I29A 4IN2A 4RI0A 4YLQH 1IQMA 2WSSD 1GMCF 2Y80A 4B1TA 2A4QA 2J9NA 9LPRA 1DITH 4WH8A 1CBWC 3AAVA 1AVWA 5I25A 1D9IA 1SB1H 4JYVH 3ZZAA 2CV3A 1W13U 1W7GH 3FN8A 1FX0B 1EOJA 3GY5A 3STIA 1ZPBA 1B7XB 3A84A 3TK6A 1GBLA 3FANA 1BZXE 2FXRA 2BLVA 3LKWA 1C5OH 3SU3A 3TJVA 1H8IH 3R3GB 2O8LA 2QXIA 3URDA 3HK6B 2Z94A 1O2RA 1NY22 3OU0A 2UUJB 1NFWA 2QF0A 1ZRBA 2F91A 3SI4H 5EXLA 3F6UH 3A8CA 3U1JB 1T8MA 2BD5A 2G5NA 3RXQA 2FOAA 1ZSLA 4GLYA 3MO3A 1O3FA 3STJA 1K0HA 2YOLA 1YPLH 2Y5FA 1EPTB 5CMXH 3T28A 4XBDA 1O5GH 5LPRA 3PTBA 5DKMA 5C20A 1C5RA 1TGTA 3T5FH 2A0QB 4D9RA 1SGNE 4CR5A 1EJNA 3O8CA 2HPQH 3ITIA 2A4OA 1V2VT 2CXVA 3S7HB 2A7CA 2RA0A 1HLTH 4H6TA 3RXDA 2THFB 1GMDF 1AGJA 1OHHD 2BD4A 2RCEA 2XBVA 1A5IA 1Y5BT 1BTHH 3RM2H 3PMHB 1GJ5H 2XC0A 2KM0A 3P92A 4NA8A 1IQNA 2ODYB 4ABJA 1XXFA 2EI7A 3UNQA 1K1JA 2PKSC 3NXPA 4U01A 3A87A 5C17A 3D62A 1VZQH 1BMLA 1W0JD 5JBBS 4ISNA 1P8VC 3S9CA 2Q6GA 1HDTH 4IS5A 1GHAG 1OWJA 1O2IA 2Y7XA 2ZHFH 3L3TA 1BITA 4GSOA 4F48B 1NBMD 1A4WH 2BDCA 1K1LA 1DANH 5SGAE 3BG4C 2A7JA 1BCUH 1ZPCA 3IWMA 2RG3A 4Y71A 3GDUA 6GCHG 3OTPA 5FL7D 1CGIE 1Z71A 2RA3A 4RN6A 3SUDA 3ZVEA 2HVYB 2P95A 1SC8U 1MZAA 1C5ZB 3TNSA 1GCTC 3LGWA 3TJOA 5A8YA 2ZGHA 3K9XB 4WXIA 5AFZH 3BTGE 1IQJA 4JZFH 4RSPA 1ZTLA 3BTEE 3F2HA 1W10U 4D9QA 2BDIA 5C0TA 5DP7A 1G37A 3ELAH 3A7WA 1FN8A 1V2JT 4UFFH 2AGEX 1XMNB 2BDBA 2A7HA 5E2OA 2ZFPH 3FKSD 1YPMH 1GBTA 3HPTB 3RXEA 4DW2U 3GISB 4GUXA 2ANMH 1O3KA 1H9LB 1LMWB 4D76A 2Y7ZA 1YPHE 3QZRA 1TNLA 4MNYA 1TA6A 7KMEH 1LQDB 3SQHE 4VGCC 4WF8A 2EQNA 2ULLA 3KCGH 5G4BA 1DLKB 2BZAA 1GMHF 1P3EA 1D3TB 5GXPA 5E2PA 1O2NA 4DURA 1U6QA 4OGYA 2GTBA 1FN6A 1C5TA 2BHGA 1AY6H 4P00A 1OP0A 3S69A 2M2AA 1MD8A 2J92A 3MOCA 1OXGA 1C5UA 2QE7D 1INCA 2OC8A 3SU1A 1SKYE 3F9GA 2VH6A 1FPHH 