5C6AA

Crystal structure of staphylococcal nuclease variant delta+phs l25e / n100e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKEMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVEEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25E / N100E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c6aA00
2LKVA 2EYHA 1U9RA 2EY2A 2EY5A 4KD4A 3NQTA 4KY6A 4E6IA 1JOQA 5EKKA 3SXHA 4F7XA 5KYLA 1STNA 2SOBA 3ITPA 4K5XA 5CV5A 3SK5A 3T13A 5C4ZA 1KDCA 3U9OA 4KJOA 5DAUA 1AEXA 4EQOA 3TP5A 2F0GA 4WORA 5ISRA 5E1FA 1EZ6A 5CV9A 1SNMA 1TR5A 3D4WA 4G57A 3PMFA 4NP5A 4LAAA 5EGTA 3P75A 3LX0A 1EYCA 1SNCA 3SK4A 4N9TA 3TMEA 2KHSA 1A2UA 4H7BA 4NDXA 5C4HA 3MZ5A 1NSNS 5CR3A 4PMBA 5I9PA 2HQEA 1STGA 4ID6A 4K5WA 4EQPA 4IUNA 1ENCA 5HURA 4WRDA 5C3XA 5C5MA 2EXZA 4QB4A 5NUCA 4N9PA 3TP7A 2EYMA 4B9WA 3H6MA 1TT2A 3DMUA 4EVOA 2F3VA 4K8JA 5EKLA 3SHLA 3TP8A 3RUZA 5CV4A 4IALA 4RKBA 4PNYA 5IOCA 2PW7A 5KIXA 2F0EA 1TQOA 2F0IA 4ZUJA 5M9OA 5HGTA 2OXPA 1SNPA 4YIJA 2PYKA 1SYCA 3BDCA 3MXPA 1EYAA 1EY8A 1SYBA 2F0TA 3BDLA 5IGBA 1SNQA 1ENAA 5K5PA 5CV8A 2OF1A 4HTHA 2F0UA 2PZTA 4KTAA 2F0VA 1EY6A 1KAAA 1EY7A 1JORA 5F2DA 4I65A 4K2LA 2F0HA 3DHQA 3EROA 2NUCA 1A3VA 3ERQA 1SYDA 3NUCA 4K8IA 1JOKA 2EYFA 4DF7A 4K2KA 5IGCA 4OL7A 5JAVA 1F2YA 4NKLA 2SNSA 5CV6A 3SK8A 5C3WA 3HEJA 4K6DA 3HZXA 2F0KA 3NK9A 4MIUA 5IGGA 2RBMA 3EVQA 4RKLA 3EJIA 4K5VA 4ME5A 3QOJA 2OEOA 4QF4A 2QDBA 2WACA 2PQEA 4DGZA 5IGFA 4HMIA 1JOOA 3NXWA 3OSOA 3S9WA 3QOLA 2F0SA 2RKSA 5CC4A 5IODA 2F0JA 4R8NA 3C1FA 1EQVA 3OMGA 1SYEA 4PMCA 1RKNA 4ZUIA 2PZUA 4F8MA 2F0MA 3D8GA 5I6WA 2ENBA 4S3SA 3P1HA 5CV7A 5C5LA 1SYGA 4TRDA 5CGKA 1EYDA 1F2MA 2SNMA 1SYFA 4NMZA 1STBA 5I9OA 5J39A 1KDBA 5KRUA 3SR1A 1F2ZA 2PZWA 4IZ8A 4ZQ3A 1EY4A 2PW5A 3NHHA 3VA5A 4ODGA 1EZ8A 1A2TA 2F0QA 1STYA 2F3WA 3V2TA 5IIFA 2F0DA 2O4XA 3D6CA 1A3TA 3SK6A 4K14A 4HMJA 4B9XA 1A3UA 2EYOA 1KABA 2F0WA 3MHBA 2KQ3A 4KV6A 4DU9A 5KEEA 5JOBA 5J1ZA 5DEHA 1STAA 2F0FA 4KJNA 5J22A 3OMCA 4KHVA 2F0NA 2EYJA 4J1MA 1IHZA 1II3A 5KYIA 1SNDA 5IGEA 2EYPA 1EY9A 2F0LA 5IGDA 1EY0A 2M00A 1NUCA 2RDFA 3TP6A 4EQNA 5I6YA 4J6HA 4DFAA 5C6AA 3QB3A 5E3FA 3MVVA 3NP8A 3OWFA 1KDAA 1EY5A 2EY6A 4KY5A 1SNOA 2F0OA 4KY7A 4QMGA 5KGUA 3C1EA 1STHA 2F0PA 3T16A 3D4DA 3R3OA 4KD3A 2EY1A 2EYLA 3MEHA 3E5SA
chains in the Genus database with same CATH superfamily
4BBRG 4RFBA 2E8GA 3GV6A 3NPPA 4AH6A 1HCZA 3T13A 1ZEQX 1WTQA 4EQOA 1ASYA 3W5OA 2E5LL 4JI6L 3D4WA 4G57A 4NP5A 4C3IG 4OEMB 3MTSA 5AJ3L 2F4VQ 2A1AA 1CTMA 5DLQE 1S5DD 1TIID 1SMYC 1ENCA 1V1PB 2EJGC 5NUCA 1GHKA 4JV5L 1VQ5A 1VMPA 2JSOA 3QWNA 4IPGA 2C9OA 4PNYA 5ELBA 1DJRD 1TY2A 3KUPA 4LF4Q 1EYAA 3PIOA 4JI3Q 1O7YA 3C2PA 3ULPA 1VQMA 2YU9B 2ZM6L 2F0UA 1YNNC 2F0VA 1YHBA 1EY7A 1ET6A 5C4JB 2UU9L 4GLVB 1QUQB 1EEFD 1X65A 1JCKB 1KNAA 3ICEA 2VS1A 1SE4A 2FXQA 4DAVA 3D31A 5LL6S 3CMAA 1HZAA 5T1GA 4HMIA 1JOOA 4M1UB 3S9WA 4IUPA 1K28A 4GNXC 3VR2A 3TBIB 2DJFC 1E7ZA 2B2TA 5C3EH 1A63A 3G6EA 4NMZA 5IP7H 4LNQA 5DNFA 4C3IH 1RTOA 4JI5Q 2NVTB 3HGBA 1XNQL 5JEAJ 1CKOA 2A68D 4NPSA 1PZID 4LMQD 3K5MA 3FKIG 4R4OA 3UI2A 4DFAA 3S24A 3M4YA 3KK7A 4C56C 4HIDA 1GO3E 4JVZA 2UXBL 3VR6A 4UHVA 5COYA 2JA9A 1Z7TA 1B3QA 5CBEE 3NWTA 2MP1A 2EY2A 4CKCA 3U4ZA 3PO2G 4BBSB 1G6ZA 4LUOA 3M85A 2B8GA 1RF2D 1KDCA 4K0KL 1RHPA 1H9SB 3IKJA 4WORA 3K58A 3UE1A 1RIPA 5GAEC 1OXUA 1I6VC 3S1NH 3KF8A 3G4SA 1D7QA 3TQYA 2BH8A 1BBWA 4PMBA 1Q3LA 1IYJB 1O7LA 3S15H 3RZOB 1XYIA 4QB4A 1IBLL 4RAUC 1TT2A 2F3VA 4L6TB 4LF5L 5JPNC 1U4PA 1SYCA 2K28A 3J7YW 1TU2B 2F0TA 3M7GA 3K0YA 1UE7A 5FLXc 1XMQL 2MJ8A 2NB0A 1BDOA 5FLMH 1NAPA 1C0AA 3P7JA 4APVA 3EROA 5IT9L 3MEFA 4DF7A 3FMCA 4GN5A 3G7LA 4OL7A 3X3MA 3ULJA 3T51B 4C1NI 5IWAL 1YNJC 1RODA 2K50A 2K5NA 3QO2A 1C9OA 5T1IA 2E75C 5IGFA 4UP9A 3FEWX 3H3VC 4NXML 2R7DA 3M4QA 4AYBG 5ELNA 1EIFA 3BDOA 1CZWA 3P1HA 3NE5B 3GTJB 1B2TA 4R4IA 3VDYA 1QCBD 4RCOA 1NJIC 4RG1A 4P75A 4C3JG 1RCVD 3W1BA 4EX5A 1U5KA 4C2MH 2RDGA 3VYSA 4KHPL 1CM9A 2YYZA 2KQ3A 4JI8Q 1Y1WB 3S1MH 1LTSD 2EJMA 4DK1A 4CGYB 3OOCA 4DV3L 1N36Q 1SNDA 1YHQA 3A7AB 2RDFA 4GN3B 1LO5D 1GUGA 2N8NA 1ASZA 3GDEA 4IFDH 3HOWG 1SJED 3NP8A 1EY5A 4KHZA 1XTDA 3U58A 4RH6A 1TWFB 2E2IH 3I70A 4X66Q 2EY1A 2DGYA 3A0JA 1I6HB 4BY1H 1VS0A 4KY6A 2EY5A 1W2BA 1B4OA 3SXHA 1HR0W 1YBYA 2K5HA 3RN2A 1G2SA 1X56A 2RCFA 1HJPA 1VQKA 3EA6A 2KCCA 4A3CG 1MSHA 1AEXA 1S4ZA 4HR7B 4XQNA 2X6GA 3HOVH 2HCIA 2G9DA 1SE8A 1S40A 3SK4A 4Y52H 1KNEA 3MZ5A 3RZDH 1CK1A 4K5WA 1A0IA 3CD6A 3U9SA 1PH3A 3VR3A 3WOEA 1EFWA 1RJTA 4JYAQ 5GROA 4HIOA 2ZJRA 4OELB 2H4OA 2QEXA 4A3MH 3G6JB 1PZKD 2JA5H 3K0XA 2EXDA 1X9NA 4FXKC 4DPGA 2WV6D 3TDQA 3WDNA 4GOPB 1KAAA 4P73A 4R4TA 4Z9CB 1E0BA 1BCPB 2B2TC 1YITA 3Q24A 3HKSA 2UUCQ 1WTOA 1HQRD 1LT3D 1SFOH 4K5VA 3A5UA 1CA6A 1VQOA 1J6QA 1LV9A 1ZYRC 2F0JA 4DUZL 1PRTB 3C46A 2AUKA 3PSIA 4LF8Q 1WTPA 2DY8A 3DWQA 4A3CH 4GKKQ 4A3EG 5I9OA 3CU7A 2ALYB 1UE6A 4IZ8A 3AB9A 1HRJA 2BOSA 2E76C 1BCPF 2F3WA 4V190 1A3TA 4BBRB 4B9XA 4YHHQ 5EPJA 3NBIA 2R7ZH 4OO1I 3M4PA 5JPMC 4C3IB 4A3JH 4EQNA 1I4RA 2VNUD 1PRTF 3UE0A 5E3FA 2Y0SB 1X55A 3JAMc 2CHBD 2XWJB 4KY7A 3UDIA 5EBCA 4CDCC 2B29A 1EWHA 1N32L 1N9WA 2A5HA 4ILWA 2EYLA 1FNWA 1RDPD 4OWXB 5E7NA 2CKZB 4POGA 1Q86C 1K0SA 1SJHD 3KDFB 2AQ3B 4BY7H 4X3TA 1IBKQ 3VYTA 4K5XA 1DGSA 1N34Q 3GV3A 5DAUA 2IHFA 4DV5Q 2I5HA 2VY3A 5ISRA 1EWCA 1LLRD 3BJUA 5CV9A 3STBD 2MNAA 4IQZA 4H7BA 3H94A 1T5XD 2PMZB 1ESFA 5I9PA 1F9SA 4HCEA 1F9QA 2EXZA 4ZAIA 4N9PA 5JJKA 1MHWC 5FLXL 2K5QA 1K3BC 1PFNA 4A3EH 1EIHA 4OX9L 4RGTA 3A7LA 3ER0A 3D6WA 3RUZA 5EQ0A 4RKBA 2NWGA 4YCWA 3V96A 4KK7A 2BCOA 3S15B 3TN2A 1EIYB 1PYSB 1GD7A 2N88A 1NR2A 4ULLA 2RCNA 2ZTDA 1STEA 3BS1A 1QJOA 3TS0A 4YWMA 1Q90A 4HEDA 5IGCA 2EYFA 4XIGS 1CFMA 1F2YA 3M9BA 4BXXG 1I3QB 1L0YB 1E2VA 1KHIA 3I4MG 1LM0A 2L5TA 2K52A 3A56A 2G5DA 2E74C 2PQEA 5FKAC 2WINB 3OSOA 4YY3Q 2MUYA 3FKIB 1GOZA 2AWNA 3KLSX 1RKNA 4F8MA 2NYZD 3J7ZC 2ENBA 2PPBC 1CZGA 1VQAA 4LJZC 3VYUA 3ZJYC 2NTTA 1L1OA 1LTTD 2JEBI 4HJ5A 2CCZA 4B3SQ 2EZVA 1HFGA 2PNHA 4DUYL 4A4IA 4DV2Q 1WJJA 3OW2A 4DR5Q 4JI1L 5KEEA 3PO2B 4L5TA 1ET9A 1JWSD 1STAA 4IJLA 1OXVA 3J81j 1WCMG 1IHZA 2JA7G 3EQLC 1BKBA 2L1BA 3OPOA 4JI2Q 2R93G 3QG1A 1L0WA 4DV7L 4AQYL 2NVTH 1QE6A 3A54A 4C2MB 1ICFB 4QMGA 4R9WA 5C0XG 1AFPA 1VQEA 3R3OA 3NTKA 2V4DA 1PXUA 3E5SA 2HHHL 4DV0L 2NN6I 4QQBX 4U68A 4DR4Q 1NBWA 2XVSA 3QR8A 2UUBL 1B70B 3AYHB 3CKIB 2CH4W 3I4MH 1U4MA 1XJVA 5JVG3 2K14A 3IL8A 2VQFQ 2Z6BA 4MZ9A 3T1HQ 1WD0A 3SE0A 3HS0C 4PMWA 1X3EA 4GKJL 4ZCKA 4BBSH 2AMCB 5CR3A 4JI7L 1KD1C 1B1ZA 1VF5C 2WAQG 1KTKA 2Y0SE 4DR1Q 1NY4A 1E1OA 2BE5D 4EVOA 3L2PA 3I4NG 4G4KA 2F52A 4IPHA 5KYLA 3I73A 4X3SA 2JYOA 3RZDB 1G291 3HG9A 3A8IE 1TWCB 3UDFA 2K03A 4AYBB 4QJFA 1VQCA 1UNSA 4R4QA 3KLRA 4HJAA 5AFWA 3WWVA 2JA7H 2WB1E 3CCVA 5JAVA 1JOKA 2WIIB 4C3JB 1H9SA 1SSOA 1ESRA 4LFAQ 3PO3G 3URYA 2PMZE 2IX0A 3K7AB 2FJ2A 2ZXPA 3OHXC 5C0XH 1FNVA 3NENA 3KF6A 2X69A 3HOXG 4RHSA 1HNXL 3MXUA 3H3VI 1D5XC 1GJXA 1XXGA 1SBBB 4LW1A 5I2YA 4PMCA 4LF9Q 1JC7A 1IXRA 5A35A 4A3GG 3E0JA 4UDUC 3OTOL 4R1JA 3HOWB 3CHBD 1EUJA 4A3LG 5M5YH 5KRUA 5FO9B 1F2ZA 2PZWA 2F0QA 1NMGA 4FNFA 2F03A 3J7AF 4A3DG 2F0DA 1HNWL 3SVMA 2LSSA 1J8IA 3JAML 2ZXRA 3AFQA 1VCIA 3R8BA 1HR0L 5AJ3Q 5IYCG 4RCNA 2EYJA 3BYTB 2IX3A 1EFID 3F2CA 2HT1A 3KFUA 2CFMA 3AFPA 2P5ZX 5C6AA 2QILA 3OWFA 1GVPA 2K5DA 4QGUA 5LMNQ 5KGUA 5G3LD 3HP3A 1H9RA 3BYYB 5IP9G 1RD9D 1O7ZA 2UXCQ 3HKZG 2A69D 4E6IA 4A3JB 5TSSA 2ZM6Q 3ULLA 2B2UC 3PCOB 3F2UA 3MAQA 5EPLA 3BU2A 2F0GA 3TP5A 3Q23A 1I6HH 2UU9Q 5BR8Q 5IIFA 1DD2A 3PMFA 3LX0A 3KOJA 3S1RH 2Q2HA 1NSNS 1FJGQ 2VB3X 3K6OA 2B63G 3OW7A 1C48A 1UAPA 1VQJA 4JC0A 1EQTA 1IYUA 4A3GH 3GO5A 3H6MA 3GTOB 4X64L 1K73C 1M90C 4ZYSA 4WJWA 4X3KA 2VQEL 1SMXA 4CDDC 1F2LA 3J80E 3CCMA 4B3TL 3I90A 4A3DH 4KMUC 1Y8OB 4DV6L 2E2HH 3KYHC 1T9HA 4QCLA 4P74A 4QIWB 4H44C 4A3EB 2I46A 2R92G 4I65A 4DK6C 2O5JC 1HH2P 1CT1D 2AHOB 1XNQQ 4F87A 3SK8A 4HJ9A 2K75A 4IFDJ 4RWSC 3F1ZA 1X3GA 5IP9H 1VQHA 2WACA 1VQ7A 4N8FA 1L1OB 5I2XA 1VMCA 1BBUA 3C1FA 3OMGA 2PNRC 1PTOD 2XRQD 3KBGA 2UXBQ 2LXKA 4B3RL 2R7FA 5CGKA 4JI4L 4JBWA 2ASBA 2MO1A 3PGZA 4AYBE 3PUVA 2KEEA 4A3FG 1BR9A 4K0KQ 1TWGH 4EGVA 1BNZA 1HA5A 1FGUA 4GOPA 2F0WA 4FP5D 1HA6A 2DNEA 3J7AV 5DEHA 1AN8A 3OMCA 2K5WA 5L37A 2ID0A 2L11A 1M1KC 2ZXOA 2C5CA 1EY0A 4BBRH 1BVSA 5H1SE 3BZDB 1JWMD 3MVVA 4DR6L 1DOMA 1LUZA 2B2VA 1FNUA 2OTJA 4CDFC 4XXEA 2R92H 5E4WC 1U9RA 1WFQA 2NZHA 1IKLA 4BA2I 4DR2L 4P72A 4WJ3M 2I5MX 4WJ4A 1KRSA 3M3YB 4CHTB 1V9PA 5FO8B 3Q8DA 4IUVA 5IWAQ 5M5XB 3TMEA 4NDXA 4G7ZC 1EWIA 1U0LA 4IPDA 2RSNA 1AE3A 4P71A 4CDEC 2NVQB 2B2YA 3KBXA 3I4MB 4DR3Q 3BVZA 2HIVA 4ME3A 4RGOS 3DMUA 