5C6AA

Crystal structure of staphylococcal nuclease variant delta+phs l25e / n100e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKEMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVEEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25E / N100E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c6aA00
4K8JA 2EYHA 3MZ5A 3NHHA 4N9TA 3OMCA 1EY9A 4ODGA 5CR3A 4PNYA 5CV6A 2F0OA 1SYGA 2F0IA 5IGGA 2OF1A 2ENBA 5JOBA 2EY5A 1SYCA 3SR1A 1STYA 1EY6A 2EYFA 3EROA 5C5MA 5C4HA 2PW5A 1IHZA 4G57A 2EYJA 2F0DA 2PZTA 4KD3A 2EYMA 3ERQA 5CGKA 2QDBA 1SYEA 4LAAA 3U9OA 4K2KA 4PMCA 4NMZA 1KDAA 5DEHA 4F8MA 1ENAA 3MVVA 1STBA 1JOOA 3DMUA 2F0JA 1SYDA 5CV5A 4K5XA 1II3A 2PYKA 5IGFA 4PMBA 4J1MA 3S9WA 1EY5A 4NDXA 5CC4A 1A3TA 2PW7A 4WORA 2PZWA 2KHSA 2OEOA 4E6IA 5KIXA 2SNMA 3MXPA 4KY5A 3TP8A 5I9OA 3SK8A 3OWFA 4K5WA 4WRDA 3SK4A 4DGZA 5IGDA 5HURA 2F0HA 2F0GA 2KQ3A 3P75A 2EY1A 4KJOA 4F7XA 2F0NA 4ID6A 3RUZA 4R8NA 2LKVA 2F0WA 4KV6A 5CV7A 1EZ6A 2EXZA 3ITPA 4EVOA 2F0SA 2SOBA 4KY7A 1EYAA 3SHLA 3OSOA 4K5VA 4QMGA 3VA5A 5F2DA 2EY6A 2F0FA 4ZQ3A 1A3UA 3C1FA 2EYLA 4IZ8A 5IOCA 5KGUA 1U9RA 2EY2A 5IODA 5K5PA 3MHBA 5CV8A 3MEHA 2F0UA 1EY4A 1A3VA 5NUCA 5IGBA 3D4DA 5IGCA 1F2MA 1NUCA 2F0MA 5DAUA 3TP5A 1SNDA 1KDBA 3C1EA 3HEJA 1STNA 5KYLA 5M9OA 3D8GA 2HQEA 3SXHA 5CV4A 5I9PA 2F0KA 1KDCA 2O4XA 2M00A 3EJIA 2OXPA 2F0VA 3NUCA 4KJNA 1AEXA 4YIJA 5KRUA 1JOQA 5C3XA 3NXWA 2EYPA 4RKBA 3BDCA 5C3WA 3D4WA 2F3VA 1A2UA 5EGTA 1EQVA 4HTHA 1SNQA 3SK5A 4KTAA 1NSNS 4IUNA 4S3SA 3T16A 4DFAA 4EQNA 5HGTA 3QOLA 5IIFA 5J39A 3R3OA 1JOKA 5C5LA 4DU9A 4ZUJA 1KABA 3TP6A 5J1ZA 4B9XA 4QB4A 1SNMA 5CV9A 1SYBA 2F0LA 5I6WA 2RKSA 1ENCA 1SYFA 2RBMA 4B9WA 5ISRA 4J6HA 3NQTA 4KY6A 4IALA 1KAAA 4KHVA 1EYCA 1EY8A 3LX0A 4I65A 3D6CA 1TT2A 2F0PA 4NKLA 3PMFA 4DF7A 5J22A 2RDFA 3QOJA 3TMEA 3H6MA 4K2LA 1TQOA 3OMGA 4HMIA 1F2YA 4HMJA 4KD4A 4RKLA 3TP7A 5KEEA 1EY0A 3V2TA 5C4ZA 1A2TA 1EY7A 4K8IA 5IGEA 3NK9A 3EVQA 5E1FA 5EKLA 2SNSA 1EYDA 2F3WA 4TRDA 2NUCA 5KYIA 4QF4A 4OL7A 3BDLA 1SNOA 1JORA 1SNPA 1TR5A 2PZUA 3HZXA 4MIUA 4K14A 3DHQA 2F0QA 3NP8A 5C6AA 1STAA 5I6YA 4EQPA 4EQOA 4K6DA 4NP5A 1STHA 5E3FA 1STGA 4ZUIA 3T13A 4N9PA 1RKNA 1EZ8A 5EKKA 4ME5A 1F2ZA 3E5SA 5JAVA 3QB3A 3SK6A 2F0TA 1SNCA 4H7BA 2EYOA 2PQEA 3P1HA 2WACA 2F0EA
chains in the Genus database with same CATH superfamily
3A8KE 1OXVA 1GVPA 1X9NA 2F4VQ 1NNXA 2OF1A 5JOBA 3KLSX 2EYFA 3LNNA 3MA2B 1JR0D 4JI8L 3VR3A 1SE2A 4PMCA 2RCNA 4NMZA 2OTLA 4KHPL 1R4PB 2PMZB 1YBYA 4KKTA 1UUPA 4QIWB 4DR5Q 2Z6KC 2LXJA 1PA6A 2N78A 3DLLA 1EY5A 2UUBL 4DPGA 4KKSA 4LFCQ 3I73A 1B3AA 3S1MB 1B8AA 1ZYRD 2Q8IB 2F0HA 1N33Q 4BXXH 1VF5C 1BKBA 3BVGA 2F0WA 3G4SA 3KF8A 5H1SE 4B3RQ 3I55A 3SHLA 1DONA 2EOTA 4ZRZA 1E2ZA 1E1TA 2EY6A 2JSOA 3L9AX 5KGUA 1MSHA 3K7AB 4KI0A 2VNUD 5NUCA 5IP7H 2NN6H 1B4OA 2K33A 3K0XA 3G7LA 1IW7C 2KUMA 3H15A 1BBWA 4B3SL 4R4OA 4LF8L 2WB1E 4PG3A 2I07B 5HGQA 4OONA 4LNQA 2RDHA 5IT9c 1PFSA 5C3XA 4V190 4UP8A 3UDXA 2VS1A 4OIKA 1FVIA 2L1BA 4DR7L 1PRTC 2B2WA 4JI6Q 4CGYB 5IIFA 2XWBB 1XJVA 1G6ZA 1V1PB 1PYWD 3A56A 1I4XA 1LUZA 2B8GA 1PH2A 1CA5A 5IWAQ 4YWKA 5FOBB 2A5HA 3PO2H 3L3OC 1SMYC 2WAQG 3G48A 1HUNA 1HFGA 1D5MC 1EIYB 4A3GH 4GN5A 3UE1A 5JJIA 3TMEA 1EU4A 2DY8A 2LMCB 5KEEA 3GV3A 3HRZC 1H9JA 3F8TA 5BR8Q 1Q81C 5GADC 1PHJA 2NBFA 4GLXA 5EPKA 4DR4L 2J4XA 1RIPA 1YHAA 1J5EQ 1F2ZA 3S1QB 3J80i 2VB2X 1CUKA 2F0TA 2NVTB 4IJHA 3M7NA 2K4KA 3I4NH 5GROA 1RF2D 3EQLC 2WV6D 4A3FH 2Z6BA 3DEOA 2SDFA 3BZCA 2F0OA 2VW9A 3EIVA 2VZAA 3EN2A 4RWSC 1STYA 4Q5VA 1RHPA 1XMOL 4O42A 2JA6H 2EYJA 2IL8A 5CGKA 3Q22A 4DK3C 1YNJC 2KA7A 1V1OA 4MN3A 3MFYA 3SEBA 2K52A 1BBUA 3TZUA 2E2DC 5CBEE 3P7JA 1VQMA 1K83H 1VQGA 2E74C 1Q1BA 2KHJA 4XIGS 1IBMQ 2D2CC 1PTOB 4B3TL 3TS2A 2K1BA 3MXPA 1I6VC 5IGDA 4IPDA 1N32Q 1LLRD 4TVAB 1JB3A 4CHTB 4A3KG 3HFZB 3KF8B 1DXMA 1JJGA 1RTOA 4BY7G 2UUAQ 4OIJA 3AMUA 1UAPA 1FNVA 4C3JH 3GTQH 1A3VA 1RJTA 4A3EH 2F0MA 5M9OA 2UU9L 3FHWA 1VQDA 1HZAA 3Q24A 4R4TA 4A4IA 1Y1VG 4B3ML 2H5XA 4DUZQ 1BNZA 1GUOA 4A3KB 3NXWA 2EYPA 3R8BA 1EWCA 1LT5D 4BY7B 5E4WC 1WCMH 5LHY1 1H95A 4LF4Q 4DFAA 5HGTA 3PUYA 5C44G 1MBYA 5C4JB 3J7A5 2YV5A 3L0OA 3T1YL 1YZ6A 1FJGL 2KENA 4IFDJ 4BA1I 3A7AB 1CI3M 1BXTA 1PV4A 1Y1VB 2HUGA 3U50C 1EY8A 4I65A 2HDMA 5J22A 1NAPA 1VQEA 1LTLA 2QILA 3V2TA 5C4ZA 3IFDA 5C0XH 3K58A 4DN4M 1D6EC 4FXKC 4TRDA 5C44B 1Q7YC 2EQSA 1I4HA 4NXML 2VQEL 3DHQA 4L5SA 1SRUA 2K32A 4JI7Q 1D1IA 4ME5A 1LTTD 4JBWA 1XYIA 4IFDI 2Z4IA 2B63H 1KL9A 5DM63 3ICEA 5IY0A 2AWOA 1DJRD 2Z9HA 4C3IG 3S1MH 4P2CB 5D3IB 4PNYA 4R1JA 1D5ZC 3CCVA 2HIVA 1YHBA 1TWFH 4DNRB 1HZBA 4ZLTF 4IJLA 1B2TA 2B29A 1J6QA 4DV5Q 4CDEC 2WAQE 1TWCB 2BE5C 3D3RA 2O2LD 1ENAA 3A8JE 3K7AH 5EBDA 4CBVA 1F9SA 3S2DB 4C3IB 3GTGB 1P8LA 4Z9CB 5KIXA 1BCPF 3EFXD 1NMGA 3TP8A 2XVSA 1WOCA 4GOPC 1UEAB 3NTHA 1VQCA 4PZ6A 3FKIG 4DV0L 5JEAG 4QCLA 1CSPA 4P75A 3PF4A 1K28A 1W6JA 3UDIA 4HAEA 1C48A 2FMMA 4ZQ3A 1PTOC 1BR9A 4K6LA 1LTBD 1EY4A 1BCPB 3CKIB 2L0CA 2YTVA 1NUCA 2HD3A 2E2IH 1JJCB 5IE8A 4DR2L 1OTCA 2EJMA 4GKJQ 4ME3A 4LFBQ 5KRUA 3FPPA 1G2SA 4TSSA 5CORA 1GUGA 3LWEA 3Q6SA 1GHJA 3R3OA 1YHQA 1TY0A 1QILA 1ASYA 3S17B 3W1GA 1PFBA 4YHHL 1IBKQ 3S1QH 4IUQA 2K5QA 2OQ0A 3NQTA 4KY6A 3MAQA 2NVTH 2Z8LA 2KCCA 2NZOA 1TS3A 1NY4A 1SROA 4J15A 4TQUS 2B2WC 4G7ZC 4JVZA 1CSQA 4OEMB 4XDXA 5FLXL 5KYIA 4QF4A 4O2DA 4CDCC 3HZXA 1DOKA 1PLFA 1STAA 1TU2B 4OELB 2Q2UA 1GHKA 2DUDA 1A15A 2QDLA 2A73B 2VQFL 3UI2A 1XPRA 2Z0SA 2E76C 2LXKA 3S1NB 2RCFA 1I6HB 2HQLA 2N3SA 4IPGA 2P5ZX 4A76A 3FVQA 3N52A 2NN6I 1F9RA 2F0IA 4RCNA 4XYQA 3E6ZX 4QL5A 2A6EC 5CBAE 1SMXA 1WI5A 4A75A 3AYHB 3GTPB 1Q46A 1STEA 4KD3A 3CD6A 1SLJA 1SYEA 3F2CA 4G7HC 1IZ6A 2KOLA 4K5XA 1H9KA 2UXDQ 1D1KA 1ICFB 2E75C 2OT2A 4LFAL 3HKSA 3PUWA 3HOUG 1ASZA 2I5LX 2KCTA 1L0XB 2KQ3A 4U68A 4JI4L 3PCOB 1VQJA 4BY7H 3FP9A 2A68C 4EQ5A 3A5UA 1ML0D 5CV7A 2UUCL 1VQAA 5C4JH 2SOBA 1Q82C 1U4LA 3OSOA 4R4QA 1JWUD 4X66L 4JI3Q 3CPFA 5IOCA 1Y1VH 3MC0B 2I0QA 3HOUB 3QO2A 5FLXc 4OHJA 4UAIA 1GXDC 1HCZA 2NVYH 5EAYA 3S15B 3T4AC 2F3VA 1QNKA 5C44H 1PZJD 1YI2A 3QOLA 2PI2E 1SE8A 2CHBD 2QGQA 1UEBA 3SGIA 3T1HL 5FLMG 3K0YA 2F0LA 4AQYQ 3WOFA 3ZYYX 3DWPA 4J6HA 3W5OA 1PYSB 3HP3A 3GO5A 3KOJA 3FRPB 1VQ4A 5IGEA 2R93G 1JCKB 1VQPA 4A3LH 4EQPA 1MHWC 4CKEA 4DR1Q 1CTMA 2A1AA 2UXBQ 1JWMD 2ZT9C 4GN4B 5EKKA 3SVMA 5I2XA 4LF5Q 5DM73 1GJXA 3MXUA 2JA5G 4DV1L 4WJ3M 1N34Q 4LF9Q 2WINB 2HDLA 3S2DH 2ZXPA 3MZ5A 3F2BA 1MKHA 4QGUA 2KECA 2R93B 1XMQL 2EJFC 1B44D 3C46A 2N88A 1PH3A 1BF4A 4POFA 5DLQE 1X54A 3BVMA 3RZOB 1EEFD 1EY6A 4XYOA 3FDTA 4LF6Q 1HTPA 1HQMC 2F0DA 3H3VC 2EZVA 2JA5B 1DZ1A 4K2KA 3H91A 4UPAA 2XWJB 3BVZA 2IY5B 3I91A 4PMBA 5BN5A 1O7YA 4WORA 2E2HB 2F4VL 2EXDA 5EJWA 1LM0A 5T1IA 4OX9Q 1YVCA 3N6RA 3PV0A 2ATWA 3FKIH 3P75A 1RD9D 4M1UB 1JWSD 1JQYD 4YCWA 3K8AA 1E2VA 1WVLA 1J9OA 5D65A 5IP9G 1EYAA 4K5VA 3VA5A 3S17H 4DR5L 4DAVA 1A3UA 1FNWA 2B2TA 3I90A 1EFWA 1ET9A 1KQSA 4DK1A 1O78A 4LFCL 3TP5A 3TDQA 4QQBX 2MPMA 3D8GA 2MP1A 2M00A 1N33L 1AEXA 3D6WA 4LW1A 2E5LQ 3IKJA 3OIQA 4B3RL 1BUVT 1Y1WG 3T16A 2JA8H 1FR3A 1GOZA 4HIDA 3W1BA 3JC66 3L7ZC 2MO1A 5ELNA 4B9XA 5KNDA 1PRTB 3TBIB 1G8ZD 5IYCG 2FFKB 3CQZB 2K5NA 5FO9B 1EL0A 4OO1H 1SR3A 5ELOA 1EY0A 2K5HA 1Y1WB 1G51A 3EVQA 2YU9H 4JI6L 1W6KA 5KNBA 1VQNA 4HJ8A 1SNOA 2KCMA 3J80E 5IWAL 2XRSD 4RCOA 3Q23A 3GTPH 4N9PA 5C4XG 3KJOA 1KTKA 2TMPA 2NB0A 1VQIA 3RLFA 2B2YA 3GV6A 2BCOA 3BYTB 2ICEC 3OMCA 4DAMA 5BR8L 3S1RB 3KDFA 3CC2A 1ILPA 2IPKD 3GTLB 1AP0A 5D14A 5CMDA 2BOSA 4RHSA 2MO0A 1ESFA 2D5DA 4JV5Q 5C4XB 1IYUA 1DOLA 1IHZA 1TS4A 4G57A 1YJNA 4P71A 1J5EL 1ZKOA 2EE1A 3OPOA 4A3DG 2L9HA 4F8MA 1KAWA 3D31A 5LMUL 1PZKD 1SYDA 2R7ZG 1K0SA 3J7YW 2FXQA 4NDXA 4X3SA 3SE0A 2DN8A 3HOUH 1HPCA 1WTWA 2SNMA 1E22A 3ULJA 1KNEA 3SK8A 3OWFA 1LTSD 4AYBG 3S15H 4PQXA 3KJPA 4RGTA 1SJED 2RF4A 3HOVG 2PQAA 4L8JA 3NTKA 4A3DB 2EXZA 4EVOA 4GOPA 3M4YA 2R7ZB 5JJZA 1PMRA 1IBML 5K5PA 5ELCA 2F0UA 3KLSA 1AN8A 1K0RA 2DY7A 3DWAA 3HEJA 4H13C 4AYBB 2HQEA 4A3BG 3U4VA 1N32L 2IWHA 4HJAA 1JOQA 2OQKA 3HOVB 1M1KC 4RKBA 1V9PA 1QZGA 2NWGA 4JI1Q 2N49A 2UUAL 4IUNA 4EQNA 1YNND 5M5WB 2AQ2B 4WJ4A 2RHSB 2JP1A 1ONLA 1A62A 1G6PA 1F9QA 4A3BB 4IALA 3RZDB 4DXGA 1EYCA 5FJ8H 4NKLA 3X3NA 1W2BA 3CU7A 1EFID 1C4QA 4DUZL 2XRQD 3TP7A 2R93H 3W3AA 1EYGA 4A93G 4LF4L 2ICIA 1EYDA 1B9MA 4HJ7A 4FXDA 2IW3A 3RZOH 2WP8J 4K14A 3MWYW 2Q8TA 1I4PA 4K6DA 3CCQA 3VR6A 5GAEC 2JA5H 1EQQA 4I7AA 3CRLC 1EWHA 2J7ZA 4RMFA 1EQRA 1O7LA 2C9OA 2KJXA 1IKLA 1HNZQ 3SDZA 3QIAA 4A3MG 4K8JA 4P73A 4A93B 2EYHA 2IHEA 3KDFB 2JK8A 3UDFA 1H9RA 3NENA 1OXXK 2EY5A 1AE3A 3K6OA 2K5WA 1N8RC 4A3CG 3OIPA 4JI7L 2MGSA 3K59A 2Y0SE 1NTGA 