3MFJA 4X2YA 2XNDD 1G9IE 1G32B 4I31A 3UB0A 1O3MA 3ZZ6A 2FESH 1UTJA 4INHA 2AYWA 2WPIS 4A7IB 4AFUA 1ZYOA 3ZVAA 4UFEH 4K5ZA 1E36B 1HAHH 2K7XA 1AN1E 3EGKH 4B2AA 4B6FA 5C5NA 4NWKA 4OGXA 1YPEH 2VNTA 2G00A 2VU8E 4B71A 1KSNA 2OLGA 2ZPQA 5ETXA 1Y3WA 1GVKB 1DLEA 1EZUC 3RC6A 7LPRA 1TRNA 3SV8A 2ZFRH 2AFQB 1B0EA 1D4PB 1HNEE 1P02A 1C2FA 1EB1H 3SNEA 4WMFA 1GBFA 2FOBA 4GVUA 3QX5H 4JMYA 4DGJA 3T25A 3RMMH 1BTWA 2C93B 1AWFH 3A7XA 3U98H 7GCHG 4AC9A 2R0KA 3SGBE 1HPGA 3UWJH 2C90B 1C2LA 1FLEE 1DDJA 4CBNA 4Q2KA 3UR9A 3UQVA 2SGEE 5ESBA 1UTKA 2ZFFH 1COWD 1F7ZA 1O2TA 4CH2B 2AMDA 5CE1A 3M3TA 1BTZA 3EAJA 2IJOB 4FVBA 1VGCC 3ZVBA 3FP7E 2XNIA 1MU6B 4Y79A 2STBE 5JDUB 2A31A 4I33A 1FNIA 3BIVH 1V6DA 1ELAA 3QN7A 4CRGA 4AFSA 3CS0A 4D7GA 4HG6A 3SZEA 1ZMNA 1PPGE 3PO1C 3RXKA 4UDWH 1O2QA 2BD8A 1GI2A 2VH0A 3WWBA 2FOCA 1D6WA 1NFYA 1C4V2 2GCHG 3ZVCA 5ESTE 1V2QT 4CRAA 4ZHMU 3PRBA 1QRXA 2JH6D 1FI8A 1AKSA 1A46H 3TNTA 2C8WB 2GMTC 3DSGA 2IOTA 1O37A 1O34A 2QXJA 2PWXA 2ZTZA 4CRFA 2GX4A 4UEHH 1T8NA 2EI8A 5HIYA 4IGDA 4KTCA 1FUJA 1DWEH 1HJ9A 3MU8A 1SLUB 3SGAE 4DCDA 4AB9A 3AK5A 1SQRA 2V3HH 4CHAB 5DO4H 1NFXA 1E1QD 2Q6DA 3RC5A 1J16A 1AIXH 3LIWA 1C5PA 3BV9B 2OC7A 1EAXA 3O8BA 1HAPH 2QN5T 2CJIA 1P03A 4M9FA 1P06A 2WINI 3KN2A 3P95A 5T6DA 2AMPA 1O3PB 2BY5X 3AW0A 1O5FH 4KELA 1D3PB 4B73A 1SVPA 3U69H 1Y3YA 1ARBA 1QY6A 1CT0E 1G2LA 1PYTD 4ISHH 4DT4A 4CRBA 2Z3CA 2D26C 2HOBA 3RXBA 5L6NH 1ZTKA 1BJVA 3GYMA 4NA9H 4IN1A 2R2WU 3FZDA 3EE0B 4B2CA 3TGKE 5KGOA 4CHAC 2J98A 2ZDNA 1YYY1 1O3OA 2BTCE 2F83A 2KCAA 1QCPA 2HNTE 2JKHA 3GY2A 5PTPA 1O2WA 1YLNA 4X1PU 4ZHAA 2JJ1D 4B74A 1K21H 1TLDA 1LPGB 1NS3A 1Z8RA 2ZFQH 1MKWK 3RXTA 4ZUHA 4MVNA 4R8TB 5E0GA 3QTVH 2BY9X 3UUZA 2ZZUH 1W2KH 4ZKRU 1BOQA 1UVTH 2XWBI 2DE8A 2BZ6H 2G52A 