4H13C 1FYCA 4NXMQ 1KIXA 5EKLA 1Q1EA 3K57A 1GUSA 4A3FH 4DAMA 1K3RA 2PYKA 4C3HG 3MXPA 3PIP3 3G48A 2A6HD 1G2TA 4RHRA 2Z4IA 4LF7Q 1QZHA 3KDFA 2OTLA 1E24A 5CV4A 4ALPA 3NUCA 3KF6B 4KHPQ 3I4OA 1D2BA 2SNSA 4JBMA 4DV3Q 1B8AA 1EL0A 4MTNA 1XPUA 3A8JE 1K0RA 1D1KA 2WKDA 1B9MA 2HUGA 1TKWB 1WCMB 3NXWA 2JA7B 1I3QH 1CQVA 2RKSA 5IODA 3S17H 5ELOA 4R8NA 2R93B 1EEID 2BDNA 2L0CA 3NTIA 2F0MA 1CHPD 4ZK9B 1ML0D 1F2MA 4DK0A 1TS3A 2SNMA 3FKIH 1X54A 4GN4B 1IYVA 4QIWE 2J7ZA 1IW7D 1Y8PB 3W3AA 1MSGA 3K7UC 1JJCB 5BN4A 3K81C 1KABA 3QJYA 1NTGA 2A74C 4XT1B 4O0AA 1Y69U 2B3GA 2F0FA 4KHVA 5IE8A 1LT5D 1QILA 5J3BA 5M5YB 1SLJA 3NBHB 5E4XA 4Q5VA 3PO2H 3PIPA 3JC66 1IBML 2Q2IA 3V05A 3P20A 3OIQA 3MC0B 3OWEB 1JE4A 3D4DA 1YJNA 2DN8A 2WAQB 5JVH3 2QKIC 4IFDI 3I4NB 2EYHA 2RHSB 3S16B 1SN8A 2XGTA 3DLLA 3GD7A 3SK5A 1LTID 5C4ZA 5D3DA 2B8FA 2K01A 1Q7YC 1B9NA 4CBVA 4HSPA 2HQEA 2RVLA 3RNUA 1PH2A 4IOCA 3CMEA 3NEMA 5C3XA 4YCUA 3PO3B 1I4GA 1I4HA 1SMYD 2F1MA 3J81E 1SE2A 4MHEA 3IAYA 3R2TA 3TP8A 5KIXA 3HOXB 1VQ9A 1O80A 3S1RB 1PFSA 4NXNQ 3FRPB 5K5PA 1SYBA 2XSCA 5JEAG 5FJ8G 2OF1A 4A3GB 3MXNB 1D6EC 1D5ZC 1JORA 1L0XB 3B6YA 3DHQA 1A3VA 1YNND 1YHAA 4X65Q 3FPUB 1TWCH 3D0FA 3Q22A 1PHJA 3CRKC 2JP1A 1K8MA 4DXFA 4JW0A 3J80i 4A3DB 1I94Q 1I4QA 3VR4A 3S1QH 2E2HB 3CCUA 1VQPA 5ELCA 4GOPC 3CCQA 4C3JH 4ZKCB 1F77A 1Z47A 5IT9E 4MTKA 1O78A 3K7AH 4ZUIA 1BCPC 1C8CA 1AP0A 2MFIA 3EFXD 1N32Q 2NVYH 1SYGA 3MFYA 1GUWA 1ILPA 3CRLC 2K32A 2XWBB 1JWUD 4ZQ3A 3VA5A 4DR7Q 3V2TA 3ONAB 4LK1C 5IYBG 3HKZB 2O4XA 1KQSA 1U4LA 3D6CA 3HOWH 1A3UA 4DV1Q 1PRTC 1FGBD 1JB7A 2XN9C 1PH1A 1PH5A 5J22A 2C35B 2N49A 4J1MA 2K05A 2F0LA 4KKUA 4JI8L 1IKMA 1OTCA 1NUCA 4JBJA 4QL5A 2YV5A 1TWGB 2VXWA 1JE5A 2Q2TA 4OX9Q 2QCPX 4OO1G 3HFZB 3GTQH 2B63B 5FJ8H 1CKMA 4LFBL 3CC2A 4KKSA 2L12A 2N78A 4DNIA 2CWPA 5EKIA 4O42A 4YWKA 1M8AA 1JJGA 5E1FA 1WTWA 4LAAA 1SNCA 2R92B 5M3MG 4CKBA 3A5ZB 4Y7NB 1R4QB 4DV4L 2K7VA 3H91A 1VQIA 1FL0A 1BQQT 4B9WA 4FF4A 5EBDA 2VUMG 2K5VA 4K8JA 4PZ7A 1DCZA 3DWPA 1TY0A 1W6JA 2D9UA 1SEBD 5M9OA 5HGTA 4B08A 2AWOA 2HDMA 2NZ1D 1I5FA 3GTOH 1EY8A 3F8TA 4JCVE 1XMOQ 3U4VA 2L4NA 4JYAL 3BZCA 2CWAA 1HZCA 5F2DA 4K8IA 5IGDA 4KN7C 3I8ZA 5LMUQ 2I5LX 3SGIA 4A3FB 4KN4C 4K6DA 4OO1H 5FO7B 3EVQA 1YNJD 1BBXC 1PH9A 3UDXA 2UUCL 2AQ1B 3CC4A 4GLAC 3ZYYX 3DM1A 3D8GA 4L63B 4A93G 1S5BD 2WFWA 4DV0Q 1QB5D 4C1NK 5J39A 1HTLD 3GQBA 4LF8L 2UUBQ 3L3OC 5FK9C 3I55A 3S17B 2KUMA 2CW0C 4CKEA 3GTPB 4H0LC 5C4XG 1QWYA 1MJEA 4LF6L 4GKJQ 2L9HA 3LGJA 2JA6G 2FMCA 4JI7Q 2BH2A 3NQIA 3BZKA 5JJLA 3SDZA 4J15A 4R8IA 3QB3A 4LFCQ 2J4XA 4RGNA 1R9TH 4HJ8A 1LT6D 1EOTA 1JICA 1ICWA 3D3RA 2KCTA 3SEBA 2UUAQ 2KCMA 5G3LF 1KAWA 3IRBA 1STNA 4C3HB 1VDZA 3CF5A 1YZ6A 1HZBA 4KJOA 2NN6G 1J5EQ 3FP9A 1B53A 4B3ML 3GTKB 3EN2A 2KHSA 5M3FG 2R3ZA 4ID6A 1WTRA 4KLKA 3M3YH 4A93H 2EDGA 1E2WA 1QOHA 2XIWA 4OIJA 1Q12A 2DY7A 2ICIA 1RL2A 5M5XH 4RMFA 4BS9A 3DM3A 4BXXH 2OXPA 2SDFA 3OTOQ 2NVQH 3CXCA 4IO9A 3FDTA 2TSSA 1LT4D 2XNAC 5C4XH 1AZPA 2LY7A 1SXTA 1WYDA 5FLXE 1PTOB 1TS2A 2Z9HA 2PCFB 2B39A 5D14A 3J81i 1HNWQ 1WVLA 2F4IA 3I72A 3EBEA 3K5OA 1HR0Q 1WTHA 4X62L 3D4RA 2WKCA 2RBMA 5DM73 3EJIA 3H09A 5EPKA 4A3BG 4POFA 1R4PB 1O7IA 1E22A 1VQDA 4N8X1 3CQZH 3DEPA 3UDGA 1WD1A 2KOLA 1SYEA 1PA6A 1CSPA 2KVMA 4A3IG 1D5MC 1FD7D 4YY3L 1ZYRD 2VW9A 2KCNA 1BUVT 1WCMH 3U50C 3S1QB 3ND9A 3I2ZA 1Q46A 5HGQA 2R93H 2PW5A 3CCJA 1HNZL 1GXDC 4UY8C 2QF7A 2CH4A 4HMJA 2A68C 2OCEA 1E2ZA 4KV6A 2NVYB 1EOVA 3A8KE 3N6RA 5J1ZA 1G6PA 3HOUG 1UE5A 2Z8LA 3RLNA 4L5RC 3HOYG 4DV2L 1LABA 3FPPA 4JK1C 2JE6I 4JI0L 5KNCA 1PLFA 3CP0A 3VYRA 4KI0A 1DXMA 2DNCA 4X64Q 2MO0A 5LL6X 4IUUA 4KY5A 1U4RA 1STHA 2VQEQ 4A76A 1K9MC 4OWTB 2HD3A 4KD3A 1QVCA 2O5IC 1K83B 4DV6Q 1QZGA 2E5LQ 2IHEA 4JI6Q 2JA8G 3GTQB 3I4NH 1KLUD 1F9RA 4A3BH 4PZ6A 3K8AA 4HJ7A 3S16H 1TXYA 3MXGA 3F2DA 4JV5Q 1A2UA 2VQFL 2EQSA 2EPBA 1K8OA 1EU3A 1X32A 1SROA 3BG3A 2VB2X 2EYMA 3NBHA 2J0TD 3TP7A 3H3VH 3AQQA 4FVMA 4DA2A 4IALA 2F0IA 1MI2A 4JI4Q 1V8QA 1X6OA 4JOIA 4RGMA 3RN5A 2Z0SA 3I91A 2GVAA 3BDCA 3PO3H 2DJGC 3BDLA 5A2QE 3HOYH 2QDLA 3HOXH 2M9VA 4RA8A 4OWWB 4K2LA 1DOLA 1TWAB 1HUNA 3GTLH 1CHQD 1LTGD 1VQBA 2D0PA 2EJFC 2Z1CA 3PUYA 2Z4HA 3NTHA 1TS4A 4OONA 4A3LH 3E3XA 3PIO3 2YTXA 3GP7A 4LFAL 3HOZG 3E9HA 1HFNA 3R2IA 1XX8A 2OQKA 4DR6Q 3R93A 2RF4A 3LWEA 1DYQA 4S3SA 5FOBB 1I50B 3NSWA 2Q8TA 1MJCA 4XT3B 5IYCH 4L5SA 1SYFA 3L9AX 3SR1A 3QIAA 3T1YL 1F9PA 2R61A 4GS3A 1L1OC 1GUOA 1NR4A 3MXNA 1V1QA 4GZYC 4OHJA 2PO4A 4DU9A 3MHBA 4TSSA 1EYGA 5JOBA 2D0OA 2R6GA 5BN5A 3GTMB 2UXDL 5C3EG 3LNNA 4PG3A 4IN3A 2ZTEA 5IP7G 1B50A 4GLXA 1E1TA 1K8AC 5M3MB 1VQLA 3Q0AA 2OT2A 2KBNA 2Y0SG 3H15A 1VQNA 3KJPA 1D8LA 1DZ1A 3GTGB 3JAME 1Y8NB 2RQXA 4HCSA 2LFNA 2VUMB 4LUVA 1CSQA 3MEHA 5LMNL 1XWEA 4U673 1RTNA 3AU7A 4TQUS 1UWVA 3VR5A 3CCEA 1Y14B 2B63H 2IJ0A 5CV5A 2NZOA 3DEOA 2UXCL 4UP8A 1KL9A 1N33L 1R9TB 2WB1G 1CKNA 2E2JB 1XNRL 1IZ6A 2IX1A 1SNMA 5EGTA 3HOZH 4JBKA 3P75A 2D2CC 4CJ1B 2IW3A 1IBLQ 5D65A 2A8VA 1IL2A 4ABNA 5BR8L 4I7AA 1LTAD 1QG7A 2Z6KA 3LWUA 4LF5Q 1GM5A 3S14B 1FJGL 3M7NA 1PYWD 1MIUA 4Y7NH 5IOCA 1CA5A 4ZUJA 4NB3A 3PF5A 1XMQQ 4AIMA 2IWHA 5CV8A 4A93B 3FVQA 2KA7A 3L0OA 5GQOA 1T5EA 5CYUA 4GNXB 2EE1A 3TZDA 4HSVA 1E3PA 1JB3A 1I4PA 3RMHA 5GAGC 2F4VL 4CJ0B 2QA4A 3E6ZX 2F0KA 3DXJC 3S2DB 1Y1VG 5C4XB 1MGSA 2OEOA 5FLMG 4QUFA 1IBMQ 2JA6B 2B2WA 5EAYA 2NTSA 2KECA 1TS5A 5CV7A 4DXGA 2Q8RE 1IL8A 4LF4L 4JI3L 2JQOA 2YTYA 1PVOA 5CMDA 3J7A5 3CQZB 2FMMA 4IUQA 2X6LA 1OXTA 4X3UA 3I4LA 4TKOB 3J81L 3E0EA 3TREA 2PQAB 1C7YA 3AEVA 1H9MA 1EY9A 2V1CC 3BVGA 2I0QA 3GTPH 1GKHA 3K59A 5M3FB 5CORA 4CJ2C 2ATWA 4JG2A 4BWGB 1WI5A 5JJZA 4PZ8A 2A6EC 3H0GG 1ILQA 2JN4A 3IFDA 2RHQB 1AE2A 1Q8KA 1YEZA 2IL8A 4FYDA 2SOBA 3ITPA 4JI5L 4IFDG 1BXTA 3NWSA 3STBC 4HIMA 1Y1VH 4JOIC 1VQ6A 4I7ZC 1EZ6A 1TR5A 5C44G 4BY1G 1QVFA 1QNKA 2KHJA 2XRSD 3N52A 4C3HH 1DOKA 4IUNA 4R4CA 1P8LA 2BDOA 1J9OA 1PH6A 1SR3A 3GTKH 1XTCD 1EIGA 2LMCB 3CCRA 3HOVG 5M5WH 4Q0FA 4A3BB 1GUTA 3WOFA 4DR3L 1TQOA 5IYDG 4YIJA 5LHY1 3I56A 1W6KA 2LS01 4A3KG 4HTHA 4A3IB 1HPCA 2PZTA 1NNXA 1EY6A 3T4AC 5JJIA 3T53B 3DWAA 2CQOA 2NUCA 3ERQA 2PI2A 4K2KA 2EOTA 4LF7L 4PQXA 3MWYW 3HEJA 4A3MG 3M4OH 1PTOH 4MIUA 5IGGA 2JA5G 2NVXH 4IURA 4QF4A 4HAEA 4DUZQ 1WTXA 3HOUB 4DGZA 1B3AA 3HOYB 1QVGA 2AUJD 3H0GH 3QOLA 1TVXA 1PDQA 3GTLB 4A75A 5I6WA 3VA7A 2AQ2B 1BOSA 1NE3A 2VL6A 3RLFA 4LFBQ 4OGQC 1LTBD 3T56B 4DNTB 2ZT9C 3IFTA 4XYQA 4XQQA 5C44H 3G71A 1YI2A 1TWHB 4ODGA 2AKWB 1A2TA 1STYA 2HQLA 4K14A 4XQJA 4ZKBB 1A62A 2WP8J 2JA8B 1KLGD 4ZRZA 4F88A 1HTPA 5IGEA 4DV4Q 1N8RC 1LTLA 5ELEA 2HDLA 1P16A 5IYDH 3ERSX 5I6YA 1WTVA 3PUZA 4G7OC 3W2DA 2EY6A 4A3KH 3C1EA 4L8JA 3T16A 4FO2A 2E2DC 2R7ZG 2NBFA 1A15A 1CKNB 2B2VC 2Z6KC 4KD4A 1A6XA 3NQTA 4A3JG 4P2CB 3ND8A 2G9HD 3PQIA 2IPKD 3U9OA 4G7HC 1PV4A 3JAMi 4QY7A 1K83H 5IY0A 1JMCA 1EYCA 1AZQA 1N36L 4O1NA 4BY7G 4YWLA 2BE5C 5JEAH 1XPRA 2IY5B 1EQQA 4FXGC 2B2YC 5D3IB 1V1OA 4K6LA 1OXSC 1SRUA 3J80c 3HOZB 5I4DA 2PW7A 3O13A 4X66L 1ENFA 1S5FD 3S2HH 1HZ9A 4HN7A 1UE1A 2N3SA 1B44D 1PFBA 2B2WC 4NXNL 5C0XJ 2JXMB 1VQ8A 2FFKB 2OQ0A 2QGQA 1SYDA 4XTCS 1UEAB 2HIXA 4H02A 4NKLA 2L15A 4LF6Q 4ZLTF 4IOAA 2FHTA 3NK9A 1OXXK 4X65L 5LMNW 1TWAH 4X6AH 1VQFA 2QDBA 4DAPA 5C3EB 1VQ4A 2WAQE 1I94L 4UAIA 1G8ZD 5IYBH 3TZUA 2VZAA 1D1IA 2PZUA 1VQGA 5C5LA 2QW7A 4FDBA 4DUYQ 1EQRA 1STBA 1KDBA 3C3LA 3AMUA 3TEHB 4JI1Q 1Q82C 1EY4A 1YJ9A 2KEDA 3HRZC 1EZ8A 1PFMA 4FF1A 1I50H 1SAPA 1QNUA 1S5ED 2A6ED 3KF8B 2EYOA 3X3NA 1H9JA 1A8VA 4DR7L 4DV7Q 4B3MQ 4AQYQ 1CI3M 1HUMA 1I4XA 2A19A 1II3A 2WB1B 4DV1L 1G91A 1MBYA 3BVMA 2K04A 4J6HA 4M8AA 3GTMH 1WOCA 3CPWA 2HHHQ 2F0OA 4DAYA 2F0PA 1YIJA 2A69C 4QUCA 3MA2B 4FXDA 2B2UA 1EU4A 2LKVA 4GKKL 5M3MH 4PV1C 3RLOA 4TVAB 2HCCA 1JOQA 3S1NB 2D62A 3L7ZC 5DM63 1DONA 4F7XA 1G51A 3K5NA 3GTGH 3PUXA 3TSSA 2FINB 1HHVA 1VF7A 2VUMH 1FR3A 2RSOA 4YHHL 1XPOA 2ZJQA 2K4KA 1H9KA 1ZKOA 4X62Q 1KC8C 4EQPA 1MD2D 1PH7A 4WRDA 1KXLA 3A55A 3CPFA 5C5MA 2A73B 1PZJD 2E2JH 2YU9H 3OYYA 1B7YB 1JR0D 1Y1VB 5C4JH 4WFN3 3TS2A 3SHLA 4NW2A 5GAHC 1HQMC 4BBSG 4LUZA 1V1PA 1LYLA 1S5CD 2GA4B 3HKZE 1Q1BA 3RD4A 4V0BA 4XYOA 5GADC 1SNQA 2JEAI 3S14H 4BA1I 1CUKA 1IBKL 4HIKA 1LTRD 1HNZQ 2GN5A 1N34L 2I07B 5M5WB 2LXJA 4DV5L 1XMOL 3CC7A 4XDXA 1BO0A 1L2FA 2MGSA 2D5DA 2K1BA 4OIKA 1C4QA 4UPAA 5C3WA 1HNXQ 2M2LA 1YJWA 5LMUL 3W1GA 3KJOA 4ME5A 3CCLA 3QOJA 1MKHA 4JI0Q 2F3IA 1X3QA 1PTOC 1QUQA 1HXYD 2OWOA 1UUPA 3S2DH 1BCPD 1EYDA 3TRZA 3M4OB 1AH9A 1K8GA 2NVXB 2JA6H 3S1MB 5CBAE 3MFGA 3EIVA 3NHHA 3H0GB 2EIFA 2SEBD 3SK6A 3NELA 2RDHA 4O2DA 3DUZA 1Q8IA 1BF4A 2KJXA 4GNXA 3I7FA 4KJNA 1PRTD 2F0NA 3PF4A 5KNBA 2EYPA 4OXPA 2Q2UA 5C44B 2E2IB 5C0XI 2H1EA 4L5QA 4BY1B 3I3CA 5A2QL 1KDAA 1H95A 2NN6H 4IUTA 1SNOA 1X3PA 3K80C 1PTOF 4EQ5A 2QEJC 2K6AA 4LFCL 2MPMA 3HOVB 1GUNA 2KENA 5M3FH 4IJHA 4B3SL 5EKKA 4DN4M 3RZOH 1Y1WG 1CQFA 3CW2C 5K36G 2MQHA 2UUAL 2JJQA 4JPBW 4A3KB 4DR5L 2XTIA 2JK8A 1S72A 5ELDA 3J80L 4N9TA 5C4HA 1J5EL 1NMFA 4DKAC 4DNRB 1STGA 4JI2L 2CVRA 5HURA 2PQAA 3J81c 3E9IA 4J8QA 4A3MB 1W3SA 2RA4A 1PH8A 2JA5B 4B3TQ 1JJ2A 4YCVA 1S3OA 2F0EA 1ZXTA 2GVBA 5ELFA 1SNPA 2YTVA 2A6HC 2ZTCA 5IGBA 5KNDA 4DR4L 1ENAA 4FF3A 3T1YQ 1GHJA 4IPCA 1AW7A 4KTAA 1SFOB 2F0HA 2N55A 3F2BA 1KRTA 3T1HL 3FHWA 2BA0A 2UXDQ 4A3IH 5CV6A 3GTJH 3S2HB 1FVIA 3HZXA 2CQAA 5BN3A 4RKLA 1ONLA 3K5LA 1Z6HA 4B3RQ 3A74A 5IT9c 4DR1L 3PV0A 2F0SA 1M4VA 4KKTA 5CC4A 1UEBA 2O2LD 2MHVA 1EQVA 1V43A 4MNOA 2ICEC 2ES2A 1Y1WH 1OO9B 4TRDA 5K36H 3CCSA 3HOUH 2PI2E 1JT8A 3CAMA 1DM0B 2EVBA 1IW7C 2K33A 5HY6A 2L55A 2R7ZB 1N33Q 4MN3A 1X3FA 4LWCA 2DUDA 1XNRQ 3RR5A 4DK3C 1SE3A 1TWFH 2CW0D 1SDFA 2IT1A 5KYIA 1YVCA 1TWHH 2KHIA 1PH4A 1YNXA 4DAYB 3Q6SA 3OIPA 2H5XA 2ZJPA 2TMPA 3PUWA 2M00A 2BA1A 3KLSA 3TP6A 1NCVA 1PYBA 1Z9FA 2JA8H 4BY7B 1LACA 4LF9L 4FF2A 4DR2Q 1PMRA 1Q81C 3KLWA 2Q8IB 1JQYD 5EJWA 4UP7A