1Y8OB 2WFWA 3X3MA 3HKZG 1NCVA 1SAPA 4LAAA 3TZDA 2A69D 3I2ZA 4RH6A 2F52A 4A3MB 1L1OA 5AJ3Q 5IGFA 4GS3A 4J1MA 1I4RA 3VR4A 3PSIA 3H0GG 2XTIA 4LJZC 3SK4A 3HS0C 1PTOF 2F0GA 4KJOA 3R2IA 1IYVA 5HY6A 1OO9B 1S72A 3A5ZB 4DV5L 1QVGA 2LKVA 5IP9H 3HKZB 4GOPB 4KV6A 2B2UC 3FMCA 1L2FA 2MJ8A 4IZ8A 2PO4A 2JN4A 1WD1A 3PQIA 3H0GB 5EQ0A 2A74C 2G5DA 4IOAA 3C1EA 1LACA 3T51B 1EOVA 2FHTA 1XNRQ 3C3LA 4FVMA 1U4PA 1S5BD 1N36Q 1WTRA 1HRJA 1B3QA 2JYOA 1TWAB 2B2TC 4KTAA 4OGQC 3KBGA 3Q8DA 1KABA 2HCIA 1E7ZA 1B1ZA 4CJ2C 2RKSA 1UE1A 3LWUA 1AZQA 5IYCH 3J81E 2PMZE 4QIWE 1GO3E 3S14B 4GKJL 3KK7A 4AYBE 4LFBL 1LTAD 1UE5A 3T53B 4K2LA 1TQOA 3OMGA 4HMIA 1I94Q 4BBSH 3S1RH 1A2TA 1WYDA 3M9BA 5EKLA 1O7ZA 2IHFA 1BO0A 2QA4A 3IFTA 2R7DA 4POGA 5C4XH 1RDPD 1T5XD 4DA2A 5JPMC 1IBKL 3H09A 4HSVA 5IYDG 2O5JC 3PUXA 1QJOA 3QB3A 1HZ9A 2F0EA 3CCJA 3BYYB 1EY9A 4ODGA 2XN9C 5AFWA 1KLUD 1G91A 1HZCA 2QKIC 4RG1A 2JE6I 1BCPD 3IRBA 1FGUA 2B2YC 1CQVA 1L1OB 4QUCA 3HOYG 2PNRC 4UHVA 4FNFA 4IUTA 1S40A 5ELFA 1EWIA 5K36G 2EPBA 5JJLA 5I9OA 1ILQA 2Q2IA 4XTCS 4BS9A 4X64Q 1TXYA 1S5ED 3RD4A 5I4DA 4BBRG 2NTSA 4ULLA 1GM5A 4OO1I 4GKKQ 1XTCD 2FMCA 4DR4Q 3M3YB 1CFMA 3PIP3 3OOCA 3HOYB 2XSCA 2A6HD 2UXDL 1QOHA 5M5YB 1U9RA 1E1OA 5I2YA 5IGBA 4HJ5A 4HN7A 3QG1A 1D5XC 1JT8A 1KXLA 2F0KA 2VY3A 3EJIA 5JPNC 3FPUB 1O7IA 3STBD 1E3PA 4BBRB 3LGJA 3CCRA 4LUZA 4JBJA 1X3GA 4JCVE 1ZYRC 1A2UA 5EGTA 1SNQA 3HKZE 1IBLQ 3D0FA 2A8VA 4JI2Q 1JOKA 4JI3L 1Z6HA 1IYJB 3L2PA 2CW0D 2SEBD 1SEBD 1HH2P 3NELA 1K3BC 2H1EA 4J8QA 4FXGC 1X32A 1Y8NB 3GTJB 4A93H 1ET6A 1X55A 3QR8A 4RKLA 5A2QE 3S2HB 2Z4HA 4L5RC 2AUKA 3NK9A 2NYZD 4LUVA 2NUCA 4IPHA 3WDNA 1YNXA 1CZWA 1D8LA 3NP8A 1PVOA 3PIOA 5E7NA 1B53A 4AQYL 3ND8A 1I4QA 1G2TA 3V96A 1YJ9A 1IXRA 1ZEQX 1QNUA 3RLOA 4A3MH 4ABNA 2EYOA 1K8MA 2MNAA 3LX0A 1JC7A 4ZYSA 4DV2Q 1PH7A 1OXUA 3J81i 1VF7A 1I3QB 5CR3A 4A3CH 3G6EA 1SYGA 2ZXRA 3PIO3 1R9TB 4DR1L 4IUVA 4GLVB 4BY1G 2UXBL 4LWCA 2QW7A 4L5QA 1WJJA 4C3HG 1K9MC 2EYMA 1YITA 2DNEA 3PO3G 1K8GA 2F0JA 1N34L 1S5DD 4LF9L 4WJWA 3HOZG 3H0GH 4PZ8A 3AQQA 2MHVA 2KEEA 1PTOH 3WWVA 4DGZA 1ICWA 2B39A 3A8IE 3ONAB 4H44C 4QUFA 4HIOA 2AQ1B 4BY1B 2CWAA 4C3HB 4LF6L 1EZ6A 4ILWA 1L1OC 4WFN3 3PO3B 1F9PA 1N9WA 1XPUA 4LUOA 3HOZB 3A74A 2CQAA 3C1FA 3DM3A 3CPWA 1H9SA 2G9HD 1VQLA 5DAUA 1KDBA 1HA6A 4OX9L 1DOMA 3OW2A 2AMCB 4DNTB 4DV3Q 1NR4A 4JK1C 1NJIC 3CCSA 3D4WA 2NZHA 3H94A 4A3KH 1XXGA 4K0KQ 2Q2HA 3ERSX 3CCMA 3KLWA 1QVCA 5L37A 5J39A 4X62Q 2B3GA 1U0LA 1TS2A 1CT1D 2JXMB 4QB4A 4R4IA 2JJQA 3NPPA 5CV9A 1VQHA 4FF3A 1Q8KA 2VXWA 1VQKA 4HSPA 1OXSC 5C3EG 4KHVA 1KAAA 5E4XA 4CKBA 3QOJA 4DAPA 2E5LL 1TVXA 4Y52H 1SJHD 1NE3A 4DR3Q 2SNSA 1Q3LA 3BZDB 3GTOB 1ESRA 3PUVA 2ZM6Q 2UXCL 4ZKBB 1E24A 3CMEA 4DUYQ 2F4IA 4X3KA 4DV6Q 1AH9A 1M4VA 4IUPA 5C3EB 2EIFA 1Y14B 5COYA 4RA8A 3VR2A 1HR0Q 2NVQB 1OXTA 3AFPA 3JAME 2GVBA 3P1HA 4E6IA 3CRKC 5JVH3 3NHHA 3TREA 4GZYC 3BS1A 5CV6A 3RMHA 4BXXG 5IGGA 2I5HA 4YY3Q 1JMCA 5IYBG 3SR1A 1B9NA 1QWYA 5G3LD 1UNSA 2WKDA 1G291 2EJGC 3PGZA 4FF2A 1PZID 3HOYH 2RVLA 1L0YB 4JI0Q 4Y7NB 1TWCH 4O0AA 2Z1CA 1IW7D 2K6AA 4JG2A 1II3A 5K36H 4JBKA 2NN6G 1A3TA 1EOTA 4C3IH 3GTGH 4KY5A 2RA4A 4K5WA 1S5FD 4V0BA 4X65Q 1BQQT 1PRTD 2BA0A 4JV5L 1VQFA 2D0OA 4HCEA 2JA7G 4R8NA 1HHVA 4XQNA 1M8AA 5C0XJ 4XXEA 1LABA 2F0SA 2B2VC 1SMYD 5LMNQ 3DEPA 1TIID 1KHIA 2K50A 1HJPA 1F2MA 2B2UA 3OTOQ 5T1GA 4IURA 4A3GG 5IT9E 5G3LF 3GTJH 1X3QA 4YIJA 3S2HH 1IL2A 2JA7B 5FO7B 5C3WA 1X3EA 3DWQA 3GDEA 5JEAH 3TP6A 3A7LA 1Y8PB 5C0XI 4M8AA 3HOWG 3S24A 5KNCA 2BH8A 4U673 5EBCA 2CWPA 2OCEA 4QJFA 4A3GB 1BVSA 4DF7A 4DK6C 1PRTF 4FP5D 2IX3A 2RSNA 3I4NG 2ZXOA 1CKOA 1GKHA 5GAGC 1A6XA 2K7VA 4KD4A 1D7QA 5ELBA 3CC7A 1HNWQ 2WB1G 4JI1L 4A3FG 4K8IA 3NWTA 1GUTA 3D4RA 4NW2A 4P72A 3I72A 1AFPA 4JI5Q 1R9TH 4MIUA 1Q8IA 3HOWB 1YNJD 2AQ3B 1S3OA 1CHPD 3U58A 4P74A 1PH6A 1VQ7A 5M3MG 3TQYA 4FO2A 3CAMA 1SE3A 3A54A 3I4NB 3H3VH 3S1NH 2C5CA 2WACA 2K01A 2WB1B 4A3FB 3HOXG 1I6HH 1BOSA 1XNQQ 4JPBW 4EGVA 4BY1H 4F87A 3BDOA 3EROA 4C3HH 3I3CA 5M3MB 1Q86C 2LS01 1LTRD 3PO3H 1LT4D 3U9OA 4JYAQ 5LL6S 3C2PA 1K83B 1M90C 3MVVA 3HOZH 4PMWA 3OYYA 3TEHB 1HNZL 1SBBB 4MZ9A 3ZJYC 4C3JG 4DV4Q 4HIKA 1VQOA 3HOXB 4H0LC 3PUZA 1TS5A 1T5EA 1HA5A 2KHSA 1MGSA 3JAMi 3CP0A 4UDUC 3RN2A 2ALYB 3J7AF 2F0NA 4ID6A 3VR5A 1VDZA 2A19A 1H9MA 3RLNA 4KY7A 1QE6A 1PH9A 4C3JB 2JQOA 1RL2A 2EYLA 5AJ3L 2EY2A 2K04A 2LY7A 2ZTEA 1PFMA 4DNIA 4FYDA 5M5XB 1STNA 3BG3A 1X3PA 4AIMA 1FNUA 3SXHA 5CV4A 3GQBA 2PCFB 4JOIC 1WCMB 4HR7B 2QCPX 2MQHA 3I4MG 1CHQD 1CZGA 1QB5D 5M3FG 1CM9A 4DXFA 1T9HA 5BN3A 1HXYD 2NVXB 4HCSA 1I50B 4BA2I 5C3EH 1NMFA 1B7YB 4N8FA 1XNRL 1Q12A 1PH8A 3MXNA 2HCCA 1N36L 1KRSA 3H6MA 5JVG3 2IT1A 4KMUC 2QF7A 3I4MB 4MTNA 5M3FB 1ENFA 4X3UA 5BN4A 1CQFA 1U4MA 1GUNA 4R8IA 3M85A 1SNPA 3F2DA 4NXNQ 2DGYA 2R92G 3R93A 5E3FA 2BE5D 1FGBD 5FLMH 5ELDA 2LSSA 3E5SA 3AEVA 2B63B 1MD2D 3I4LA 5FO8B 4Y7NH 1XPOA 4UP7A 2V1CC 2PQEA 4F88A 2XGTA 3OWEB 4MTKA 1I94L 3P20A 4N9TA 2GA4B 1LO5D 1TWFB 2O5IC 4QY7A 5IYBH 3E0EA 2HHHQ 2R92B 3CC4A 3UDGA 2KEDA 1X65A 1MSGA 1TKWB 2PZTA 2QDBA 1PTOD 3K5MA 5EPLA 1STBA 1JOOA 5CV5A 4C1NK 1QVFA 3J80L 1EUJA 2GVAA 1I5FA 2DJFC 5CC4A 4DV7Q 2OEOA 4C2MB 4GN3B 3NWSA 1HNXQ 2M2LA 2E2HH 3VDYA 2HIXA 3RNUA 2JA7H 2NTTA 3U9SA 2VUMG 3RUZA 3J7AV 1FL0A 3HG9A 1KRTA 4OWXB 2JEBI 3I4OA 1PYBA 1VMPA 2F0FA 1AZPA 2K14A 1DYQA 2V4DA 5IODA 4JBMA 4DR6Q 3MHBA 3AFQA 4ZKCB 2KCNA 2E2IB 2B8FA 3RN5A 2FJ2A 5I9PA 1KDCA 4X64L 2R7FA 2VUMB 2F03A 4O1NA 3V05A 2RDGA 1LT3D 4GKKL 1E2WA 2PQAB 3FEWX 4LF7Q 3URYA 3O13A 3MXGA 3DM1A 1Q90A 3HOWH 1X6OA 2WAQB 4G4KA 1SYBA 1A63A 2N8NA 1YJWA 2RHQB 5ELEA 2RBMA 4ALPA 2K5VA 1RTNA 3MXNB 5LMUQ 1K8OA 1TT2A 4TKOB 3TRZA 2RDFA 3BU2A 3CQZH 1EIGA 2LFNA 3F1ZA 4HMJA 1CKNA 1EY7A 4OWTB 2A6ED 1IBLL 2F3WA 1Y1WH 2L4NA 4JI2L 1RCVD 4B08A 2WIIB 1F2LA 2L11A 3J80c 1STGA 4ZUIA 3T13A 5JEAJ 5M3MH 1RKNA 2K28A 4GNXC 1A8VA 4JI8Q 2BH2A 1HTLD 1QG7A 3ULPA 1C7YA 4KHPQ 3HOXH 1SNCA 1TWGB 4JC0A 3E9IA 1E0BA 3KF6A 4H02A 2UUBQ 2GN5A 5FKAC 4OWWB 3M4PA 1IL8A 2A68D 4CDFC 3GTLH 2ENBA 2E2JB 2OTJA 2X6GA 1LTID 4DK0A 3CXCA 2PI2A 4HEDA 1KC8C 5DEHA 1DM0B 3I56A 3NSWA 4DV2L 3I8ZA 5M5XH 2K75A 2PNHA 3BJUA 1LT6D 3A55A 4B3SQ 4WRDA 4LF8Q 1SFOB 2YYZA 3GD7A 1PH1A 1VS0A 4KLKA 3ER0A 3CMAA 2IX0A 4DR7Q 4A3DH 1FYCA 2QEJC 4QMGA 2NVXH 1I50H 2R7ZH 5IGCA 1XWEA 3PIPA 3D4DA 2EDGA 1LYLA 3R2TA 4G7OC 5FLXE 4A3JG 2B2VA 4FDBA 5GAHC 2NVYB 2OXPA 4IN3A 2YTXA 2F0VA 4A3IG 3H3VI 1DGSA 5DNFA 1EIHA 3I4MH 4KKUA 5EPJA 5M3FH 3HOVH 4HTHA 3SK5A 1KNAA 3TS0A 1UE7A 2I46A 1QZHA 4PV1C 1L0WA 4A3LG 5J1ZA 1SNMA 4Q0FA 5M5WH 1VQ9A 4JW0A 1ENCA 2D9UA 4HIMA 1SYFA 4B9WA 5ISRA 1P16A 4XQJA 4A3JB 3NE5B 3VYTA 4A3BH 3RZDH 1PH4A 1A0IA 1S4ZA 4A3IB 1CKNB 4DV3L 1F2YA 2AKWB 4PZ7A 4K0KL 2CCZA 1X56A 1TWHB 2R92H 4OL7A 4X62L 4IO9A 2PZUA 4BWGB 1U4RA 3CCUA 1YNNC 1RODA 1XMOQ 1EZ8A 2D0PA 2I5MX 2YTYA 4X6AH 1GUWA 1QUQA 3KF6B 1WTQA 4YCUA 4C2MH 4CDDC 4DR3L 1JB7A 4B3TQ 1R4QB 1KIXA 3RR5A 3J81L 2ZM6L 3NQIA 4DUYL 1LTGD 4LMQD 1SYCA 4DV6L 5C5MA 2PW5A 3KLRA 2ID0A 1HR0L 1JE4A 4ZCKA 1K3RA 1PDQA 1Y69U 2WKCA 1WTHA 1WD0A 2UU9Q 3FKIB 4B3MQ 2VUMH 5HURA 4YY3L 2EY1A 2RQXA 3GP7A 1HQRD 2JA8G 3HGBA 1UWVA 3AU7A 4JI0L 2DNCA 3CCLA 4LF5L 4IFDG 4C1NI 3PF5A 3T1YQ 2KVMA 2A69C 5CV8A 1FJGQ 2K03A 3M7GA 5KYLA 1JJ2A 1BBXC 4IQZA 1WTOA 2O4XA 3E0JA 3NUCA 4X65L 5CYUA 4RGMA 3M4QA 4OO1G 1WTPA 1I4GA 1MI2A 4I7ZC 2L15A 3EA6A 3S16B 1C0AA 2JA8B 2OWOA 1EQVA 1EQTA 3EBEA 1WTXA 1TWAH 3QWNA 3J7ZC 2N55A 3GTKB 4JOIA 5LMNL 2VQEQ 4NXMQ 3MTSA 4KN4C 4KHZA 1GUSA 1SXTA 3NBIA 3OTOL 2ZJPA 1J8IA 3J81c 2F0PA 3S14H 4RGOS 1TWGH 3K7UC 2YU9B 2D62A 2HT1A 4KN7C 3CHBD 2K5DA 2JEAI 2AWNA 3BDLA 2E2JH 2TSSA 2QEXA 1JORA 1V43A 2IX1A 2F0QA 5J3BA 5C6AA 3M4OB 4EQOA 1VCIA 3KYHC 1DD2A 2NZ1D 2BDOA 3VA7A 1MJEA 3VYSA 3JAMc 1DCZA 5JAVA 3F2UA 4AH6A 3TN2A 1QUQB 3VYUA 3NEMA 3GTMB 1HNWL 3K5LA 2Z6KA 3QJYA 1AE2A 4JI5L 1SFOH 1B70B 4L5TA 4HJ9A 1VQ8A 2F3IA 2KBNA 4IUUA 5EKIA 2FINB 1Z7TA 1UE6A 1U5KA 5A2QL 2VL6A 2ZTCA 4DV0Q 3ERQA 3NBHA 4DAYA 4CJ1B 1YIJA 1XX8A 1C8CA 1EEID 3E9HA 5IYDH 4L6TB 4APVA 1CK1A 2AHOB 2PPBC 3TSSA 2X69A 3KBXA 1SSOA 2VB3X 1VQBA 2PW7A 4DKAC 1XNQL 3MFGA 5A35A 4DR2Q 3CF5A 4F7XA 1GD7A 2CFMA 3KUPA 1MJCA 4EX5A 3ITPA 4JYAL 1BCPC 2G9DA 3T56B 3M3YH 4DV4L 4OXPA 1IKMA 1B50A 2R3ZA 4CKCA 4A3JH 5M5YH 4YHHQ 1SNDA 3WOEA 4KK7A 5IP7G 1F77A 5FJ8G 4A3IH 4UP9A 3NTIA 2CH4W 1W3SA 1HFNA 2ES2A 1NR2A 3BDCA 3K57A 4BBRH 3ULLA 4L63B 3U4ZA 1TWHH 2J0TD 3CW2C 4N8X1 1KD1C 4S3SA 1SN8A 5C5LA 3E3XA 1X3FA 1PXUA 3G71A 4R9WA 3IAYA 2M9VA 5I6WA 1H9SB 2L12A 4XT1B 2VQFQ 2A6HC 3AB9A 3PO2G 2R6GA 4FF4A 1FD7D 1JICA 1BDOA 1HR0W 4MNOA 5E1FA 3STBC 1K8AC 3CCEA 4YWMA 2BA1A 3MEFA 2JA9A 4NP5A 2DJGC 4YWLA 2ZTDA 4FF1A 3PO2B 2EVBA 1WTVA 2CW0C 2F1MA 3I70A 3SK6A 1PH5A 3K5OA 2K05A 3UE0A 4GLAC 4H7BA 4NPSA 5F2DA 4GNXA 1C9OA 2L5TA 2ZJQA 4LFAQ 4MHEA 2Q8RE 2AUJD 1I3QH 4NXNL 2CH4A 2IJ0A 2CKZB 5JJKA 1TY2A 1EIFA 4JI4Q 5C4HA 1XTDA 3NBHB 4DAYB 2UUCQ 4RHRA 2JA6G 1VQ5A 1KDAA 3DMUA 4X66Q 1CA6A 1CKMA 4RFBA 2PYKA 5TSSA 3S9WA 2ASBA 5GQOA 2KHIA 2PZWA 3W2DA 4IOCA 1WFQA 1HUMA 3ND9A 4YCVA 5LMNW 3DXJC 2RSOA 2HHHL 2XNAC 3JAML 2CQOA 4IPCA 3S16H 3G6JB 1K73C 1YEZA 2MUYA 2C35B 3J81j 2UXCQ 2JA6B 3OHXC 4IFDH 3GTKH 2Y0SG 3K5NA 2L55A 3K80C 3T1HQ 3MEHA 3IL8A 4DV7L 1S5CD 3K81C 2Q2TA 2XIWA 1HNXL 4A3EG 2BDNA 1O80A 5D3DA 4KJNA 4ZK9B 3B6YA 3DUZA 4RAUC 4BBSG 1SE4A 5FK9C 1SDFA 2MFIA 1PFNA 4NB3A 1NSNS 1WCMG 2Y0SB 1V8QA 3OW7A 3M4OH 4DU9A 4ZAIA 4ZUJA 2CVRA 1V1PA 4DR6L 1VQ6A 1EU3A 1KLGD 4CJ0B 1NBWA 2ZJRA 3GTQB 4A3EB 2R61A 1VMCA 3D6CA 3PMFA 3GTMH 2E8GA 4DV1Q 4BBSB 3A0JA 2X6LA 3VYRA 4C56C 4XQQA 3KFUA 1AW7A 1XMQQ 1Q1EA 4LF7L 1Z9FA 4R4CA 3I7FA 5C0XG 3Q0AA 5IT9L 1QCBD 1JE5A 1TR5A 3GTOH 1LV9A 5I6YA 2H4OA 3BZKA 1STHA 1D2BA 1ZXTA 1Z47A 4RGNA 1MIUA 5LL6X 4XT3B 4X3TA 4LK1C 2NVQH 4GNXB 1V1QA 4UY8C 2B63G
