5C7HA

Crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 in complex with nadph
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
281
structure length
281
Chain Sequence
MHDPIPTIAFPDGRKVPALGQGTWRMGENRAKTADEVRSLQTGLDLGMTLIDTAEMYGDGAAERIVGEAIKGRRDEAFVVSKVLPSNASRAGTVAACERSLRNLGIDCVDLYLLHWRGGYPLAETVAAFEELKKAGKIRAWGVSNFDVDDMEELSAVPDGGNVAANQVLYNLARRGIEFDLLPRCRAQGVPVMAYSPLDEGRLLHDADLIHIAKAHQATPAQVALAFLKTCSGVISIPKTGSPERARENRDAMDIHLTTENLAELDRHFPPPRRKTRLEVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aldo-keto reductase from Sinorhizobium meliloti 1021 in complex with NADPH
rcsb
source organism Rhizobium meliloti (strain 1021)
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase
total genus 107
structure length 281
sequence length 281
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 5c7hA00
3CV7A 1AZ1A 2ACSA 4WDXA 2AGTA 1US0A 2HDJA 2IPJA 3VXGA 1OG6A 4FZIA 4DBUA 1EKOA 3M0IA 4IGSA 2C91A 2VDGA 2IPWA 1PZ1A 1MI3A 4XVEA 4I5XA 4YU1A 3LENA 3MC5A 4ASTA 3O3RA 4H8NA 2ALRA 1Q5MA 4YVPA 1Z9AA 3H4GA 3COTA 3G1RA 2ACUA 1UR3M 1AZ2A 3LEPA 2PDPA 2DUXA 3EAUA 5HA7A 1MRQA 5DANA 3RX2A 1GVEA 2FZ8A 2PDKA 4XK2A 1EL3A 1IEIA 4JIIX 4FALA 4LAUA 3BUVA 3GUGA 2F38A 2HV5A 5C7HA 2PDJA 1JEZA 4WDWA 4GA8A 1PYFA 4WRHA 4QR6A 3CMFA 3R8GA 2INZA 2PDQA 3Q67A 2PDMA 1HW6A 3B3DA 1FRBA 4GQ0A 1AFSA 5LIKX 4JQ4A 4XZNX 5LIYX 3UZWA 4FAMA 2IQ0A 1S2CA 4ZFCA 4PUWA 3UP8A 3R7MA 3Q65A 2PDBA 4EXAA 3CASA 2PDYA 2PD5A 4XO6A 2HVOA 4EXBA 3LZ3A 3D3FA 4DBSA 4NKCA 1Q13A 4YVVA 4IJRA 5LIUX 4GIEA 1ZSXA 3NTYA 4MHBA 2R9RA 3O0KA 3C3UA 4L1XA 2NVCA 3DN5A 4JIRA 4G5DA 2PDNA 1Z8AA 4WDUA 3P2VA 4JTRA 2HEJA 2WZTA 3UG8A 3UZYA 4XZMX 3CAQA 4FA3A 2IS7A 4WEVX 2ISFA 5JH1A 1RALA 3N2TA 2BP1A 3LUTA 2PF8A 1YE6A 3R6IA 3R43A 1AH0A 2PDHA 2FVLA 1PZ0A 1IHIA 3UFYA 3GHRA 2PD9A 3R58A 4LAZA 2BGSA 3V0TA 1XF0A 1QRQA 1ZQ5A 4JQ2A 1QWKA 4GACA 4PR4A 1YNQA 2HE8A 2IPFA 5HNUA 2IKGA 4RPQA 1MZRA 3R8HA 3F7JA 2IKHA 3WCZA 1J96A 5AZ0A 3LQLA 4IJCA 3UWEA 2PDWA 2P5NA 2ACQA 4JQ3A 1VP5A 3U2CA 4GCAA 4GABA 3UZZA 2ACRA 2I17A 3R94A 3N6QA 4Q3MA 1X97A 3GHUA 1HQTA 4LB4A 4XAPA 1RY0A 1Z3NA 3V0UA 4XZHA 2DV0A 4AUBA 1S2AA 2DUZA 2HE5A 1SM9A 2NVDA 2PDIA 4PRTA 4HMNA 3V36A 3V35A 2PDCA 2PDUA 4PRRA 3DOPA 3ERPA 3V0SA 2IKIA 2PEVA 3KRBA 2INEA 3LD5A 3FJNA 1A80A 4PMJA 5LIWX 4JIHA 2HVNA 4Q7BA 2PZNA 2PDGA 1S1RA 1X96A 2A79A 5M2FX 3RX4A 4WGHA 1M9HA 2R24A 5JH2A 1R38A 2IKJA 2PDXA 4JTAA 2F2KA 3GHSA 4QX4A 2IQDA 4YS1A 3RX3A 4JQ1A 2CLPA 3WBXA 4QXIA 4XZLX 3BV7A 4JTQA 4XZIA 1T41A 3WBYA 3UYIA 2PFHA 2FGBA 2FZDA 2BGQA 1YNPA 3ONBA 1AH3A 2I16A 1S1PA 2PDLA 1EXBA 3CV6A 2QXWA 3BURA 3WBWA 4LB3A 2PDFA 1LWIA 1RY8A 4L1WA 1ADSA 3QKZA 4ICCX 1AH4A 2J8TA 3WG6A 4LBRA 4HBKA 3GHTA 1PWLA 4H7CA 4DZ5A 4GQGA 3EB3A 4WDTA 3S3GA 1PWMA 1ZUAX 3LZ5A 4JQAA 1X98A 3H7RA 1XGDA 3T42A 4PUUA 2WZMA 5AZ1A 3MB9A 3M64A 3BCJA 1LQAA 4F40A 4QBXA 3UGRA 2FZBA 1C9WA 4LBSA 1YE4A 3LBOA 4XVDA 1T40A 2FZ9A 3H7UA 4OTKA 4JTDA 5KETA 1VBJA 1EF3A 2IPGA 3ONCA 3LN3A 3UZXA 3M4HA 3CAVA 4XO7A 3FX4A 4JTCA 1XJBA 1ZGDA 5LIXX 1Z89A 3EB4A 3LNMA 4R9OA 4DBWA 3LQGA 3G5EA 4YVXA 5HNTA 1K8CA
chains in the Genus database with same CATH superfamily
2ZUTA 4JXCA 1LWJA 2IUZA 3H70A 4A3YA 1AODA 2XGZA 3BTNA 4WKHA 3LOTA 3GYCA 3UT0A 1LT7A 2X7VA 3GO2A 1QI2A 3R1ZA 1ZP3A 2XFFA 3IGHX 4IMCA 5IOBA 3WEMA 3OOQA 3EDEA 1JCJA 3LENA 1U83A 1E4IA 1UWUA 1XH1A 3O3RA 5FL1A 1Q7QA 2OXNA 3W1MA 2P1FA 3QR1A 6CGTA 1R9XA 2EXOA 4Y6GA 4Y9OA 3VCCA 3QC0A 4H8HA 1C92A 4QDWA 5J8LA 1Q7MA 3VNIA 2DUXA 1K7FA 3ZJ6A 2ALDA 2VZSA 4D71A 1J5TA 1RJPA 5EU9A 2VR5A 1FWRA 4LV4A 1OYBA 1KC7A 4IM4A 1P4CA 2QYGA 2SFPA 3B0XA 3R89A 1TWDA 2NWSA 2DVXA 2J27A 3S1UA 3QF0A 2A21A 5BXPA 5FF4A 2PC8A 3NXFA 1BAGA 4L65A 1DJYA 3VA8A 1KNWA 5BRBA 2V82A 2KAUC 3LTSA 4YPJA 4C6KA 4K68A 5LSMA 1HL2A 1FWBC 4PE8A 1GQLA 4LFYA 1XC6A 4S1FA 2RFGA 4Q8TA 1Z48A 1M68A 1HW6A 2Z27A 4TQTA 2BTMA 