chains in the Genus database with same CATH topology
4RFBA 3GV6A 3NPPA 1HCZA 3T13A 1ZEQX 1WTQA 4EQOA 3D4WA 4G57A 4NP5A 4C3IG 3MTSA 1CTMA 1S5DD 1TIID 1SMYC 1ENCA 1V1PB 2EJGC 5NUCA 1GHKA 1VMPA 2JSOA 3QWNA 2C9OA 4PNYA 5ELBA 1DJRD 1TY2A 3KUPA 1EYAA 1O7YA 3C2PA 2YU9B 2F0UA 1YNNC 2F0VA 1EY7A 1ET6A 5C4JB 1EEFD 1JCKB 1KNAA 1SE4A 4DAVA 3D31A 5LL6S 5T1GA 4HMIA 1JOOA 4M1UB 3S9WA 4IUPA 3VR2A 3TBIB 2B2TA 4NMZA 5DNFA 1RTOA 2NVTB 3HGBA 5JEAJ 2A68D 1PZID 4LMQD 3K5MA 3UI2A 4DFAA 3M4YA 3KK7A 4C56C 3VR6A 5COYA 1Z7TA 5CBEE 3NWTA 2MP1A 2EY2A 4CKCA 4BBSB 1G6ZA 3M85A 2B8GA 1RF2D 1KDCA 1RHPA 1H9SB 3IKJA 4WORA 3K58A 1OXUA 1I6VC 3KF8A 4PMBA 1Q3LA 1O7LA 3RZOB 1XYIA 4QB4A 4RAUC 1TT2A 2F3VA 4L6TB 5JPNC 1U4PA 1SYCA 2K28A 3J7YW 1TU2B 2F0TA 3M7GA 3K0YA 2MJ8A 2NB0A 1BDOA 1NAPA 3P7JA 3EROA 5IT9L 4DF7A 3FMCA 3G7LA 4OL7A 3X3MA 3T51B 4C1NI 1YNJC 1RODA 3QO2A 5T1IA 5IGFA 2E75C 3FEWX 3H3VC 3BDOA 1CZWA 3P1HA 3NE5B 3GTJB 1B2TA 1QCBD 4RCOA 4C3JG 1RCVD 2RDGA 3VYSA 1CM9A 2YYZA 2KQ3A 1Y1WB 1LTSD 2EJMA 4DK1A 4CGYB 3OOCA 1SNDA 3A7AB 2RDFA 1LO5D 1GUGA 4IFDH 1SJED 3NP8A 1EY5A 4KHZA 4RH6A 1TWFB 3I70A 2EY1A 1I6HB 4KY6A 2EY5A 1B4OA 3SXHA 1G2SA 3EA6A 2KCCA 1MSHA 1AEXA 1S4ZA 4HR7B 4XQNA 2X6GA 2HCIA 2G9DA 3SK4A 1KNEA 3MZ5A 1CK1A 4K5WA 3U9SA 3VR3A 3WOEA 1RJTA 2H4OA 3G6JB 1PZKD 4FXKC 2WV6D 3TDQA 3WDNA 1KAAA 4Z9CB 1E0BA 1BCPB 2B2TC 3Q24A 1WTOA 1HQRD 1LT3D 4K5VA 1CA6A 1LV9A 2F0JA 1ZYRC 1PRTB 3C46A 2AUKA 1WTPA 2DY8A 3DWQA 5I9OA 3CU7A 4IZ8A 3AB9A 1HRJA 2BOSA 2E76C 1BCPF 2F3WA 4V190 1A3TA 4BBRB 4B9XA 5EPJA 3NBIA 4OO1I 5JPMC 4C3IB 4EQNA 1I4RA 2VNUD 1PRTF 5E3FA 2Y0SB 2CHBD 2XWJB 4KY7A 5EBCA 1EWHA 2A5HA 4ILWA 2EYLA 1FNWA 1RDPD 1SJHD 2AQ3B 4X3TA 3VYTA 4K5XA 3GV3A 5DAUA 5ISRA 1EWCA 1LLRD 5CV9A 4IQZA 4H7BA 3H94A 1T5XD 2PMZB 1ESFA 5I9PA 1F9SA 4HCEA 1F9QA 2EXZA 4ZAIA 4N9PA 5FLXL 2K5QA 1PFNA 1EIHA 4RGTA 3A7LA 3D6WA 3RUZA 5EQ0A 4RKBA 2NWGA 3V96A 4KK7A 2BCOA 3S15B 3TN2A 2N88A 1NR2A 4ULLA 1STEA 3BS1A 1QJOA 1Q90A 4HEDA 5IGCA 2EYFA 4XIGS 1CFMA 1F2YA 1I3QB 1L0YB 1E2VA 2L5TA 3A56A 2E74C 2PQEA 5FKAC 2WINB 3OSOA 2MUYA 3FKIB 1GOZA 2AWNA 3KLSX 1RKNA 4F8MA 2NYZD 2ENBA 2PPBC 1CZGA 4LJZC 3VYUA 2NTTA 1LTTD 2JEBI 2EZVA 1HFGA 5KEEA 3PO2B 1ET9A 1JWSD 1STAA 1OXVA 1IHZA 3EQLC 2L1BA 3OPOA 3QG1A 1QE6A 3A54A 4C2MB 4QMGA 4R9WA 5C0XG 1AFPA 3R3OA 3NTKA 2V4DA 1PXUA 3E5SA 2NN6I 4U68A 2XVSA 3CKIB 1U4MA 5JVG3 3IL8A 1WD0A 3SE0A 3HS0C 4PMWA 5CR3A 1B1ZA 1VF5C 1KTKA 2BE5D 4EVOA 4G4KA 5KYLA 3I73A 4X3SA 2JYOA 3RZDB 1G291 3HG9A 3A8IE 1TWCB 2K03A 4AYBB 1UNSA 3KLRA 5AFWA 5JAVA 1JOKA 2WIIB 4C3JB 1H9SA 1SSOA 1ESRA 3URYA 2IX0A 3K7AB 2FJ2A 2ZXPA 3OHXC 5C0XH 1FNVA 2X69A 4RHSA 3MXUA 1D5XC 1GJXA 1XXGA 1SBBB 5I2YA 4PMCA 1JC7A 5A35A 3E0JA 4UDUC 3HOWB 3CHBD 5KRUA 5FO9B 1F2ZA 2PZWA 2F0QA 4FNFA 3J7AF 2F03A 2F0DA 3SVMA 1J8IA 3JAML 2ZXRA 1VCIA 3R8BA 4RCNA 2EYJA 3BYTB 2IX3A 1EFID 5C6AA 2QILA 3OWFA 2K5DA 5KGUA 5G3LD 3HP3A 1H9RA 3BYYB 1RD9D 1O7ZA 2A69D 4E6IA 4A3JB 5TSSA 2B2UC 3F2UA 3MAQA 5EPLA 3TP5A 2F0GA 3Q23A 5IIFA 1DD2A 3PMFA 3LX0A 1NSNS 2VB3X 3K6OA 3OW7A 1C48A 1UAPA 1EQTA 1IYUA 3GO5A 3H6MA 3GTOB 4ZYSA 4WJWA 4X3KA 1F2LA 3J80E 3I90A 4KMUC 1Y8OB 4QCLA 4QIWB 4H44C 4A3EB 2I46A 4I65A 2O5JC 1CT1D 4F87A 3SK8A 4IFDJ 4RWSC 2WACA 5I2XA 1VMCA 2PNRC 1PTOD 2XRQD 3C1FA 3OMGA 3KBGA 5CGKA 4JBWA 3PUVA 2KEEA 1BR9A 4EGVA 1BNZA 1HA5A 2F0WA 4FP5D 1HA6A 2DNEA 3J7AV 5DEHA 1AN8A 3OMCA 2K5WA 2ID0A 2L11A 2ZXOA 2C5CA 1EY0A 3BZDB 1JWMD 3MVVA 1DOMA 2B2VA 1FNUA 4XXEA 5E4WC 1U9RA 1IKLA 4BA2I 3M3YB 4CHTB 5FO8B 4IUVA 5M5XB 3TMEA 4NDXA 4G7ZC 2RSNA 2NVQB 2B2YA 3KBXA 3I4MB 3BVZA 4RGOS 3DMUA 4H13C 1FYCA 5EKLA 1Q1EA 3K57A 1GUSA 2PYKA 4C3HG 3MXPA 3PIP3 2A6HD 1G2TA 4RHRA 2Z4IA 5CV4A 3NUCA 1D2BA 2SNSA 1EL0A 3A8JE 1D1KA 2WKDA 1B9MA 2HUGA 1TKWB 1WCMB 3NXWA 2JA7B 1CQVA 2RKSA 5IODA 2R93B 4R8NA 1EEID 2BDNA 2L0CA 3NTIA 2F0MA 1CHPD 4ZK9B 1ML0D 1F2MA 4DK0A 1TS3A 2SNMA 1IYVA 2J7ZA 1IW7D 1Y8PB 3W3AA 1MSGA 5BN4A 1KABA 3QJYA 2A74C 4XT1B 1Y69U 2F0FA 4KHVA 1LT5D 1QILA 5M5YB 5E4XA 4Q5VA 3V05A 3P20A 3OIQA 3MC0B 3OWEB 1JE4A 3D4DA 2DN8A 2WAQB 5JVH3 2QKIC 4IFDI 3I4NB 2EYHA 3S16B 3GD7A 3SK5A 1LTID 5C4ZA 5D3DA 2B8FA 2K01A 1B9NA 4CBVA 4HSPA 2HQEA 2RVLA 5C3XA 3PO3B 1I4GA 1I4HA 1SMYD 2F1MA 3J81E 1SE2A 4MHEA 3IAYA 3R2TA 3TP8A 5KIXA 3HOXB 1O80A 3S1RB 3FRPB 5K5PA 1SYBA 2XSCA 5JEAG 2OF1A 4A3GB 1D6EC 1D5ZC 1JORA 1L0XB 3DHQA 1A3VA 1YNND 3FPUB 3Q22A 3CRKC 2JP1A 1K8MA 4DXFA 4A3DB 1I4QA 3VR4A 2E2HB 5ELCA 4ZKCB 1F77A 1Z47A 5IT9E 4ZUIA 1O78A 1BCPC 1C8CA 1AP0A 3EFXD 1SYGA 3MFYA 1GUWA 1ILPA 3CRLC 2K32A 2XWBB 1JWUD 4ZQ3A 3VA5A 3V2TA 3ONAB 4LK1C 3HKZB 2O4XA 1U4LA 3D6CA 1A3UA 1PRTC 1FGBD 2XN9C 5J22A 4J1MA 2K05A 2F0LA 4KKUA 1IKMA 1NUCA 1TWGB 2VXWA 2QCPX 4OO1G 2B63B 4KKSA 2L12A 5EKIA 4O42A 1M8AA 5E1FA 1WTWA 4LAAA 1SNCA 2R92B 4CKBA 4Y7NB 1R4QB 2K7VA 3H91A 4FF4A 1BQQT 4B9WA 5EBDA 4K8JA 1DCZA 3DWPA 1TY0A 1W6JA 2D9UA 1SEBD 5M9OA 5HGTA 4B08A 2AWOA 2HDMA 2NZ1D 1EY8A 2L4NA 5F2DA 4K8IA 5IGDA 4KN7C 3I8ZA 4A3FB 4KN4C 4K6DA 4OO1H 5FO7B 3EVQA 1YNJD 1BBXC 2AQ1B 3ZYYX 3DM1A 3D8GA 4L63B 1S5BD 1QB5D 4C1NK 5J39A 1HTLD 3GQBA 3L3OC 5FK9C 3S17B 2KUMA 2CW0C 4CKEA 3GTPB 4H0LC 1QWYA 2L9HA 2FMCA 3NQIA 3SDZA 4R8IA 3QB3A 2J4XA 4RGNA 1LT6D 1EOTA 1JICA 1ICWA 3D3RA 3SEBA 5G3LF 1STNA 4C3HB 1VDZA 4KJOA 2NN6G 1B53A 3GTKB 2KHSA 2R3ZA 4ID6A 1WTRA 2EDGA 1E2WA 1QOHA 2XIWA 4OIJA 1Q12A 2DY7A 2ICIA 4BS9A 2OXPA 2SDFA 3FDTA 2TSSA 1LT4D 2XNAC 1AZPA 2LY7A 1SXTA 5FLXE 1PTOB 1TS2A 2PCFB 2B39A 5D14A 1WVLA 2F4IA 3I72A 3K5OA 3D4RA 2WKCA 2RBMA 5DM73 3EJIA 3H09A 5EPKA 1R4PB 3DEPA 1WD1A 2KOLA 1SYEA 2KVMA 1D5MC 1FD7D 1ZYRD 2KCNA 1BUVT 3S1QB 3ND9A 2PW5A 1GXDC 2QF7A 4HMJA 2A68C 1E2ZA 4KV6A 2NVYB 3A8KE 5J1ZA 3N6RA 2Z8LA 1LABA 3FPPA 4JK1C 2JE6I 5KNCA 1PLFA 3VYRA 4KI0A 1DXMA 2DNCA 5LL6X 4IUUA 4KY5A 1U4RA 1STHA 4KD3A 2O5IC 1K83B 3GTQB 1KLUD 1F9RA 3MXGA 1A2UA 2EPBA 1K8OA 1EU3A 1X32A 3BG3A 2VB2X 2EYMA 3NBHA 2J0TD 3TP7A 4FVMA 4DA2A 4IALA 2F0IA 1MI2A 1V8QA 4RGMA 3I91A 3BDCA 3BDLA 5A2QE 2M9VA 4RA8A 4K2LA 1DOLA 1TWAB 1HUNA 1CHQD 1LTGD 2EJFC 2Z1CA 3PUYA 2Z4HA 3NTHA 1TS4A 3PIO3 3GP7A 1HFNA 3R2IA 1XX8A 3R93A 3LWEA 1DYQA 4S3SA 5FOBB 1I50B 2Q8TA 3NSWA 4XT3B 1SYFA 3L9AX 3SR1A 3QIAA 1F9PA 2R61A 1GUOA 1NR4A 3MXNA 4GZYC 4OHJA 2PO4A 4DU9A 3MHBA 4TSSA 5JOBA 2R6GA 5BN5A 3GTMB 3LNNA 4IN3A 1B50A 5M3MB 3Q0AA 2OT2A 1DZ1A 3GTGB 3JAME 1Y8NB 2RQXA 4HCSA 2LFNA 2VUMB 3MEHA 1XWEA 4U673 1RTNA 3AU7A 4TQUS 3VR5A 2IJ0A 5CV5A 3DEOA 1R9TB 2E2JB 2IX1A 1SNMA 5EGTA 3P75A 2D2CC 4CJ1B 2IW3A 5D65A 4ABNA 1LTAD 1QG7A 3LWUA 3S14B 3M7NA 1PYWD 5IOCA 1CA5A 4ZUJA 2IWHA 5CV8A 4A93B 3FVQA 2KA7A 1T5EA 5CYUA 2EE1A 3TZDA 4HSVA 1JB3A 1I4PA 3RMHA 4CJ0B 3E6ZX 2F0KA 3DXJC 3S2DB 5C4XB 1MGSA 2OEOA 4QUFA 2JA6B 2B2WA 2NTSA 2KECA 1TS5A 5CV7A 4DXGA 2Q8RE 1IL8A 5CMDA 3CQZB 2FMMA 4IUQA 2X6LA 1OXTA 4X3UA 3I4LA 4TKOB 3J81L 1H9MA 1EY9A 3BVGA 3K59A 5M3FB 5CORA 4CJ2C 4BWGB 5JJZA 2A6EC 1ILQA 3IFDA 2IL8A 4FYDA 2SOBA 3ITPA 4IFDG 1BXTA 3NWSA 4I7ZC 1EZ6A 1TR5A 1QNKA 2XRSD 3N52A 1DOKA 4IUNA 2BDOA 1J9OA 1XTCD 1EIGA 2LMCB 4Q0FA 4A3BB 1GUTA 3WOFA 1TQOA 4YIJA 5LHY1 1W6KA 2LS01 4HTHA 4A3IB 1HPCA 2PZTA 3T4AC 1EY6A 3T53B 3DWAA 3ERQA 2NUCA 4K2KA 2EOTA 4PQXA 3MWYW 3HEJA 1PTOH 4MIUA 5IGGA 4IURA 4QF4A 4HAEA 1WTXA 3HOUB 4DGZA 1B3AA 3HOYB 2AUJD 3QOLA 1TVXA 1PDQA 3GTLB 5I6WA 3VA7A 2AQ2B 1BOSA 3RLFA 4OGQC 1LTBD 3T56B 4DNTB 2ZT9C 3IFTA 4XYQA 4XQQA 1TWHB 4ODGA 1A2TA 