4MG3A 5FPYA 4X1QU 2ZU3A 4CH8B 1PPFE 3SN8A 1LCYA 1OWHA 2OC0A 3PLPA 4LOYH 1S83A 2FLRH 3ZZ3A 4A1VA 1AI8H 2ZF0H 1KLIH 5EPYA 1BRBE 4JK6A 3LDXH 3D49H 2Y81A 3DHKH 1VITG 2A4RA 3GCHB 1JWTA 2R9PA 4JYUH 2BD3A 2KR7A 2P3TB 1XVMA 2BVRH 1P04A 1LVYA 1W3CA 1TOMH 3HGNA 2RDLA 1DM4B 4MQAA 1V2KT 1FY4A 2ANKH 1EQ9A 4NA7A 2QXHA 3R0FA 1F2SE 3RXSA 1CT4E 3M3SA 3Q3XA 1EJMA 1AVXA 4M7GA 1O3EA 2VJ1A 3TITA 1Y59T 1F0TA 1F0SA 2ZHEH 4IMQA 2C8ZB 1T7CA 2ZNKH 1O3AA 2OTVA 3ZIAD 3P8GA 1S5SA 3SGQE 1NRPH 4UONA 1O2OA 3BTKE 4I8HA 2AH4X 1TABE 2J2UA 6CHAC 2P93A 4FUJA 1IAUA 3GCHC 1AVGH 4NFEA 1DY8A 1BMFD 2A2XH 2TBSA 3SV7A 1OWIA 3V3MA 1XUHA 2W26A 1AUTC 1DFPA 1SL3A 1UTLM 2QF4A 3OEHD 4TY6A 1V2NT 2P94A 3H7OA 1NBME 1L4DA 3UWIA 3M5MA 3BTWE 3GY4A 8GCHF 1O2HA 1T4VH 1A1RA 1YLDA 2FZZA 2GDEH 2OQ5A 2NU4E 1GJBB 1GPZA 1H4WA 1HUTH 4ZKNU 3OE7D 5IDKA 4U30A 3E91A 4FUDA 3EBNA 3A85A 1SGCA 2ZPSA 3ZYDA 3RMLH 1SQTA 1SFIA 2XW9A 1GI8B 1WSSH 1YPHC 2HVXA 2VIWA 1LHCH 1CU1A 1QQUA 3LGUA 1QB6A 1RJXB 2VVVA 5HMAA 1ZSJA 1ABIH 4BNRA 2B0FA 1EUFA 3RXUA 1AE5A 3LJJA 4XD7D 2FYRA 1O2ZA 1UK2A 1XM1A 4KKDA 5FX5A 2K1QA 4O9VA 1QRZA 1Y5AT 1F0RA 1JRSA 2EY4C 3H09A 2DUCA 5LGOA 3N7DA 4K1SA 1Z1IA 1ZGIA 2ZKSA 3RU4T 1XKBC 1KXAA 3SV9A 1C2JA 2FWWA 2AIPA 3Q3KA 2PV9B 3U1IB 1UHBA 5KECA 4NIVA 5EQSA 4HTCH 5EJZA 2HWLB 1JXPA 3M7TA 4HGCA 2UUFB 1GVZA 5LH8A 3GY8A 2UUYA 1LO6A 1NM6A 1NU7B 1F92A 1O2YA 3VXEH 4Q4LA 1TGNA 1WXRA 5A8XA 1HXFH 3BIUH 1O5BB 1GBJA 3E8LA 1XUGA 5EQQA 3WW7A 1EASA 3MH5A 5CDFE 3K2UA 3KL6A 1QA0A 1O2LA 2ZU2A 1ZTJA 5JBAS 2WPHS 5C1XA 1TWXB 1DWCH 1WCZA 4ABHA 1SI5H 1IOEA 1HRTH 2OCVB 3ZVGA 3PMBB 1H1BA 1S81A 2F9UA 5DP6A 2IN2A 3TK5A 2VGCB 3GY7A 1SGDE 2Z9IA 2OK5A 5FBIA 2V3MA 4B76A 3A8BA 1L0ZA 3E6PH 1Z1JA 2L74A 2Q1JA 2O8WA 3M36A 3F68H 4LK4A 4ABEA 