5JBDA 4NL1A 2GQ8A 3R7MA 1MFUA 3TYBA 3PJUA 3P14A 2PAJA 1Q13A 4YVVA 1CXEA 5LHFA 4R7JA 5CPSA 4NJIA 1JG9A 1SGJA 4MHBA 3RR1A 5E9XA 3K46A 4RR4A 5FEZA 4LSBA 1W1VA 4JFVA 4P7OA 4ZVJA 3HPSA 1REQB 3N4AA 4JN6A 1PYMA 3ABZA 5DXYA 4HMDA 4R7WA 3NQ8A 1TV2A 4HQVA 2DIEA 2HEJA 2NQ9A 3VKDA 1MDRA 4EWND 1QTWA 2YL8A 4X2RA 4DNHA 2VXNA 3PZVA 4L9XA 4RDWA 3BJSA 4ZCWA 1OFRA 4K8EA 4MNKA 4DF0A 1UWSA 2VRQA 1X38A 4GWEA 4BA0A 2H8XA 1VR6A 3UVAA 4KEVA 3NIYA 3IUHA 1ZAIA 3SUUA 3AMLA 1QVBA 3BLDA 1XD1A 4E5TA 5EB8A 3I6RA 1WX0A 3PTMA 1J0YA 5J04A 4C6IA 3HMJG 5HUPA 2R1NA 3WDQA 2X40A 3VDCA 2PS2A 4UFJA 3QOKA 3UWEA 4FIRA 3ITTA 4HKPA 1HZYA 3T05A 1QBAA 3NXLA 3TCSA 2UV8G 2Q8LA 4O10A 4GZ7A 6XIMA 3DHUA 1X39A 3O0FA 1J0IA 1KKOA 1JDEA 4JEQA 1TO3A 2C7FA 1KCXA 2A2IA 2FMOA 1KR0A 1VPXA 4I9MA 1ZENA 1YTEA 2DUZA 2BNJA 3NM1A 4WD0A 3B0UX 1B3XA 2PDIA 3NO3A 4WKFA 4DBDA 4CD4A 1E6QM 7A3HA 4QG6A 1XIHA 1DE5A 3ELFA 1WOAA 2I9EA 2INEA 2Y2WA 4GXMA 4K3ZA 4GUHA 3PBUA 4ZOCA 1XKYA 3STEA 3SGZA 2OZ8A 4C60A 4M7SA 4W87A 3M0JA 1KQZA 4WGHA 1XIGA 1OFOA 3B4YA 3WK3A 2HTMA 1XL9A 1WKYA 4QG8A 1VRXA 1EHNA 1M53A 8CGTA 5EMUA 1FBAA 3SCSA 1EJSC 4IIGA 1KM4A 3LK6A 3BV7A 4LRTA 1UD5A 3MHGA 3RCYA 2YDRA 3UZ5A 1C90A 3VNLA 1LCOA 1LQ0A 3JU2A 1XCWA 2I16A 2PU1A 3W53A 2YBTA 3C6CA 1LWIA 3ES8A 1XS2A 1UHVA 4LBRA 2DT1A 3P74A 4N4PA 1FWFC 4JTEA 2CERA 4E2BA 1PB0A 3IGSA 3T8QA 2NSXA 5KMYA 3C2FA 5A6TC 4S2BA 4ZSUA 1I2PA 5HULA 5XIAA 1NDZA 4ZODA 3MZNA 1MW2A 5CPTA 3LM7A 1HKMA 2FZBA 5AFDA 3WDIA 3AIQA 1WNOA 4FLSA 4OTKA 1IEWA 4NU7A 5KZ6A 2A3CA 5D8ZA 3DKJA 1CXKA 3HJZA 3IUDA 1XJBA 2WNZA 2LLEA 1S3TC 2YIHA 1E55A 4LVAA 4DUXA 5A69A 1WOBA 2ZKMX 4H19A 3FDKA 3QLDA 1EJVC 1RA5A 1V6UA 2D69A 2D23A 4MKVA 6ALDA 2R91A 1ICSA 3SGGA 2YPIA 5JXQA 2DZVA 1LL7A 3TKFA 2PRLA 4BQ4A 3JVAA 4KGLA 4PBEA 1PIFA 3KCLA 2UWFA 1H7OA 2BZNA 3URAA 2XFWA 4HN4A 3GC5A 5I00A 1FHUA 3E0FA 4AISA 4W9TA 1Q3NA 5GNYA 3ARRA 1E6RA 1ME9A 1UUOA 4E6MA 1RLCL 1UP3A 1BXBA 1M65A 1GJPA 5HWJA 5AVHA 3TN5A 3EAUA 3PB0A 1T0OA 1Q8AA 3QMSA 1EDGA 2Z6IA 2Y24A 3V5OA 2O9OA 2DEPA 3REQA 1OCJA 4W5UA 1PKYA 5F4WA 1R86A 4PH6A 2A7PA 2XIOA 4FALA 4BEUA 3WUEA 5BROA 3GUGA 2Y7FA 1OY0A 4ICNA 1FH8A 4DEFA 4IICA 5FJUA 3EXSA 3VM7A 3QC3A 3V75A 3LLXA 4WRHA 1X1NA 4UQBA 4AIBA 2PODA 4IXXA 3MANA 1UR0A 4A8RA 3AC0A 3M0KA 3BG9A 4E0CA 3FKRA 2D22A 2YFNA 3UBPC 5E5CA 1UROA 4H3DA 3W4RA 3BAIA 4E8DA 4UR9A 1E72M 8XIMA 3FA4A 1TWSA 3U2OA 2DVUA 1R87A 2IQTA 3EB2A 4N02A 4KW2A 1QATA 2C1IA 4PUKA 1F6YA 1IR1A 4DUVA 3UD6A 2CKSA 3NO1A 2D3LA 5HANA 3IJLA 4IQJA 3K2GA 5AC6A 1GG1A 3RHGA 2ZVRA 4GUJA 1H5VA 2HZGA 3UXLA 3W1LA 2QMJA 2H6RA 4HU0A 1NJJA 1O60A 1SFTA 4BF7A 4LY4A 1VFMA 3TCEA 1UJPA 3TWBA 1OABA 2AMGA 2VUYA 2UY5A 4Z1BA 5C9UA 3PSWA 5D05A 2Z2BA 3I65A 2ZYFA 4J4KA 3WH6A 3GDRA 4URIA 1I2OA 5F2IA 3C2OA 1W1IE 1FWWA 1IWPA 3W00A 1FTXA 5CC6A 3DU0A 5F7UA 1OIMA 3N11A 2QF8A 4LAZA 2CNCA 3THQA 2O56A 3F5KA 1KBLA 1CGXA 4I9AA 1NP0A 4FR1A 4KCUA 2QCFA 5HNRA 1W9DM 4S3EA 3QZ6A 3L2IA 2I57A 4X0NA 1B30A 1HVXA 1NELA 4N9DA 5U4NA 3E49A 2DZTA 3UR7A 3NQDA 4PC8A 1R9YA 3IJ9A 4NRSA 1PX3A 1M01A 3E3HA 1XLBA 3A4WA 5LYRA 2X1IA 2VEFA 3O2LA 3VIOA 3FKKA 5HQEA 3NYDA 3E1F1 1J4EA 3W7KA 2YOCA 4L7ZA 4NX5A 4O57A 3KL5A 4O14A 4PZVA 4M81A 5KZMA 4LB4A 2QV5A 4H8VA 4AXKA 1PTGA 2D0FA 4PCSA 1KFJA 1RP8A 4B3KA 3ZT5A 4JHZA 2FPTA 4E8CA 1GVQA 2FHCA 1F5ZA 4JICA 1IZCA 1MWOA 1M3UA 5H1WA 1SM9A 3WQPA 3KHJA 4AYGA 3TSBA 2QGYA 1XLJA 2VD9A 1ZTVA 3H7VA 1E15A 3VX1A 3BANA 1J9YA 5D02A 3S5NA 3B0VC 3EOLA 3NZQA 3T81A 3S47A 4HYRA 2V38A 3UGVA 3BGJA 1J0KA 2P8BA 5I06A 4UR7A 3QV8A 3W86A 5G2HA 2PZ0A 1MXSA 1VEPA 1F3XA 3K8KA 5GNXA 4X63A 4LBUA 2J7BA 3EDKA 4NJHA 2G97A 3G0UA 1RUSA 3RMJA 1DVJA 3DHPA 1B3YA 3NDZA 3VKAA 4H8UA 1TSIA 2G5WA 4U5IA 1ML1A 4PRWA 2JF6A 3H2CA 4F4RA 4QQUA 2VGGA 4S2CA 2PDXA 4NZFA 1YTKA 5A1AA 1F76A 4JIEA 4AD0A 3D0CA 3MO7A 4MAZA 4AC1X 4YNGA 1Q6OA 4J3VA 3ZT6A 4RE3A 3L4UA 4AIOA 4O0ZA 1Z7AA 3LGDA 