1STYA 4K14A 4XQJA 4ZKBB 2WP8J 2JA8B 1KLGD 4ZRZA 4F88A 1HTPA 5IGEA 5ELEA 2HDLA 5I6YA 1WTVA 3PUZA 4G7OC 3W2DA 2EY6A 3C1EA 4L8JA 3T16A 4FO2A 2E2DC 2NBFA 1A15A 2B2VC 4KD4A 1A6XA 3NQTA 4P2CB 3ND8A 2G9HD 2IPKD 3U9OA 4G7HC 1EYCA 1AZQA 4O1NA 2BE5C 5JEAH 4FXGC 2B2YC 5D3IB 1V1OA 4K6LA 1OXSC 3HOZB 5I4DA 2PW7A 3O13A 1ENFA 1S5FD 4HN7A 1B44D 1PFBA 2B2WC 5C0XJ 2JXMB 2FFKB 1SYDA 4XTCS 1UEAB 4NKLA 4ZLTF 2FHTA 3NK9A 1OXXK 2QDBA 4DAPA 5C3EB 4UAIA 1G8ZD 3TZUA 1D1IA 2PZUA 5C5LA 1STBA 1KDBA 3C3LA 3AMUA 1EY4A 2KEDA 3HRZC 1EZ8A 1PFMA 4FF1A 1SAPA 1QNUA 1S5ED 2A6ED 2EYOA 3X3NA 1H9JA 1CI3M 1HUMA 1I4XA 1II3A 2WB1B 1G91A 1MBYA 3BVMA 2K04A 4J6HA 4M8AA 2F0OA 4DAYA 2F0PA 2A69C 4QUCA 3MA2B 4FXDA 2B2UA 1EU4A 2LKVA 4PV1C 2HCCA 1JOQA 3S1NB 2D62A 3L7ZC 5DM63 1DONA 4F7XA 3K5NA 3PUXA 3TSSA 2FINB 1HHVA 1VF7A 1FR3A 2RSOA 1H9KA 1ZKOA 4EQPA 1MD2D 4WRDA 3A55A 5C5MA 2A73B 1PZJD 1JR0D 1Y1VB 4WFN3 3SHLA 4NW2A 1HQMC 1V1PA 1S5CD 2GA4B 1Q1BA 3RD4A 4V0BA 4XYOA 1SNQA 2JEAI 4BA1I 1LTRD 2I07B 5M5WB 4XDXA 1BO0A 2MGSA 2D5DA 2K1BA 4OIKA 1C4QA 5C3WA 2M2LA 4ME5A 3QOJA 1X3QA 1PTOC 1HXYD 1UUPA 1BCPD 1EYDA 3M4OB 2NVXB 3S1MB 5CBAE 3MFGA 3NHHA 3H0GB 2SEBD 3SK6A 2RDHA 3DUZA 1Q8IA 1BF4A 2KJXA 4KJNA 1PRTD 2F0NA 5KNBA 2EYPA 5C44B 2E2IB 5C0XI 2H1EA 4BY1B 3I3CA 5A2QL 1KDAA 2NN6H 4IUTA 1SNOA 1X3PA 1PTOF 2QEJC 2K6AA 2MPMA 3HOVB 1GUNA 5EKKA 4DN4M 1CQFA 5K36G 4A3KB 5ELDA 3J80L 4N9TA 5C4HA 4DNRB 1STGA 2CVRA 5HURA 4J8QA 4A3MB 2RA4A 2JA5B 2F0EA 1ZXTA 5ELFA 1SNPA 2A6HC 5IGBA 5KNDA 1ENAA 4FF3A 1GHJA 1AW7A 4KTAA 1SFOB 2F0HA 2N55A 2BA0A 5CV6A 3S2HB 3HZXA 2CQAA 5BN3A 4RKLA 1ONLA 3K5LA 1Z6HA 3PV0A 2F0SA 1M4VA 4KKTA 5CC4A 2O2LD 2MHVA 1EQVA 1V43A 2ICEC 1OO9B 4TRDA 5K36H 1DM0B 2EVBA 1IW7C 2K33A 2L55A 2R7ZB 4MN3A 1SE3A 2CW0D 1SDFA 2IT1A 5KYIA 3Q6SA 3OIPA 2TMPA 3PUWA 2M00A 2BA1A 3KLSA 3TP6A 1NCVA 4BY7B 1LACA 4FF2A 1PMRA 2Q8IB 1JQYD 5EJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKV A;  2EYH A;  1U9R A;  2EY2 A;  2EY5 A;  4KD4 A;  3NQT A;  4KY6 A;  4E6I A;  1JOQ A;  5EKK A;  3SXH A;  4F7X A;  5KYL A;  1STN A;  2SOB A;  3ITP A;  4K5X A;  5CV5 A;  3SK5 A;  3T13 A;  5C4Z A;  1KDC A;  3U9O A;  4KJO A;  5DAU A;  1AEX A;  4EQO A;  3TP5 A;  2F0G A;  4WOR A;  5ISR A;  5E1F A;  1EZ6 A;  5CV9 A;  1SNM A;  1TR5 A;  3D4W A;  4G57 A;  3PMF A;  4NP5 A;  4LAA A;  5EGT A;  3P75 A;  3LX0 A;  1EYC A;  1SNC A;  3SK4 A;  4N9T A;  3TME A;  2KHS A;  1A2U A;  4H7B A;  4NDX A;  5C4H A;  3MZ5 A;  1NSN S;  5CR3 A;  4PMB A;  5I9P A;  2HQE A;  1STG A;  4ID6 A;  4K5W A;  4EQP A;  4IUN A;  1ENC A;  5HUR A;  4WRD A;  5C3X A;  5C5M A;  2EXZ A;  4QB4 A;  5NUC A;  4N9P A;  3TP7 A;  2EYM A;  4B9W A;  3H6M A;  1TT2 A;  3DMU A;  4EVO A;  2F3V A;  4K8J A;  5EKL A;  3SHL A;  3TP8 A;  3RUZ A;  5CV4 A;  4IAL A;  4RKB A;  4PNY A;  5IOC A;  2PW7 A;  5KIX A;  2F0E A;  1TQO A;  2F0I A;  4ZUJ A;  5M9O A;  5HGT A;  2OXP A;  1SNP A;  4YIJ A;  2PYK A;  1SYC A;  3BDC A;  3MXP A;  1EYA A;  1EY8 A;  1SYB A;  2F0T A;  3BDL A;  5IGB A;  1SNQ A;  1ENA A;  5K5P A;  5CV8 A;  2OF1 A;  4HTH A;  2F0U A;  2PZT A;  4KTA A;  2F0V A;  1EY6 A;  1KAA A;  1EY7 A;  1JOR A;  5F2D A;  4I65 A;  4K2L A;  2F0H A;  3DHQ A;  3ERO A;  2NUC A;  1A3V A;  3ERQ A;  1SYD A;  3NUC A;  4K8I A;  1JOK A;  2EYF A;  4DF7 A;  4K2K A;  5IGC A;  4OL7 A;  5JAV A;  1F2Y A;  4NKL A;  2SNS A;  5CV6 A;  3SK8 A;  5C3W A;  3HEJ A;  4K6D A;  3HZX A;  2F0K A;  3NK9 A;  4MIU A;  5IGG A;  2RBM A;  3EVQ A;  4RKL A;  3EJI A;  4K5V A;  4ME5 A;  3QOJ A;  2OEO A;  4QF4 A;  2QDB A;  2WAC A;  2PQE A;  4DGZ A;  5IGF A;  4HMI A;  1JOO A;  3NXW A;  3OSO A;  3S9W A;  3QOL A;  2F0S A;  2RKS A;  5CC4 A;  5IOD A;  2F0J A;  4R8N A;  3C1F A;  1EQV A;  3OMG A;  1SYE A;  4PMC A;  1RKN A;  4ZUI A;  2PZU A;  4F8M A;  2F0M A;  3D8G A;  5I6W A;  2ENB A;  4S3S A;  3P1H A;  5CV7 A;  5C5L A;  1SYG A;  4TRD A;  5CGK A;  1EYD A;  1F2M A;  2SNM A;  1SYF A;  4NMZ A;  1STB A;  5I9O A;  5J39 A;  1KDB A;  5KRU A;  3SR1 A;  1F2Z A;  2PZW A;  4IZ8 A;  4ZQ3 A;  1EY4 A;  2PW5 A;  3NHH A;  3VA5 A;  4ODG A;  1EZ8 A;  1A2T A;  2F0Q A;  1STY A;  2F3W A;  3V2T A;  5IIF A;  2F0D A;  2O4X A;  3D6C A;  1A3T A;  3SK6 A;  4K14 A;  4HMJ A;  4B9X A;  1A3U A;  2EYO A;  1KAB A;  2F0W A;  3MHB A;  2KQ3 A;  4KV6 A;  4DU9 A;  5KEE A;  5JOB A;  5J1Z A;  5DEH A;  1STA A;  2F0F A;  4KJN A;  5J22 A;  3OMC A;  4KHV A;  2F0N A;  2EYJ A;  4J1M A;  1IHZ A;  1II3 A;  5KYI A;  1SND A;  5IGE A;  2EYP A;  1EY9 A;  2F0L A;  5IGD A;  1EY0 A;  2M00 A;  1NUC A;  2RDF A;  3TP6 A;  4EQN A;  5I6Y A;  4J6H A;  4DFA A;  5C6A A;  3QB3 A;  5E3F A;  3MVV A;  3NP8 A;  3OWF A;  1KDA A;  1EY5 A;  2EY6 A;  4KY5 A;  1SNO A;  2F0O A;  4KY7 A;  4QMG A;  5KGU A;  3C1E A;  1STH A;  2F0P A;  3T16 A;  3D4D A;  3R3O A;  4KD3 A;  2EY1 A;  2EYL A;  3MEH A;  3E5S A; 
#chains in the Genus database with same CATH topology
 4BBR G;  4RFB A;  2E8G A;  3GV6 A;  3NPP A;  4AH6 A;  1HCZ A;  3T13 A;  1ZEQ X;  1WTQ A;  4EQO A;  1ASY A;  3W5O A;  2E5L L;  4JI6 L;  3D4W A;  4G57 A;  4NP5 A;  4C3I G;  4OEM B;  3MTS A;  5AJ3 L;  2F4V Q;  2A1A A;  1CTM A;  5DLQ E;  1S5D D;  1TII D;  1SMY C;  1ENC A;  1V1P B;  2EJG C;  5NUC A;  1GHK A;  4JV5 L;  1VQ5 A;  1VMP A;  2JSO A;  3QWN A;  4IPG A;  2C9O A;  4PNY A;  5ELB A;  1DJR D;  1TY2 A;  3KUP A;  4LF4 Q;  1EYA A;  3PIO A;  4JI3 Q;  1O7Y A;  3C2P A;  3ULP A;  1VQM A;  2YU9 B;  2ZM6 L;  2F0U A;  1YNN C;  2F0V A;  1YHB A;  1EY7 A;  1ET6 A;  5C4J B;  2UU9 L;  4GLV B;  1QUQ B;  1EEF D;  1X65 A;  1JCK B;  1KNA A;  3ICE A;  2VS1 A;  1SE4 A;  2FXQ A;  4DAV A;  3D31 A;  5LL6 S;  3CMA A;  1HZA A;  5T1G A;  4HMI A;  1JOO A;  4M1U B;  3S9W A;  4IUP A;  1K28 A;  4GNX C;  3VR2 A;  3TBI B;  2DJF C;  1E7Z A;  2B2T A;  5C3E H;  1A63 A;  3G6E A;  4NMZ A;  5IP7 H;  4LNQ A;  5DNF A;  4C3I H;  1RTO A;  4JI5 Q;  2NVT B;  3HGB A;  1XNQ L;  5JEA J;  1CKO A;  2A68 D;  4NPS A;  1PZI D;  4LMQ D;  3K5M A;  3FKI G;  4R4O A;  3UI2 A;  4DFA A;  3S24 A;  3M4Y A;  3KK7 A;  4C56 C;  4HID A;  1GO3 E;  4JVZ A;  2UXB L;  3VR6 A;  4UHV A;  5COY A;  2JA9 A;  1Z7T A;  1B3Q A;  5CBE E;  3NWT A;  2MP1 A;  2EY2 A;  4CKC A;  3U4Z A;  3PO2 G;  4BBS B;  1G6Z A;  4LUO A;  3M85 A;  2B8G A;  1RF2 D;  1KDC A;  4K0K L;  1RHP A;  1H9S B;  3IKJ A;  4WOR A;  3K58 A;  3UE1 A;  1RIP A;  5GAE C;  1OXU A;  1I6V C;  3S1N H;  3KF8 A;  3G4S A;  1D7Q A;  3TQY A;  2BH8 A;  1BBW A;  4PMB A;  1Q3L A;  1IYJ B;  1O7L A;  3S15 H;  3RZO B;  1XYI A;  4QB4 A;  1IBL L;  4RAU C;  1TT2 A;  2F3V A;  4L6T B;  4LF5 L;  5JPN C;  1U4P A;  1SYC A;  2K28 A;  3J7Y W;  1TU2 B;  2F0T A;  3M7G A;  3K0Y A;  1UE7 A;  5FLX c;  1XMQ L;  2MJ8 A;  2NB0 A;  1BDO A;  5FLM H;  1NAP A;  1C0A A;  3P7J A;  4APV A;  3ERO A;  5IT9 L;  3MEF A;  4DF7 A;  3FMC A;  4GN5 A;  3G7L A;  4OL7 A;  3X3M A;  3ULJ A;  3T51 B;  4C1N I;  5IWA L;  1YNJ C;  1ROD A;  2K50 A;  2K5N A;  3QO2 A;  1C9O A;  5T1I A;  2E75 C;  5IGF A;  4UP9 A;  3FEW X;  3H3V C;  4NXM L;  2R7D A;  3M4Q A;  4AYB G;  5ELN A;  1EIF A;  3BDO A;  1CZW A;  3P1H A;  3NE5 B;  3GTJ B;  1B2T A;  4R4I A;  3VDY A;  1QCB D;  4RCO A;  1NJI C;  4RG1 A;  4P75 A;  4C3J G;  1RCV D;  3W1B A;  4EX5 A;  1U5K A;  4C2M H;  2RDG A;  3VYS A;  4KHP L;  1CM9 A;  2YYZ A;  2KQ3 A;  4JI8 Q;  1Y1W B;  3S1M H;  1LTS D;  2EJM A;  4DK1 A;  4CGY B;  3OOC A;  4DV3 L;  1N36 Q;  1SND A;  1YHQ A;  3A7A B;  2RDF A;  4GN3 B;  1LO5 D;  1GUG A;  2N8N A;  1ASZ A;  3GDE A;  4IFD H;  3HOW G;  1SJE D;  3NP8 A;  1EY5 A;  4KHZ A;  1XTD A;  3U58 A;  4RH6 A;  1TWF B;  2E2I H;  3I70 A;  4X66 Q;  2EY1 A;  2DGY A;  3A0J A;  1I6H B;  4BY1 H;  1VS0 A;  4KY6 A;  2EY5 A;  1W2B A;  1B4O A;  3SXH A;  1HR0 W;  1YBY A;  2K5H A;  3RN2 A;  1G2S A;  1X56 A;  2RCF A;  1HJP A;  1VQK A;  3EA6 A;  2KCC A;  4A3C G;  1MSH A;  1AEX A;  1S4Z A;  4HR7 B;  4XQN A;  2X6G A;  3HOV H;  2HCI A;  2G9D A;  1SE8 A;  1S40 A;  3SK4 A;  4Y52 H;  1KNE A;  3MZ5 A;  3RZD H;  1CK1 A;  4K5W A;  1A0I A;  3CD6 A;  3U9S A;  1PH3 A;  3VR3 A;  3WOE A;  1EFW A;  1RJT A;  4JYA Q;  5GRO A;  4HIO A;  2ZJR A;  4OEL B;  2H4O A;  2QEX A;  4A3M H;  3G6J B;  1PZK D;  2JA5 H;  3K0X A;  2EXD A;  1X9N A;  4FXK C;  4DPG A;  2WV6 D;  3TDQ A;  3WDN A;  4GOP B;  1KAA A;  4P73 A;  4R4T A;  4Z9C B;  1E0B A;  1BCP B;  2B2T C;  1YIT A;  3Q24 A;  3HKS A;  2UUC Q;  1WTO A;  1HQR D;  1LT3 D;  1SFO H;  4K5V A;  3A5U A;  1CA6 A;  1VQO A;  1J6Q A;  1LV9 A;  1ZYR C;  2F0J A;  4DUZ L;  1PRT B;  