1C1RA 2ZU5A 4YO9A 1EFRD 4ZXYH 2ZTXA 1GCTB 2CN0H 1O2JA 4Y76A 2J98B 3EA8A 4ABBA 4X6NA 2SNVA 1ELGA 2F9VA 1OKXA 2VGCC 2AHME 1QTFA 3UTUH 4OS4A 4LZ4B 1OP8A 1Y5UT 1GG6C 4WJG2 1Y3XA 1P2NA 3V0XA 1ID5H 1O39A 1KLJH 3BN9A 3RXRA 1MCVA 3PO1B 1AO5A 1N6YA 1KDQB 5C67A 4JK5A 1OWDA 4RKOB 3F2FA 4IW4E 3G01A 4CREA 2WPDD 5FHTA 2V3OH 2VIQA 2OP9A 1MH0A 2ZFSA 1CGJE 4BANB 4K3JA 3F3BA 4Y7BA 2GMTB 3AVZA 3NKKA 3ZZDA 3LC5A 2B5TB 2WV9A 4AZ2B 1GBDA 4AGKA 2ZG0H 4BAMB 1IQLA 1UK3A 5FAHA 2QA9E 4JYTA 5JBCS 1ANEA 4XE4A 3WWFA 1YLCA 2OBOA 2UWOA 5FPSA 3S0NA 3FP6E 5DG6A 1UVOA 1AFQC 2D8WA 1GGDB 1HAIH 1GI7B 2A4GA 2Y82A 3UY9A 1VCQA 1SHHB 2KCYA 4JCNA 1OWEA 1DPOA 2HALA 2KZ4A 1ELBA 2TRMA 1CHGA 2SGQE 3ATKA 3MU1A 1O32A 1V2LT 1GI5A 1M9UA 7GCHF 1CA8B 1AZ8A 1MTUA 3MH4A 3NUMA 1P9UA 3KF2A 1EATA 5EXMA 2PGQB 5GCHF 4Z1MD 4MPUA 1UMAH
chains in the Genus database with same CATH topology
3E90B 4IMZA 1RD3B 2HNTF 1IQGA 3LGVA 1BIOA 1UCYK 3LU9B 4RKJB 4WMEA 4YT6H 1SGFG 3RXGA 4XFQA 4Y8YA 1C1MA 3LJOA 5TCCA 4ZKSU 1GGDC 1HAVB 4ABDA 3TH3H 2HLCA 4X6OA 5JB8S 2VVCA 2A1DB 4AYVB 1TMUH 4MLFB 1TBRH 1TIOA 2ALVA 5GWZA 1HIAB 1CHOF 1E38B 5JBTA 1C5LH 2PKAA 1J8AA 3SJKA 4HZHA 4E7RG 3T2NA 1AWHB 1P2IA 1TRMA 1EZQA 2V35A 3M7QA 4YOJA 4B75A 4E7NA 2ZDVH 3ATIA 1WQSA 3LGYA 1P57B 1XUFA 2EC9H 2FI4E 2ILNA 2P8OB 3DFLA 3OTJE 1LKBA 5DK1A 1V2WT 1THPB 2G4TA 4Q7XA 5FPTA 2J94A 3B9FH 3KNXA 1CT2E 2QYIA 4ZKOU 1MD7A 2JH5D 2OC1A 1UVUH 5EW1H 1S0QA 1T32A 2SGAA 1EKBB 2FEQH 1AMHA 4WY3A 1K1PA 1PJPA 1H9HE 1OOKB 1SQAA 4WVPE 4HFPB 1TGSZ 5K7RA 5GDSH 2QV1A 2A32A 1PQ8A 2AS9A 1H8DH 2NU1E 3QO6A 4K8BA 1QBNA 1RXPA 1XVOA 2J34A 5ABWA 1YCPH 1UJ1A 1FAXA 1LHFH 3SV2H 4F4OC 1LTOA 1RIWB 4E05H 2QGRA 1SGTA 1S0RA 1CVWH 6ESTA 2W7SA 3H5CB 1IQHA 1GCDA 3L33A 3PV4A 3U8RH 