3RITA 5T26A 3SQMA 1QDSA 3OA5A 1XLAA 3RJXA 1TR1A 3KZSA 4OT7A 3T9PA 4JTLA 3L4TA 1TMQA 4BHYA 2JGYA 3PJWA 4NX0A 4C7DA 4JL1A 2GGGA 2NV2A 1X7FA 4HHPA 4AXNA 1QJWA 2WVTA 1TIMA 3ENLA 1FWEC 3CHEA 3HPAA 3CS2A 4FNSA 1HJWA 1TB3A 2ZTJA 1FCVA 3EWXA 1ZS2A 4GPNA 4O4VA 3M0HA 2YYTA 4WSKA 1KRAC 2RGLA 1BQGA 4M5PA 4OBTA 4K7YA 5C70A 3OBKA 1W91A 2A5HA 2GGJA 4PMVA 4XVDA 5A8GA 3T08A 4JNYA 3ONCA 4MKSA 3CIWA 3IJ7A 3M43A 3RM8A 2C13A 1B90A 1O5KA 3GK0A 1TV3A 1ESWA 4K7VA 5A6LA 2ISSA 4LTSA 3NZPA 1XGEA 1V79A 3IVSA 5HMSA 1KD0A 2F61A 1VPYA 2QCNA 4M1RA 4B91A 2QUVA 2VP8A 5LA2A 4LVFA 4O1CA 3TQPA 1NOUA 1H50A 4OJYA 2PLCA 3ITGA 1JDFA 1X1OA 1MI3A 1O1HA 2HBVA 1Z69A 2V2CA 3A4XA 1A0DA 2WZEA 2AQOA 4XAFA 5AHNA 3TYDA 4Q4SA 4RXGA 1RCOB 1UR4A 1OINA 1GGOA 1QU4A 3COTA 4AIEA 2GVGA 2V69A 6ENLA 4LNYA 4HSOA 3WJWA 2PDPA 3EPOA 2BASA 5HMDA 4DJDA 1LYXA 2P76A 2BHYA 1JYXA 3TJLA 2BGNE 3WX7A 2OEMA 3WLLA 3WLMA 2FJKA 4M80A 1FCUA 2JKPA 3N19B 4XSLA 4FNQA 1XI3A 1TWZA 4NYYA 1A5LC 1OGGA 3TVAA 4GISA 3OQ8A 3UU0A 2WM1A 3F4VA 2XTKA 5C2GA 2XJ7A 3AHYA 2QDDA 1UIPA 3E5BA 1XRVA 1XIDA 1TJ1A 4R9XA 1ISXA 3WLIA 2ZRWA 3A4AA 5C7HA 3ARQA 4PB5A 3WBEA 4I90A 2BSLA 4QR6A 1V8EA 3I4KA 1FY6A 1GVOA 3B9AA 4HCDA 1S5MA 2OX4A 1S38A 1Q6GA 4FXRA 3R8GA 4AD2A 1Y5VA 2B7QA 9RUBA 5I03A 2Z1WA 2R8WA 3MI3A 1XHGA 3L5AA 3OVQA 3M9YA 4MIMA 3GG0A 2V5JA 1KM3A 4NXSA 1OZQA 1GOMA 3TR9A 1DTNA 4XZNX 4CCCA 5LIYX 1EBGA 1HP5A 4FAMA 3FEQA 4Q8VA 1TZ9A 2HVOA 5GJNA 3PBVA 4B5WA 1EP3A 3MP5A 1YIXA 2QAFA 1TIWA 2OKOA 1H1NA 3GW0A 2VJXA 5KZEA 4CEXC 3H2OA 1B2YA 2FTWA 4L9ZA 3XIMA 1FWDC 1DIDA 4G5DA 4HOWA 2EGZA 1OYCA 5G5IA 1TTJA 1VEOA 3CPUA 1O6IA 5LKYA 3UVIA 5FOOA 4FX8A 1MEHA 2FJUB 3P5ZA 3RG6A 3UZYA 3WDHA 2ISVA 4GGBA 3IWPA 1AW5A 4X9SA 5M17A 1H4PA 4AZGA 1ZJHA 4ZQOA 4DWSD 3MUIA 3EOSA 4F2UA 2PCQA 2Y61A 3KBJA 2FVLA 3AS1A 4J3WA 1NDYA 1IHIA 4RCXA 3TNOA 4RL3A 3EX1A 4MFDA 3ABXA 1MNSA 2J8GA 4IFOA 3ABOA 2QCDA 3WD4A 2Z1BA 4LCRA 3DESA 1DWIM 1TPUA 4DO5A 4F79A 1ODUA 4FX6M 1EJTC 2W91A 2R14A 3DH7A 2HE8A 1Y8BA 4IX2A 4CGTA 4FEZA 2I14A 4GI4A 4ERAA 4RKAA 2Y7GA 3E0VA 2V68A 4WVXA 3POCA 1T6MA 1QMLA 1O5XA 5F2MA 4N9BA 3L65A 2B81A 3LTYA 1E0TA 3CT7A 4U3CA 5D04C 1Q65A 2W92A 1I0BA 3WLNA 4IGHA 4Q6JA 5EFFA 1E5NA 1QPQA 3W02A 5LHEA 4QFUA 1TVPA 5LXXA 2J7CA 2VC5A 1FOBA 1GJUA 3TTOA 4LS0A 5MF5A 3N9KA 3UYCA 1QR7A 5CZSA 2YCLB 2PMQA 2NQ5A 2V5DA 1SFSA 4M3PA 3B03A 4XAPA 3E0LA 1QOPA 3WK0A 2NX3A 1YPIA 2ZZ2A 3O15A 2OZ3A 3SGUA 2YXOA 5FEXA 1SW0A 1W9XA 1CLVA 4E2DA 2PTWA 4LVGA 2NVDA 4ONVA 5K9XA 4PUJA 4GGHA 3W84A 3VO0A 2VELA 3V35A 1AW2A 4LALA 2WVUA 4LWWA 1I75A 4EPKA 4ORIA 1IQ8A 4M6UA 4QE4A 4B90A 3GXIA 4C6MA 3H21A 3AO0A 2Z7KA 4Q32A 1KFLA 4HTYA 2YB1A 1MQPA 4GRSA 2BOFX 2UY3A 2ZX9A 4OOZA 2A79A 5M2FX 3LU2A 3OGSA 4LAMA 2AKMA 4IP5A 3W1NA 4YYCA 4I9TA 2ATSA 1EZ2A 2W67A 3S5ZA 3ARXA 3OVPA 3DG6A 1JUEA 4MB1A 1G67A 3A24A 2E77A 2ASHA 4UBPC 1M5WA 5CBIA 3S0CA 3CUGA 3SSZA 1TMLA 3G8RA 4C6QA 4V28A 1TCMA 3U5UA 1EXBA 2EBNA 3WQ8A 4H6RA 4TV5A 2XINA 1C8XA 1SR0A 3GNOA 2FFIA 3APYA 3UCCA 2XWEA 5CPNA 2OTDA 2XN2A 1DWAM 2A6NA 3CL7A 5H91A 4HHLA 2CFFA 2GOUA 1RBAA 1PWMA 1VJSA 3NVDA 4P7QA 4GJJA 1UCWA 2HPIA 1CDGA 5REQA 3IJ8A 5D9PA 1IXNA 4O28A 2EO7A 3DEQA 4ROPA 4JR5A 1JF5A 1XLKA 1CB7B 5HDRA 2DIKA 4YHEA 1KCLA 3E2SA 4MJ4A 1JAEA 4G7EA 2Q8ZA 1QNPA 1FHDA 5ABFB 5FSDC 3CMGA 5HPCA 3OG3A 2JK2A 2Z4GA 4UOQA 1EF3A 5JBFA 3GDKA 1Q6LA 4XO7A 1B5TA 3UWZA 1VD6A 1YKWA 4PMYA 5LIXX 3EPNA 3U5YA 4LYPA 5FSEC 3HN3A 4L4LA 4QDPA 2DFAA 1J0ZA 4NJGA 3OBAA 4U28A 1XD0A 4M0XA 4F3HA 2Q3OA 4ML4A 3GBDA 4XBJA 3DFSA 5JIWA 1AZ1A 2C19A 2GQAA 1BWVA 1UA3A 5LNVA 1UH3A 3KZPA 3NQMA 3CZEA 1EB3A 4Z1CA 1T8QA 1RPKA 3MKKA 3RO8A 2R1MA 4C7GA 5HR7A 1Q6RA 3ITOA 3ARVA 3U3HA 4PTDA 3UPWA 3P8JA 3WLHA 3L4YA 4HNTA 1ICPA 1WXYA 3S1WA 1FVPA 3VGDA 3BGGA 1XISA 1UKSA 4O1DA 3KRSA 4NYUA 3G1RA 1UR3M 5KSWA 2YLAA 3W22A 1EUNA 4Q8OA 1VAHA 2EG7A 3FSUA 1TZ7A 2OODA 4UQCA 3KCOA 3NSMA 