3C46 A;  2AUK A;  3PSI A;  4LF8 Q;  1WTP A;  2DY8 A;  3DWQ A;  4A3C H;  4GKK Q;  4A3E G;  5I9O A;  3CU7 A;  2ALY B;  1UE6 A;  4IZ8 A;  3AB9 A;  1HRJ A;  2BOS A;  2E76 C;  1BCP F;  2F3W A;  4V19 0;  1A3T A;  4BBR B;  4B9X A;  4YHH Q;  5EPJ A;  3NBI A;  2R7Z H;  4OO1 I;  3M4P A;  5JPM C;  4C3I B;  4A3J H;  4EQN A;  1I4R A;  2VNU D;  1PRT F;  3UE0 A;  5E3F A;  2Y0S B;  1X55 A;  3JAM c;  2CHB D;  2XWJ B;  4KY7 A;  3UDI A;  5EBC A;  4CDC C;  2B29 A;  1EWH A;  1N32 L;  1N9W A;  2A5H A;  4ILW A;  2EYL A;  1FNW A;  1RDP D;  4OWX B;  5E7N A;  2CKZ B;  4POG A;  1Q86 C;  1K0S A;  1SJH D;  3KDF B;  2AQ3 B;  4BY7 H;  4X3T A;  1IBK Q;  3VYT A;  4K5X A;  1DGS A;  1N34 Q;  3GV3 A;  5DAU A;  2IHF A;  4DV5 Q;  2I5H A;  2VY3 A;  5ISR A;  1EWC A;  1LLR D;  3BJU A;  5CV9 A;  3STB D;  2MNA A;  4IQZ A;  4H7B A;  3H94 A;  1T5X D;  2PMZ B;  1ESF A;  5I9P A;  1F9S A;  4HCE A;  1F9Q A;  2EXZ A;  4ZAI A;  4N9P A;  5JJK A;  1MHW C;  5FLX L;  2K5Q A;  1K3B C;  1PFN A;  4A3E H;  1EIH A;  4OX9 L;  4RGT A;  3A7L A;  3ER0 A;  3D6W A;  3RUZ A;  5EQ0 A;  4RKB A;  2NWG A;  4YCW A;  3V96 A;  4KK7 A;  2BCO A;  3S15 B;  3TN2 A;  1EIY B;  1PYS B;  1GD7 A;  2N88 A;  1NR2 A;  4ULL A;  2RCN A;  2ZTD A;  1STE A;  3BS1 A;  1QJO A;  3TS0 A;  4YWM A;  1Q90 A;  4HED A;  5IGC A;  2EYF A;  4XIG S;  1CFM A;  1F2Y A;  3M9B A;  4BXX G;  1I3Q B;  1L0Y B;  1E2V A;  1KHI A;  3I4M G;  1LM0 A;  2L5T A;  2K52 A;  3A56 A;  2G5D A;  2E74 C;  2PQE A;  5FKA C;  2WIN B;  3OSO A;  4YY3 Q;  2MUY A;  3FKI B;  1GOZ A;  2AWN A;  3KLS X;  1RKN A;  4F8M A;  2NYZ D;  3J7Z C;  2ENB A;  2PPB C;  1CZG A;  1VQA A;  4LJZ C;  3VYU A;  3ZJY C;  2NTT A;  1L1O A;  1LTT D;  2JEB I;  4HJ5 A;  2CCZ A;  4B3S Q;  2EZV A;  1HFG A;  2PNH A;  4DUY L;  4A4I A;  4DV2 Q;  1WJJ A;  3OW2 A;  4DR5 Q;  4JI1 L;  5KEE A;  3PO2 B;  4L5T A;  1ET9 A;  1JWS D;  1STA A;  4IJL A;  1OXV A;  3J81 j;  1WCM G;  1IHZ A;  2JA7 G;  3EQL C;  1BKB A;  2L1B A;  3OPO A;  4JI2 Q;  2R93 G;  3QG1 A;  1L0W A;  4DV7 L;  4AQY L;  2NVT H;  1QE6 A;  3A54 A;  4C2M B;  1ICF B;  4QMG A;  4R9W A;  5C0X G;  1AFP A;  1VQE A;  3R3O A;  3NTK A;  2V4D A;  1PXU A;  3E5S A;  2HHH L;  4DV0 L;  2NN6 I;  4QQB X;  4U68 A;  4DR4 Q;  1NBW A;  2XVS A;  3QR8 A;  2UUB L;  1B70 B;  3AYH B;  3CKI B;  2CH4 W;  3I4M H;  1U4M A;  1XJV A;  5JVG 3;  2K14 A;  3IL8 A;  2VQF Q;  2Z6B A;  4MZ9 A;  3T1H Q;  1WD0 A;  3SE0 A;  3HS0 C;  4PMW A;  1X3E A;  4GKJ L;  4ZCK A;  4BBS H;  2AMC B;  5CR3 A;  4JI7 L;  1KD1 C;  1B1Z A;  1VF5 C;  2WAQ G;  1KTK A;  2Y0S E;  4DR1 Q;  1NY4 A;  1E1O A;  2BE5 D;  4EVO A;  3L2P A;  3I4N G;  4G4K A;  2F52 A;  4IPH A;  5KYL A;  3I73 A;  4X3S A;  2JYO A;  3RZD B;  1G29 1;  3HG9 A;  3A8I E;  1TWC B;  3UDF A;  2K03 A;  4AYB B;  4QJF A;  1VQC A;  1UNS A;  4R4Q A;  3KLR A;  4HJA A;  5AFW A;  3WWV A;  2JA7 H;  2WB1 E;  3CCV A;  5JAV A;  1JOK A;  2WII B;  4C3J B;  1H9S A;  1SSO A;  1ESR A;  4LFA Q;  3PO3 G;  3URY A;  2PMZ E;  2IX0 A;  3K7A B;  2FJ2 A;  2ZXP A;  3OHX C;  5C0X H;  1FNV A;  3NEN A;  3KF6 A;  2X69 A;  3HOX G;  4RHS A;  1HNX L;  3MXU A;  3H3V I;  1D5X C;  1GJX A;  1XXG A;  1SBB B;  4LW1 A;  5I2Y A;  4PMC A;  4LF9 Q;  1JC7 A;  1IXR A;  5A35 A;  4A3G G;  3E0J A;  4UDU C;  3OTO L;  4R1J A;  3HOW B;  3CHB D;  1EUJ A;  4A3L G;  5M5Y H;  5KRU A;  5FO9 B;  1F2Z A;  2PZW A;  2F0Q A;  1NMG A;  4FNF A;  2F03 A;  3J7A F;  4A3D G;  2F0D A;  1HNW L;  3SVM A;  2LSS A;  1J8I A;  3JAM L;  2ZXR A;  3AFQ A;  1VCI A;  3R8B A;  1HR0 L;  5AJ3 Q;  5IYC G;  4RCN A;  2EYJ A;  3BYT B;  2IX3 A;  1EFI D;  3F2C A;  2HT1 A;  3KFU A;  2CFM A;  3AFP A;  2P5Z X;  5C6A A;  2QIL A;  3OWF A;  1GVP A;  2K5D A;  4QGU A;  5LMN Q;  5KGU A;  5G3L D;  3HP3 A;  1H9R A;  3BYY B;  5IP9 G;  1RD9 D;  1O7Z A;  2UXC Q;  3HKZ G;  2A69 D;  4E6I A;  4A3J B;  5TSS A;  2ZM6 Q;  3ULL A;  2B2U C;  3PCO B;  3F2U A;  3MAQ A;  5EPL A;  3BU2 A;  2F0G A;  3TP5 A;  3Q23 A;  1I6H H;  2UU9 Q;  5BR8 Q;  5IIF A;  1DD2 A;  3PMF A;  3LX0 A;  3KOJ A;  3S1R H;  2Q2H A;  1NSN S;  1FJG Q;  2VB3 X;  3K6O A;  2B63 G;  3OW7 A;  1C48 A;  1UAP A;  1VQJ A;  4JC0 A;  1EQT A;  1IYU A;  4A3G H;  3GO5 A;  3H6M A;  3GTO B;  4X64 L;  1K73 C;  1M90 C;  4ZYS A;  4WJW A;  4X3K A;  2VQE L;  1SMX A;  4CDD C;  1F2L A;  3J80 E;  3CCM A;  4B3T L;  3I90 A;  4A3D H;  4KMU C;  1Y8O B;  4DV6 L;  2E2H H;  3KYH C;  1T9H A;  4QCL A;  4P74 A;  4QIW B;  4H44 C;  4A3E B;  2I46 A;  2R92 G;  4I65 A;  4DK6 C;  2O5J C;  1HH2 P;  1CT1 D;  2AHO B;  1XNQ Q;  4F87 A;  3SK8 A;  4HJ9 A;  2K75 A;  4IFD J;  4RWS C;  3F1Z A;  1X3G A;  5IP9 H;  1VQH A;  2WAC A;  1VQ7 A;  4N8F A;  1L1O B;  5I2X A;  1VMC A;  1BBU A;  3C1F A;  3OMG A;  2PNR C;  1PTO D;  2XRQ D;  3KBG A;  2UXB Q;  2LXK A;  4B3R L;  2R7F A;  5CGK A;  4JI4 L;  4JBW A;  2ASB A;  2MO1 A;  3PGZ A;  4AYB E;  3PUV A;  2KEE A;  4A3F G;  1BR9 A;  4K0K Q;  1TWG H;  4EGV A;  1BNZ A;  1HA5 A;  1FGU A;  4GOP A;  2F0W A;  4FP5 D;  1HA6 A;  2DNE A;  3J7A V;  5DEH A;  1AN8 A;  3OMC A;  2K5W A;  5L37 A;  2ID0 A;  2L11 A;  1M1K C;  2ZXO A;  2C5C A;  1EY0 A;  4BBR H;  1BVS A;  5H1S E;  3BZD B;  1JWM D;  3MVV A;  4DR6 L;  1DOM A;  1LUZ A;  2B2V A;  1FNU A;  2OTJ A;  4CDF C;  4XXE A;  2R92 H;  5E4W C;  1U9R A;  1WFQ A;  2NZH A;  1IKL A;  4BA2 I;  4DR2 L;  4P72 A;  4WJ3 M;  2I5M X;  4WJ4 A;  1KRS A;  3M3Y B;  4CHT B;  1V9P A;  5FO8 B;  3Q8D A;  4IUV A;  5IWA Q;  5M5X B;  3TME A;  4NDX A;  4G7Z C;  1EWI A;  1U0L A;  4IPD A;  2RSN A;  1AE3 A;  4P71 A;  4CDE C;  2NVQ B;  2B2Y A;  3KBX A;  3I4M B;  4DR3 Q;  3BVZ A;  2HIV A;  4ME3 A;  4RGO S;  3DMU A;  4H13 C;  1FYC A;  4NXM Q;  1KIX A;  5EKL A;  1Q1E A;  3K57 A;  1GUS A;  4A3F H;  4DAM A;  1K3R A;  2PYK A;  4C3H G;  3MXP A;  3PIP 3;  3G48 A;  2A6H D;  1G2T A;  4RHR A;  2Z4I A;  4LF7 Q;  1QZH A;  3KDF A;  2OTL A;  1E24 A;  5CV4 A;  4ALP A;  3NUC A;  3KF6 B;  4KHP Q;  3I4O A;  1D2B A;  2SNS A;  4JBM A;  4DV3 Q;  1B8A A;  1EL0 A;  4MTN A;  1XPU A;  3A8J E;  1K0R A;  1D1K A;  2WKD A;  1B9M A;  2HUG A;  1TKW B;  1WCM B;  3NXW A;  2JA7 B;  1I3Q H;  1CQV A;  2RKS A;  5IOD A;  3S17 H;  5ELO A;  4R8N A;  2R93 B;  1EEI D;  2BDN A;  2L0C A;  3NTI A;  2F0M A;  1CHP D;  4ZK9 B;  1ML0 D;  1F2M A;  4DK0 A;  1TS3 A;  2SNM A;  3FKI H;  1X54 A;  4GN4 B;  1IYV A;  4QIW E;  2J7Z A;  1IW7 D;  1Y8P B;  3W3A A;  1MSG A;  3K7U C;  1JJC B;  5BN4 A;  3K81 C;  1KAB A;  3QJY A;  1NTG A;  2A74 C;  4XT1 B;  4O0A A;  1Y69 U;  2B3G A;  2F0F A;  4KHV A;  5IE8 A;  1LT5 D;  1QIL A;  5J3B A;  5M5Y B;  1SLJ A;  3NBH B;  5E4X A;  4Q5V A;  3PO2 H;  3PIP A;  3JC6 6;  1IBM L;  2Q2I A;  3V05 A;  3P20 A;  3OIQ A;  3MC0 B;  3OWE B;  1JE4 A;  3D4D A;  1YJN A;  2DN8 A;  2WAQ B;  5JVH 3;  2QKI C;  4IFD I;  3I4N B;  2EYH A;  2RHS B;  3S16 B;  1SN8 A;  2XGT A;  3DLL A;  3GD7 A;  3SK5 A;  1LTI D;  5C4Z A;  5D3D A;  2B8F A;  2K01 A;  1Q7Y C;  1B9N A;  4CBV A;  4HSP A;  2HQE A;  2RVL A;  3RNU A;  1PH2 A;  4IOC A;  3CME A;  3NEM A;  5C3X A;  4YCU A;  3PO3 B;  1I4G A;  1I4H A;  1SMY D;  2F1M A;  3J81 E;  1SE2 A;  4MHE A;  3IAY A;  3R2T A;  3TP8 A;  5KIX A;  3HOX B;  1VQ9 A;  1O80 A;  3S1R B;  1PFS A;  4NXN Q;  3FRP B;  5K5P A;  1SYB A;  2XSC A;  5JEA G;  5FJ8 G;  2OF1 A;  4A3G B;  3MXN B;  1D6E C;  1D5Z C;  1JOR A;  1L0X B;  3B6Y A;  3DHQ A;  1A3V A;  1YNN D;  1YHA A;  4X65 Q;  3FPU B;  1TWC H;  3D0F A;  3Q22 A;  1PHJ A;  3CRK C;  2JP1 A;  1K8M A;  4DXF A;  4JW0 A;  3J80 i;  4A3D B;  1I94 Q;  1I4Q A;  3VR4 A;  3S1Q H;  2E2H B;  3CCU A;  1VQP A;  5ELC A;  4GOP C;  3CCQ A;  4C3J H;  4ZKC B;  1F77 A;  1Z47 A;  5IT9 E;  4MTK A;  1O78 A;  3K7A H;  4ZUI A;  1BCP C;  1C8C A;  1AP0 A;  2MFI A;  3EFX D;  1N32 Q;  2NVY H;  1SYG A;  3MFY A;  1GUW A;  1ILP A;  3CRL C;  2K32 A;  2XWB B;  1JWU D;  4ZQ3 A;  3VA5 A;  4DR7 Q;  3V2T A;  3ONA B;  4LK1 C;  5IYB G;  3HKZ B;  2O4X A;  1KQS A;  1U4L A;  3D6C A;  3HOW H;  1A3U A;  4DV1 Q;  1PRT C;  1FGB D;  1JB7 A;  2XN9 C;  1PH1 A;  1PH5 A;  5J22 A;  2C35 B;  2N49 A;  4J1M A;  2K05 A;  2F0L A;  4KKU A;  4JI8 L;  1IKM A;  1OTC A;  1NUC A;  4JBJ A;  4QL5 A;  2YV5 A;  1TWG B;  2VXW A;  1JE5 A;  2Q2T A;  4OX9 Q;  2QCP X;  4OO1 G;  3HFZ B;  3GTQ H;  2B63 B;  5FJ8 H;  1CKM A;  4LFB L;  3CC2 A;  4KKS A;  2L12 A;  2N78 A;  4DNI A;  2CWP A;  5EKI A;  4O42 A;  4YWK A;  1M8A A;  1JJG A;  5E1F A;  1WTW A;  4LAA A;  1SNC A;  2R92 B;  5M3M G;  4CKB A;  3A5Z B;  4Y7N B;  1R4Q B;  4DV4 L;  