2Z3EA 5AVDA 1O3IA 3VFEA 2VIVA 1VCWA 8ESTE 1BHXF 4A92A 1GHVH 2XBYA 4X8SH 1QJ6B 4MNXA 4ABIA 3ZV8A 2UWLA 1EAIA 2J4IA 2ALPA 3VB4A 3SNBA 1JIRA 1EAUA 1ORFA 1V2TT 3ATLA 4IC5A 2GZ7A 2BD7A 1ETSH 3GDVA 5CHAB 2GZ8A 3SJ8A 2I6SA 2XC4A 1TGCA 4O3TA 1QA7A 3B8JA 2ODPA 1P09A 2H6MA 1MTNB 3O8RA 1LVMA 4FUFA 3EA7A 2Z3DA 2F9NA 2STAE 5F03A 1QR3E 2G8TA 4X8TH 3T62A 4CR9A 1Q31A 5HYOA 5DGJA 3U8TH 1A7SA 1Y8TA 1SFQB 3IITA 3M35A 2ZDAH 1GBAA 1VJAU 3SI3H 3LT3A 5AF9H 3VB3A 3F9FA 1O2KA 4A1XA 1HAZB 2PUQH 1K9OE 4Y6DA 5EODA 3A80A 3A7VA 2ZECA 4BTIB 2BX4A 1C2HA 1EOLA 1QBVH 3BTFE 2VIPA 1GI1A 4YTAA 2BVXH 1L4ZA 2W7UA 5H4IB 1YCPK 2OD3B 1HCGA 3URCA 1MMJN 3T27A 1QB1A 2QXGA 2PSYA 1GMCG 2C8XB 2ZC9H 1O2SA 2ZEBA 1FAKH 3ODDA 1HBTH 1C1OA 2ZQ2A 3QTOH 2WYJA 3A82A 1VJ9U 1OP2A 1FIWA 2WUCA 4OS2A 1EP6A 2SGFE 1XUKA 1GJ7B 1BT7A 2BLWA 1C1WH 4BXWA 2GCHF 3AW1A 3CENA 4D8NA 5GJ4B 1P9SA 4O03A 5DP4A 2WUBA 5T6GA 4K8YA 1T4UH 4FU7A 1ZR0A 3A7TA 4UE7H 4Q80A 3M61U 1KIGH 3W95A 1LPZB 2QY0B 4FUEA 1SSXA 2ZCLP 1O3HA 1GDNA 2GCTC 2Z9JA 1SLXB 3OY5U 4MNVA 5HXFA 1SPJA 1V2UT 3BEIB 4GCHG 1K1NA 1WYKA 3M5LA 4KTSA 3PLKA 1OWKA 1BJUA 3KHVA 2GKVE 3GCNA 1P10A 5A8ZA 3UOPA 2BVSH 2VB0A 1MKXK 1ZRKA 2PTCE 3RXMA 2AMQA 1J17T 3MMGA 1QL8A 2BDHA 4GHTA 2AGIX 2ZWLH 1G3BA 3CP7A 1NRRH 3ZZ5A 2FM2A 1W12U 5DJ7A 1MTSA 1MZDA 3QLPH 1J15A 1HIAA 5FCRA 1O2VA 1QNJA 3P8NA 1C5MD 4IC6A 1BMMH 4BAKB 1NZQH 3SUGA 1WV7H 2FI5E 3U8OH 1TMTH 1HAYB 4DJZB 3A8AA 5JYIA 3PROA 4K69A 3KQBA 3OX7U 1YKTA 3BSQA 1Y3VA 3SHAH 4YLUA 1GJDB 1E37B 4GPGA 1S6HA 3MHWU 1YF4A 3V12A 1EJAA 3NPSA 2EEKA 3MU4A 3SW2B 4A6LA 3EQ0H 2J95A 3RMOH 7ESTE 3MU5A 1G3EA 5EPNA 1J14A 1FQ3A 1LHDH 5C2ZA 3RXHA 3HGPA 1ZZZA 1F0UA 6LPRA 4OS1A 5L30H 4Q7ZA 3SU4A 3T26A 5A0BA 2CF9H 1O30A 1GVLA 1GJ6A 1NU9A 2TGAA 