3W2LA 4O8AA 1N2VA 3UWYA 3NA8A 2B31A 4NJKA 1W32A 3T55A 1FXQA 4CEUC 1ZZMA 3RPDA 2YBUA 3BOXA 4JY9A 1PHWA 1RBOB 3N2XA 3GTNA 1JYWA 3U0HA 3MMDA 4EANA 5A8MA 2X2GA 3CGTA 3WFLA 1R3QA 5I5RA 1I2QA 4Y96A 3CMFA 2INZA 2XVLA 3Q67A 4AY1A 5CBJA 1K9TA 2ZXQA 1V0KA 2JEPA 1EIBA 2YA0A 3W7DA 3CQIA 1EJWC 3T09A 1F2JA 2PDBA 4HU3A 3CASA 4W86A 5IDIA 2QZRA 4JL2A 5I02A 1QNVA 4DBSA 1OFDA 1VFLA 4E38A 1PCKA 4EOUA 4F9JA 3KOFA 1K4GA 4EVZA 4IG2B 3IAQA 4C6DA 2ZADA 4NF7A 4AX7A 1A53A 3E12A 2OYKA 3T2PA 1ZHAA 3ARSA 1FQ0A 2AKZA 4AFYA 4ZA0A 1W5MA 2NT1A 2Q8XA 3M7WA 1W5QA 5I3IA 5DMYA 4L6HA 1VPQA 1DV7A 5HJLA 3CQ0A 1BYAA 3DERA 4NT0A 1S39A 2NXGA 3HG5A 3SUWA 3DHDA 2Y1HA 3OPSA 1JZ4A 1C3FA 1A5SA 1G6CA 4ZO8A 4AZCB 4MSSA 3W1XA 4M6QA 4D8LA 2BOEX 4KFOA 4GK8A 4IPNB 3EMCA 2ONEA 1IZJA 3GFZA 1V7AA 3OYZA 2FGLA 3VNZA 1JYVA 3GIYA 5FJOA 1XQLA 1K70A 4L6OA 4BI6A 2J8FA 3IIPA 3IK4A 2HBXA 4PEKA 1OC6A 3PTKA 4FXFA 3OG2A 4ZTXA 5LA1A 4MY1A 5CPQA 3WCZA 1TTIA 1K4HA 2GSHA 3A64A 2JIWA 3L67A 5AC7A 3GR8A 4EKJA 4NZ1A 1U22A 2OR2A 4JQ3A 1H60A 8TIMA 1BYBA 2HK0A 1IV8A 1BQCA 1A5OC 4I6KA 1W37A 3S46A 2GJNA 4ZO9A 3N73A 1XFCA 3ARPA 3N2BA 3GNPA 3V0UA 1S2UA 4O54A 2FZMA 4O1BA 4WOZA 1V08A 3CPGA 3TV8A 3GNRA 3GC2A 4WF7A 4TMCA 2UY4A 5K3VA 3M6DA 3RLVA 2CETA 1A47A 3JUGA 3U48A 3ZWTA 1EOKA 3CQKA 3OHMB 3MUCA 5IHRA 3VD4A 3S2LA 1QPKA 4PMJA 1XKJA 1TREA 1QBBA 4JIHA 5IHSA 3H2EA 3EOUA 1PIIA 5EMLA 4KWVA 1P1XA 3WH9A 1S1RA 1PEZA 4ML9A 4WSJA 3FGCA 4R53A 2G8ZA 1HFBA 3UXDA 1K1DA 3KXQA 4FI4A 3KVLA 3HGSA 3T0BA 3V16A 3PP7A 4O50A 4L80A 2X7WA 1VCVA 2V8ZA 4NZ4A 1OQFA 1U33A 3Q45A 3GDBA 2RH9A 4QXIA 1IF2A 1FWJC 2VOMA 4JTQA 1RCXB 1J6PA 1W1ZA 3PNZA 3M41A 2FGBA 4ZGYA 4RUBA 3THDA 3ECQA 5D03A 2A7RA 3QFWA 4EIVA 1KLYA 3W6MA 3GRIA 3PPGA 2V30A 5CZ0A 3EWBX 2F7FA 4UMCA 3SN4A 4H7CA 3W2UA 3O06A 4G6CA 4O52A 4WDTA 2WBKA 4S23A 1UH2A 1JDDA 1PXGA 2PP3A 3VZYA 1B4KA 4G1NA 1TPC1 2JF7A 1DJHA 1X98A 3F4CA 3P7YA 3P8IA 2BMBA 3PY2A 3A23A 4PUUA 2XUCA 3R0UA 2Y7EA 2VX4A 2REQA 4LVBA 4N7QA 1L8PA 4CN4A 1S5WA 2YA2A 5ECVA 3PBWA 3H24A 4GVIA 2YXXA 4QNEA 4UTFA 1GEQA 4AB4A 3B9EA 1W3IA 2OYMA 4O18A 3LXAA 2VFGA 3FX4A 4W93A 4FK9A 4PULA 1VCGA 1ZLPA 2WC7A 3C2EA 1GTHA 1MW0A 1RLDA 1QI4A 4U4MA 3P62A 2B7OA 4LY8A 4XAYA 2YDAA 4GJ1A 2JEQA 3NNTA 4YL2A 3CYJA 2FIQA 2HDJA 5G2WA 4Z2LA 1DBTA 3KTCA 3K8LA 3M0IA 5H8PA 5C2XA 3W6LA 1Q7ZA 2CLEA 3MC5A 4E8GA 2GWNA 3IK2A 4F0SA 2ISDA 1IYXA 4RNJA 1E9ZB 1ADDA 1TFVA 1KB3A 3CUXA 1ITQA 2ZUVA 4LPCA 2YJQA 3UNTA 3TNBA 4LEFA 3MHFA 2ACUA 3RN6A 4UXDA 4J5NA 2VEPA 4H9MA 1JI2A 2DY3A 1SYTA 3IARA 4EX4A 5D09A 1WYIA 2DSZA 2J77A 2PBGA 2ZIDA 1MRQA 2X05A 3EA1A 5DELA 1OX4A 1J12A 3GW3A 2QIWA 1EL3A 3DFHA 1DHPA 4M6PA 4LAUA 3PJXA 3G24A 4AVFA 3CBWA 1OK4A 4GE8A 4J3XA 4C1LA 3BLIA 3THAA 4MADA 2CHRA 2Z00A 1GYLA 1NIUA 3T0DA 1UKOA 3UR2A 2HV5A 4IIFA 4MG4A 1YPXA 3SCPA 1PYFA 4IHCA 3VKJA 4GOAA 1RD6A 1WXZA 2C8NA 1VB9A 3TQ0A 4JFWA 3GU2A 3APGA 2FHBA 4HOXA 3BSMA 4DYEA 3RR4A 5BOOA 2HS8A 2QHAA 3VGEA 1M7JA 1FKXA 1XLHA 3IACA 1CXFA 3UJFA 4L9YA 3UW6A 3VK5A 4DZHA 1VC4A 3STFA 3UXAA 3BAXA 3UP8A 3KEHA 2WVSA 3VGBA 3WMSA 4D1IA 2OQLA 3C8NA 4D6CA 3LCHA 5FF2A 2W63A 4R85A 1AD1A 1TTQA 6TAAA 2J47A 4UQAA 3AXIA 4KCTA 3SRDA 4EXQA 2E9BA 3OB8A 3KHDA 1XYFA 1QPOA 1ZSXA 4CU6A 4F0RA 1EA0A 4GC3A 3VABA 3A9IA 2OOGA 4GI6A 4MTVA 2D2JA 3MUXA 4WR3A 1K77A 3GNXA 4D6IA 2W6RA 2X0HA 3G6MA 1AMYA 3KDOA 1QI3A 3TMLA 2PDNA 3I4EA 2D73A 1N8WA 2VQUA 4QQ3A 4WDUA 3SN0A 3U4AA 3CIVA 4M8UA 2E8YA 3QTGA 4H41A 4FA3A 3IS4A 2Y89A 4BEQA 4X22A 3KOXA 4IGNA 3GH7A 3LUTA 2A0NA 4RE2A 3UR5A 2PLJA 1H7PA 1OSEA 4E4UA 4X2PA 3F4NA 4RZ5A 3RPMA 1K03A 2J7GA 1CXLA 1XIBA 3QV6A 3GXDA 4WY0F 2CEQA 4UNLA 3FHQA 1CGVA 4N6EA 4GACA 4B4FA 1VLIA 4NZ3A 3OIHA 3K1GA 2J74A 4I6VA 1AW1A 2PE4A 7ODCA 1I45A 2Y5SA 3HGRA 3WLQA 4IQEA 3ARZA 5JVLA 1W2VA 3R0DA 5CAHA 2NQHA 1LLZA 3PZ9A 4E3TA 3G3MA 3GUWA 1O68A 2J62A 2P5NA 1M1BA 1H11A 4CNOA 3U2CA 1F07A 3B8UA 5LGXA 