2K7V A;  3H91 A;  1VQI A;  1FL0 A;  1BQQ T;  4B9W A;  4FF4 A;  5EBD A;  2VUM G;  2K5V A;  4K8J A;  4PZ7 A;  1DCZ A;  3DWP A;  1TY0 A;  1W6J A;  2D9U A;  1SEB D;  5M9O A;  5HGT A;  4B08 A;  2AWO A;  2HDM A;  2NZ1 D;  1I5F A;  3GTO H;  1EY8 A;  3F8T A;  4JCV E;  1XMO Q;  3U4V A;  2L4N A;  4JYA L;  3BZC A;  2CWA A;  1HZC A;  5F2D A;  4K8I A;  5IGD A;  4KN7 C;  3I8Z A;  5LMU Q;  2I5L X;  3SGI A;  4A3F B;  4KN4 C;  4K6D A;  4OO1 H;  5FO7 B;  3EVQ A;  1YNJ D;  1BBX C;  1PH9 A;  3UDX A;  2UUC L;  2AQ1 B;  3CC4 A;  4GLA C;  3ZYY X;  3DM1 A;  3D8G A;  4L63 B;  4A93 G;  1S5B D;  2WFW A;  4DV0 Q;  1QB5 D;  4C1N K;  5J39 A;  1HTL D;  3GQB A;  4LF8 L;  2UUB Q;  3L3O C;  5FK9 C;  3I55 A;  3S17 B;  2KUM A;  2CW0 C;  4CKE A;  3GTP B;  4H0L C;  5C4X G;  1QWY A;  1MJE A;  4LF6 L;  4GKJ Q;  2L9H A;  3LGJ A;  2JA6 G;  2FMC A;  4JI7 Q;  2BH2 A;  3NQI A;  3BZK A;  5JJL A;  3SDZ A;  4J15 A;  4R8I A;  3QB3 A;  4LFC Q;  2J4X A;  4RGN A;  1R9T H;  4HJ8 A;  1LT6 D;  1EOT A;  1JIC A;  1ICW A;  3D3R A;  2KCT A;  3SEB A;  2UUA Q;  2KCM A;  5G3L F;  1KAW A;  3IRB A;  1STN A;  4C3H B;  1VDZ A;  3CF5 A;  1YZ6 A;  1HZB A;  4KJO A;  2NN6 G;  1J5E Q;  3FP9 A;  1B53 A;  4B3M L;  3GTK B;  3EN2 A;  2KHS A;  5M3F G;  2R3Z A;  4ID6 A;  1WTR A;  4KLK A;  3M3Y H;  4A93 H;  2EDG A;  1E2W A;  1QOH A;  2XIW A;  4OIJ A;  1Q12 A;  2DY7 A;  2ICI A;  1RL2 A;  5M5X H;  4RMF A;  4BS9 A;  3DM3 A;  4BXX H;  2OXP A;  2SDF A;  3OTO Q;  2NVQ H;  3CXC A;  4IO9 A;  3FDT A;  2TSS A;  1LT4 D;  2XNA C;  5C4X H;  1AZP A;  2LY7 A;  1SXT A;  1WYD A;  5FLX E;  1PTO B;  1TS2 A;  2Z9H A;  2PCF B;  2B39 A;  5D14 A;  3J81 i;  1HNW Q;  1WVL A;  2F4I A;  3I72 A;  3EBE A;  3K5O A;  1HR0 Q;  1WTH A;  4X62 L;  3D4R A;  2WKC A;  2RBM A;  5DM7 3;  3EJI A;  3H09 A;  5EPK A;  4A3B G;  4POF A;  1R4P B;  1O7I A;  1E22 A;  1VQD A;  4N8X 1;  3CQZ H;  3DEP A;  3UDG A;  1WD1 A;  2KOL A;  1SYE A;  1PA6 A;  1CSP A;  2KVM A;  4A3I G;  1D5M C;  1FD7 D;  4YY3 L;  1ZYR D;  2VW9 A;  2KCN A;  1BUV T;  1WCM H;  3U50 C;  3S1Q B;  3ND9 A;  3I2Z A;  1Q46 A;  5HGQ A;  2R93 H;  2PW5 A;  3CCJ A;  1HNZ L;  1GXD C;  4UY8 C;  2QF7 A;  2CH4 A;  4HMJ A;  2A68 C;  2OCE A;  1E2Z A;  4KV6 A;  2NVY B;  1EOV A;  3A8K E;  3N6R A;  5J1Z A;  1G6P A;  3HOU G;  1UE5 A;  2Z8L A;  3RLN A;  4L5R C;  3HOY G;  4DV2 L;  1LAB A;  3FPP A;  4JK1 C;  2JE6 I;  4JI0 L;  5KNC A;  1PLF A;  3CP0 A;  3VYR A;  4KI0 A;  1DXM A;  2DNC A;  4X64 Q;  2MO0 A;  5LL6 X;  4IUU A;  4KY5 A;  1U4R A;  1STH A;  2VQE Q;  4A76 A;  1K9M C;  4OWT B;  2HD3 A;  4KD3 A;  1QVC A;  2O5I C;  1K83 B;  4DV6 Q;  1QZG A;  2E5L Q;  2IHE A;  4JI6 Q;  2JA8 G;  3GTQ B;  3I4N H;  1KLU D;  1F9R A;  4A3B H;  4PZ6 A;  3K8A A;  4HJ7 A;  3S16 H;  1TXY A;  3MXG A;  3F2D A;  4JV5 Q;  1A2U A;  2VQF L;  2EQS A;  2EPB A;  1K8O A;  1EU3 A;  1X32 A;  1SRO A;  3BG3 A;  2VB2 X;  2EYM A;  3NBH A;  2J0T D;  3TP7 A;  3H3V H;  3AQQ A;  4FVM A;  4DA2 A;  4IAL A;  2F0I A;  1MI2 A;  4JI4 Q;  1V8Q A;  1X6O A;  4JOI A;  4RGM A;  3RN5 A;  2Z0S A;  3I91 A;  2GVA A;  3BDC A;  3PO3 H;  2DJG C;  3BDL A;  5A2Q E;  3HOY H;  2QDL A;  3HOX H;  2M9V A;  4RA8 A;  4OWW B;  4K2L A;  1DOL A;  1TWA B;  1HUN A;  3GTL H;  1CHQ D;  1LTG D;  1VQB A;  2D0P A;  2EJF C;  2Z1C A;  3PUY A;  2Z4H A;  3NTH A;  1TS4 A;  4OON A;  4A3L H;  3E3X A;  3PIO 3;  2YTX A;  3GP7 A;  4LFA L;  3HOZ G;  3E9H A;  1HFN A;  3R2I A;  1XX8 A;  2OQK A;  4DR6 Q;  3R93 A;  2RF4 A;  3LWE A;  1DYQ A;  4S3S A;  5FOB B;  1I50 B;  3NSW A;  2Q8T A;  1MJC A;  4XT3 B;  5IYC H;  4L5S A;  1SYF A;  3L9A X;  3SR1 A;  3QIA A;  3T1Y L;  1F9P A;  2R61 A;  4GS3 A;  1L1O C;  1GUO A;  1NR4 A;  3MXN A;  1V1Q A;  4GZY C;  4OHJ A;  2PO4 A;  4DU9 A;  3MHB A;  4TSS A;  1EYG A;  5JOB A;  2D0O A;  2R6G A;  5BN5 A;  3GTM B;  2UXD L;  5C3E G;  3LNN A;  4PG3 A;  4IN3 A;  2ZTE A;  5IP7 G;  1B50 A;  4GLX A;  1E1T A;  1K8A C;  5M3M B;  1VQL A;  3Q0A A;  2OT2 A;  2KBN A;  2Y0S G;  3H15 A;  1VQN A;  3KJP A;  1D8L A;  1DZ1 A;  3GTG B;  3JAM E;  1Y8N B;  2RQX A;  4HCS A;  2LFN A;  2VUM B;  4LUV A;  1CSQ A;  3MEH A;  5LMN L;  1XWE A;  4U67 3;  1RTN A;  3AU7 A;  4TQU S;  1UWV A;  3VR5 A;  3CCE A;  1Y14 B;  2B63 H;  2IJ0 A;  5CV5 A;  2NZO A;  3DEO A;  2UXC L;  4UP8 A;  1KL9 A;  1N33 L;  1R9T B;  2WB1 G;  1CKN A;  2E2J B;  1XNR L;  1IZ6 A;  2IX1 A;  1SNM A;  5EGT A;  3HOZ H;  4JBK A;  3P75 A;  2D2C C;  4CJ1 B;  2IW3 A;  1IBL Q;  5D65 A;  2A8V A;  1IL2 A;  4ABN A;  5BR8 L;  4I7A A;  1LTA D;  1QG7 A;  2Z6K A;  3LWU A;  4LF5 Q;  1GM5 A;  3S14 B;  1FJG L;  3M7N A;  1PYW D;  1MIU A;  4Y7N H;  5IOC A;  1CA5 A;  4ZUJ A;  4NB3 A;  3PF5 A;  1XMQ Q;  4AIM A;  2IWH A;  5CV8 A;  4A93 B;  3FVQ A;  2KA7 A;  3L0O A;  5GQO A;  1T5E A;  5CYU A;  4GNX B;  2EE1 A;  3TZD A;  4HSV A;  1E3P A;  1JB3 A;  1I4P A;  3RMH A;  5GAG C;  2F4V L;  4CJ0 B;  2QA4 A;  3E6Z X;  2F0K A;  3DXJ C;  3S2D B;  1Y1V G;  5C4X B;  1MGS A;  2OEO A;  5FLM G;  4QUF A;  1IBM Q;  2JA6 B;  2B2W A;  5EAY A;  2NTS A;  2KEC A;  1TS5 A;  5CV7 A;  4DXG A;  2Q8R E;  1IL8 A;  4LF4 L;  4JI3 L;  2JQO A;  2YTY A;  1PVO A;  5CMD A;  3J7A 5;  3CQZ B;  2FMM A;  4IUQ A;  2X6L A;  1OXT A;  4X3U A;  3I4L A;  4TKO B;  3J81 L;  3E0E A;  3TRE A;  2PQA B;  1C7Y A;  3AEV A;  1H9M A;  1EY9 A;  2V1C C;  3BVG A;  2I0Q A;  3GTP H;  1GKH A;  3K59 A;  5M3F B;  5COR A;  4CJ2 C;  2ATW A;  4JG2 A;  4BWG B;  1WI5 A;  5JJZ A;  4PZ8 A;  2A6E C;  3H0G G;  1ILQ A;  2JN4 A;  3IFD A;  2RHQ B;  1AE2 A;  1Q8K A;  1YEZ A;  2IL8 A;  4FYD A;  2SOB A;  3ITP A;  4JI5 L;  4IFD G;  1BXT A;  3NWS A;  3STB C;  4HIM A;  1Y1V H;  4JOI C;  1VQ6 A;  4I7Z C;  1EZ6 A;  1TR5 A;  5C44 G;  4BY1 G;  1QVF A;  1QNK A;  2KHJ A;  2XRS D;  3N52 A;  4C3H H;  1DOK A;  4IUN A;  4R4C A;  1P8L A;  2BDO A;  1J9O A;  1PH6 A;  1SR3 A;  3GTK H;  1XTC D;  1EIG A;  2LMC B;  3CCR A;  3HOV G;  5M5W H;  4Q0F A;  4A3B B;  1GUT A;  3WOF A;  4DR3 L;  1TQO A;  5IYD G;  4YIJ A;  5LHY 1;  3I56 A;  1W6K A;  2LS0 1;  4A3K G;  4HTH A;  4A3I B;  1HPC A;  2PZT A;  1NNX A;  1EY6 A;  3T4A C;  5JJI A;  3T53 B;  3DWA A;  2CQO A;  2NUC A;  3ERQ A;  2PI2 A;  4K2K A;  2EOT A;  4LF7 L;  4PQX A;  3MWY W;  3HEJ A;  4A3M G;  3M4O H;  1PTO H;  4MIU A;  5IGG A;  2JA5 G;  2NVX H;  4IUR A;  4QF4 A;  4HAE A;  4DUZ Q;  1WTX A;  3HOU B;  4DGZ A;  1B3A A;  3HOY B;  1QVG A;  2AUJ D;  3H0G H;  3QOL A;  1TVX A;  1PDQ A;  3GTL B;  4A75 A;  5I6W A;  3VA7 A;  2AQ2 B;  1BOS A;  1NE3 A;  2VL6 A;  3RLF A;  4LFB Q;  4OGQ C;  1LTB D;  3T56 B;  4DNT B;  2ZT9 C;  3IFT A;  4XYQ A;  4XQQ A;  5C44 H;  3G71 A;  1YI2 A;  1TWH B;  4ODG A;  2AKW B;  1A2T A;  1STY A;  2HQL A;  4K14 A;  4XQJ A;  4ZKB B;  1A62 A;  2WP8 J;  2JA8 B;  1KLG D;  4ZRZ A;  4F88 A;  1HTP A;  5IGE A;  4DV4 Q;  1N8R C;  1LTL A;  5ELE A;  2HDL A;  1P16 A;  5IYD H;  3ERS X;  5I6Y A;  1WTV A;  3PUZ A;  4G7O C;  3W2D A;  2EY6 A;  4A3K H;  3C1E A;  4L8J A;  3T16 A;  4FO2 A;  2E2D C;  2R7Z G;  2NBF A;  1A15 A;  1CKN B;  2B2V C;  2Z6K C;  4KD4 A;  1A6X A;  3NQT A;  4A3J G;  4P2C B;  3ND8 A;  2G9H D;  3PQI A;  2IPK D;  3U9O A;  4G7H C;  1PV4 A;  3JAM i;  4QY7 A;  1K83 H;  5IY0 A;  1JMC A;  1EYC A;  1AZQ A;  1N36 L;  4O1N A;  4BY7 G;  4YWL A;  2BE5 C;  5JEA H;  1XPR A;  2IY5 B;  1EQQ A;  4FXG C;  2B2Y C;  5D3I B;  1V1O A;  4K6L A;  1OXS C;  1SRU A;  3J80 c;  3HOZ B;  5I4D A;  2PW7 A;  3O13 A;  4X66 L;  1ENF A;  1S5F D;  3S2H H;  1HZ9 A;  4HN7 A;  1UE1 A;  2N3S A;  1B44 D;  1PFB A;  2B2W C;  4NXN L;  5C0X J;  2JXM B;  1VQ8 A;  2FFK B;  2OQ0 A;  2QGQ A;  1SYD A;  4XTC S;  1UEA B;  2HIX A;  4H02 A;  4NKL A;  2L15 A;  4LF6 Q;  4ZLT F;  4IOA A;  2FHT A;  3NK9 A;  1OXX K;  4X65 L;  5LMN W;  1TWA H;  4X6A H;  1VQF A;  2QDB A;  4DAP A;  5C3E B;  1VQ4 A;  2WAQ E;  1I94 L;  4UAI A;  1G8Z D;  5IYB H;  3TZU A;  2VZA A;  1D1I A;  2PZU A;  1VQG A;  5C5L A;  2QW7 A;  4FDB A;  4DUY Q;  1EQR A;  1STB A;  1KDB A;  3C3L A;  3AMU A;  3TEH B;  4JI1 Q;  1Q82 C;  1EY4 A;  1YJ9 A;  2KED A;  3HRZ C;  1EZ8 A;  1PFM A;  4FF1 A;  1I50 H;  1SAP A;  1QNU A;  1S5E D;  2A6E D;  3KF8 B;  2EYO A;  3X3N A;  1H9J A;  1A8V A;  4DR7 L;  4DV7 Q;  4B3M Q;  4AQY Q;  1CI3 M;  1HUM A;  1I4X A;  2A19 A;  1II3 A;  2WB1 B;  4DV1 L;  1G91 A;  1MBY A;  3BVM A;  2K04 A;  4J6H A;  4M8A A;  3GTM H;  1WOC A;  3CPW A;  2HHH Q;  2F0O A;  4DAY A;  2F0P A;  1YIJ A;  2A69 C;  4QUC A;  3MA2 B;  4FXD A;  2B2U A;  1EU4 A;  2LKV A;  4GKK L;  