chains in the Genus database with same CATH topology
3A8KE 1OXVA 2OF1A 5JOBA 3KLSX 2EYFA 3LNNA 3MA2B 1JR0D 3VR3A 1SE2A 4PMCA 4NMZA 1R4PB 2PMZB 4KKTA 1UUPA 4QIWB 1EY5A 4KKSA 3I73A 1B3AA 3S1MB 1ZYRD 2Q8IB 2F0HA 1VF5C 3BVGA 2F0WA 3KF8A 3SHLA 1DONA 2EOTA 4ZRZA 1E2ZA 2EY6A 2JSOA 3L9AX 5KGUA 1MSHA 3K7AB 4KI0A 2VNUD 5NUCA 2NN6H 1B4OA 2K33A 3G7LA 1IW7C 2KUMA 2I07B 2RDHA 5C3XA 4V190 4OIKA 2L1BA 1PRTC 2B2WA 4CGYB 5IIFA 2XWBB 1G6ZA 1V1PB 1PYWD 3A56A 1I4XA 2B8GA 1CA5A 5FOBB 2A5HA 3L3OC 1SMYC 1HUNA 1HFGA 1D5MC 3TMEA 1EU4A 2DY8A 2LMCB 5KEEA 3GV3A 3HRZC 1H9JA 2NBFA 5EPKA 2J4XA 1F2ZA 3S1QB 2VB2X 2F0TA 2NVTB 3M7NA 1RF2D 3EQLC 2WV6D 3DEOA 2SDFA 2F0OA 4RWSC 1STYA 4Q5VA 1RHPA 4O42A 2EYJA 5CGKA 2IL8A 3Q22A 1YNJC 2KA7A 1V1OA 4MN3A 3MFYA 3SEBA 5CBEE 3TZUA 2E2DC 3P7JA 2E74C 1Q1BA 4XIGS 2D2CC 1PTOB 2K1BA 3MXPA 1I6VC 5IGDA 1LLRD 1JB3A 4CHTB 1DXMA 1RTOA 4OIJA 3AMUA 1UAPA 1FNVA 1A3VA 1RJTA 2F0MA 5M9OA 3Q24A 1BNZA 1GUOA 4A3KB 3NXWA 2EYPA 3R8BA 1EWCA 1LT5D 4BY7B 5E4WC 5LHY1 4DFAA 5HGTA 3PUYA 5C4JB 1MBYA 4IFDJ 4BA1I 3A7AB 1CI3M 1BXTA 1Y1VB 2HUGA 1EY8A 4I65A 2HDMA 5J22A 1NAPA 2QILA 3V2TA 5C4ZA 3IFDA 5C0XH 3K58A 4DN4M 1D6EC 4FXKC 4TRDA 5C44B 1I4HA 3DHQA 2K32A 1D1IA 4ME5A 1LTTD 4JBWA 1XYIA 4IFDI 2Z4IA 5DM63 2AWOA 1DJRD 4C3IG 4P2CB 5D3IB 4PNYA 1D5ZC 4DNRB 4ZLTF 1B2TA 1TWCB 2BE5C 3D3RA 2O2LD 1ENAA 3A8JE 5EBDA 4CBVA 1F9SA 3S2DB 4C3IB 3GTGB 4Z9CB 5KIXA 1BCPF 3EFXD 3TP8A 2XVSA 1UEAB 3NTHA 5JEAG 4QCLA 1W6JA 4HAEA 1C48A 2FMMA 4ZQ3A 1PTOC 1BR9A 4K6LA 1LTBD 1EY4A 1BCPB 3CKIB 2L0CA 1NUCA 2EJMA 5KRUA 3FPPA 1G2SA 4TSSA 5CORA 1GUGA 3LWEA 3Q6SA 1GHJA 3R3OA 1TY0A 1QILA 3S17B 1PFBA 4IUQA 2K5QA 3NQTA 4KY6A 3MAQA 2Z8LA 2KCCA 1TS3A 4TQUS 2B2WC 4G7ZC 4XDXA 5FLXL 5KYIA 4QF4A 3HZXA 1DOKA 1PLFA 1STAA 1TU2B 1GHKA 1A15A 2A73B 3UI2A 2E76C 3S1NB 1I6HB 3FVQA 3N52A 2NN6I 1F9RA 2F0IA 4RCNA 4XYQA 3E6ZX 2A6EC 5CBAE 3GTPB 1STEA 4KD3A 1SYEA 4G7HC 2KOLA 4K5XA 1H9KA 1D1KA 2E75C 2OT2A 3PUWA 2KQ3A 4U68A 1L0XB 2A68C 1ML0D 5CV7A 2SOBA 1U4LA 3OSOA 1JWUD 5IOCA 3MC0B 3HOUB 3QO2A 4OHJA 4UAIA 1GXDC 1HCZA 3S15B 3T4AC 2F3VA 1QNKA 1PZJD 3QOLA 2CHBD 3K0YA 2F0LA 3WOFA 3ZYYX 3DWPA 4J6HA 3HP3A 3GO5A 3FRPB 5IGEA 1JCKB 4EQPA 4CKEA 1CTMA 1JWMD 2ZT9C 5EKKA 3SVMA 5I2XA 1GJXA 5DM73 3MXUA 2WINB 2HDLA 2ZXPA 3MZ5A 2R93B 2KECA 2EJFC 1B44D 3C46A 2N88A 1BF4A 3BVMA 3RZOB 1EEFD 1EY6A 4XYOA 3FDTA 1HTPA 1HQMC 2F0DA 3H3VC 2EZVA 2JA5B 1DZ1A 4K2KA 3H91A 2XWJB 3BVZA 3I91A 4PMBA 5BN5A 1O7YA 4WORA 2E2HB 5EJWA 5T1IA 3N6RA 3PV0A 3P75A 1RD9D 4M1UB 1JWSD 1JQYD 1E2VA 1WVLA 1J9OA 5D65A 1EYAA 4K5VA 3VA5A 4DAVA 1A3UA 1FNWA 2B2TA 3I90A 1ET9A 4DK1A 1O78A 3TP5A 3TDQA 2MPMA 3D8GA 2MP1A 2M00A 1AEXA 3D6WA 3IKJA 3OIQA 1BUVT 3T16A 1FR3A 1GOZA 3L7ZC 5KNDA 4B9XA 1PRTB 3TBIB 1G8ZD 2FFKB 3CQZB 5FO9B 1EL0A 4OO1H 1EY0A 1Y1WB 3EVQA 1W6KA 5KNBA 1SNOA 3J80E 2XRSD 4RCOA 3Q23A 4N9PA 1KTKA 2TMPA 2NB0A 3RLFA 2B2YA 3GV6A 2BCOA 3BYTB 2ICEC 3OMCA 3S1RB 1ILPA 2IPKD 3GTLB 1AP0A 5D14A 5CMDA 2BOSA 4RHSA 1ESFA 2D5DA 5C4XB 1IYUA 1DOLA 1IHZA 1TS4A 4G57A 1ZKOA 2EE1A 3OPOA 2L9HA 4F8MA 3D31A 1PZKD 1SYDA 3J7YW 4NDXA 4X3SA 3SE0A 2DN8A 1HPCA 1WTWA 2SNMA 1KNEA 3SK8A 3OWFA 1LTSD 4PQXA 4RGTA 1SJED 4L8JA 3NTKA 4A3DB 2EXZA 4EVOA 3M4YA 2R7ZB 5JJZA 1PMRA 5K5PA 5ELCA 2F0UA 3KLSA 1AN8A 2DY7A 3DWAA 3HEJA 4H13C 4AYBB 2HQEA 2IWHA 1JOQA 3HOVB 4RKBA 2NWGA 4IUNA 4EQNA 1YNND 5M5WB 2AQ2B 2JP1A 1ONLA 1F9QA 4A3BB 4IALA 3RZDB 4DXGA 1EYCA 4NKLA 3X3NA 3CU7A 1EFID 1C4QA 2XRQD 3TP7A 3W3AA 2ICIA 1EYDA 1B9MA 4FXDA 2IW3A 2WP8J 4K14A 3MWYW 2Q8TA 1I4PA 4K6DA 3VR6A 3CRLC 1EWHA 2J7ZA 1O7LA 2C9OA 2KJXA 1IKLA 3SDZA 3QIAA 4K8JA 4A93B 2EYHA 1H9RA 1OXXK 2EY5A 3K6OA 2K5WA 3OIPA 2MGSA 3K59A 1Y8OB 3X3MA 1NCVA 1SAPA 4LAAA 3TZDA 2A69D 4RH6A 4A3MB 5IGFA 4J1MA 1I4RA 3VR4A 4LJZC 3SK4A 3HS0C 1PTOF 2F0GA 4KJOA 3R2IA 1IYVA 1OO9B 2LKVA 3HKZB 4KV6A 2B2UC 3FMCA 2MJ8A 4IZ8A 2PO4A 1WD1A 3H0GB 5EQ0A 2A74C 3C1EA 1LACA 3T51B 2FHTA 3C3LA 4FVMA 1U4PA 1S5BD 1WTRA 1HRJA 2JYOA 1TWAB 2B2TC 4KTAA 4OGQC 3KBGA 1KABA 2HCIA 1B1ZA 4CJ2C 2RKSA 3LWUA 1AZQA 3J81E 3S14B 3KK7A 1LTAD 3T53B 4K2LA 1TQOA 3OMGA 4HMIA 1A2TA 5EKLA 1O7ZA 1BO0A 3IFTA 1RDPD 1T5XD 4DA2A 5JPMC 3H09A 4HSVA 2O5JC 3PUXA 1QJOA 3QB3A 2F0EA 3BYYB 1EY9A 4ODGA 2XN9C 5AFWA 1KLUD 1G91A 2QKIC 2JE6I 1BCPD 2B2YC 1CQVA 4QUCA 2PNRC 4FNFA 4IUTA 5ELFA 5K36G 2EPBA 5I9OA 1ILQA 4XTCS 4BS9A 1S5ED 3RD4A 5I4DA 2NTSA 4ULLA 4OO1I 1XTCD 2FMCA 3M3YB 1CFMA 3PIP3 3OOCA 3HOYB 2XSCA 2A6HD 1QOHA 5M5YB 1U9RA 5I2YA 5IGBA 4HN7A 3QG1A 1D5XC 2F0KA 3EJIA 5JPNC 3FPUB 4BBRB 1ZYRC 1A2UA 5EGTA 1SNQA 1JOKA 1Z6HA 2CW0D 2SEBD 1SEBD 2H1EA 4J8QA 4FXGC 1X32A 1Y8NB 3GTJB 1ET6A 4RKLA 5A2QE 3S2HB 2Z4HA 2AUKA 3NK9A 2NYZD 2NUCA 3WDNA 1CZWA 3NP8A 1B53A 3ND8A 1I4QA 1G2TA 3V96A 1ZEQX 1QNUA 4ABNA 2EYOA 1K8MA 3LX0A 1JC7A 4ZYSA 1OXUA 1VF7A 1I3QB 5CR3A 1SYGA 2ZXRA 3PIO3 1R9TB 4IUVA 4C3HG 2EYMA 2DNEA 2F0JA 1S5DD 4WJWA 2MHVA 2KEEA 1PTOH 4DGZA 1ICWA 2B39A 3A8IE 3ONAB 4H44C 4QUFA 4BY1B 2AQ1B 4C3HB 1EZ6A 4ILWA 4WFN3 3PO3B 1F9PA 3HOZB 2CQAA 3C1FA 1H9SA 2G9HD 5DAUA 1KDBA 1HA6A 1DOMA 4DNTB 1NR4A 4JK1C 3D4WA 3H94A 1XXGA 5J39A 1TS2A 1CT1D 2JXMB 4QB4A 3NPPA 5CV9A 4FF3A 2VXWA 4HSPA 1OXSC 4KHVA 1KAAA 5E4XA 4CKBA 3QOJA 4DAPA 1TVXA 1SJHD 2SNSA 1Q3LA 3BZDB 3GTOB 1ESRA 3PUVA 4ZKBB 2F4IA 4X3KA 1M4VA 4IUPA 5C3EB 5COYA 4RA8A 3VR2A 2NVQB 1OXTA 3JAME 3P1HA 4E6IA 3CRKC 5JVH3 3NHHA 4GZYC 3BS1A 5CV6A 3RMHA 5IGGA 3SR1A 1B9NA 1QWYA 5G3LD 1UNSA 2WKDA 1G291 2EJGC 4FF2A 1PZID 2RVLA 1L0YB 4Y7NB 2Z1CA 1IW7D 2K6AA 1II3A 5K36H 2NN6G 1A3TA 1EOTA 4KY5A 2RA4A 4K5WA 1S5FD 4V0BA 1BQQT 1PRTD 2BA0A 4HCEA 4R8NA 1HHVA 4XQNA 1M8AA 5C0XJ 4XXEA 1LABA 2F0SA 2B2VC 1SMYD 3DEPA 1TIID 1F2MA 2B2UA 5T1GA 4IURA 5IT9E 5G3LF 1X3QA 4YIJA 2JA7B 5FO7B 5C3WA 3DWQA 5JEAH 3TP6A 3A7LA 1Y8PB 5C0XI 4M8AA 5KNCA 4U673 5EBCA 4A3GB 4DF7A 1PRTF 4FP5D 2IX3A 2RSNA 2ZXOA 1A6XA 2K7VA 4KD4A 5ELBA 4K8IA 3NWTA 1GUTA 3D4RA 4NW2A 3I72A 1AFPA 4MIUA 1Q8IA 3HOWB 1YNJD 2AQ3B 1CHPD 4FO2A 1SE3A 3A54A 3I4NB 2C5CA 2WACA 2K01A 2WB1B 4A3FB 1BOSA 4EGVA 4F87A 3BDOA 3EROA 3I3CA 5M3MB 2LS01 1LTRD 1LT4D 3U9OA 5LL6S 3C2PA 1K83B 3MVVA 4PMWA 1SBBB 4C3JG 3HOXB 4H0LC 3PUZA 1TS5A 1T5EA 1HA5A 2KHSA 1MGSA 4UDUC 3J7AF 2F0NA 4ID6A 3VR5A 1VDZA 1H9MA 4KY7A 1QE6A 4C3JB 2EYLA 2EY2A 2K04A 2LY7A 1PFMA 4FYDA 5M5XB 1STNA 3BG3A 1X3PA 1FNUA 3SXHA 5CV4A 3GQBA 2PCFB 1WCMB 4HR7B 2QCPX 1CHQD 1CZGA 1QB5D 1CM9A 4DXFA 5BN3A 1HXYD 2NVXB 4HCSA 1I50B 4BA2I 1Q12A 3MXNA 2HCCA 3H6MA 5JVG3 2IT1A 4KMUC 2QF7A 3I4MB 5M3FB 1ENFA 4X3UA 5BN4A 1CQFA 1U4MA 1GUNA 4R8IA 3M85A 1SNPA 3R93A 5E3FA 2BE5D 1FGBD 5ELDA 3E5SA 2B63B 1MD2D 3I4LA 5FO8B 2PQEA 4F88A 3OWEB 3P20A 4N9TA 2GA4B 1LO5D 1TWFB 2O5IC 2R92B 2KEDA 1MSGA 1TKWB 2PZTA 2QDBA 1PTOD 3K5MA 5EPLA 1STBA 1JOOA 5CV5A 4C1NK 3J80L 5CC4A 2OEOA 4C2MB 3NWSA 2M2LA 2NTTA 3U9SA 3RUZA 3J7AV 3HG9A 2JEBI 1VMPA 2F0FA 1AZPA 1DYQA 2V4DA 5IODA 3MHBA 4ZKCB 2KCNA 2E2IB 2B8FA 2FJ2A 5I9PA 1KDCA 2VUMB 2F03A 4O1NA 3V05A 2RDGA 1LT3D 1E2WA 3FEWX 3URYA 3O13A 3MXGA 3DM1A 1Q90A 2WAQB 4G4KA 1SYBA 5ELEA 2RBMA 1RTNA 1K8OA 1TT2A 4TKOB 2RDFA 1EIGA 2LFNA 4HMJA 1EY7A 2A6ED 2F3WA 2L4NA 1RCVD 4B08A 2WIIB 1F2LA 2L11A 1STGA 4ZUIA 3T13A 5JEAJ 1RKNA 2K28A 1HTLD 1QG7A 1SNCA 1TWGB 1E0BA 5FKAC 1IL8A 2A68D 2ENBA 2E2JB 2X6GA 1LTID 4DK0A 4HEDA 5DEHA 1DM0B 3NSWA 3I8ZA 1LT6D 3A55A 4WRDA 1SFOB 2YYZA 3GD7A 2IX0A 1FYCA 2QEJC 4QMGA 5IGCA 1XWEA 3D4DA 2EDGA 3R2TA 