3W1QA 2BHUA 5DY3A 1DEDA 4Q3MA 5AYYA 4JBRA 2NLYA 1EHAA 3CJPA 1B0IA 2GJXB 3MUZ1 1GKPA 3RMEA 4GY1A 3ZXWA 1XR2A 1NF7A 5DMNA 1HXJA 1S2AA 5D4YA 5J5RA 3P93A 3O1NA 2CBIA 2YW3A 5F4SA 1DORA 2DZPA 3V36A 2C79A 2YB4A 5I79A 2PGFA 4HYVA 2E28A 2A3BA 3ZWSA 3MSGA 4AZ7A 5CPOA 1TQXA 4ADSA 4MYXA 3SEPA 3N9RA 3OODA 3BW4A 3N2CA 4Q7BA 5ABHA 3GXPA 1X96A 5BYWA 1MVYA 3PZQA 1M9HA 1TA3A 1XYMA 3BZGA 4PGLA 1EGZA 4LF2A 2EJAA 2CBVA 1E4LA 1PPIA 1Z32X 1UD3A 2E6FA 4AX6A 5A6BD 4D6HA 3TQKA 4GY7A 1Q6DA 5E6YA 2FPYA 2IQDA 3EKZA 1I0DA 3O16A 2ZWYA 3WBXA 4XZLX 1VFHA 2H9AA 2CCRA 1E71M 4GYJA 1IEVA 3GVRA 5EGRA 2WBGA 4EP8C 2X41A 3BURA 1OGSA 4LB3A 4DM2A 1CW2A 1QNRA 1S5NA 4DM1A 3DKLA 3FEMA 2DW7A 5DBTA 4MNJA 4DAFA 4YTSA 3T44A 3CB8A 4QCFA 1G4TA 5ABGA 3LSCA 4JAWA 2V3DA 3CQJA 3B8DA 1CYGA 3CLWA 1XH0A 4MDPA 1F8MA 4YWSA 2O7QA 1DE6A 3MCNA 3E0WA 4DYKA 4Q8MA 1BGAA 1EP2A 2VEKA 1KBKA 3R10A 4Q4RA 2QCEA 1R7AA 1DPMA 3DIPA 1C9WA 2BFGA 3VCRA 4JFTA 2IPGA 2NQZA 2D2OA 2ZUWA 4DO4A 1EWEA 2NXIA 5FF3A 2CLKA 2BHZA 2OEKA 3S4TA 3QW3A 3S2JA 2PRHA 4DXKA 3N6HA 4NHVA 1XPGA 2VL4A 4CUCA 4ORMA 2DSWA 1FA2A 4QE1A 5HNTA 4ZQPA 2OJPA 5CJNA 2PURA 3OGVA 1DJIA 5D2XA 1A5UA 2WJDA 2OQYA 4BJHA 4K37A 3U6WA 4AD1A 3N29A 3AMGA 3CO4A 3HA1A 4P7LA 2DZSA 1OG6A 2HROA 4H9YA 1MNZA 1CENA 4YU1A 2HMCA 1TVLA 1LT8A 4H8NA 3G18A 3PZOA 3QHOA 4ES4A 1BSLA 2XH0A 1RQBA 2CKRA 3GDLA 1FWGC 3A47A 1E56A 3WMCA 3L2LA 5KEZA 2XPKA 3V3WA 3G77A 5KTLA 3SY1A 3DX5A 3E9AA 1EWDA 4IT1A 3SCVA 2QEZA 3JS3A 1VQTA 1YPFA 1MMFA 4B2DD 1TG7A 4LT9A 2NWRA 4PODA 2PWVA 2DZUA 2NUXA 1GCYA 3CV2A 5K4ZA 3BOFA 2OWCA 3M5ZA 1FWHC 2GUBA 1GEHA 1G0CA 1O4UA 5G1MA 2TAAA 1G1YA 1VFOA 4UTLA 1P6BA 2NQLA 2GVJA 1XDLA 1MDLA 4DWDA 2J9XA 3W7EA 4OV9A 3MWAA 3WF1A 5A6JA 2CWXA 4O0QA 3GC4A 3UY7A 4Z2IA 2OB3A 1R2SA 4D6DA 1KBBA 4A29A 2FDMA 1QNOA 1EQPA 3NEVA 4YCPA 4HPHA 3KCJA 5BWFA 4ICMA 1E73M 5BWAA 1N8FA 1W6TA 1UG6A 4A6GA 2ZRZA 4QIUA 3P61A 1MZHA 1R3SA 1U2YA 4P8VA 1V6XA 4W84A 1V7YA 2D24A 1ONXA 4P5UA 2GVYA 5AYZA 4CN1A 3OVRA 3NL6A 2ZE0A 1ZPTA 1RAKA 2WPBA 3H2MA 2AAAA 2VEGA 5FJIA 4O16A 3CNYA 1F6PA 3W71A 1ZP4A 3O05A 3GE7A 1DIEA 4GCXA 1OJXA 4XBSA 3KOWA 2IW0A 4I5RA 3SO7A 1SO3A 3KE0A 3WMLA 3GB6A 4FNUA 4YTRA 3L23A 2ISFA 4GQQA 5JH1A 2C16A 2QDEA 1XQKA 1J93A 2CC0A 5D37A 3R43A 1WDDA 3G8EA 3GBEA 4AY8A 2VGFA 1IEXA 4MYAA 1RK5A 1IZKA 1Q85A 3ARWA 5CLWA 4WIWA 3RJYA 1E70M 3DFQA 2OLHA 2Z24A 5T9CE 3RILA 1XF0A 4WSHA 3W26A 1GNXA 4EACA 1QWKA 2UY2A 2IPFA 5D2WA 4GIAA 1CECA 3RDKA 4YWIA 1KW1A 3KTXA 5DBUA 3F7JA 3P5YA 1EPVA 1J96A 5CBBA 3SBFA 4MUZA 1R8LA 3GDMA 2WXDM 3KBMA 2WZHA 4TXEA 4ZQRA 3EDJA 4A2RA 3TTSA 2C0HA 2CLMA 2YR1A 4N4QA 3IJDA 3LSBA 4Y90A 2UBPC 4YLWA 1EZWA 4H1ZA 5DEZA 3MJYA 1P6CA 1R6WA 2Y8KA 4XZHA 3G22A 2QUUA 1XINA 3TJ4A 4WX2A 4TX6A 2HE5A 2GGIA 1EDQA 3AZSA 2V3GA 3CL8A 2NW0A 4PRRA 3DOPA 2EQDA 1TJ2A 4M6VA 3VYLA 3FNDA 5CH9A 3P82A 1NDVA 3LD5A 5JU6A 5CGQA 5AY7A 4Z2JA 3VIHA 3MA8A 4FX7A 3E0IA 1H5YA 3SQLA 1A4MA 3S8HA 4X3ZA 1C9DA 2DIJA 4KQNA 5D33A 2D2HA 1MXDA 5I24A 1SMDA 1EJ7L 3L9CA 4LCQA 4JTFA 1G4PA 4CNUA 1JCYA 1UD4A 1CPUA 1JRBA 4O11A 4ERGA 5BU9A 3TYUA 3LHWA 4TIMA 5FKYA 2OZ0A 3SFKA 3RX3A 4JQ1A 4UZUA 2DH2A 4KWSA 3BZJA 1T41A 2YL6A 2EAWA 3T7VA 3QN3A 4AZBA 2DDXA 3VOJA 5EMMA 1BVNP 2BGQA 3N14A 1AH3A 2VFHA 1OVDA 2CLIA 3WNNA 3UPBA 1CXHA 2VC7A 1RQHA 4AD4A 2G95A 3VM5A 3VE7A 1ADSA 1TMHA 4CCEA 2AAMA 4BQ2A 4HPNA 2EG8A 4F0HA 1ICQA 2WJEA 3UY8A 5EMJA 4A3QA 3WELA 1LOSA 3W2NA 4F2BA 3EB3A 3TYEA 4QJ1A 4O53A 1SSGA 1F61A 4YYFA 4DLFA 2DSKA 2DZAA 2D0HA 4ZENA 1P7TA 1K9DA 4UC5A 1VYSX 2RDTA 3BJFA 3CAKA 1H62A 1JZ5A 4H01A 2VRKA 2CU0A 5F2GA 1ZAJA 3KL3A 2FZ9A 3H7UA 5KETA 1W1PA 3LN3A 4UIOA 3FSTA 2BV9A 1ZRQA 2WANA 5RUBA 1LJYA 5EA9A 4J28A 3M44A 4FLOA 3OBEA 3STCA 1KM6A 2FGZA 3NURA 1FWSA 4Y9MA 2WW5A 2WSYA 4FHAA 3MJMA 4KCVA 5A6AA 3SQSA 2VUNA 1OD0A 2PSNA 1BYDA 4FXJA 1X6LA 3TW7A 4NZ5A 2CIPA 2EPHA 3U7VA 1IXOA 3B4UA 3SW6A 1UC5A 1MO0A 