1VITF 1E34B 4YZUA 1Z8IB 1NPMA 4K2YA 5E8EH 1QBOA 3BF6H 4PROA 2R3YA 3QGNB 4ASHA 3SV6A 1SGPE 4X8VH 3UFAA 1EX3A 4U2WA 1A61H 1AD8H 2BD9A 2FPZA 3P17H 4BOHA 4YESB 5J4QA 5J4SA 1NRNH 2ZCKP 1KTTB 1O35A 4AX9H 2OINA 4YOGA 1V3XA 1SGYE 4FU9A 3SUFA 3DD2H 2H5CA 3E16B 1WAYB 1C9PA 1GDUA 1SGRE 1C5NH 1KXFA 1MCTA 4FUIA 4I8GA 2O8UA 2QIQA 2FOEA 2SGDE 5E0HA 3ENSB 3KGPA 4X6PA 3RXIA 4O3UA 5L2ZH 1GHBF 1NROH 3UQOA 3ZZ7A 4X1NU 1L1JA 2WV5A 2BXUH 2ZHDA 2OBQA 3MTYA 1WOFA 4DY7B 2BLOA 2G81E 5TCAA 1WTHD 3ZVFA 1A0HB 1GBBA 1ELCA 2BXTH 3GICB 3LOXA 1FY3A 1T8OA 1O31A 3FVFB 4LXBH 3GCTG 1MAYA 5A09A 4IBLH 4MNWA 1C1TA 1O3BA 1GG6B 1V2PT 4Y0ZE 5E0JA 1BQYA 1ABJH 1IQKA 4GAWA 3LGTA 3QGJA 1NTPA 4NFFA 2Z9KA 3VPKA 4MPVA 1BBRK 3GCOA 1S85A 4NG9H 3TLOA 1ANBA 4INKA 1NRQH 3PM3A 4FXGH 2ZU4A 1GHYH 1J9CH 2FOGA 2GV7A 1D6RA 1LDTT 2ZGCA 2BB4A 1TAWA 1YM0A 1K1IA 4FVDA 1RGQA 4K60A 4AORA 4ZH8A 1K22H 3S9AA 1C5QA 2XXLA 2GT8A 3ODFA 1CSOE 1A5HA 1GJCB 1PPHE 3RXJA 3F1SB 1V2OT 5LPFA 1BRCE 1HFDA 2A2QH 3BG8A 1SBWA 1GI6A 2ZDKA 2WPJS 1CBWB 2R3UA 1B5GH 1AFQB 1UTMA 1WU1A 5DP5A 1S82A 1GBIA 1ZJDA 1TPAE 1TMBH 5F6MA 4WWYA 1PPBH 4X2XA 2ZHQH 1P2MA 1F5RA 1O3NA 1E35B 1O2XA 3PLBA 1AUJA 4X2WA 2ZIQH 5BPEA 4NCYA 1KTSB 1SLWB 3BTME 4FUHA 1DSTA 3A89A 1TFXA 4X8UH 3V13A 1K2I1 2BYAX 2G4UA 1VITH 2WYGA 2BY8X 5GPIB 4DIHH 5A2MH 2ZO3H 2P3FH 1MTNC 3MNSA 2BQ6B 1Z6JH 2BOKA 1SQOA 1OSSA 1ESBA 3HKIB 3LONA 2F9OA 1AHTH 3RDZA 4I32A 1O36A 1X7AC 2UUKB 4FUGA 6GCHF 1C1UH 1O3DA 2AGGX 2BY6X 2F9BH 3TPIZ 1SGIB 3ZZBA 2HPPH 2BQ7B 3RXCA 1FZZA 3MWIU 3QK1A 1DUEA 1JOUB 3A8DA 1TPSA 2Y6TA 1GI0A 4KP0A 1GHXH 1BMAA 1A3BH 2SGPE 3PWCA 2H9EH 3CS7A 2TGPZ 2H9HA 4SGAE 1WBGB 4DG4A 4X2VA 1TRYA 2PW8H 1GHAF 4LZ1H 1XUJA 1DVAH 4U32A 2FS9A 3RM0H 2H2ZA 3A81A 1TONA 5EQRA 2PKSB 