4G7OC 5FLXE 2B2VA 2NVYB 2OXPA 4IN3A 2F0VA 5DNFA 1EIHA 4KKUA 5EPJA 4HTHA 3SK5A 1KNAA 2I46A 4PV1C 5J1ZA 1SNMA 4Q0FA 1ENCA 2D9UA 4A3JB 1SYFA 4B9WA 5ISRA 4XQJA 3NE5B 3VYTA 1S4ZA 4A3IB 1F2YA 1TWHB 4OL7A 2PZUA 4BWGB 1U4RA 1YNNC 1RODA 1EZ8A 1GUWA 1WTQA 1R4QB 3J81L 3NQIA 1LTGD 4LMQD 1SYCA 5C5MA 2PW5A 3KLRA 2ID0A 1JE4A 1PDQA 1Y69U 2WKCA 1WD0A 3FKIB 5HURA 2EY1A 2RQXA 3GP7A 1HQRD 3HGBA 3AU7A 2DNCA 4IFDG 4C1NI 2KVMA 2A69C 5CV8A 2K03A 3M7GA 5KYLA 1BBXC 4IQZA 1WTOA 2O4XA 3E0JA 3NUCA 5CYUA 4RGMA 4OO1G 1WTPA 1I4GA 1MI2A 4I7ZC 3EA6A 3S16B 2JA8B 1EQVA 1EQTA 1WTXA 3QWNA 2N55A 3GTKB 3MTSA 4KN4C 4KHZA 1GUSA 1SXTA 3NBIA 1J8IA 2F0PA 4RGOS 2YU9B 2D62A 4KN7C 3CHBD 2K5DA 2JEAI 2AWNA 3BDLA 2TSSA 1JORA 1V43A 2IX1A 2F0QA 5C6AA 3M4OB 4EQOA 1VCIA 1DD2A 2NZ1D 2BDOA 3VA7A 3VYSA 1DCZA 5JAVA 3F2UA 3TN2A 3VYUA 3GTMB 3K5LA 3QJYA 4IUUA 5EKIA 2FINB 1Z7TA 5A2QL 3ERQA 3NBHA 4DAYA 4CJ1B 1C8CA 1XX8A 1EEID 4L6TB 1CK1A 2PPBC 3TSSA 2X69A 3KBXA 1SSOA 2VB3X 2PW7A 3MFGA 5A35A 4F7XA 3KUPA 3ITPA 1BCPC 2G9DA 3T56B 1IKMA 1B50A 2R3ZA 4CKCA 1SNDA 3WOEA 4KK7A 1F77A 3NTIA 1HFNA 1NR2A 3BDCA 3K57A 4L63B 2J0TD 4S3SA 5C5LA 1PXUA 4R9WA 3IAYA 2M9VA 5I6WA 1H9SB 2L12A 4XT1B 2A6HC 3AB9A 2R6GA 4FF4A 1FD7D 1JICA 1BDOA 5E1FA 2BA1A 4NP5A 4FF1A 3PO2B 2EVBA 1WTVA 2CW0C 2F1MA 3I70A 3SK6A 3K5OA 2K05A 4H7BA 5F2DA 2L5TA 4MHEA 2Q8RE 2AUJD 2IJ0A 1TY2A 5C4HA 4RHRA 1KDAA 3DMUA 1CA6A 4RFBA 2PYKA 5TSSA 3S9WA 2PZWA 3W2DA 1HUMA 3ND9A 3DXJC 2RSOA 2XNAC 3JAML 3G6JB 2MUYA 2JA6B 3OHXC 4IFDH 3K5NA 2L55A 3MEHA 3IL8A 1S5CD 2XIWA 2BDNA 1O80A 5D3DA 4KJNA 4ZK9B 3DUZA 4RAUC 1SE4A 5FK9C 1SDFA 1PFNA 1NSNS 2Y0SB 1V8QA 3OW7A 4DU9A 4ZAIA 4ZUJA 2CVRA 1V1PA 1EU3A 1KLGD 4CJ0B 3GTQB 4A3EB 2R61A 1VMCA 3D6CA 3PMFA 4BBSB 3VYRA 2X6LA 4C56C 4XQQA 1AW7A 1Q1EA 5C0XG 3Q0AA 5IT9L 1QCBD 1TR5A 1LV9A 5I6YA 2H4OA 1STHA 1D2BA 1ZXTA 1Z47A 4RGNA 5LL6X 4XT3B 4X3TA 4LK1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K8J A;  2EYH A;  3MZ5 A;  3NHH A;  4N9T A;  3OMC A;  1EY9 A;  4ODG A;  5CR3 A;  4PNY A;  5CV6 A;  2F0O A;  1SYG A;  2F0I A;  5IGG A;  2OF1 A;  2ENB A;  5JOB A;  2EY5 A;  1SYC A;  3SR1 A;  1STY A;  1EY6 A;  2EYF A;  3ERO A;  5C5M A;  5C4H A;  2PW5 A;  1IHZ A;  4G57 A;  2EYJ A;  2F0D A;  2PZT A;  4KD3 A;  2EYM A;  3ERQ A;  5CGK A;  2QDB A;  1SYE A;  4LAA A;  3U9O A;  4K2K A;  4PMC A;  4NMZ A;  1KDA A;  5DEH A;  4F8M A;  1ENA A;  3MVV A;  1STB A;  1JOO A;  3DMU A;  2F0J A;  1SYD A;  5CV5 A;  4K5X A;  1II3 A;  2PYK A;  5IGF A;  4PMB A;  4J1M A;  3S9W A;  1EY5 A;  4NDX A;  5CC4 A;  1A3T A;  2PW7 A;  4WOR A;  2PZW A;  2KHS A;  2OEO A;  4E6I A;  5KIX A;  2SNM A;  3MXP A;  4KY5 A;  3TP8 A;  5I9O A;  3SK8 A;  3OWF A;  4K5W A;  4WRD A;  3SK4 A;  4DGZ A;  5IGD A;  5HUR A;  2F0H A;  2F0G A;  2KQ3 A;  3P75 A;  2EY1 A;  4KJO A;  4F7X A;  2F0N A;  4ID6 A;  3RUZ A;  4R8N A;  2LKV A;  2F0W A;  4KV6 A;  5CV7 A;  1EZ6 A;  2EXZ A;  3ITP A;  4EVO A;  2F0S A;  2SOB A;  4KY7 A;  1EYA A;  3SHL A;  3OSO A;  4K5V A;  4QMG A;  3VA5 A;  5F2D A;  2EY6 A;  2F0F A;  4ZQ3 A;  1A3U A;  3C1F A;  2EYL A;  4IZ8 A;  5IOC A;  5KGU A;  1U9R A;  2EY2 A;  5IOD A;  5K5P A;  3MHB A;  5CV8 A;  3MEH A;  2F0U A;  1EY4 A;  1A3V A;  5NUC A;  5IGB A;  3D4D A;  5IGC A;  1F2M A;  1NUC A;  2F0M A;  5DAU A;  3TP5 A;  1SND A;  1KDB A;  3C1E A;  3HEJ A;  1STN A;  5KYL A;  5M9O A;  3D8G A;  2HQE A;  3SXH A;  5CV4 A;  5I9P A;  2F0K A;  1KDC A;  2O4X A;  2M00 A;  3EJI A;  2OXP A;  2F0V A;  3NUC A;  4KJN A;  1AEX A;  4YIJ A;  5KRU A;  1JOQ A;  5C3X A;  3NXW A;  2EYP A;  4RKB A;  3BDC A;  5C3W A;  3D4W A;  2F3V A;  1A2U A;  5EGT A;  1EQV A;  4HTH A;  1SNQ A;  3SK5 A;  4KTA A;  1NSN S;  4IUN A;  4S3S A;  3T16 A;  4DFA A;  4EQN A;  5HGT A;  3QOL A;  5IIF A;  5J39 A;  3R3O A;  1JOK A;  5C5L A;  4DU9 A;  4ZUJ A;  1KAB A;  3TP6 A;  5J1Z A;  4B9X A;  4QB4 A;  1SNM A;  5CV9 A;  1SYB A;  2F0L A;  5I6W A;  2RKS A;  1ENC A;  1SYF A;  2RBM A;  4B9W A;  5ISR A;  4J6H A;  3NQT A;  4KY6 A;  4IAL A;  1KAA A;  4KHV A;  1EYC A;  1EY8 A;  3LX0 A;  4I65 A;  3D6C A;  1TT2 A;  2F0P A;  4NKL A;  3PMF A;  4DF7 A;  5J22 A;  2RDF A;  3QOJ A;  3TME A;  3H6M A;  4K2L A;  1TQO A;  3OMG A;  4HMI A;  1F2Y A;  4HMJ A;  4KD4 A;  4RKL A;  3TP7 A;  5KEE A;  1EY0 A;  3V2T A;  5C4Z A;  1A2T A;  1EY7 A;  4K8I A;  5IGE A;  3NK9 A;  3EVQ A;  5E1F A;  5EKL A;  2SNS A;  1EYD A;  2F3W A;  4TRD A;  2NUC A;  5KYI A;  4QF4 A;  4OL7 A;  3BDL A;  1SNO A;  1JOR A;  1SNP A;  1TR5 A;  2PZU A;  3HZX A;  4MIU A;  4K14 A;  3DHQ A;  2F0Q A;  3NP8 A;  5C6A A;  1STA A;  5I6Y A;  4EQP A;  4EQO A;  4K6D A;  4NP5 A;  1STH A;  5E3F A;  1STG A;  4ZUI A;  3T13 A;  4N9P A;  1RKN A;  1EZ8 A;  5EKK A;  4ME5 A;  1F2Z A;  3E5S A;  5JAV A;  3QB3 A;  3SK6 A;  2F0T A;  1SNC A;  4H7B A;  2EYO A;  2PQE A;  3P1H A;  2WAC A;  2F0E A; 
#chains in the Genus database with same CATH topology
 3A8K E;  1OXV A;  1GVP A;  1X9N A;  2F4V Q;  1NNX A;  2OF1 A;  5JOB A;  3KLS X;  2EYF A;  3LNN A;  3MA2 B;  1JR0 D;  4JI8 L;  3VR3 A;  1SE2 A;  4PMC A;  2RCN A;  4NMZ A;  2OTL A;  4KHP L;  1R4P B;  2PMZ B;  1YBY A;  4KKT A;  1UUP A;  4QIW B;  4DR5 Q;  2Z6K C;  2LXJ A;  1PA6 A;  2N78 A;  3DLL A;  1EY5 A;  2UUB L;  4DPG A;  4KKS A;  4LFC Q;  3I73 A;  1B3A A;  3S1M B;  1B8A A;  1ZYR D;  2Q8I B;  2F0H A;  1N33 Q;  4BXX H;  1VF5 C;  1BKB A;  3BVG A;  2F0W A;  3G4S A;  3KF8 A;  5H1S E;  4B3R Q;  3I55 A;  3SHL A;  1DON A;  2EOT A;  4ZRZ A;  1E2Z A;  1E1T A;  2EY6 A;  2JSO A;  3L9A X;  5KGU A;  1MSH A;  3K7A B;  4KI0 A;  2VNU D;  5NUC A;  5IP7 H;  2NN6 H;  1B4O A;  2K33 A;  3K0X A;  3G7L A;  1IW7 C;  2KUM A;  3H15 A;  1BBW A;  4B3S L;  4R4O A;  4LF8 L;  2WB1 E;  4PG3 A;  2I07 B;  5HGQ A;  4OON A;  4LNQ A;  2RDH A;  5IT9 c;  1PFS A;  5C3X A;  4V19 0;  4UP8 A;  3UDX A;  2VS1 A;  4OIK A;  1FVI A;  2L1B A;  4DR7 L;  1PRT C;  2B2W A;  4JI6 Q;  4CGY B;  5IIF A;  2XWB B;  1XJV A;  1G6Z A;  1V1P B;  1PYW D;  3A56 A;  1I4X A;  1LUZ A;  2B8G A;  1PH2 A;  1CA5 A;  5IWA Q;  4YWK A;  5FOB B;  2A5H A;  3PO2 H;  3L3O C;  1SMY C;  2WAQ G;  3G48 A;  1HUN A;  1HFG A;  1D5M C;  1EIY B;  4A3G H;  4GN5 A;  3UE1 A;  5JJI A;  3TME A;  1EU4 A;  2DY8 A;  2LMC B;  5KEE A;  3GV3 A;  3HRZ C;  1H9J A;  3F8T A;  5BR8 Q;  1Q81 C;  5GAD C;  1PHJ A;  2NBF A;  4GLX A;  5EPK A;  4DR4 L;  2J4X A;  1RIP A;  1YHA A;  1J5E Q;  1F2Z A;  3S1Q B;  3J80 i;  2VB2 X;  1CUK A;  2F0T A;  2NVT B;  4IJH A;  3M7N A;  2K4K A;  3I4N H;  5GRO A;  1RF2 D;  3EQL C;  2WV6 D;  4A3F H;  2Z6B A;  3DEO A;  2SDF A;  3BZC A;  2F0O A;  2VW9 A;  3EIV A;  2VZA A;  3EN2 A;  4RWS C;  1STY A;  4Q5V A;  1RHP A;  1XMO L;  4O42 A;  2JA6 H;  2EYJ A;  2IL8 A;  5CGK A;  3Q22 A;  4DK3 C;  1YNJ C;  2KA7 A;  1V1O A;  4MN3 A;  3MFY A;  3SEB A;  2K52 A;  1BBU A;  3TZU A;  2E2D C;  5CBE E;  3P7J A;  1VQM A;  1K83 H;  1VQG A;  2E74 C;  1Q1B A;  2KHJ A;  4XIG S;  1IBM Q;  2D2C C;  1PTO B;  4B3T L;  3TS2 A;  2K1B A;  3MXP A;  1I6V C;  5IGD A;  4IPD A;  1N32 Q;  1LLR D;  4TVA B;  1JB3 A;  4CHT B;  4A3K G;  3HFZ B;  3KF8 B;  1DXM A;  1JJG A;  1RTO A;  4BY7 G;  2UUA Q;  4OIJ A;  3AMU A;  1UAP A;  1FNV A;  4C3J H;  3GTQ H;  1A3V A;  1RJT A;  4A3E H;  2F0M A;  5M9O A;  2UU9 L;  3FHW A;  1VQD A;  1HZA A;  3Q24 A;  4R4T A;  4A4I A;  1Y1V G;  4B3M L;  2H5X A;  4DUZ Q;  1BNZ A;  1GUO A;  4A3K B;  3NXW A;  2EYP A;  3R8B A;  1EWC A;  1LT5 D;  4BY7 B;  5E4W C;  1WCM H;  5LHY 1;  1H95 A;  4LF4 Q;  4DFA A;  5HGT A;  3PUY A;  5C44 G;  1MBY A;  5C4J B;  3J7A 5;  2YV5 A;  3L0O A;  3T1Y L;  1YZ6 A;  1FJG L;  2KEN A;  4IFD J;  4BA1 I;  3A7A B;  1CI3 M;  1BXT A;  1PV4 A;  1Y1V B;  2HUG A;  3U50 C;  1EY8 A;  4I65 A;  2HDM A;  5J22 A;  1NAP A;  1VQE A;  1LTL A;  2QIL A;  3V2T A;  5C4Z A;  3IFD A;  5C0X H;  3K58 A;  4DN4 M;  1D6E C;  4FXK C;  4TRD A;  5C44 B;  1Q7Y C;  2EQS A;  1I4H A;  4NXM L;  2VQE L;  3DHQ A;  4L5S A;  1SRU A;  2K32 A;  4JI7 Q;  1D1I A;  4ME5 A;  1LTT D;  4JBW A;  1XYI A;  4IFD I;  2Z4I A;  2B63 H;  1KL9 A;  5DM6 3;  3ICE A;  5IY0 A;  2AWO A;  1DJR D;  2Z9H A;  4C3I G;  3S1M H;  4P2C B;  5D3I B;  4PNY A;  4R1J A;  1D5Z C;  3CCV A;  2HIV A;  1YHB A;  1TWF H;  4DNR B;  1HZB A;  4ZLT F;  4IJL A;  1B2T A;  2B29 A;  1J6Q A;  4DV5 Q;  4CDE C;  2WAQ E;  1TWC B;  2BE5 C;  3D3R A;  2O2L D;  1ENA A;  3A8J E;  3K7A H;  5EBD A;  4CBV A;  1F9S A;  3S2D B;  4C3I B;  3GTG B;  1P8L A;  4Z9C B;  5KIX A;  1BCP F;  3EFX D;  1NMG A;  3TP8 A;  2XVS A;  1WOC A;  