4ZXOA 1OADA 4AEFA 3PG8A 1OYAA 4MOZA 3LHZA 4W7VA 3MMTA 1BXNA 1GPWA 3WD0A 5CC5A 4J7RA 3QM3A 3KWSA 2DW6A 2VDGA 3LCWA 2QPSA 4OZOA 3NAVA 2XWDA 4B5TA 4ASTA 2P0IA 3EWDA 5PTDA 5FEWA 1JPDX 2NUWA 5LXEA 5DXXA 3ZLHA 3TYCA 4JDYA 3N6JA 1UW9A 1YTDA 1FHVA 3BC9A 1P1MA 3EPMA 2BXYA 4D6FA 1UMYA 2JQXA 2EEXA 1UR8A 4H9UA 1L6YA 3L7RA 3A5FA 3ALGA 4Q4KA 1G01A 3HV9A 5F1UA 3WNOA 3GU9A 1OCBA 3GTIA 3QSTA 5AHFA 2Q71A 1J2WA 2G0WA 3BLKA 3WLOA 3N1AA 4WHBA 4GH3A 3GG1A 5FF0A 3O9NA 2VC6A 3AZTA 4RLIA 3OHIA 1HGYA 1G7UA 2AGKA 3WQ4A 3WNLA 4RV8A 4UTWC 3MU7A 1PUDA 1L2QA 3G1YA 2PI6A 1MRAA 1CGTA 1OF6A 4M19A 3S1XA 3B3DA 3GNNA 2VKZG 1B57A 3HU7A 4MY8A 1KM5A 4PFHA 2QCDB 2EF9A 2Q09A 3LCIA 1AA1B 1AFSA 4JGDA 3HJEA 3UZWA 2IQ0A 2OCZA 4WZHA 2FHFA 4DJFD 5I07A 4H7VA 1AVAA 2Z6JA 3QV7A 3VINA 1EJRC 3LZ3A 5GNZA 4PSRA 3LG3A 4GZIA 3WYZA 1T8XA 3KBVA 1ISZA 1CWYA 5DLCA 3M0LA 5IFTA 1YDVA 2XFYA 2R9RA 3AXMA 3UG3A 1E5JA 1WA3A 3OZPA 1I2NA 4BQ3A 2GOKA 5DN1A 4GUFA 2QUTA 4NSBA 5GPRA 2QT3A 5HQMA 2V81A 1RHCA 2PBOA 3QLLA 1V0MA 1U1JA 3MWCA 3LCGA 2BY3A 3Q58A 4HNCA 3SIZA 1NH6A 3UG8A 5EMYA 1PTAA 1HP4A 4N9CA 2FKPA 5H8MA 3ISIX 1TPH1 2BVDA 1L9WA 1MQQA 1KV5A 1P0DA 3MW7A 1C7TA 2J13A 1GWJA 2XU2A 3TUUA 2C0AA 2O9TA 3P0XA 1IT0A 2QAPA 1BF2A 3FJ6A 1TRDA 4OGZA 3C86A 4DJEA 2HXTA 3P3BA 1KFEA 4OUIA 5AHIA 1GJWA 5EL1A 1WAUA 2BGSA 3IANA 1U5JA 1QRQA 2RUSA 3WFZA 3PM6A 1AJZA 3S2MA 4GVHA 5LNRA 5HNUA 1LWHA 1XW8A 2VTFA 5M5DA 3N12A 3C8FA 4TTGA 1QWGA 1V93A 1KTNA 4J40A 3BSHA 3LCLA 4NASA 5B7YA 1Q6CA 3AS2A 5H2ZA 3K1DA 2P53A 4W8BA 3RPTA 1DIOA 4GABA 4KCWA 1L8NA 1JPMA 2EKGA 3H4XA 3DI1A 1B9BA 3EXTA 2RDXA 2OMAA 5HR6A 1YQ2A 4DJFC 1PKNA 1Z3NA 2FVMA 5GJPA 3TYAA 3TOPA 4K2SA 3VZXA 3VNYA 3M0YA 3TA9A 2YLLA 1ZFJA 1TPDA 4KEZA 4BI7A 5BXSA 5L9FA 1D7FA 1ZY9A 1ITXA 3NQ7A 3TN3A 1VYPX 4ZR8A 3DUGA 5CQ1A 4XBKA 3KRBA 4GUGA 1DWHM 1ALDA 3B04A 2J78A 1BG9A 3EOOA 5FEPA 3C5QA 4KS0A 4ZO6A 4QEEA 1E0XA 5AHMA 1UKPA 3UJSA 1BWLA 5SWUA 1IIHA 4XD4A 3JR2A 1YMYA 4HNUA 2PTDA 3WH7A 3WUGA 3PULA 4O1AA 4AWEA 3DFOA 3WD2A 3WQOA 4BR1A 3AAMA 1YBQB 4IPLA 4EE9A 1WO2A 3ABQA 2OX1A 3PJTA 1QO5A 1CZ1A 4PUNA 4PCPA 1L0PA 1VCFA 1TV4A 1MSSA 4GQRA 3IIXA 2WSQA 4IIEA 3S42A 3ANYA 2PFHA 1NOWA 1JPHA 3QXBA 4JKMA 1GG0A 1XLEA 1S1PA 2PDLA 5DY2A 3TTEA 1QPNA 5C71A 3EX3A 4LXFA 4AD3A 3C4UA 2HWGA 4B4HA 1TR9A 4LOCA 2FTPA 1XFBA 4DZ5A 1XX1A 3VD9A 2W79A 4P2VA 1Y7VA 1CXIA 1KTCA 1W9PA 1E1FA 4F0KA 2ANUA 4MZ8A 5BOFA 1F4HA 1S2WA 2W0UA 4R33A 2R6OA 2O4MA 3RXZA 4BI5A 1JQXA 4A2SA 3UWUA 2YCLA 2OG9A 3CUHA 4N2YA 3TLLA 1B3OA 4IUGA 1UASA 2GDQA 1XBVA 3PS7A 3GH5A 2VC9A 4V1YA 1JI1A 1H2JA 4FIQA 3RCNA 1XWYA 4DJFA 1XIIA 3JZUA 4IIDA 3W23A 4S3BA 1E6NA 3REQB 5F1VA 3HF3A 3A9BA 4R88A 3BARA 3SADA 2R1LA 3G6LA 2QKFA 4NG3A 2ESCA 5I09A 1EC9A 4P7RA 3MY9A 5C7VA 2X1RA 1JULA 1GHRA 4XAZA 1Z42A 1GVSA 4DBUA 3W7CA 3B40A 1UZHA 2WPGA 2AQWA 3RLHA 4LW7A 4WGXA 3MSDA 3IV3A 4I5XA 4GYPC 3W01A 3UJ2A 2BWGA 5TBOA 1TJRA 1WB0A 1SFLA 4IMAA 3IJIA 2MANA 1T7LA 3AMDA 3AIBA 1X8FA 2X42A 1JXJA 4L64A 4XAGA 1YEYA 2ZZ5A 1Z44A 1N55A 4G7FA 1R2RA 4JTUA 4D1JA 1H61A 3BXWA 3PZNA 3STPA 1F7BA 1NVMA 3EWUA 3ZYZA 3CB3A 1VKFA 4R5EA 3IUIA 2QJHA 4HB7A 3BG3A 4ROQA 2PDKA 2NLIA 4LYKA 3PHAA 1E9LA 1IXPA 4CQ9A 1KCZA 2DORA 2RHGA 2F38A 1JUKA 2VR2A 3NSNA 4C7FA 4ZB2A 1TPVA 5HJXA 9CGTA 5I0DA 4ZB5A 4QGCA 1TV5A 4DVOA 7TAAA 5DX7A 2BY1A 1D2KA 2CXEA 2D2GA 2NZLA 4IFKA 3OLDA 3LMYA 1M7XA 3GVQA 3MI6A 4B5VA 1PZ2A 2WKLA 3SCQA 3V7PA 2OWWA 4RDVA 3WLKX 2ISWA 3FA3A 3RO6A 1XPYA 1HJVA 1YX1A 2PF0A 1QNQA 2DZWA 1NY1A 2F6XA 5DMMA 4XX6A 2PD5A 4W5ZA 3NQFA 4KWWA 2ZQ0A 3W1UA 2VX5A 5DO8A 1M04A 3WN6A 2WJZA 1V6WA 3GYEA 3IIVA 2X09A 3O0KA 1I2RA 3GVWA 5H6HA 5I23A 1EGVA 3ID7A 3CZ8A 4CVUA 2NX9A 3NQ6A 1FXPA 2GDVA 2BG5A 1PTDA 5D2TA 4B5XA 2G37A 1Q6EA 1ZJIA 4ZOAA 1THFD 2A7NA 3A3XA 5A2CA 3P2VA 1I1WA 4UB9A 3S2NA 4AYSA 1EBHA 2E9MA 2V9DA 2CPUA 2ZUUA 4GVGA 3QOMA 3ABRA 3MMWA 4CNTA 1M41A 3WJYA 2ZXAA 