5M3M H;  4PV1 C;  3RLO A;  4TVA B;  2HCC A;  1JOQ A;  3S1N B;  2D62 A;  3L7Z C;  5DM6 3;  1DON A;  4F7X A;  1G51 A;  3K5N A;  3GTG H;  3PUX A;  3TSS A;  2FIN B;  1HHV A;  1VF7 A;  2VUM H;  1FR3 A;  2RSO A;  4YHH L;  1XPO A;  2ZJQ A;  2K4K A;  1H9K A;  1ZKO A;  4X62 Q;  1KC8 C;  4EQP A;  1MD2 D;  1PH7 A;  4WRD A;  1KXL A;  3A55 A;  3CPF A;  5C5M A;  2A73 B;  1PZJ D;  2E2J H;  2YU9 H;  3OYY A;  1B7Y B;  1JR0 D;  1Y1V B;  5C4J H;  4WFN 3;  3TS2 A;  3SHL A;  4NW2 A;  5GAH C;  1HQM C;  4BBS G;  4LUZ A;  1V1P A;  1LYL A;  1S5C D;  2GA4 B;  3HKZ E;  1Q1B A;  3RD4 A;  4V0B A;  4XYO A;  5GAD C;  1SNQ A;  2JEA I;  3S14 H;  4BA1 I;  1CUK A;  1IBK L;  4HIK A;  1LTR D;  1HNZ Q;  2GN5 A;  1N34 L;  2I07 B;  5M5W B;  2LXJ A;  4DV5 L;  1XMO L;  3CC7 A;  4XDX A;  1BO0 A;  1L2F A;  2MGS A;  2D5D A;  2K1B A;  4OIK A;  1C4Q A;  4UPA A;  5C3W A;  1HNX Q;  2M2L A;  1YJW A;  5LMU L;  3W1G A;  3KJO A;  4ME5 A;  3CCL A;  3QOJ A;  1MKH A;  4JI0 Q;  2F3I A;  1X3Q A;  1PTO C;  1QUQ A;  1HXY D;  2OWO A;  1UUP A;  3S2D H;  1BCP D;  1EYD A;  3TRZ A;  3M4O B;  1AH9 A;  1K8G A;  2NVX B;  2JA6 H;  3S1M B;  5CBA E;  3MFG A;  3EIV A;  3NHH A;  3H0G B;  2EIF A;  2SEB D;  3SK6 A;  3NEL A;  2RDH A;  4O2D A;  3DUZ A;  1Q8I A;  1BF4 A;  2KJX A;  4GNX A;  3I7F A;  4KJN A;  1PRT D;  2F0N A;  3PF4 A;  5KNB A;  2EYP A;  4OXP A;  2Q2U A;  5C44 B;  2E2I B;  5C0X I;  2H1E A;  4L5Q A;  4BY1 B;  3I3C A;  5A2Q L;  1KDA A;  1H95 A;  2NN6 H;  4IUT A;  1SNO A;  1X3P A;  3K80 C;  1PTO F;  4EQ5 A;  2QEJ C;  2K6A A;  4LFC L;  2MPM A;  3HOV B;  1GUN A;  2KEN A;  5M3F H;  4IJH A;  4B3S L;  5EKK A;  4DN4 M;  3RZO H;  1Y1W G;  1CQF A;  3CW2 C;  5K36 G;  2MQH A;  2UUA L;  2JJQ A;  4JPB W;  4A3K B;  4DR5 L;  2XTI A;  2JK8 A;  1S72 A;  5ELD A;  3J80 L;  4N9T A;  5C4H A;  1J5E L;  1NMF A;  4DKA C;  4DNR B;  1STG A;  4JI2 L;  2CVR A;  5HUR A;  2PQA A;  3J81 c;  3E9I A;  4J8Q A;  4A3M B;  1W3S A;  2RA4 A;  1PH8 A;  2JA5 B;  4B3T Q;  1JJ2 A;  4YCV A;  1S3O A;  2F0E A;  1ZXT A;  2GVB A;  5ELF A;  1SNP A;  2YTV A;  2A6H C;  2ZTC A;  5IGB A;  5KND A;  4DR4 L;  1ENA A;  4FF3 A;  3T1Y Q;  1GHJ A;  4IPC A;  1AW7 A;  4KTA A;  1SFO B;  2F0H A;  2N55 A;  3F2B A;  1KRT A;  3T1H L;  3FHW A;  2BA0 A;  2UXD Q;  4A3I H;  5CV6 A;  3GTJ H;  3S2H B;  1FVI A;  3HZX A;  2CQA A;  5BN3 A;  4RKL A;  1ONL A;  3K5L A;  1Z6H A;  4B3R Q;  3A74 A;  5IT9 c;  4DR1 L;  3PV0 A;  2F0S A;  1M4V A;  4KKT A;  5CC4 A;  1UEB A;  2O2L D;  2MHV A;  1EQV A;  1V43 A;  4MNO A;  2ICE C;  2ES2 A;  1Y1W H;  1OO9 B;  4TRD A;  5K36 H;  3CCS A;  3HOU H;  2PI2 E;  1JT8 A;  3CAM A;  1DM0 B;  2EVB A;  1IW7 C;  2K33 A;  5HY6 A;  2L55 A;  2R7Z B;  1N33 Q;  4MN3 A;  1X3F A;  4LWC A;  2DUD A;  1XNR Q;  3RR5 A;  4DK3 C;  1SE3 A;  1TWF H;  2CW0 D;  1SDF A;  2IT1 A;  5KYI A;  1YVC A;  1TWH H;  2KHI A;  1PH4 A;  1YNX A;  4DAY B;  3Q6S A;  3OIP A;  2H5X A;  2ZJP A;  2TMP A;  3PUW A;  2M00 A;  2BA1 A;  3KLS A;  3TP6 A;  1NCV A;  1PYB A;  1Z9F A;  2JA8 H;  4BY7 B;  1LAC A;  4LF9 L;  4FF2 A;  4DR2 Q;  1PMR A;  1Q81 C;  3KLW A;  2Q8I B;  1JQY D;  5EJW A;  4UP7 A; 
#chains in the Genus database with same CATH homology
 4RFB A;  3GV6 A;  3NPP A;  1HCZ A;  3T13 A;  1ZEQ X;  1WTQ A;  4EQO A;  3D4W A;  4G57 A;  4NP5 A;  4C3I G;  3MTS A;  1CTM A;  1S5D D;  1TII D;  1SMY C;  1ENC A;  1V1P B;  2EJG C;  5NUC A;  1GHK A;  1VMP A;  2JSO A;  3QWN A;  2C9O A;  4PNY A;  5ELB A;  1DJR D;  1TY2 A;  3KUP A;  1EYA A;  1O7Y A;  3C2P A;  2YU9 B;  2F0U A;  1YNN C;  2F0V A;  1EY7 A;  1ET6 A;  5C4J B;  1EEF D;  1JCK B;  1KNA A;  1SE4 A;  4DAV A;  3D31 A;  5LL6 S;  5T1G A;  4HMI A;  1JOO A;  4M1U B;  3S9W A;  4IUP A;  3VR2 A;  3TBI B;  2B2T A;  4NMZ A;  5DNF A;  1RTO A;  2NVT B;  3HGB A;  5JEA J;  2A68 D;  1PZI D;  4LMQ D;  3K5M A;  3UI2 A;  4DFA A;  3M4Y A;  3KK7 A;  4C56 C;  3VR6 A;  5COY A;  1Z7T A;  5CBE E;  3NWT A;  2MP1 A;  2EY2 A;  4CKC A;  4BBS B;  1G6Z A;  3M85 A;  2B8G A;  1RF2 D;  1KDC A;  1RHP A;  1H9S B;  3IKJ A;  4WOR A;  3K58 A;  1OXU A;  1I6V C;  3KF8 A;  4PMB A;  1Q3L A;  1O7L A;  3RZO B;  1XYI A;  4QB4 A;  4RAU C;  1TT2 A;  2F3V A;  4L6T B;  5JPN C;  1U4P A;  1SYC A;  2K28 A;  3J7Y W;  1TU2 B;  2F0T A;  3M7G A;  3K0Y A;  2MJ8 A;  2NB0 A;  1BDO A;  1NAP A;  3P7J A;  3ERO A;  5IT9 L;  4DF7 A;  3FMC A;  3G7L A;  4OL7 A;  3X3M A;  3T51 B;  4C1N I;  1YNJ C;  1ROD A;  3QO2 A;  5T1I A;  5IGF A;  2E75 C;  3FEW X;  3H3V C;  3BDO A;  1CZW A;  3P1H A;  3NE5 B;  3GTJ B;  1B2T A;  1QCB D;  4RCO A;  4C3J G;  1RCV D;  2RDG A;  3VYS A;  1CM9 A;  2YYZ A;  2KQ3 A;  1Y1W B;  1LTS D;  2EJM A;  4DK1 A;  4CGY B;  3OOC A;  1SND A;  3A7A B;  2RDF A;  1LO5 D;  1GUG A;  4IFD H;  1SJE D;  3NP8 A;  1EY5 A;  4KHZ A;  4RH6 A;  1TWF B;  3I70 A;  2EY1 A;  1I6H B;  4KY6 A;  2EY5 A;  1B4O A;  3SXH A;  1G2S A;  3EA6 A;  2KCC A;  1MSH A;  1AEX A;  1S4Z A;  4HR7 B;  4XQN A;  2X6G A;  2HCI A;  2G9D A;  3SK4 A;  1KNE A;  3MZ5 A;  1CK1 A;  4K5W A;  3U9S A;  3VR3 A;  3WOE A;  1RJT A;  2H4O A;  3G6J B;  1PZK D;  4FXK C;  2WV6 D;  3TDQ A;  3WDN A;  1KAA A;  4Z9C B;  1E0B A;  1BCP B;  2B2T C;  3Q24 A;  1WTO A;  1HQR D;  1LT3 D;  4K5V A;  1CA6 A;  1LV9 A;  2F0J A;  1ZYR C;  1PRT B;  3C46 A;  2AUK A;  1WTP A;  2DY8 A;  3DWQ A;  5I9O A;  3CU7 A;  4IZ8 A;  3AB9 A;  1HRJ A;  2BOS A;  2E76 C;  1BCP F;  2F3W A;  4V19 0;  1A3T A;  4BBR B;  4B9X A;  5EPJ A;  3NBI A;  4OO1 I;  5JPM C;  4C3I B;  4EQN A;  1I4R A;  2VNU D;  1PRT F;  5E3F A;  2Y0S B;  2CHB D;  2XWJ B;  4KY7 A;  5EBC A;  1EWH A;  2A5H A;  4ILW A;  2EYL A;  1FNW A;  1RDP D;  1SJH D;  2AQ3 B;  4X3T A;  3VYT A;  4K5X A;  3GV3 A;  5DAU A;  5ISR A;  1EWC A;  1LLR D;  5CV9 A;  4IQZ A;  4H7B A;  3H94 A;  1T5X D;  2PMZ B;  1ESF A;  5I9P A;  1F9S A;  4HCE A;  1F9Q A;  2EXZ A;  4ZAI A;  4N9P A;  5FLX L;  2K5Q A;  1PFN A;  1EIH A;  4RGT A;  3A7L A;  3D6W A;  3RUZ A;  5EQ0 A;  4RKB A;  2NWG A;  3V96 A;  4KK7 A;  2BCO A;  3S15 B;  3TN2 A;  2N88 A;  1NR2 A;  4ULL A;  1STE A;  3BS1 A;  1QJO A;  1Q90 A;  4HED A;  5IGC A;  2EYF A;  4XIG S;  1CFM A;  1F2Y A;  1I3Q B;  1L0Y B;  1E2V A;  2L5T A;  3A56 A;  2E74 C;  2PQE A;  5FKA C;  2WIN B;  3OSO A;  2MUY A;  3FKI B;  1GOZ A;  2AWN A;  3KLS X;  1RKN A;  4F8M A;  2NYZ D;  2ENB A;  2PPB C;  1CZG A;  4LJZ C;  3VYU A;  2NTT A;  1LTT D;  2JEB I;  2EZV A;  1HFG A;  5KEE A;  3PO2 B;  1ET9 A;  1JWS D;  1STA A;  1OXV A;  1IHZ A;  3EQL C;  2L1B A;  3OPO A;  3QG1 A;  1QE6 A;  3A54 A;  4C2M B;  4QMG A;  4R9W A;  5C0X G;  1AFP A;  3R3O A;  3NTK A;  2V4D A;  1PXU A;  3E5S A;  2NN6 I;  4U68 A;  2XVS A;  3CKI B;  1U4M A;  5JVG 3;  3IL8 A;  1WD0 A;  3SE0 A;  3HS0 C;  4PMW A;  5CR3 A;  1B1Z A;  1VF5 C;  1KTK A;  2BE5 D;  4EVO A;  4G4K A;  5KYL A;  3I73 A;  4X3S A;  2JYO A;  3RZD B;  1G29 1;  3HG9 A;  3A8I E;  1TWC B;  2K03 A;  4AYB B;  1UNS A;  3KLR A;  5AFW A;  5JAV A;  1JOK A;  2WII B;  4C3J B;  1H9S A;  1SSO A;  1ESR A;  3URY A;  2IX0 A;  3K7A B;  2FJ2 A;  2ZXP A;  3OHX C;  5C0X H;  1FNV A;  2X69 A;  4RHS A;  3MXU A;  1D5X C;  1GJX A;  1XXG A;  1SBB B;  5I2Y A;  4PMC A;  1JC7 A;  5A35 A;  3E0J A;  4UDU C;  3HOW B;  3CHB D;  5KRU A;  5FO9 B;  1F2Z A;  2PZW A;  2F0Q A;  4FNF A;  3J7A F;  2F03 A;  2F0D A;  3SVM A;  1J8I A;  3JAM L;  2ZXR A;  1VCI A;  3R8B A;  4RCN A;  2EYJ A;  3BYT B;  2IX3 A;  1EFI D;  5C6A A;  2QIL A;  3OWF A;  2K5D A;  5KGU A;  5G3L D;  3HP3 A;  1H9R A;  3BYY B;  1RD9 D;  1O7Z A;  2A69 D;  4E6I A;  4A3J B;  5TSS A;  2B2U C;  3F2U A;  3MAQ A;  5EPL A;  3TP5 A;  2F0G A;  3Q23 A;  5IIF A;  1DD2 A;  3PMF A;  3LX0 A;  1NSN S;  2VB3 X;  3K6O A;  3OW7 A;  1C48 A;  1UAP A;  1EQT A;  1IYU A;  3GO5 A;  3H6M A;  3GTO B;  4ZYS A;  4WJW A;  4X3K A;  1F2L A;  3J80 E;  3I90 A;  4KMU C;  1Y8O B;  4QCL A;  4QIW B;  4H44 C;  4A3E B;  2I46 A;  4I65 A;  2O5J C;  1CT1 D;  4F87 A;  3SK8 A;  4IFD J;  4RWS C;  2WAC A;  5I2X A;  1VMC A;  2PNR C;  1PTO D;  2XRQ D;  3C1F A;  3OMG A;  3KBG A;  5CGK A;  4JBW A;  3PUV A;  2KEE A;  1BR9 A;  4EGV A;  1BNZ A;  1HA5 A;  2F0W A;  4FP5 D;  1HA6 A;  2DNE A;  3J7A V;  5DEH A;  1AN8 A;  3OMC A;  2K5W A;  2ID0 A;  2L11 A;  2ZXO A;  2C5C A;  1EY0 A;  3BZD B;  1JWM D;  3MVV A;  1DOM A;  2B2V A;  1FNU A;  4XXE A;  5E4W C;  1U9R A;  1IKL A;  4BA2 I;  3M3Y B;  4CHT B;  5FO8 B;  4IUV A;  5M5X B;  3TME A;  4NDX A;  4G7Z C;  2RSN A;  2NVQ B;  2B2Y A;  3KBX A;  3I4M B;  3BVZ A;  4RGO S;  3DMU A;  4H13 C;  1FYC A;  5EKL A;  1Q1E A;  3K57 A;  1GUS A;  2PYK A;  4C3H G;  3MXP A;  3PIP 3;  2A6H D;  1G2T A;  4RHR A;  2Z4I A;  5CV4 A;  3NUC A;  1D2B A;  2SNS A;  1EL0 A;  3A8J E;  1D1K A;  2WKD A;  1B9M A;  2HUG A;  1TKW B;  1WCM B;  3NXW A;  2JA7 B;  1CQV A;  2RKS A;  5IOD A;  2R93 B;  4R8N A;  1EEI D;  2BDN A;  2L0C A;  3NTI A;  2F0M A;  1CHP D;  4ZK9 B;  1ML0 D;  1F2M A;  4DK0 A;  1TS3 A;  2SNM A;  1IYV A;  2J7Z A;  1IW7 D;  1Y8P B;  3W3A A;  1MSG A;  5BN4 A;  1KAB A;  3QJY A;  2A74 C;  4XT1 B;  1Y69 U;  2F0F A;  4KHV A;  1LT5 D;  1QIL A;  5M5Y B;  5E4X A;  4Q5V A;  3V05 A;  3P20 A;  3OIQ A;  3MC0 B;  3OWE B;  1JE4 A;  3D4D A;  2DN8 A;  2WAQ B;  5JVH 3;  2QKI C;  4IFD I;  3I4N B;  2EYH A;  3S16 B;  3GD7 A;  3SK5 A;  1LTI D;  5C4Z A;  5D3D A;  2B8F A;  2K01 A;  1B9N A;  4CBV A;  4HSP A;  2HQE A;  2RVL A;  5C3X A;  3PO3 B;  1I4G A;  1I4H A;  1SMY D;  2F1M A;  3J81 E;  1SE2 A;  4MHE A;  3IAY A;  3R2T A;  3TP8 A;  5KIX A;  3HOX B;  1O80 A;  3S1R B;  3FRP B;  5K5P A;  1SYB A;  2XSC A;  5JEA G;  2OF1 A;  4A3G B;  1D6E C;  1D5Z C;  1JOR A;  1L0X B;  3DHQ A;  1A3V A;  1YNN D;  3FPU B;  3Q22 A;  3CRK C;  2JP1 A;  1K8M A;  4DXF A;  4A3D B;  1I4Q A;  3VR4 A;  2E2H B;  5ELC A;  4ZKC B;  1F77 A;  1Z47 A;  5IT9 E;  4ZUI A;  1O78 A;  1BCP C;  1C8C A;  1AP0 A;  3EFX D;  1SYG A;  3MFY A;  1GUW A;  1ILP A;  3CRL C;  2K32 A;  2XWB B;  1JWU D;  4ZQ3 A;  3VA5 A;  3V2T A;  3ONA B;  4LK1 C;  3HKZ B;  2O4X A;  1U4L A;  3D6C A;  1A3U A;  1PRT C;  1FGB D;  2XN9 C;  5J22 A;  4J1M A;  2K05 A;  2F0L A;  4KKU A;  1IKM A;  1NUC A;  1TWG B;  2VXW A;  2QCP X;  4OO1 G;  2B63 B;  4KKS A;  2L12 A;  5EKI A;  4O42 A;  1M8A A;  5E1F A;  1WTW A;  4LAA A;  1SNC A;  2R92 B;  4CKB A;  4Y7N B;  1R4Q B;  2K7V A;  3H91 A;  4FF4 A;  1BQQ T;  4B9W A;  5EBD A;  4K8J A;  1DCZ A;  3DWP A;  1TY0 A;  1W6J A;  2D9U A;  1SEB D;  5M9O A;  5HGT A;  4B08 A;  2AWO A;  2HDM A;  2NZ1 D;  1EY8 A;  2L4N A;  5F2D A;  4K8I A;  5IGD A;  4KN7 C;  3I8Z A;  4A3F B;  4KN4 C;  4K6D A;  4OO1 H;  5FO7 B;  3EVQ A;  1YNJ D;  1BBX C;  2AQ1 B;  3ZYY X;  3DM1 A;  3D8G A;  4L63 B;  1S5B D;  1QB5 D;  4C1N K;  5J39 A;  1HTL D;  3GQB A;  3L3O C;  5FK9 C;  3S17 B;  2KUM A;  2CW0 C;  4CKE A;  3GTP B;  4H0L C;  1QWY A;  2L9H A;  2FMC A;  3NQI A;  3SDZ A;  4R8I A;  3QB3 A;  2J4X A;  4RGN A;  1LT6 D;  1EOT A;  1JIC A;  1ICW A;  3D3R A;  3SEB A;  5G3L F;  1STN A;  4C3H B;  1VDZ A;  4KJO A;  2NN6 G;  1B53 A;  3GTK B;  2KHS A;  2R3Z A;  4ID6 A;  1WTR A;  2EDG A;  1E2W A;  1QOH A;  2XIW A;  4OIJ A;  1Q12 A;  2DY7 A;  2ICI A;  4BS9 A;  2OXP A;  2SDF A;  3FDT A;  2TSS A;  1LT4 D;  2XNA C;  1AZP A;  2LY7 A;  1SXT A;  5FLX E;  1PTO B;  1TS2 A;  2PCF B;  2B39 A;  5D14 A;  1WVL A;  2F4I A;  3I72 A;  3K5O A;  3D4R A;  2WKC A;  2RBM A;  5DM7 3;  3EJI A;  3H09 A;  5EPK A;  1R4P B;  3DEP A;  1WD1 A;  2KOL A;  1SYE A;  2KVM A;  1D5M C;  1FD7 D;  1ZYR D;  2KCN A;  1BUV T;  3S1Q B;  3ND9 A;  2PW5 A;  1GXD C;  2QF7 A;  4HMJ A;  2A68 C;  1E2Z A;  4KV6 A;  2NVY B;  3A8K E;  5J1Z A;  3N6R A;  2Z8L A;  1LAB A;  3FPP A;  4JK1 C;  2JE6 I;  5KNC A;  1PLF A;  3VYR A;  4KI0 A;  1DXM A;  2DNC A;  5LL6 X;  4IUU A;  4KY5 A;  1U4R A;  1STH A;  4KD3 A;  2O5I C;  1K83 B;  3GTQ B;  1KLU D;  1F9R A;  3MXG A;  1A2U A;  2EPB A;  1K8O A;  1EU3 A;  1X32 A;  3BG3 A;  2VB2 X;  2EYM A;  3NBH A;  2J0T D;  3TP7 A;  4FVM A;  4DA2 A;  4IAL A;  2F0I A;  1MI2 A;  1V8Q A;  4RGM A;  3I91 A;  3BDC A;  3BDL A;  5A2Q E;  2M9V A;  4RA8 A;  4K2L A;  1DOL A;  1TWA B;  1HUN A;  1CHQ D;  1LTG D;  2EJF C;  2Z1C A;  3PUY A;  2Z4H A;  3NTH A;  1TS4 A;  3PIO 3;  3GP7 A;  1HFN A;  3R2I A;  1XX8 A;  3R93 A;  3LWE A;  1DYQ A;  4S3S A;  5FOB B;  1I50 B;  2Q8T A;  3NSW A;  4XT3 B;  1SYF A;  3L9A X;  3SR1 A;  3QIA A;  1F9P A;  2R61 A;  1GUO A;  1NR4 A;  3MXN A;  4GZY C;  4OHJ A;  2PO4 A;  4DU9 A;  3MHB A;  4TSS A;  5JOB A;  2R6G A;  5BN5 A;  3GTM B;  3LNN A;  4IN3 A;  1B50 A;  5M3M B;  3Q0A A;  2OT2 A;  1DZ1 A;  3GTG B;  3JAM E;  1Y8N B;  2RQX A;  4HCS A;  2LFN A;  2VUM B;  3MEH A;  1XWE A;  4U67 3;  1RTN A;  3AU7 A;  4TQU S;  3VR5 A;  2IJ0 A;  5CV5 A;  3DEO A;  1R9T B;  2E2J B;  2IX1 A;  1SNM A;  5EGT A;  3P75 A;  2D2C C;  4CJ1 B;  2IW3 A;  5D65 A;  4ABN A;  1LTA D;  1QG7 A;  3LWU A;  3S14 B;  3M7N A;  1PYW D;  5IOC A;  1CA5 A;  4ZUJ A;  2IWH A;  5CV8 A;  4A93 B;  3FVQ A;  2KA7 A;  1T5E A;  5CYU A;  2EE1 A;  3TZD A;  4HSV A;  1JB3 A;  1I4P A;  3RMH A;  4CJ0 B;  3E6Z X;  2F0K A;  3DXJ C;  3S2D B;  5C4X B;  1MGS A;  2OEO A;  4QUF A;  2JA6 B;  2B2W A;  2NTS A;  2KEC A;  1TS5 A;  5CV7 A;  4DXG A;  2Q8R E;  1IL8 A;  5CMD A;  3CQZ B;  2FMM A;  4IUQ A;  2X6L A;  1OXT A;  4X3U A;  3I4L A;  4TKO B;  3J81 L;  1H9M A;  1EY9 A;  3BVG A;  3K59 A;  5M3F B;  5COR A;  4CJ2 C;  4BWG B;  5JJZ A;  2A6E C;  1ILQ A;  3IFD A;  2IL8 A;  4FYD A;  2SOB A;  3ITP A;  4IFD G;  1BXT A;  3NWS A;  4I7Z C;  1EZ6 A;  1TR5 A;  1QNK A;  2XRS D;  3N52 A;  1DOK A;  4IUN A;  2BDO A;  1J9O A;  1XTC D;  1EIG A;  2LMC B;  4Q0F A;  4A3B B;  1GUT A;  3WOF A;  1TQO A;  4YIJ A;  5LHY 1;  1W6K A;  2LS0 1;  4HTH A;  4A3I B;  1HPC A;  2PZT A;  3T4A C;  1EY6 A;  3T53 B;  3DWA A;  3ERQ A;  2NUC A;  4K2K A;  2EOT A;  4PQX A;  3MWY W;  3HEJ A;  1PTO H;  4MIU A;  5IGG A;  4IUR A;  4QF4 A;  4HAE A;  1WTX A;  3HOU B;  4DGZ A;  1B3A A;  3HOY B;  2AUJ D;  3QOL A;  1TVX A;  1PDQ A;  3GTL B;  5I6W A;  3VA7 A;  2AQ2 B;  1BOS A;  3RLF A;  4OGQ C;  1LTB D;  3T56 B;  4DNT B;  2ZT9 C;  3IFT A;  4XYQ A;  4XQQ A;  1TWH B;  4ODG A;  1A2T A;  1STY A;  4K14 A;  4XQJ A;  4ZKB B;  2WP8 J;  2JA8 B;  1KLG D;  4ZRZ A;  4F88 A;  1HTP A;  5IGE A;  5ELE A;  2HDL A;  5I6Y A;  1WTV A;  3PUZ A;  4G7O C;  3W2D A;  2EY6 A;  3C1E A;  4L8J A;  3T16 A;  4FO2 A;  2E2D C;  2NBF A;  1A15 A;  2B2V C;  4KD4 A;  1A6X A;  3NQT A;  4P2C B;  3ND8 A;  2G9H D;  2IPK D;  3U9O A;  4G7H C;  1EYC A;  1AZQ A;  4O1N A;  2BE5 C;  5JEA H;  4FXG C;  2B2Y C;  5D3I B;  1V1O A;  4K6L A;  1OXS C;  3HOZ B;  5I4D A;  2PW7 A;  3O13 A;  1ENF A;  1S5F D;  4HN7 A;  1B44 D;  1PFB A;  2B2W C;  5C0X J;  2JXM B;  2FFK B;  1SYD A;  4XTC S;  1UEA B;  4NKL A;  4ZLT F;  2FHT A;  3NK9 A;  1OXX K;  2QDB A;  4DAP A;  5C3E B;  4UAI A;  1G8Z D;  3TZU A;  1D1I A;  2PZU A;  5C5L A;  1STB A;  1KDB A;  3C3L A;  3AMU A;  1EY4 A;  2KED A;  3HRZ C;  1EZ8 A;  1PFM A;  4FF1 A;  1SAP A;  1QNU A;  1S5E D;  2A6E D;  2EYO A;  3X3N A;  1H9J A;  1CI3 M;  1HUM A;  1I4X A;  1II3 A;  2WB1 B;  1G91 A;  1MBY A;  3BVM A;  2K04 A;  4J6H A;  4M8A A;  2F0O A;  4DAY A;  2F0P A;  2A69 C;  4QUC A;  3MA2 B;  4FXD A;  2B2U A;  1EU4 A;  2LKV A;  4PV1 C;  2HCC A;  1JOQ A;  3S1N B;  2D62 A;  3L7Z C;  5DM6 3;  1DON A;  4F7X A;  3K5N A;  3PUX A;  3TSS A;  2FIN B;  1HHV A;  1VF7 A;  1FR3 A;  2RSO A;  1H9K A;  1ZKO A;  4EQP A;  1MD2 D;  4WRD A;  3A55 A;  5C5M A;  2A73 B;  1PZJ D;  1JR0 D;  1Y1V B;  4WFN 3;  3SHL A;  4NW2 A;  1HQM C;  1V1P A;  1S5C D;  2GA4 B;  1Q1B A;  3RD4 A;  4V0B A;  4XYO A;  1SNQ A;  2JEA I;  4BA1 I;  1LTR D;  2I07 B;  5M5W B;  4XDX A;  1BO0 A;  2MGS A;  2D5D A;  2K1B A;  4OIK A;  1C4Q A;  5C3W A;  2M2L A;  4ME5 A;  3QOJ A;  1X3Q A;  1PTO C;  1HXY D;  1UUP A;  1BCP D;  1EYD A;  3M4O B;  2NVX B;  3S1M B;  5CBA E;  3MFG A;  3NHH A;  3H0G B;  2SEB D;  3SK6 A;  2RDH A;  3DUZ A;  1Q8I A;  1BF4 A;  2KJX A;  4KJN A;  1PRT D;  2F0N A;  5KNB A;  2EYP A;  5C44 B;  2E2I B;  5C0X I;  2H1E A;  4BY1 B;  3I3C A;  5A2Q L;  1KDA A;  2NN6 H;  4IUT A;  1SNO A;  1X3P A;  1PTO F;  2QEJ C;  2K6A A;  2MPM A;  3HOV B;  1GUN A;  5EKK A;  4DN4 M;  1CQF A;  5K36 G;  4A3K B;  5ELD A;  3J80 L;  4N9T A;  5C4H A;  4DNR B;  1STG A;  2CVR A;  5HUR A;  4J8Q A;  4A3M B;  2RA4 A;  2JA5 B;  2F0E A;  1ZXT A;  5ELF A;  1SNP A;  2A6H C;  5IGB A;  5KND A;  1ENA A;  4FF3 A;  1GHJ A;  1AW7 A;  4KTA A;  1SFO B;  2F0H A;  2N55 A;  2BA0 A;  5CV6 A;  3S2H B;  3HZX A;  2CQA A;  5BN3 A;  4RKL A;  1ONL A;  3K5L A;  1Z6H A;  3PV0 A;  2F0S A;  1M4V A;  4KKT A;  5CC4 A;  2O2L D;  2MHV A;  1EQV A;  1V43 A;  2ICE C;  1OO9 B;  4TRD A;  5K36 H;  1DM0 B;  2EVB A;  1IW7 C;  2K33 A;  2L55 A;  2R7Z B;  4MN3 A;  1SE3 A;  2CW0 D;  1SDF A;  2IT1 A;  5KYI A;  3Q6S A;  3OIP A;  2TMP A;  3PUW A;  2M00 A;  2BA1 A;  3KLS A;  3TP6 A;  1NCV A;  4BY7 B;  1LAC A;  4FF2 A;  1PMR A;  2Q8I B;  1JQY D;  5EJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...