4GOP C;  1UEA B;  3NTH A;  1VQC A;  4PZ6 A;  3FKI G;  4DV0 L;  5JEA G;  4QCL A;  1CSP A;  4P75 A;  3PF4 A;  1K28 A;  1W6J A;  3UDI A;  4HAE A;  1C48 A;  2FMM A;  4ZQ3 A;  1PTO C;  1BR9 A;  4K6L A;  1LTB D;  1EY4 A;  1BCP B;  3CKI B;  2L0C A;  2YTV A;  1NUC A;  2HD3 A;  2E2I H;  1JJC B;  5IE8 A;  4DR2 L;  1OTC A;  2EJM A;  4GKJ Q;  4ME3 A;  4LFB Q;  5KRU A;  3FPP A;  1G2S A;  4TSS A;  5COR A;  1GUG A;  3LWE A;  3Q6S A;  1GHJ A;  3R3O A;  1YHQ A;  1TY0 A;  1QIL A;  1ASY A;  3S17 B;  3W1G A;  1PFB A;  4YHH L;  1IBK Q;  3S1Q H;  4IUQ A;  2K5Q A;  2OQ0 A;  3NQT A;  4KY6 A;  3MAQ A;  2NVT H;  2Z8L A;  2KCC A;  2NZO A;  1TS3 A;  1NY4 A;  1SRO A;  4J15 A;  4TQU S;  2B2W C;  4G7Z C;  4JVZ A;  1CSQ A;  4OEM B;  4XDX A;  5FLX L;  5KYI A;  4QF4 A;  4O2D A;  4CDC C;  3HZX A;  1DOK A;  1PLF A;  1STA A;  1TU2 B;  4OEL B;  2Q2U A;  1GHK A;  2DUD A;  1A15 A;  2QDL A;  2A73 B;  2VQF L;  3UI2 A;  1XPR A;  2Z0S A;  2E76 C;  2LXK A;  3S1N B;  2RCF A;  1I6H B;  2HQL A;  2N3S A;  4IPG A;  2P5Z X;  4A76 A;  3FVQ A;  3N52 A;  2NN6 I;  1F9R A;  2F0I A;  4RCN A;  4XYQ A;  3E6Z X;  4QL5 A;  2A6E C;  5CBA E;  1SMX A;  1WI5 A;  4A75 A;  3AYH B;  3GTP B;  1Q46 A;  1STE A;  4KD3 A;  3CD6 A;  1SLJ A;  1SYE A;  3F2C A;  4G7H C;  1IZ6 A;  2KOL A;  4K5X A;  1H9K A;  2UXD Q;  1D1K A;  1ICF B;  2E75 C;  2OT2 A;  4LFA L;  3HKS A;  3PUW A;  3HOU G;  1ASZ A;  2I5L X;  2KCT A;  1L0X B;  2KQ3 A;  4U68 A;  4JI4 L;  3PCO B;  1VQJ A;  4BY7 H;  3FP9 A;  2A68 C;  4EQ5 A;  3A5U A;  1ML0 D;  5CV7 A;  2UUC L;  1VQA A;  5C4J H;  2SOB A;  1Q82 C;  1U4L A;  3OSO A;  4R4Q A;  1JWU D;  4X66 L;  4JI3 Q;  3CPF A;  5IOC A;  1Y1V H;  3MC0 B;  2I0Q A;  3HOU B;  3QO2 A;  5FLX c;  4OHJ A;  4UAI A;  1GXD C;  1HCZ A;  2NVY H;  5EAY A;  3S15 B;  3T4A C;  2F3V A;  1QNK A;  5C44 H;  1PZJ D;  1YI2 A;  3QOL A;  2PI2 E;  1SE8 A;  2CHB D;  2QGQ A;  1UEB A;  3SGI A;  3T1H L;  5FLM G;  3K0Y A;  2F0L A;  4AQY Q;  3WOF A;  3ZYY X;  3DWP A;  4J6H A;  3W5O A;  1PYS B;  3HP3 A;  3GO5 A;  3KOJ A;  3FRP B;  1VQ4 A;  5IGE A;  2R93 G;  1JCK B;  1VQP A;  4A3L H;  4EQP A;  1MHW C;  4CKE A;  4DR1 Q;  1CTM A;  2A1A A;  2UXB Q;  1JWM D;  2ZT9 C;  4GN4 B;  5EKK A;  3SVM A;  5I2X A;  4LF5 Q;  5DM7 3;  1GJX A;  3MXU A;  2JA5 G;  4DV1 L;  4WJ3 M;  1N34 Q;  4LF9 Q;  2WIN B;  2HDL A;  3S2D H;  2ZXP A;  3MZ5 A;  3F2B A;  1MKH A;  4QGU A;  2KEC A;  2R93 B;  1XMQ L;  2EJF C;  1B44 D;  3C46 A;  2N88 A;  1PH3 A;  1BF4 A;  4POF A;  5DLQ E;  1X54 A;  3BVM A;  3RZO B;  1EEF D;  1EY6 A;  4XYO A;  3FDT A;  4LF6 Q;  1HTP A;  1HQM C;  2F0D A;  3H3V C;  2EZV A;  2JA5 B;  1DZ1 A;  4K2K A;  3H91 A;  4UPA A;  2XWJ B;  3BVZ A;  2IY5 B;  3I91 A;  4PMB A;  5BN5 A;  1O7Y A;  4WOR A;  2E2H B;  2F4V L;  2EXD A;  5EJW A;  1LM0 A;  5T1I A;  4OX9 Q;  1YVC A;  3N6R A;  3PV0 A;  2ATW A;  3FKI H;  3P75 A;  1RD9 D;  4M1U B;  1JWS D;  1JQY D;  4YCW A;  3K8A A;  1E2V A;  1WVL A;  1J9O A;  5D65 A;  5IP9 G;  1EYA A;  4K5V A;  3VA5 A;  3S17 H;  4DR5 L;  4DAV A;  1A3U A;  1FNW A;  2B2T A;  3I90 A;  1EFW A;  1ET9 A;  1KQS A;  4DK1 A;  1O78 A;  4LFC L;  3TP5 A;  3TDQ A;  4QQB X;  2MPM A;  3D8G A;  2MP1 A;  2M00 A;  1N33 L;  1AEX A;  3D6W A;  4LW1 A;  2E5L Q;  3IKJ A;  3OIQ A;  4B3R L;  1BUV T;  1Y1W G;  3T16 A;  2JA8 H;  1FR3 A;  1GOZ A;  4HID A;  3W1B A;  3JC6 6;  3L7Z C;  2MO1 A;  5ELN A;  4B9X A;  5KND A;  1PRT B;  3TBI B;  1G8Z D;  5IYC G;  2FFK B;  3CQZ B;  2K5N A;  5FO9 B;  1EL0 A;  4OO1 H;  1SR3 A;  5ELO A;  1EY0 A;  2K5H A;  1Y1W B;  1G51 A;  3EVQ A;  2YU9 H;  4JI6 L;  1W6K A;  5KNB A;  1VQN A;  4HJ8 A;  1SNO A;  2KCM A;  3J80 E;  5IWA L;  2XRS D;  4RCO A;  3Q23 A;  3GTP H;  4N9P A;  5C4X G;  3KJO A;  1KTK A;  2TMP A;  2NB0 A;  1VQI A;  3RLF A;  2B2Y A;  3GV6 A;  2BCO A;  3BYT B;  2ICE C;  3OMC A;  4DAM A;  5BR8 L;  3S1R B;  3KDF A;  3CC2 A;  1ILP A;  2IPK D;  3GTL B;  1AP0 A;  5D14 A;  5CMD A;  2BOS A;  4RHS A;  2MO0 A;  1ESF A;  2D5D A;  4JV5 Q;  5C4X B;  1IYU A;  1DOL A;  1IHZ A;  1TS4 A;  4G57 A;  1YJN A;  4P71 A;  1J5E L;  1ZKO A;  2EE1 A;  3OPO A;  4A3D G;  2L9H A;  4F8M A;  1KAW A;  3D31 A;  5LMU L;  1PZK D;  1SYD A;  2R7Z G;  1K0S A;  3J7Y W;  2FXQ A;  4NDX A;  4X3S A;  3SE0 A;  2DN8 A;  3HOU H;  1HPC A;  1WTW A;  2SNM A;  1E22 A;  3ULJ A;  1KNE A;  3SK8 A;  3OWF A;  1LTS D;  4AYB G;  3S15 H;  4PQX A;  3KJP A;  4RGT A;  1SJE D;  2RF4 A;  3HOV G;  2PQA A;  4L8J A;  3NTK A;  4A3D B;  2EXZ A;  4EVO A;  4GOP A;  3M4Y A;  2R7Z B;  5JJZ A;  1PMR A;  1IBM L;  5K5P A;  5ELC A;  2F0U A;  3KLS A;  1AN8 A;  1K0R A;  2DY7 A;  3DWA A;  3HEJ A;  4H13 C;  4AYB B;  2HQE A;  4A3B G;  3U4V A;  1N32 L;  2IWH A;  4HJA A;  1JOQ A;  2OQK A;  3HOV B;  1M1K C;  4RKB A;  1V9P A;  1QZG A;  2NWG A;  4JI1 Q;  2N49 A;  2UUA L;  4IUN A;  4EQN A;  1YNN D;  5M5W B;  2AQ2 B;  4WJ4 A;  2RHS B;  2JP1 A;  1ONL A;  1A62 A;  1G6P A;  1F9Q A;  4A3B B;  4IAL A;  3RZD B;  4DXG A;  1EYC A;  5FJ8 H;  4NKL A;  3X3N A;  1W2B A;  3CU7 A;  1EFI D;  1C4Q A;  4DUZ L;  2XRQ D;  3TP7 A;  2R93 H;  3W3A A;  1EYG A;  4A93 G;  4LF4 L;  2ICI A;  1EYD A;  1B9M A;  4HJ7 A;  4FXD A;  2IW3 A;  3RZO H;  2WP8 J;  4K14 A;  3MWY W;  2Q8T A;  1I4P A;  4K6D A;  3CCQ A;  3VR6 A;  5GAE C;  2JA5 H;  1EQQ A;  4I7A A;  3CRL C;  1EWH A;  2J7Z A;  4RMF A;  1EQR A;  1O7L A;  2C9O A;  2KJX A;  1IKL A;  1HNZ Q;  3SDZ A;  3QIA A;  4A3M G;  4K8J A;  4P73 A;  4A93 B;  2EYH A;  2IHE A;  3KDF B;  2JK8 A;  3UDF A;  1H9R A;  3NEN A;  1OXX K;  2EY5 A;  1AE3 A;  3K6O A;  2K5W A;  1N8R C;  4A3C G;  3OIP A;  4JI7 L;  2MGS A;  3K59 A;  2Y0S E;  1NTG A;  1Y8O B;  2WFW A;  3X3M A;  3HKZ G;  1NCV A;  1SAP A;  4LAA A;  3TZD A;  2A69 D;  3I2Z A;  4RH6 A;  2F52 A;  4A3M B;  1L1O A;  5AJ3 Q;  5IGF A;  4GS3 A;  4J1M A;  1I4R A;  3VR4 A;  3PSI A;  3H0G G;  2XTI A;  4LJZ C;  3SK4 A;  3HS0 C;  1PTO F;  2F0G A;  4KJO A;  3R2I A;  1IYV A;  5HY6 A;  1OO9 B;  1S72 A;  3A5Z B;  4DV5 L;  1QVG A;  2LKV A;  5IP9 H;  3HKZ B;  4GOP B;  4KV6 A;  2B2U C;  3FMC A;  1L2F A;  2MJ8 A;  4IZ8 A;  2PO4 A;  2JN4 A;  1WD1 A;  3PQI A;  3H0G B;  5EQ0 A;  2A74 C;  2G5D A;  4IOA A;  3C1E A;  1LAC A;  3T51 B;  1EOV A;  2FHT A;  1XNR Q;  3C3L A;  4FVM A;  1U4P A;  1S5B D;  1N36 Q;  1WTR A;  1HRJ A;  1B3Q A;  2JYO A;  1TWA B;  2B2T C;  4KTA A;  4OGQ C;  3KBG A;  3Q8D A;  1KAB A;  2HCI A;  1E7Z A;  1B1Z A;  4CJ2 C;  2RKS A;  1UE1 A;  3LWU A;  1AZQ A;  5IYC H;  3J81 E;  2PMZ E;  4QIW E;  1GO3 E;  3S14 B;  4GKJ L;  3KK7 A;  4AYB E;  4LFB L;  1LTA D;  1UE5 A;  3T53 B;  4K2L A;  1TQO A;  3OMG A;  4HMI A;  1I94 Q;  4BBS H;  3S1R H;  1A2T A;  1WYD A;  3M9B A;  5EKL A;  1O7Z A;  2IHF A;  1BO0 A;  2QA4 A;  3IFT A;  2R7D A;  4POG A;  5C4X H;  1RDP D;  1T5X D;  4DA2 A;  5JPM C;  1IBK L;  3H09 A;  4HSV A;  5IYD G;  2O5J C;  3PUX A;  1QJO A;  3QB3 A;  1HZ9 A;  2F0E A;  3CCJ A;  3BYY B;  1EY9 A;  4ODG A;  2XN9 C;  5AFW A;  1KLU D;  1G91 A;  1HZC A;  2QKI C;  4RG1 A;  2JE6 I;  1BCP D;  3IRB A;  1FGU A;  2B2Y C;  1CQV A;  1L1O B;  4QUC A;  3HOY G;  2PNR C;  4UHV A;  4FNF A;  4IUT A;  1S40 A;  5ELF A;  1EWI A;  5K36 G;  2EPB A;  5JJL A;  5I9O A;  1ILQ A;  2Q2I A;  4XTC S;  4BS9 A;  4X64 Q;  1TXY A;  1S5E D;  3RD4 A;  5I4D A;  4BBR G;  2NTS A;  4ULL A;  1GM5 A;  4OO1 I;  4GKK Q;  1XTC D;  2FMC A;  4DR4 Q;  3M3Y B;  1CFM A;  3PIP 3;  3OOC A;  3HOY B;  2XSC A;  2A6H D;  2UXD L;  1QOH A;  5M5Y B;  1U9R A;  1E1O A;  5I2Y A;  5IGB A;  4HJ5 A;  4HN7 A;  3QG1 A;  1D5X C;  1JT8 A;  1KXL A;  2F0K A;  2VY3 A;  3EJI A;  5JPN C;  3FPU B;  1O7I A;  3STB D;  1E3P A;  4BBR B;  3LGJ A;  3CCR A;  4LUZ A;  4JBJ A;  1X3G A;  4JCV E;  1ZYR C;  1A2U A;  5EGT A;  1SNQ A;  3HKZ E;  1IBL Q;  3D0F A;  2A8V A;  4JI2 Q;  1JOK A;  4JI3 L;  1Z6H A;  1IYJ B;  3L2P A;  2CW0 D;  2SEB D;  1SEB D;  1HH2 P;  3NEL A;  1K3B C;  2H1E A;  4J8Q A;  4FXG C;  1X32 A;  1Y8N B;  3GTJ B;  4A93 H;  1ET6 A;  1X55 A;  3QR8 A;  4RKL A;  5A2Q E;  3S2H B;  2Z4H A;  4L5R C;  2AUK A;  3NK9 A;  2NYZ D;  4LUV A;  2NUC A;  4IPH A;  3WDN A;  1YNX A;  1CZW A;  1D8L A;  3NP8 A;  1PVO A;  3PIO A;  5E7N A;  1B53 A;  4AQY L;  3ND8 A;  1I4Q A;  1G2T A;  3V96 A;  1YJ9 A;  1IXR A;  1ZEQ X;  1QNU A;  3RLO A;  4A3M H;  4ABN A;  2EYO A;  1K8M A;  2MNA A;  3LX0 A;  1JC7 A;  4ZYS A;  4DV2 Q;  1PH7 A;  1OXU A;  3J81 i;  1VF7 A;  1I3Q B;  5CR3 A;  4A3C H;  3G6E A;  1SYG A;  2ZXR A;  3PIO 3;  1R9T B;  4DR1 L;  4IUV A;  4GLV B;  