3R5EA 2PF8A 3AMCA 2QF7A 1GOWA 2OEJA 2WCAA 4IL2A 2PDHA 3VDGA 3A6OA 2XG9A 1I9CB 4CD6A 2NV9A 4K8HA 1DXIA 1H0IA 4WJ8A 4L5ZA 3WDJA 4IL0A 4GI9A 4QROA 2WCGA 1UWQA 1JZ7A 4XZBA 4KH2A 1WZMA 1VIWA 2J79A 4JPGA 4XSMA 3UQNA 5CXPA 3FY1A 3GG7A 2GWGA 1B31A 4L56A 3ZMRA 1G69A 2QPXA 2Y6ZA 1K6WA 1H51A 4CVWA 4RNFA 4KWUA 1BXCA 4ADTA 2YL5A 1U5HA 4ZL1A 2EPNA 5DQPA 2QCMA 1UMLA 3DYOA 1FP9A 4JOMA 4ZQNA 3TJXA 1V77A 3WEOA 1QHOA 3F4WA 1VP5A 2RGMA 5L6UA 2P50A 2ACRA 2O4QA 4B16A 3CZGA 3VVGA 1RY0A 1NOFA 2E4TA 5A94A 2QVHA 2H8ZA 5G1YA 4AUBA 1W9UA 4UTJA 1WE5A 4TX8A 4DYJA 4PUDA 1WDQA 3WEZA 3C61A 1EX5A 3EKGA 4XIAA 3HURA 2Y70A 2PDUA 1TA3B 4B3LA 3THCA 4FPSA 2GZXA 4PB4A 2VENA 3FDGA 4PMRA 1X8CA 3EMQA 4IOTA 4FB7A 1A80A 5LIWX 3FXGA 3AU2A 3PWIA 4E4FA 2AQVA 4UTWA 4ACZB 4XB3A 2ZTKA 5C8BB 1XBXA 4XUYA 3TAOA 3EDFA 4Z0SA 1XIFA 2D3NA 4MF4A 3W2JA 3VUPA 3ZVIA 1NAL1 3KAOA 2P3ZA 3LI0A 1SZNA 4RE0A 4NNCA 1HN1A 4UTTA 3IJQA 1DXEA 1ONWA 4GKLA 4RDYA 3AISA 5LA0A 2XVGA 3CC1A 2PCEA 1ZBVA 1QHPA 4C6BA 4CN6A 4MUPA 4EF9A 3BVJA 4DJDC 4EPDC 3WFAA 2H3BA 3BICA 2ZA3A 3WO8A 3HQPA 3CV6A 1XM3A 4Q33A 1QXLA 3CO8A 4OVXA 1K3UA 1RCQA 5CZJA 4HBKA 1ITCA 1XLCA 1PWLA 3PF3A 3VNJA 4A35A 3QR0A 4HT3A 3VC5A 3W1AA 4FS9A 1H0GA 5TAOA 3G1FA 3S3GA 1UWTA 5FJTA 3ZR6A 4IF2A 2XYLA 4Q8QA 4M82A 4JQAA 4MZYA 1JZ8A 3KRZA 3AI0A 1Q8JA 1DJXA 3UZJA 1JAKA 3K8MA 3VKCA 2VI0A 2QVNA 2QCLA 3M64A 1XSIA 1FX6A 1LDCA 2INFA 1KLZA 1GVFA 1RK6A 4LU0A 4NQ1A 3MPGA 2W3ZA 3SCUA 4KIRA 1GYMA 1AQHA 2BBFA 3P60A 4EK7A 4XIMA 5KITA 4KPLA 2OT0A 5MKGB 4INFA 4XISA 5D30A 4HJWA 1EDTA 4GINA 3AYTA 4GHRA 3DG3A 3LHYA 1KFWA 4MFEA 2RAGA 1VBGA 1CCWB 4R9OA 1RBLA 3BSGA 4AZHA 1TE6A 3N17A 2BXZA 2V0TA 3HPXA 3W76A 1PVNA 1U5VA 2VX6A 4HU4A 4YTQA 4GIRA 1QOXA 4EPBC 1JGIA 1CGWA 3K30A 1US0A 4QITA 1MEWA 4FZIA 1LUCB 1C8QA 1EKOA 4IPIA 1QK2A 2YDSA 4U10A 4ACYA 1B9ZA 4UTHA 2G3NA 4CKQA 2YGYA 3H6OA 3W72A 1PDZA 1XH2A 3OIXA 3S9ZA 2ZE3A 2ALRA 5I7GA 4C1NA 3DC8A 4G56A 3PFRA 3NQBA 4D8ZA 3CHCA 4GH1A 4HZMA 4LCSA 3ZSTA 1A5AA 3QV9A 4JTTA 1HF6A 3QGVA 3F2CA 4MPKA 4ZOBA 3CZJA 4YMZA 1XGZA 1R3VA 4LYQA 4DLMA 1FH9A 1IIGA 4HK7A 3ARYA 1JJKA 3C2VA 3WD1A 3W2MA 2ZA2A 3GKFA 1VBHA 2J6XA 2ZDSA 3LV5A 1PCWA 1RP9A 3H2FA 3XISA 5AC8A 2L5HA 3P0WA 2GJPA 3UETA 4DUOA 4HK5A 2VHLA 1VJIA 1W1YA 4ZEPA 3GVVA 4TMBA 4DQWA 4F66A 1A49A 2CITA 4HNNA 4NVTA 2QMKA 1LF1A 4CNNA 4AH7A 2PTYA 3KVMA 1SJCA 1DYSA 4O13A 3A4JA 1JVNA 4Z08A 5FJRA 2ICSA 4F0MA 2WC4A 3GH4A 2YZ5A 2RDWA 4GFSA 2EPOA 1TX2A 3ATYA 3R12A 3AIRA 4ZXLA 1S2CA 3QPEA 4PUWA 3MYPA 2GYIA 2VD8A 3AHTA 5HOSA 2E67A 3AHZA 1F05A 3ZLFA 5HAOA 3D3FA 2VQTA 4V27A 5LIUX 4XTDA 3WDRA 2ZRUA 3PUDA 2AOSA 3N34A 2WNQA 4CCDA 1PO9A 1E1EA 4U2ZA 3RIKA 1W8GA 1F73A 3VGHA 4JIRA 1P48A 2OWXA 1HL9A 3NDYA 4GNJA 3WDPP 3HG3A 3TJIA 5C9ZA 3I10A 2ZX8A 1HKVA 3EA3A 2A3HA 2V6AA 3EX6A 4JN8A 4XZMX 4EAMA 3WJZA 1KO0A 3FYOA 3NCOA 1QPRA 4JX4A 1DWGM 2WVVB 2OLAA 4NJJA 1AH0A 3BAYA 3NQCA 5I77A 3MVIA 1JL8A 4QISA 4QAIA 2Y7DA 3EWWA 4R7OA 1UP2A 5CZTA 3NEHA 4DELA 1QFEA 4DNMA 2YCIX 3KS6A 4WLCA 3VUSA 4UQDA 1SUXA 1GQJA 4KMQA 5XINA 5M3WA 4I7VA 2I5GA 3LCFA 2W61A 2DVTA 3LBCA 3UXKA 1JZ3A 5CGMA 1K7EA 5G4HC 2VGIA 3APTA 3OU8A 5KINA 3CUFA 4HA0A 5AC5A 2VX7A 3SCWA 3D47A 1TELA 1OFEA 7CGTA 3ITCA 3TR2A 2CESA 1TV7A 1RA0A 2ACQA 3YPIA 3OP2A 4FSAA 5T9BG 2OSYA 5HBFA 1AJ0A 1W5OA 4PL1A 3AUOA 2XIQA 3DG7A 3BOLA 4GO8A 2VCBA 4TR9A 3MKVA 2JGQA 2ZFAA 4OU1A 3NL5A 2VFIA 1E3ZA 3ZIZA 3I7RA 4L61A 8RUCA 1YW1A 2XIMA 1E6PA 3AS0A 3SB0A 4HIBA 4CQ8A 4Q22A 3W37A 1V03A 1WZKA 2F9RA 5I3DA 4PRTA 3G0SA 3OZYA 1KR1A 4XD3A 4AEOA 3EGJA 3FAXA 1ZBKA 3RU8X 3H4WA 1GT8A 2C1GA 4BF5A 2WOQA 3PZMA 3RLGA 3QJAA 1LL4A 1VHCA 1GONA 1SZFA 3W74A 3SSJA 4TVCA 2P8CA 2TPSA 2HVNA 3MSYA 3W3OA 1SSDA 4TU1A 4BY3A 2XISA 4J3SA 3WH8A 4B9YA 5I3HA 1B54A 4LEQA 3POHA 4QLJA 2OPJA 4ALDA 5AYBA 5E93A 2ON3A 4ZBCA 3AICA 4O12A 3DI0A 3GHSA 5IFPA 3TMQA 4LX4A 4UR8A 4UFIA 1TJPA 4PL2A 7PTDA 