1DOJA 3GY3A 2PFEA 2Z9LA 1IHTH 2O8MA 3MI4A 1AKSB 1GWAA 3MNXA 1DICA 1NRSH 8LPRA 3SU0A 3SU6A 3ZV9A 1XKAC 2BOHB 5F8ZA 3M5OA 4R0IA 4ZHLU 1F5LA 4SGBE 3Q3YA 1DY9A 1G36A 2FLBH 3QWCH 2P59A 3U9AH 1AU8A 1HAOH 2B7DH 2IPHA 3HK3B 1QB9A 1P2QA 2G55A 1MAXA 4ZROA 1HJ8A 1S6FA 1UCYE 3GY6A 3PYHA 4TWYA 2PR3A 5BRRE 1TBQH 4Y8XA 1BRAA 4OS7A 1KXBA 5FXLA 1TNJA 1TNKA 2G51A 1ZPZA 2PUXB 4AB8A 1YPJH 1UTQA 2Q6FA 4BXSA 2H1UA 1VR1H 1EXFA 4FU8A 1ZOMA 2ESTE 1SOTA 4WH6A 1TE0A 3T29A 3V7TA 2ZP0H 2AIQA 1P2KA 2O9QA 1QHRB 4J1YA 4OS5A 4AYYB 3MH6A 2VWOA 1FIZA 2FS8A 2W3KA 1IQFA 1BTUA 4NZQA 4BTUB 1O2UA 2TPIZ 1YCPM 2W3IA 2ZU1A 3PWBA 3S9BA 3ZZ8A 3KIDU 2C8YB 2FTMA 1BB0B 2LIZA 3RU4D 1CA0C 4MTBA 1HV7A 2QAAA 2CGAA 1L2EA 4VGCB 1UTNA 2ZFTA 4AN7A 5EU8A 1NO9H 1GJAB 4ISIH 2FP7B 4NSVA 2Z9GA 2A5AA 1O0DH 3AAUA 3PMAB 3MH7A 1PYTC 1CHOG 1TX8A 3E1XB 3VB7A 1N6XA 4TPIZ 1DT2A 4BAHB 1Z8JB 2KAIB 2XWAA 3ATMA 2P16A 5EGMA 2VWLA 4NWLA 4UD9H 5T6FA 2CHAC 2FYQA 1O5EH 4DVAU 4Y8ZA 5DP8A 5TJXA 3NWUA 1QRWA 1C4U2 4HI3A 3JZ2B 3DT0H 1F5KU 3RXLA 2ZI2H 5B6OA 1C1VH 1TNHA 1AB9C 4AG2A 3MNCA 1O3GA 3Q76A 1Q3XA 3RXOA 3VEQB 4Z6AH 3M3VA 3TH2H 3MYWA 1MKWH 1QJ7B 1AE8H 1ESTA 1GI9B 2PLXA 1L1GA 3FAOA 4KTUA 1GMHG 5HM2A 3P8FA 2BLQA 1TBZH 1C9TA 3Q77A 1DE7H 1TPOA 4ISOA 1PQ5A 1B0FA 3I78A 4DT7B 3EA9A 1FDPA 1MUEB 2CHAB 1FJSA 5JPMH 2M5TA 2PSXA 4XSKU 1TX6A 1P12E 1V2MT 2ZGBH 4TYDA 1NC6A 4BAOB 1D3QB 1NESE 3SJIA 1IHSH 1YP9A 1TALA 2GVFA 2F3CE 1TNGA 2B9LA 1YBWA 1KYNA 4AG1A 1HYLA 3E0NB 1XX9A 3HATH 3SORA 4K1EA 1FPCH 1PFXC 1Z7KA 4A5TS 2WPLS 1GBCA 3DUXH 1GJ9B 3K6YA 5A0AE 2SFAA 1EAWA 1SG8B 1C5XB 2ZGJA 1FY5A 3GYLB 1THRH 3M5NA 4H6SB 1GBEA 3A7YA 1W0YH 1AQ7A 1LVOA 1DSUA 1TOCB 1V2RT 2J38A 3MU0A 1PQAA 1ZMJA 2BQWB 3UIRA 4BAQB 1O2PA 3ZZ4A 2BMGB 3KEEA 1C4Y2 