4BY1 G;  2UXB L;  4LWC A;  2QW7 A;  4L5Q A;  1WJJ A;  4C3H G;  1K9M C;  2EYM A;  1YIT A;  2DNE A;  3PO3 G;  1K8G A;  2F0J A;  1N34 L;  1S5D D;  4LF9 L;  4WJW A;  3HOZ G;  3H0G H;  4PZ8 A;  3AQQ A;  2MHV A;  2KEE A;  1PTO H;  3WWV A;  4DGZ A;  1ICW A;  2B39 A;  3A8I E;  3ONA B;  4H44 C;  4QUF A;  4HIO A;  2AQ1 B;  4BY1 B;  2CWA A;  4C3H B;  4LF6 L;  1EZ6 A;  4ILW A;  1L1O C;  4WFN 3;  3PO3 B;  1F9P A;  1N9W A;  1XPU A;  4LUO A;  3HOZ B;  3A74 A;  2CQA A;  3C1F A;  3DM3 A;  3CPW A;  1H9S A;  2G9H D;  1VQL A;  5DAU A;  1KDB A;  1HA6 A;  4OX9 L;  1DOM A;  3OW2 A;  2AMC B;  4DNT B;  4DV3 Q;  1NR4 A;  4JK1 C;  1NJI C;  3CCS A;  3D4W A;  2NZH A;  3H94 A;  4A3K H;  1XXG A;  4K0K Q;  2Q2H A;  3ERS X;  3CCM A;  3KLW A;  1QVC A;  5L37 A;  5J39 A;  4X62 Q;  2B3G A;  1U0L A;  1TS2 A;  1CT1 D;  2JXM B;  4QB4 A;  4R4I A;  2JJQ A;  3NPP A;  5CV9 A;  1VQH A;  4FF3 A;  1Q8K A;  2VXW A;  1VQK A;  4HSP A;  1OXS C;  5C3E G;  4KHV A;  1KAA A;  5E4X A;  4CKB A;  3QOJ A;  4DAP A;  2E5L L;  1TVX A;  4Y52 H;  1SJH D;  1NE3 A;  4DR3 Q;  2SNS A;  1Q3L A;  3BZD B;  3GTO B;  1ESR A;  3PUV A;  2ZM6 Q;  2UXC L;  4ZKB B;  1E24 A;  3CME A;  4DUY Q;  2F4I A;  4X3K A;  4DV6 Q;  1AH9 A;  1M4V A;  4IUP A;  5C3E B;  2EIF A;  1Y14 B;  5COY A;  4RA8 A;  3VR2 A;  1HR0 Q;  2NVQ B;  1OXT A;  3AFP A;  3JAM E;  2GVB A;  3P1H A;  4E6I A;  3CRK C;  5JVH 3;  3NHH A;  3TRE A;  4GZY C;  3BS1 A;  5CV6 A;  3RMH A;  4BXX G;  5IGG A;  2I5H A;  4YY3 Q;  1JMC A;  5IYB G;  3SR1 A;  1B9N A;  1QWY A;  5G3L D;  1UNS A;  2WKD A;  1G29 1;  2EJG C;  3PGZ A;  4FF2 A;  1PZI D;  3HOY H;  2RVL A;  1L0Y B;  4JI0 Q;  4Y7N B;  1TWC H;  4O0A A;  2Z1C A;  1IW7 D;  2K6A A;  4JG2 A;  1II3 A;  5K36 H;  4JBK A;  2NN6 G;  1A3T A;  1EOT A;  4C3I H;  3GTG H;  4KY5 A;  2RA4 A;  4K5W A;  1S5F D;  4V0B A;  4X65 Q;  1BQQ T;  1PRT D;  2BA0 A;  4JV5 L;  1VQF A;  2D0O A;  4HCE A;  2JA7 G;  4R8N A;  1HHV A;  4XQN A;  1M8A A;  5C0X J;  4XXE A;  1LAB A;  2F0S A;  2B2V C;  1SMY D;  5LMN Q;  3DEP A;  1TII D;  1KHI A;  2K50 A;  1HJP A;  1F2M A;  2B2U A;  3OTO Q;  5T1G A;  4IUR A;  4A3G G;  5IT9 E;  5G3L F;  3GTJ H;  1X3Q A;  4YIJ A;  3S2H H;  1IL2 A;  2JA7 B;  5FO7 B;  5C3W A;  1X3E A;  3DWQ A;  3GDE A;  5JEA H;  3TP6 A;  3A7L A;  1Y8P B;  5C0X I;  4M8A A;  3HOW G;  3S24 A;  5KNC A;  2BH8 A;  4U67 3;  5EBC A;  2CWP A;  2OCE A;  4QJF A;  4A3G B;  1BVS A;  4DF7 A;  4DK6 C;  1PRT F;  4FP5 D;  2IX3 A;  2RSN A;  3I4N G;  2ZXO A;  1CKO A;  1GKH A;  5GAG C;  1A6X A;  2K7V A;  4KD4 A;  1D7Q A;  5ELB A;  3CC7 A;  1HNW Q;  2WB1 G;  4JI1 L;  4A3F G;  4K8I A;  3NWT A;  1GUT A;  3D4R A;  4NW2 A;  4P72 A;  3I72 A;  1AFP A;  4JI5 Q;  1R9T H;  4MIU A;  1Q8I A;  3HOW B;  1YNJ D;  2AQ3 B;  1S3O A;  1CHP D;  3U58 A;  4P74 A;  1PH6 A;  1VQ7 A;  5M3M G;  3TQY A;  4FO2 A;  3CAM A;  1SE3 A;  3A54 A;  3I4N B;  3H3V H;  3S1N H;  2C5C A;  2WAC A;  2K01 A;  2WB1 B;  4A3F B;  3HOX G;  1I6H H;  1BOS A;  1XNQ Q;  4JPB W;  4EGV A;  4BY1 H;  4F87 A;  3BDO A;  3ERO A;  4C3H H;  3I3C A;  5M3M B;  1Q86 C;  2LS0 1;  1LTR D;  3PO3 H;  1LT4 D;  3U9O A;  4JYA Q;  5LL6 S;  3C2P A;  1K83 B;  1M90 C;  3MVV A;  3HOZ H;  4PMW A;  3OYY A;  3TEH B;  1HNZ L;  1SBB B;  4MZ9 A;  3ZJY C;  4C3J G;  4DV4 Q;  4HIK A;  1VQO A;  3HOX B;  4H0L C;  3PUZ A;  1TS5 A;  1T5E A;  1HA5 A;  2KHS A;  1MGS A;  3JAM i;  3CP0 A;  4UDU C;  3RN2 A;  2ALY B;  3J7A F;  2F0N A;  4ID6 A;  3VR5 A;  1VDZ A;  2A19 A;  1H9M A;  3RLN A;  4KY7 A;  1QE6 A;  1PH9 A;  4C3J B;  2JQO A;  1RL2 A;  2EYL A;  5AJ3 L;  2EY2 A;  2K04 A;  2LY7 A;  2ZTE A;  1PFM A;  4DNI A;  4FYD A;  5M5X B;  1STN A;  3BG3 A;  1X3P A;  4AIM A;  1FNU A;  3SXH A;  5CV4 A;  3GQB A;  2PCF B;  4JOI C;  1WCM B;  4HR7 B;  2QCP X;  2MQH A;  3I4M G;  1CHQ D;  1CZG A;  1QB5 D;  5M3F G;  1CM9 A;  4DXF A;  1T9H A;  5BN3 A;  1HXY D;  2NVX B;  4HCS A;  1I50 B;  4BA2 I;  5C3E H;  1NMF A;  1B7Y B;  4N8F A;  1XNR L;  1Q12 A;  1PH8 A;  3MXN A;  2HCC A;  1N36 L;  1KRS A;  3H6M A;  5JVG 3;  2IT1 A;  4KMU C;  2QF7 A;  3I4M B;  4MTN A;  5M3F B;  1ENF A;  4X3U A;  5BN4 A;  1CQF A;  1U4M A;  1GUN A;  4R8I A;  3M85 A;  1SNP A;  3F2D A;  4NXN Q;  2DGY A;  2R92 G;  3R93 A;  5E3F A;  2BE5 D;  1FGB D;  5FLM H;  5ELD A;  2LSS A;  3E5S A;  3AEV A;  2B63 B;  1MD2 D;  3I4L A;  5FO8 B;  4Y7N H;  1XPO A;  4UP7 A;  2V1C C;  2PQE A;  4F88 A;  2XGT A;  3OWE B;  4MTK A;  1I94 L;  3P20 A;  4N9T A;  2GA4 B;  1LO5 D;  1TWF B;  2O5I C;  4QY7 A;  5IYB H;  3E0E A;  2HHH Q;  2R92 B;  3CC4 A;  3UDG A;  2KED A;  1X65 A;  1MSG A;  1TKW B;  2PZT A;  2QDB A;  1PTO D;  3K5M A;  5EPL A;  1STB A;  1JOO A;  5CV5 A;  4C1N K;  1QVF A;  3J80 L;  1EUJ A;  2GVA A;  1I5F A;  2DJF C;  5CC4 A;  4DV7 Q;  2OEO A;  4C2M B;  4GN3 B;  3NWS A;  1HNX Q;  2M2L A;  2E2H H;  3VDY A;  2HIX A;  3RNU A;  2JA7 H;  2NTT A;  3U9S A;  2VUM G;  3RUZ A;  3J7A V;  1FL0 A;  3HG9 A;  1KRT A;  4OWX B;  2JEB I;  3I4O A;  1PYB A;  1VMP A;  2F0F A;  1AZP A;  2K14 A;  1DYQ A;  2V4D A;  5IOD A;  4JBM A;  4DR6 Q;  3MHB A;  3AFQ A;  4ZKC B;  2KCN A;  2E2I B;  2B8F A;  3RN5 A;  2FJ2 A;  5I9P A;  1KDC A;  4X64 L;  2R7F A;  2VUM B;  2F03 A;  4O1N A;  3V05 A;  2RDG A;  1LT3 D;  4GKK L;  1E2W A;  2PQA B;  3FEW X;  4LF7 Q;  3URY A;  3O13 A;  3MXG A;  3DM1 A;  1Q90 A;  3HOW H;  1X6O A;  2WAQ B;  4G4K A;  1SYB A;  1A63 A;  2N8N A;  1YJW A;  2RHQ B;  5ELE A;  2RBM A;  4ALP A;  2K5V A;  1RTN A;  3MXN B;  5LMU Q;  1K8O A;  1TT2 A;  4TKO B;  3TRZ A;  2RDF A;  3BU2 A;  3CQZ H;  1EIG A;  2LFN A;  3F1Z A;  4HMJ A;  1CKN A;  1EY7 A;  4OWT B;  2A6E D;  1IBL L;  2F3W A;  1Y1W H;  2L4N A;  4JI2 L;  1RCV D;  4B08 A;  2WII B;  1F2L A;  2L11 A;  3J80 c;  1STG A;  4ZUI A;  3T13 A;  5JEA J;  5M3M H;  1RKN A;  2K28 A;  4GNX C;  1A8V A;  4JI8 Q;  2BH2 A;  1HTL D;  1QG7 A;  3ULP A;  1C7Y A;  4KHP Q;  3HOX H;  1SNC A;  1TWG B;  4JC0 A;  3E9I A;  1E0B A;  3KF6 A;  4H02 A;  2UUB Q;  2GN5 A;  5FKA C;  4OWW B;  3M4P A;  1IL8 A;  2A68 D;  4CDF C;  3GTL H;  2ENB A;  2E2J B;  2OTJ A;  2X6G A;  1LTI D;  4DK0 A;  3CXC A;  2PI2 A;  4HED A;  1KC8 C;  5DEH A;  1DM0 B;  3I56 A;  3NSW A;  4DV2 L;  3I8Z A;  5M5X H;  2K75 A;  2PNH A;  3BJU A;  1LT6 D;  3A55 A;  4B3S Q;  4WRD A;  4LF8 Q;  1SFO B;  2YYZ A;  3GD7 A;  1PH1 A;  1VS0 A;  4KLK A;  3ER0 A;  3CMA A;  2IX0 A;  4DR7 Q;  4A3D H;  1FYC A;  2QEJ C;  4QMG A;  2NVX H;  1I50 H;  2R7Z H;  5IGC A;  1XWE A;  3PIP A;  3D4D A;  2EDG A;  1LYL A;  3R2T A;  4G7O C;  5FLX E;  4A3J G;  2B2V A;  4FDB A;  5GAH C;  2NVY B;  2OXP A;  4IN3 A;  2YTX A;  2F0V A;  4A3I G;  3H3V I;  1DGS A;  5DNF A;  1EIH A;  3I4M H;  4KKU A;  5EPJ A;  5M3F H;  3HOV H;  4HTH A;  3SK5 A;  1KNA A;  3TS0 A;  1UE7 A;  2I46 A;  1QZH A;  4PV1 C;  1L0W A;  4A3L G;  5J1Z A;  1SNM A;  4Q0F A;  5M5W H;  1VQ9 A;  4JW0 A;  1ENC A;  2D9U A;  4HIM A;  1SYF A;  4B9W A;  5ISR A;  1P16 A;  4XQJ A;  4A3J B;  3NE5 B;  3VYT A;  4A3B H;  3RZD H;  1PH4 A;  1A0I A;  1S4Z A;  4A3I B;  1CKN B;  4DV3 L;  1F2Y A;  2AKW B;  4PZ7 A;  4K0K L;  2CCZ A;  1X56 A;  1TWH B;  2R92 H;  4OL7 A;  4X62 L;  4IO9 A;  2PZU A;  4BWG B;  1U4R A;  3CCU A;  1YNN C;  1ROD A;  1XMO Q;  1EZ8 A;  2D0P A;  2I5M X;  2YTY A;  4X6A H;  1GUW A;  1QUQ A;  3KF6 B;  1WTQ A;  4YCU A;  4C2M H;  4CDD C;  4DR3 L;  1JB7 A;  4B3T Q;  1R4Q B;  1KIX A;  3RR5 A;  3J81 L;  2ZM6 L;  3NQI A;  4DUY L;  1LTG D;  4LMQ D;  1SYC A;  4DV6 L;  5C5M A;  2PW5 A;  3KLR A;  2ID0 A;  1HR0 L;  1JE4 A;  4ZCK A;  1K3R A;  1PDQ A;  1Y69 U;  2WKC A;  1WTH A;  1WD0 A;  2UU9 Q;  3FKI B;  4B3M Q;  2VUM H;  5HUR A;  4YY3 L;  2EY1 A;  2RQX A;  3GP7 A;  1HQR D;  2JA8 G;  3HGB A;  1UWV A;  3AU7 A;  4JI0 L;  2DNC A;  3CCL A;  4LF5 L;  4IFD G;  4C1N I;  3PF5 A;  3T1Y Q;  2KVM A;  2A69 C;  5CV8 A;  1FJG Q;  2K03 A;  3M7G A;  5KYL A;  1JJ2 A;  1BBX C;  4IQZ A;  1WTO A;  2O4X A;  3E0J A;  3NUC A;  4X65 L;  5CYU A;  4RGM A;  3M4Q A;  4OO1 G;  1WTP A;  1I4G A;  1MI2 A;  4I7Z C;  2L15 A;  3EA6 A;  3S16 B;  1C0A A;  2JA8 B;  2OWO A;  1EQV A;  1EQT A;  3EBE A;  1WTX A;  1TWA H;  3QWN A;  3J7Z C;  2N55 A;  3GTK B;  4JOI A;  5LMN L;  2VQE Q;  4NXM Q;  3MTS A;  4KN4 C;  4KHZ A;  1GUS A;  1SXT A;  3NBI A;  3OTO L;  2ZJP A;  1J8I A;  3J81 c;  2F0P A;  3S14 H;  4RGO S;  1TWG H;  3K7U C;  2YU9 B;  2D62 A;  2HT1 A;  4KN7 C;  3CHB D;  2K5D A;  2JEA I;  2AWN A;  3BDL A;  2E2J H;  2TSS A;  2QEX A;  1JOR A;  1V43 A;  2IX1 A;  2F0Q A;  5J3B A;  5C6A A;  3M4O B;  4EQO A;  1VCI A;  3KYH C;  1DD2 A;  2NZ1 D;  2BDO A;  3VA7 A;  1MJE A;  3VYS A;  3JAM c;  1DCZ A;  5JAV A;  3F2U A;  4AH6 A;  3TN2 A;  1QUQ B;  3VYU A;  3NEM A;  3GTM B;  1HNW L;  3K5L A;  2Z6K A;  3QJY A;  1AE2 A;  4JI5 L;  1SFO H;  1B70 B;  4L5T A;  4HJ9 A;  1VQ8 A;  2F3I A;  2KBN A;  4IUU A;  5EKI A;  2FIN B;  1Z7T A;  1UE6 A;  1U5K A;  5A2Q L;  2VL6 A;  2ZTC A;  4DV0 Q;  3ERQ A;  3NBH A;  4DAY A;  4CJ1 B;  1YIJ A;  1XX8 A;  1C8C A;  1EEI D;  3E9H A;  5IYD H;  4L6T B;  4APV A;  1CK1 A;  2AHO B;  2PPB C;  3TSS A;  2X69 A;  3KBX A;  1SSO A;  2VB3 X;  1VQB A;  2PW7 A;  4DKA C;  1XNQ L;  3MFG A;  5A35 A;  4DR2 Q;  3CF5 A;  4F7X A;  1GD7 A;  2CFM A;  3KUP A;  1MJC A;  4EX5 A;  3ITP A;  4JYA L;  1BCP C;  2G9D A;  3T56 B;  3M3Y H;  4DV4 L;  4OXP A;  1IKM A;  1B50 A;  2R3Z A;  4CKC A;  4A3J H;  5M5Y H;  4YHH Q;  1SND A;  3WOE A;  4KK7 A;  5IP7 G;  1F77 A;  5FJ8 G;  4A3I H;  4UP9 A;  3NTI A;  2CH4 W;  1W3S A;  1HFN A;  2ES2 A;  1NR2 A;  3BDC A;  3K57 A;  4BBR H;  3ULL A;  4L63 B;  3U4Z A;  1TWH H;  2J0T D;  3CW2 C;  4N8X 1;  1KD1 C;  4S3S A;  1SN8 A;  5C5L A;  3E3X A;  1X3F A;  1PXU A;  3G71 A;  4R9W A;  3IAY A;  2M9V A;  5I6W A;  1H9S B;  2L12 A;  4XT1 B;  2VQF Q;  2A6H C;  3AB9 A;  3PO2 G;  2R6G A;  4FF4 A;  1FD7 D;  1JIC A;  1BDO A;  1HR0 W;  4MNO A;  5E1F A;  3STB C;  1K8A C;  3CCE A;  4YWM A;  2BA1 A;  3MEF A;  2JA9 A;  4NP5 A;  2DJG C;  4YWL A;  2ZTD A;  4FF1 A;  3PO2 B;  2EVB A;  1WTV A;  2CW0 C;  2F1M A;  3I70 A;  3SK6 A;  1PH5 A;  3K5O A;  2K05 A;  3UE0 A;  4GLA C;  4H7B A;  4NPS A;  5F2D A;  4GNX A;  1C9O A;  2L5T A;  2ZJQ A;  4LFA Q;  4MHE A;  2Q8R E;  2AUJ D;  1I3Q H;  4NXN L;  2CH4 A;  2IJ0 A;  2CKZ B;  5JJK A;  1TY2 A;  1EIF A;  4JI4 Q;  5C4H A;  1XTD A;  3NBH B;  4DAY B;  2UUC Q;  4RHR A;  2JA6 G;  1VQ5 A;  1KDA A;  3DMU A;  4X66 Q;  1CA6 A;  1CKM A;  4RFB A;  2PYK A;  5TSS A;  3S9W A;  2ASB A;  5GQO A;  2KHI A;  2PZW A;  3W2D A;  4IOC A;  1WFQ A;  1HUM A;  3ND9 A;  4YCV A;  5LMN W;  3DXJ C;  2RSO A;  2HHH L;  2XNA C;  3JAM L;  2CQO A;  4IPC A;  3S16 H;  3G6J B;  1K73 C;  1YEZ A;  2MUY A;  2C35 B;  3J81 j;  2UXC Q;  2JA6 B;  3OHX C;  4IFD H;  3GTK H;  2Y0S G;  3K5N A;  2L55 A;  3K80 C;  3T1H Q;  3MEH A;  3IL8 A;  4DV7 L;  1S5C D;  3K81 C;  2Q2T A;  2XIW A;  1HNX L;  4A3E G;  2BDN A;  1O80 A;  5D3D A;  4KJN A;  4ZK9 B;  3B6Y A;  3DUZ A;  4RAU C;  4BBS G;  1SE4 A;  5FK9 C;  1SDF A;  2MFI A;  1PFN A;  4NB3 A;  1NSN S;  1WCM G;  2Y0S B;  1V8Q A;  3OW7 A;  3M4O H;  4DU9 A;  4ZAI A;  4ZUJ A;  2CVR A;  1V1P A;  4DR6 L;  1VQ6 A;  1EU3 A;  1KLG D;  4CJ0 B;  1NBW A;  2ZJR A;  3GTQ B;  4A3E B;  2R61 A;  1VMC A;  3D6C A;  3PMF A;  3GTM H;  2E8G A;  4DV1 Q;  4BBS B;  3A0J A;  2X6L A;  3VYR A;  4C56 C;  4XQQ A;  3KFU A;  1AW7 A;  1XMQ Q;  1Q1E A;  4LF7 L;  1Z9F A;  4R4C A;  3I7F A;  5C0X G;  3Q0A A;  5IT9 L;  1QCB D;  1JE5 A;  1TR5 A;  3GTO H;  1LV9 A;  5I6Y A;  2H4O A;  3BZK A;  1STH A;  1D2B A;  1ZXT A;  1Z47 A;  4RGN A;  1MIU A;  5LL6 X;  4XT3 B;  4X3T A;  4LK1 C;  2NVQ H;  4GNX B;  1V1Q A;  4UY8 C;  2B63 G; 
#chains in the Genus database with same CATH homology
 3A8K E;  1OXV A;  2OF1 A;  5JOB A;  3KLS X;  2EYF A;  3LNN A;  3MA2 B;  1JR0 D;  3VR3 A;  1SE2 A;  4PMC A;  4NMZ A;  1R4P B;  2PMZ B;  4KKT A;  1UUP A;  4QIW B;  1EY5 A;  4KKS A;  3I73 A;  1B3A A;  3S1M B;  1ZYR D;  2Q8I B;  2F0H A;  1VF5 C;  3BVG A;  2F0W A;  3KF8 A;  3SHL A;  1DON A;  2EOT A;  4ZRZ A;  1E2Z A;  2EY6 A;  2JSO A;  3L9A X;  5KGU A;  1MSH A;  3K7A B;  4KI0 A;  2VNU D;  5NUC A;  2NN6 H;  1B4O A;  2K33 A;  3G7L A;  1IW7 C;  2KUM A;  2I07 B;  2RDH A;  5C3X A;  4V19 0;  4OIK A;  2L1B A;  1PRT C;  2B2W A;  4CGY B;  5IIF A;  2XWB B;  1G6Z A;  1V1P B;  1PYW D;  3A56 A;  1I4X A;  2B8G A;  1CA5 A;  5FOB B;  2A5H A;  3L3O C;  1SMY C;  1HUN A;  1HFG A;  1D5M C;  3TME A;  1EU4 A;  2DY8 A;  2LMC B;  5KEE A;  3GV3 A;  3HRZ C;  1H9J A;  2NBF A;  5EPK A;  2J4X A;  1F2Z A;  3S1Q B;  2VB2 X;  2F0T A;  2NVT B;  3M7N A;  1RF2 D;  3EQL C;  2WV6 D;  3DEO A;  2SDF A;  2F0O A;  4RWS C;  1STY A;  4Q5V A;  1RHP A;  4O42 A;  2EYJ A;  5CGK A;  2IL8 A;  3Q22 A;  1YNJ C;  2KA7 A;  1V1O A;  4MN3 A;  3MFY A;  3SEB A;  5CBE E;  3TZU A;  2E2D C;  3P7J A;  2E74 C;  1Q1B A;  4XIG S;  2D2C C;  1PTO B;  2K1B A;  3MXP A;  1I6V C;  5IGD A;  1LLR D;  1JB3 A;  4CHT B;  1DXM A;  1RTO A;  4OIJ A;  3AMU A;  1UAP A;  1FNV A;  1A3V A;  1RJT A;  2F0M A;  5M9O A;  3Q24 A;  1BNZ A;  1GUO A;  4A3K B;  3NXW A;  2EYP A;  3R8B A;  1EWC A;  1LT5 D;  4BY7 B;  5E4W C;  5LHY 1;  4DFA A;  5HGT A;  3PUY A;  5C4J B;  1MBY A;  4IFD J;  4BA1 I;  3A7A B;  1CI3 M;  1BXT A;  1Y1V B;  2HUG A;  1EY8 A;  4I65 A;  2HDM A;  5J22 A;  1NAP A;  2QIL A;  3V2T A;  5C4Z A;  3IFD A;  5C0X H;  3K58 A;  4DN4 M;  1D6E C;  4FXK C;  4TRD A;  5C44 B;  1I4H A;  3DHQ A;  2K32 A;  1D1I A;  4ME5 A;  1LTT D;  4JBW A;  1XYI A;  4IFD I;  2Z4I A;  5DM6 3;  2AWO A;  1DJR D;  4C3I G;  4P2C B;  5D3I B;  4PNY A;  1D5Z C;  4DNR B;  4ZLT F;  1B2T A;  1TWC B;  2BE5 C;  3D3R A;  2O2L D;  1ENA A;  3A8J E;  5EBD A;  4CBV A;  1F9S A;  3S2D B;  4C3I B;  3GTG B;  4Z9C B;  5KIX A;  1BCP F;  3EFX D;  3TP8 A;  2XVS A;  1UEA B;  3NTH A;  5JEA G;  4QCL A;  1W6J A;  4HAE A;  1C48 A;  2FMM A;  4ZQ3 A;  1PTO C;  1BR9 A;  4K6L A;  1LTB D;  1EY4 A;  1BCP B;  3CKI B;  2L0C A;  1NUC A;  2EJM A;  5KRU A;  3FPP A;  1G2S A;  4TSS A;  5COR A;  1GUG A;  3LWE A;  3Q6S A;  1GHJ A;  3R3O A;  1TY0 A;  1QIL A;  3S17 B;  1PFB A;  4IUQ A;  2K5Q A;  3NQT A;  4KY6 A;  3MAQ A;  2Z8L A;  2KCC A;  1TS3 A;  4TQU S;  2B2W C;  4G7Z C;  4XDX A;  5FLX L;  5KYI A;  4QF4 A;  3HZX A;  1DOK A;  1PLF A;  1STA A;  1TU2 B;  1GHK A;  1A15 A;  2A73 B;  3UI2 A;  2E76 C;  3S1N B;  1I6H B;  3FVQ A;  3N52 A;  2NN6 I;  1F9R A;  2F0I A;  4RCN A;  4XYQ A;  3E6Z X;  2A6E C;  5CBA E;  3GTP B;  1STE A;  4KD3 A;  1SYE A;  4G7H C;  2KOL A;  4K5X A;  1H9K A;  1D1K A;  2E75 C;  2OT2 A;  3PUW A;  2KQ3 A;  4U68 A;  1L0X B;  2A68 C;  1ML0 D;  5CV7 A;  2SOB A;  1U4L A;  3OSO A;  1JWU D;  5IOC A;  3MC0 B;  3HOU B;  3QO2 A;  4OHJ A;  4UAI A;  1GXD C;  1HCZ A;  3S15 B;  3T4A C;  2F3V A;  1QNK A;  1PZJ D;  3QOL A;  2CHB D;  3K0Y A;  2F0L A;  3WOF A;  3ZYY X;  3DWP A;  4J6H A;  3HP3 A;  3GO5 A;  3FRP B;  5IGE A;  1JCK B;  4EQP A;  4CKE A;  1CTM A;  1JWM D;  2ZT9 C;  5EKK A;  3SVM A;  5I2X A;  1GJX A;  5DM7 3;  3MXU A;  2WIN B;  2HDL A;  2ZXP A;  3MZ5 A;  2R93 B;  2KEC A;  2EJF C;  1B44 D;  3C46 A;  2N88 A;  1BF4 A;  3BVM A;  3RZO B;  1EEF D;  1EY6 A;  4XYO A;  3FDT A;  1HTP A;  1HQM C;  2F0D A;  3H3V C;  2EZV A;  2JA5 B;  1DZ1 A;  4K2K A;  3H91 A;  2XWJ B;  3BVZ A;  3I91 A;  4PMB A;  5BN5 A;  1O7Y A;  4WOR A;  2E2H B;  5EJW A;  5T1I A;  3N6R A;  3PV0 A;  3P75 A;  1RD9 D;  4M1U B;  1JWS D;  1JQY D;  1E2V A;  1WVL A;  1J9O A;  5D65 A;  1EYA A;  4K5V A;  3VA5 A;  4DAV A;  1A3U A;  1FNW A;  2B2T A;  3I90 A;  1ET9 A;  4DK1 A;  1O78 A;  3TP5 A;  3TDQ A;  2MPM A;  3D8G A;  2MP1 A;  2M00 A;  1AEX A;  3D6W A;  3IKJ A;  3OIQ A;  1BUV T;  3T16 A;  1FR3 A;  1GOZ A;  3L7Z C;  5KND A;  4B9X A;  1PRT B;  3TBI B;  1G8Z D;  2FFK B;  3CQZ B;  5FO9 B;  1EL0 A;  4OO1 H;  1EY0 A;  1Y1W B;  3EVQ A;  1W6K A;  5KNB A;  1SNO A;  3J80 E;  2XRS D;  4RCO A;  3Q23 A;  4N9P A;  1KTK A;  2TMP A;  2NB0 A;  3RLF A;  2B2Y A;  3GV6 A;  2BCO A;  3BYT B;  2ICE C;  3OMC A;  3S1R B;  1ILP A;  2IPK D;  3GTL B;  1AP0 A;  5D14 A;  5CMD A;  2BOS A;  4RHS A;  1ESF A;  2D5D A;  5C4X B;  1IYU A;  1DOL A;  1IHZ A;  1TS4 A;  4G57 A;  1ZKO A;  2EE1 A;  3OPO A;  2L9H A;  4F8M A;  3D31 A;  1PZK D;  1SYD A;  3J7Y W;  4NDX A;  4X3S A;  3SE0 A;  2DN8 A;  1HPC A;  1WTW A;  2SNM A;  1KNE A;  3SK8 A;  3OWF A;  1LTS D;  4PQX A;  4RGT A;  1SJE D;  4L8J A;  3NTK A;  4A3D B;  2EXZ A;  4EVO A;  3M4Y A;  2R7Z B;  5JJZ A;  1PMR A;  5K5P A;  5ELC A;  2F0U A;  3KLS A;  1AN8 A;  2DY7 A;  3DWA A;  3HEJ A;  4H13 C;  4AYB B;  2HQE A;  2IWH A;  1JOQ A;  3HOV B;  4RKB A;  2NWG A;  4IUN A;  4EQN A;  1YNN D;  5M5W B;  2AQ2 B;  2JP1 A;  1ONL A;  1F9Q A;  4A3B B;  4IAL A;  3RZD B;  4DXG A;  1EYC A;  4NKL A;  3X3N A;  3CU7 A;  1EFI D;  1C4Q A;  2XRQ D;  3TP7 A;  3W3A A;  2ICI A;  1EYD A;  1B9M A;  4FXD A;  2IW3 A;  2WP8 J;  4K14 A;  3MWY W;  2Q8T A;  1I4P A;  4K6D A;  3VR6 A;  3CRL C;  1EWH A;  2J7Z A;  1O7L A;  2C9O A;  2KJX A;  1IKL A;  3SDZ A;  3QIA A;  4K8J A;  4A93 B;  2EYH A;  1H9R A;  1OXX K;  2EY5 A;  3K6O A;  2K5W A;  3OIP A;  2MGS A;  3K59 A;  1Y8O B;  3X3M A;  1NCV A;  1SAP A;  4LAA A;  3TZD A;  2A69 D;  4RH6 A;  4A3M B;  5IGF A;  4J1M A;  1I4R A;  3VR4 A;  4LJZ C;  3SK4 A;  3HS0 C;  1PTO F;  2F0G A;  4KJO A;  3R2I A;  1IYV A;  1OO9 B;  2LKV A;  3HKZ B;  4KV6 A;  2B2U C;  3FMC A;  2MJ8 A;  4IZ8 A;  2PO4 A;  1WD1 A;  3H0G B;  5EQ0 A;  2A74 C;  3C1E A;  1LAC A;  3T51 B;  2FHT A;  3C3L A;  4FVM A;  1U4P A;  1S5B D;  1WTR A;  1HRJ A;  2JYO A;  1TWA B;  2B2T C;  4KTA A;  4OGQ C;  3KBG A;  1KAB A;  2HCI A;  1B1Z A;  4CJ2 C;  2RKS A;  3LWU A;  1AZQ A;  3J81 E;  3S14 B;  3KK7 A;  1LTA D;  3T53 B;  4K2L A;  1TQO A;  3OMG A;  4HMI A;  1A2T A;  5EKL A;  1O7Z A;  1BO0 A;  3IFT A;  1RDP D;  1T5X D;  4DA2 A;  5JPM C;  3H09 A;  4HSV A;  2O5J C;  3PUX A;  1QJO A;  3QB3 A;  2F0E A;  3BYY B;  1EY9 A;  4ODG A;  2XN9 C;  5AFW A;  1KLU D;  1G91 A;  2QKI C;  2JE6 I;  1BCP D;  2B2Y C;  1CQV A;  4QUC A;  2PNR C;  4FNF A;  4IUT A;  5ELF A;  5K36 G;  2EPB A;  5I9O A;  1ILQ A;  4XTC S;  4BS9 A;  1S5E D;  3RD4 A;  5I4D A;  2NTS A;  4ULL A;  4OO1 I;  1XTC D;  2FMC A;  3M3Y B;  1CFM A;  3PIP 3;  3OOC A;  3HOY B;  2XSC A;  2A6H D;  1QOH A;  5M5Y B;  1U9R A;  5I2Y A;  5IGB A;  4HN7 A;  3QG1 A;  1D5X C;  2F0K A;  3EJI A;  5JPN C;  3FPU B;  4BBR B;  1ZYR C;  1A2U A;  5EGT A;  1SNQ A;  1JOK A;  1Z6H A;  2CW0 D;  2SEB D;  1SEB D;  2H1E A;  4J8Q A;  4FXG C;  1X32 A;  1Y8N B;  3GTJ B;  1ET6 A;  4RKL A;  5A2Q E;  3S2H B;  2Z4H A;  2AUK A;  3NK9 A;  2NYZ D;  2NUC A;  3WDN A;  1CZW A;  3NP8 A;  1B53 A;  3ND8 A;  1I4Q A;  1G2T A;  3V96 A;  1ZEQ X;  1QNU A;  4ABN A;  2EYO A;  1K8M A;  3LX0 A;  1JC7 A;  4ZYS A;  1OXU A;  1VF7 A;  1I3Q B;  5CR3 A;  1SYG A;  2ZXR A;  3PIO 3;  1R9T B;  4IUV A;  4C3H G;  2EYM A;  2DNE A;  2F0J A;  1S5D D;  4WJW A;  2MHV A;  2KEE A;  1PTO H;  4DGZ A;  1ICW A;  2B39 A;  3A8I E;  3ONA B;  4H44 C;  4QUF A;  4BY1 B;  2AQ1 B;  4C3H B;  1EZ6 A;  4ILW A;  4WFN 3;  3PO3 B;  1F9P A;  3HOZ B;  2CQA A;  3C1F A;  1H9S A;  2G9H D;  5DAU A;  1KDB A;  1HA6 A;  1DOM A;  4DNT B;  1NR4 A;  4JK1 C;  3D4W A;  3H94 A;  1XXG A;  5J39 A;  1TS2 A;  1CT1 D;  2JXM B;  4QB4 A;  3NPP A;  5CV9 A;  4FF3 A;  2VXW A;  4HSP A;  1OXS C;  4KHV A;  1KAA A;  5E4X A;  4CKB A;  3QOJ A;  4DAP A;  1TVX A;  1SJH D;  2SNS A;  1Q3L A;  3BZD B;  3GTO B;  1ESR A;  3PUV A;  4ZKB B;  2F4I A;  4X3K A;  1M4V A;  4IUP A;  5C3E B;  5COY A;  4RA8 A;  3VR2 A;  2NVQ B;  1OXT A;  3JAM E;  3P1H A;  4E6I A;  3CRK C;  5JVH 3;  3NHH A;  4GZY C;  3BS1 A;  5CV6 A;  3RMH A;  5IGG A;  3SR1 A;  1B9N A;  1QWY A;  5G3L D;  1UNS A;  2WKD A;  1G29 1;  2EJG C;  4FF2 A;  1PZI D;  2RVL A;  1L0Y B;  4Y7N B;  2Z1C A;  1IW7 D;  2K6A A;  1II3 A;  5K36 H;  2NN6 G;  1A3T A;  1EOT A;  4KY5 A;  2RA4 A;  4K5W A;  1S5F D;  4V0B A;  1BQQ T;  1PRT D;  2BA0 A;  4HCE A;  4R8N A;  1HHV A;  4XQN A;  1M8A A;  5C0X J;  4XXE A;  1LAB A;  2F0S A;  2B2V C;  1SMY D;  3DEP A;  1TII D;  1F2M A;  2B2U A;  5T1G A;  4IUR A;  5IT9 E;  5G3L F;  1X3Q A;  4YIJ A;  2JA7 B;  5FO7 B;  5C3W A;  3DWQ A;  5JEA H;  3TP6 A;  3A7L A;  1Y8P B;  5C0X I;  4M8A A;  5KNC A;  4U67 3;  5EBC A;  4A3G B;  4DF7 A;  1PRT F;  4FP5 D;  2IX3 A;  2RSN A;  2ZXO A;  1A6X A;  2K7V A;  4KD4 A;  5ELB A;  4K8I A;  3NWT A;  1GUT A;  3D4R A;  4NW2 A;  3I72 A;  1AFP A;  4MIU A;  1Q8I A;  3HOW B;  1YNJ D;  2AQ3 B;  1CHP D;  4FO2 A;  1SE3 A;  3A54 A;  3I4N B;  2C5C A;  2WAC A;  2K01 A;  2WB1 B;  4A3F B;  1BOS A;  4EGV A;  4F87 A;  3BDO A;  3ERO A;  3I3C A;  5M3M B;  2LS0 1;  1LTR D;  1LT4 D;  3U9O A;  5LL6 S;  3C2P A;  1K83 B;  3MVV A;  4PMW A;  1SBB B;  4C3J G;  3HOX B;  4H0L C;  3PUZ A;  1TS5 A;  1T5E A;  1HA5 A;  2KHS A;  1MGS A;  4UDU C;  3J7A F;  2F0N A;  4ID6 A;  3VR5 A;  1VDZ A;  1H9M A;  4KY7 A;  1QE6 A;  4C3J B;  2EYL A;  2EY2 A;  2K04 A;  2LY7 A;  1PFM A;  4FYD A;  5M5X B;  1STN A;  3BG3 A;  1X3P A;  1FNU A;  3SXH A;  5CV4 A;  3GQB A;  2PCF B;  1WCM B;  4HR7 B;  2QCP X;  1CHQ D;  1CZG A;  1QB5 D;  1CM9 A;  4DXF A;  5BN3 A;  1HXY D;  2NVX B;  4HCS A;  1I50 B;  4BA2 I;  1Q12 A;  3MXN A;  2HCC A;  3H6M A;  5JVG 3;  2IT1 A;  4KMU C;  2QF7 A;  3I4M B;  5M3F B;  1ENF A;  4X3U A;  5BN4 A;  1CQF A;  1U4M A;  1GUN A;  4R8I A;  3M85 A;  1SNP A;  3R93 A;  5E3F A;  2BE5 D;  1FGB D;  5ELD A;  3E5S A;  2B63 B;  1MD2 D;  3I4L A;  5FO8 B;  2PQE A;  4F88 A;  3OWE B;  3P20 A;  4N9T A;  2GA4 B;  1LO5 D;  1TWF B;  2O5I C;  2R92 B;  2KED A;  1MSG A;  1TKW B;  2PZT A;  2QDB A;  1PTO D;  3K5M A;  5EPL A;  1STB A;  1JOO A;  5CV5 A;  4C1N K;  3J80 L;  5CC4 A;  2OEO A;  4C2M B;  3NWS A;  2M2L A;  2NTT A;  3U9S A;  3RUZ A;  3J7A V;  3HG9 A;  2JEB I;  1VMP A;  2F0F A;  1AZP A;  1DYQ A;  2V4D A;  5IOD A;  3MHB A;  4ZKC B;  2KCN A;  2E2I B;  2B8F A;  2FJ2 A;  5I9P A;  1KDC A;  2VUM B;  2F03 A;  4O1N A;  3V05 A;  2RDG A;  1LT3 D;  1E2W A;  3FEW X;  3URY A;  3O13 A;  3MXG A;  3DM1 A;  1Q90 A;  2WAQ B;  4G4K A;  1SYB A;  5ELE A;  2RBM A;  1RTN A;  1K8O A;  1TT2 A;  4TKO B;  2RDF A;  1EIG A;  2LFN A;  4HMJ A;  1EY7 A;  2A6E D;  2F3W A;  2L4N A;  1RCV D;  4B08 A;  2WII B;  1F2L A;  2L11 A;  1STG A;  4ZUI A;  3T13 A;  5JEA J;  1RKN A;  2K28 A;  1HTL D;  1QG7 A;  1SNC A;  1TWG B;  1E0B A;  5FKA C;  1IL8 A;  2A68 D;  2ENB A;  2E2J B;  2X6G A;  1LTI D;  4DK0 A;  4HED A;  5DEH A;  1DM0 B;  3NSW A;  3I8Z A;  1LT6 D;  3A55 A;  4WRD A;  1SFO B;  2YYZ A;  3GD7 A;  2IX0 A;  1FYC A;  2QEJ C;  4QMG A;  5IGC A;  1XWE A;  3D4D A;  2EDG A;  3R2T A;  4G7O C;  5FLX E;  2B2V A;  2NVY B;  2OXP A;  4IN3 A;  2F0V A;  5DNF A;  1EIH A;  4KKU A;  5EPJ A;  4HTH A;  3SK5 A;  1KNA A;  2I46 A;  4PV1 C;  5J1Z A;  1SNM A;  4Q0F A;  1ENC A;  2D9U A;  4A3J B;  1SYF A;  4B9W A;  5ISR A;  4XQJ A;  3NE5 B;  3VYT A;  1S4Z A;  4A3I B;  1F2Y A;  1TWH B;  4OL7 A;  2PZU A;  4BWG B;  1U4R A;  1YNN C;  1ROD A;  1EZ8 A;  1GUW A;  1WTQ A;  1R4Q B;  3J81 L;  3NQI A;  1LTG D;  4LMQ D;  1SYC A;  5C5M A;  2PW5 A;  3KLR A;  2ID0 A;  1JE4 A;  1PDQ A;  1Y69 U;  2WKC A;  1WD0 A;  3FKI B;  5HUR A;  2EY1 A;  2RQX A;  3GP7 A;  1HQR D;  3HGB A;  3AU7 A;  2DNC A;  4IFD G;  4C1N I;  2KVM A;  2A69 C;  5CV8 A;  2K03 A;  3M7G A;  5KYL A;  1BBX C;  4IQZ A;  1WTO A;  2O4X A;  3E0J A;  3NUC A;  5CYU A;  4RGM A;  4OO1 G;  1WTP A;  1I4G A;  1MI2 A;  4I7Z C;  3EA6 A;  3S16 B;  2JA8 B;  1EQV A;  1EQT A;  1WTX A;  3QWN A;  2N55 A;  3GTK B;  3MTS A;  4KN4 C;  4KHZ A;  1GUS A;  1SXT A;  3NBI A;  1J8I A;  2F0P A;  4RGO S;  2YU9 B;  2D62 A;  4KN7 C;  3CHB D;  2K5D A;  2JEA I;  2AWN A;  3BDL A;  2TSS A;  1JOR A;  1V43 A;  2IX1 A;  2F0Q A;  5C6A A;  3M4O B;  4EQO A;  1VCI A;  1DD2 A;  2NZ1 D;  2BDO A;  3VA7 A;  3VYS A;  1DCZ A;  5JAV A;  3F2U A;  3TN2 A;  3VYU A;  3GTM B;  3K5L A;  3QJY A;  4IUU A;  5EKI A;  2FIN B;  1Z7T A;  5A2Q L;  3ERQ A;  3NBH A;  4DAY A;  4CJ1 B;  1C8C A;  1XX8 A;  1EEI D;  4L6T B;  1CK1 A;  2PPB C;  3TSS A;  2X69 A;  3KBX A;  1SSO A;  2VB3 X;  2PW7 A;  3MFG A;  5A35 A;  4F7X A;  3KUP A;  3ITP A;  1BCP C;  2G9D A;  3T56 B;  1IKM A;  1B50 A;  2R3Z A;  4CKC A;  1SND A;  3WOE A;  4KK7 A;  1F77 A;  3NTI A;  1HFN A;  1NR2 A;  3BDC A;  3K57 A;  4L63 B;  2J0T D;  4S3S A;  5C5L A;  1PXU A;  4R9W A;  3IAY A;  2M9V A;  5I6W A;  1H9S B;  2L12 A;  4XT1 B;  2A6H C;  3AB9 A;  2R6G A;  4FF4 A;  1FD7 D;  1JIC A;  1BDO A;  5E1F A;  2BA1 A;  4NP5 A;  4FF1 A;  3PO2 B;  2EVB A;  1WTV A;  2CW0 C;  2F1M A;  3I70 A;  3SK6 A;  3K5O A;  2K05 A;  4H7B A;  5F2D A;  2L5T A;  4MHE A;  2Q8R E;  2AUJ D;  2IJ0 A;  1TY2 A;  5C4H A;  4RHR A;  1KDA A;  3DMU A;  1CA6 A;  4RFB A;  2PYK A;  5TSS A;  3S9W A;  2PZW A;  3W2D A;  1HUM A;  3ND9 A;  3DXJ C;  2RSO A;  2XNA C;  3JAM L;  3G6J B;  2MUY A;  2JA6 B;  3OHX C;  4IFD H;  3K5N A;  2L55 A;  3MEH A;  3IL8 A;  1S5C D;  2XIW A;  2BDN A;  1O80 A;  5D3D A;  4KJN A;  4ZK9 B;  3DUZ A;  4RAU C;  1SE4 A;  5FK9 C;  1SDF A;  1PFN A;  1NSN S;  2Y0S B;  1V8Q A;  3OW7 A;  4DU9 A;  4ZAI A;  4ZUJ A;  2CVR A;  1V1P A;  1EU3 A;  1KLG D;  4CJ0 B;  3GTQ B;  4A3E B;  2R61 A;  1VMC A;  3D6C A;  3PMF A;  4BBS B;  3VYR A;  2X6L A;  4C56 C;  4XQQ A;  1AW7 A;  1Q1E A;  5C0X G;  3Q0A A;  5IT9 L;  1QCB D;  1TR5 A;  1LV9 A;  5I6Y A;  2H4O A;  1STH A;  1D2B A;  1ZXT A;  1Z47 A;  4RGN A;  5LL6 X;  4XT3 B;  4X3T A;  4LK1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...