1UTPA 3TH4H 1GBKA 1ZHRA 2B8OH 1DX5M 4XBCA 2ODQA 1NN6A 2HNTC 1JRTA 1KXDA 2PKAB 2XCNA 2FX4A 1O3CA 1A3EH 2GD4B 3C27B 2ZHWH 2VWMA 3EDXB 1A2CH 1HXEH 1NT1A 1BRUP 4AFQA 1C5YB 3SJOA 4ABGA 1ANCA 3GOVB 3A7ZA 2UWPA 2FMJA 2WPMS 1C2MA 2GT7A 2A5KA 1HJAC 1ZSKA 2BDYA 4ABAA 1W14U 3ZZ9A 1DUAA 4JZDH 1BA8B 3SNAA 2BM2A 3P6ZB 1P01A 1PPCE 3OSYA 4NIYA 3A88A 5EXNA 1PQ7A 2GZ9A 1G3DA 2TGDA 3SQEE 2XC5A 3M7UA 2QC2A 4DIIH 4GCHF 1G30B 4H4FA 4JZEH 3SOSA 1RRKA 4Y7AA 1KXCA 1QL7A 1ZHMA 3MNBA 1ZMLA 1FONA 1P3CA 2FODA 9ESTA 5C3NA 2A5IA 3TGIE 1K28D 3DA9B 3N7OA 1QFKH 1GJ8B 1HGTH 4E06H 1KXEA 1MU8B 2KAIA 1FXYA 2V6NA 2VINA 5EOKA 1SMFE 1HJAB 4YT7H 4O97A 2Z7FE 4NSYA 1Z6EA 5AHGH 1KLTA 5F8XA 2P8OC 3M37A 3SBKA 1LHEH 1YC0A 4YOIA 2BY7X 3UPEA 2Y5HA 4JZIA 1UCYH 1LPKB 1ZLRA 3FZZA 4NGAH 2BD2A 1EP5A 1A0LA 1KY9A 2FOFA 1EZXC 2QF3A 1KDQA 2HGTH 1LVBA 2PHBA 3RC4A 3OYPA 1BTXA 3LH3A 1LQEA 3RU4E 1O3JA 1P2JA 3QZQA 3BEUA 1T31A 1ELDE 1TX7A 3I77A 2YNBA 5GIBA 4ABFA 1QJ1B 1UHBB 1FMGA 5DP3A 5HM9A 1GI4A 3RLYH 1DXPA 1P2OA 3LGIA 4UFDH 4X1SU 1OX1A 3RLWH 2YNAA 1RIWC 1C2EA 2D1JA 3VXFH 2XRCA 1GMDG 4X6MA 2VIOA 1FV9A 1D3DB 1LKAA 1MBQA 1O2GH 1ETTH 1OYTH 2C3SA 3WY8A 1PPEE 3MO9A 3BTHE 1HAGE 1TB6H 4Y10E 1O5AB 3QUMP 3UNRA 1N1LA 3KQDA 3P8OA 4KGAA 4XOJA 2GV6A 4GHQA 1A0JA 1RTLA 1CO7E 4MPWA 5JB9S 1P11E 2EI6A 2VIDA 3JZ1B 1GHWH 3E0PB 4AGJA 5CHAC 1DXWA 3FFGA 4D7FA 3EYDA 2P3UB 3K6ZA 2F9PA 4ZXXH 4ESTE 1Z8GA 1NFUA 2G5VA 1WQVH 3MO6A 2FIRH 4I8JA 1OS8A 2ZDLA 2EA3A 1L1NA 1C1PA 2NWNA 2XYAA 1QGFA 1SGFA 3RP2A 1MKXH 2H5DA 3VB5A 4CRDA 1GI3A 1GJ4H 1MQ6A 2FDAA 1UO6A 4TWWA 1GBMA 3RMNH 3RXAA 3TGJE 2JETC 3OY6U 1GBHA 1UK4A 2LPRA 3ESTA 1EPTC 1S84A 2TIOA 3SO3A 1BBRH 5C1UA 3QDZB 2FOHA 2ZDMA 3TU7H 1ETRH 2FX6A 1ELVA 3A86A 5FCKA 1ANDA 2NU0E 1Q2WA 5A0C