1V6VA 3RU6A 3ZS4A 3OLEA 3RAOA 4CU7A 1WBJA 4I5UA 1SQ7A 3VDAA 1IWAA 4UOZA 1W5PA 2CZVA 3IIOA 4N42A 4W89A 2WNWA 2PWEA 4HHMA 3DCPA 2XVKA 4Z1YA 5C55A 3VD7A 3PTQA 4FLQA 4V33A 3VNMA 4QHRA 2GFTA 3T42A 3WQWA 1MUMA 3PAOA 3HMCA 2Y63A 2W62A 4K8GA 4S3KA 1QOQA 4DJEC 1JCMP 2IMRA 2PWGA 5CSRA 5EMKA 1UOZA 3L66A 2XSAA 3LBOA 4U33A 4JKKA 4PMUA 3UZXA 4PCNA 3S5OA 3M4HA 4UTMA 3AS3A 2B0MA 1WKEA 4LANA 3L5LA 4P8WA 5AHEA 3T1GA 1MQRA 3W82A 3WUFA 4NXKA 1CTNA 3DFNA 1UUMA 3G1HA 1DWJM 2V5CA 4Y7EA 4GX9A 2XGBA 1R2TA 3QVQA 2TRSA 3G1XA 3GFXA 5CG7A 4LS1A 3O07A 1W1B1 2VEMA 3VXGA 3CYVA 1CX9A 2PGWA 1FDZA 3W24A 4GLEA 3LBMA 3TWAA 1KA9F 1LQ2A 4AAJA 3G1VA 3AIWA 1H7XA 1DXFA 4NUWA 3OTRA 4KF1A 3CZLA 4NRRA 5HINA 2Y88A 1AZ2A 2G96A 3CZKA 3B0YA 2FDSA 2DZBA 4S3GA 3ITLA 1KXHA 3CT2A 4O19A 5HA7A 3RX2A 1G7VA 2QW5A 1F6KA 4XZ9A 3OLGA 3QRHA 2E1DA 2J4GA 4KIEA 3FW6A 2JKAA 1WDWA 3WY1A 3BGAA 1TRIA 3DXIA 2E5CA 3KLKA 3NGJA 2V2DA 4WDWA 1OZMA 9XIMA 1P5BA 4QLLA 3WL1A 1C93A 4Q7NA 3L21A 4AMAA 1JYNA 1SVDA 1A5BA 2J9ZA 1BKSA 1PJ9A 4OV4A 3KM8A 3E5PA 1MW3A 1E0VA 1UR2A 1FRBA 3ARUA 1GOKA 4US5A 3S1VA 3AWNA 3AXXA 1UQZA 1LROA 4Z1DA 1SJBA 2HQAA 1XV8A 2POZA 4X9YA 4Q8WA 1VFTA 3DHFA 1OX5A 4MWAC 3F03K 4LUTA 4DPQA 1U1UA 3GAYA 5C5YA 3PBYA 5BCAA 1NU5A 4A21A 3E6EA 2CZFA 5HPOA 3AWOA 1Q2SA 4UQEA 2J24A 1O94A 1WZLA 3IVTA 1IWBA 2WC3A 3T2OA 4LUTB 3FYPA 1GOIA 2E40A 4LUSB 2E3ZA 3T0TA 2BP1A 4Q7IA 3WQFA 3BLPX 4IFKB 1W31A 2Y85A 2Z25A 4FOKA 1PZ0A 3BWWA 3UFYA 4HNOA 2QLYA 4KT2A 1VYRA 3AIVA 1EEPA 1Z6KA 2VZVA 2Y5EA 3BLFA 3FOKA 1QAPA 2DT0A 1KFKA 4LAOA 1VS1A 3VGFA 2FH6A 3TQVA 1TUFA 3AROA 4JIPA 4JX5A 1LUCA 4HTBA 3OJGA 3G3DA 2VWSA 2OSWA 2IKGA 3AU6A 3NYZA 2ZX6A 3MV01 1US3A 3PUGA 4RPQA 2JE8A 1ZL1A 3QZEA 3L5MA 3QW4B 4PUEA 5D9OA 3LQLA 3LRKA 1LRTA 4RNIA 4WJXA 1OT1A 1V51A 4W4QA 4YN5A 1UH4A 1JF6A 3W81A 1JFXA 3T0CA 3AUJA 2CWNA 1LM1A 4FP1A 1HQTA 3QMTA 4O4WA 4K6AA 5IRPA 3USZA 1V4YA 2BODX 2DV0A 2PTZA 3D46A 2OGYA 5CGTA 3LGGA 4JEJA 1ME8A 4A22A 4V15A 3MBDA 3D6NA 5BU6A 1ZCOA 2HS6A 2PDCA 1EP1A 4C6EA 3FGCB 1VFSA 5HUOA 2IKIA 3A12A 3IEBA 4JTHA 4FOUA 1A3XA 4QTGA 2GQ9A 4C90A 1Q6QA 1NFPA 3WLTA 4M24A 3MDWA 2XIJA 3SRKA 3VE9A 3PBMA 2XVNA 1RD5A 4ATDA 3E96A 3H22A 3RX4A 3HGJA 4I7UA 3ZR5A 2XH2A 5HXMA 5T8GA 3ZFHA 1HL8A 3M0ZA 3GX9A 2VZUA 2OGJA 2PPGA 3AIUA 5FJJA 1F3WA 3THUA 4PMNA 2QDGA 5FESA 3FXYA 3V5FA 3VOCA 3UEQA 2PP1A 4KERA 1Y65A 1LL6A 3TIMA 4GYKA 3ZOAA 3EWCA 2JALA 1N8IA 4PTXA 3GG8A 2XSBA 5D32A 3ZM8A 3QY8A 1AD4A 1LLOA 2WJFA 4RDZA 1FWTA 2VO5A 3RUBL 1OHLA 3AJ7A 4MMWA 1JD7A 4B2DA 1EYEA 4WY0B 1XLMA 1E4NA 4HD5A 1NWRA 3DYMA 3TOYA 2OFJA 4OFCA 4O15A 4GQGA 2VFFA 5C0QA 4UTIA 2WVVA 3HG4A 4C6CA 3ABSA 2JBMA 1R30A 3QTPA 2F6KA 1XGDA 4MZ1A 5G4WA 4V1XA 1IGSA 2WZMA 3R79A 1PDYA 3MB9A 4GG9A 3WQVA 4YTUA 1H1YA 1UD2A 1GKRA 2O9RA 3FYYA 1VFUA 3ARTA 3W2KA 4KWOA 4CCZA 1YE4A 4S3DA 4PCFA 3FFSA 1T40A 1VBJA 4XG1A 4ZE4A 4RNHA 1KKRA 3MI2A 3PB2A 4HCLA 1D7KA 1H7NA 3PWAA 4JTCA 1TPEA 1DHKA 4DF1A 3T78A 3NO5A 3QQ0A 3AXKA 1AMKA 1YXYA 1WBHA 3Q2DA 1K7XA 4K1WA 4IPJA 4FF5A 3T6CA 1ISWA 3BDKA 3PR2A 3AXHA 2XSXA 5TQLA 3J7HA 1UKTA 3A13A 5FAGA 3F4DA 3V5CA 3MVTA 4U31A 3VDHA 2Z2UA 1WDPA 4RV3A 1K9EA 2E6YA 1L6WA 4S3CA 4JHMA 5U7SA 3WQEA 4KRUA 2G4JA 1KXVA 7ENLA 4X0VA 3U2EA 3O6AA 2QPUA 2OQHA 2DGAA 2CZEA 1WUFA 1EC7A 1NTHA 1TV8A 4HVXA 3W83A 1L6FA 1JZ2A 4MNMA 4PTWA 1V5XA 3PZTA 5IBXC 5CSYA 1CLKA 2CW6A 4W8AA 3VD5A 1B4EA 5K9DA 3WH5A 3M46A 1GHSA 1T96A 1GVIA 2E09A 1QUMA 5AOUA 2YKKA 1M6JA 1P0BA 3WK1A 4U2YA 1M03A 1V0NA 1WKFA 1X7IA 4PFMA 1DQWA 1HT6A 1HKWA 3QEZA 1ECQA 4RJEA 3SCOA 1K6AA 4IMEA 4LYRA 1NEYA 5D2YA 4J2PA 3N13A 4IIBA 1NWUA 2XM2A 4KBXA 3H54A 2ZXDA 3VX0A 3QZAA 5AECA 1D9EA 3SN1A 3PPCA 1GOOA 1K02A 2PDMA 4AVOA 1HG3A 3PUOA 1UIOA 3NPVA 1VIZA 2ZBTA 4EXAA 3ZT7A 2VFDA 4XO6A 2G50A 3UJRA 3IPWA 2Z7GA 3SUVA 1CGYA 4DHGA 4PCTA 5CLTA 3AJXA 3A5VA 3GM8A 4GIEA 4RPPA 4AEEA 4XUGA 2PLMA 3N3TA 4XKYB 3WJSA 5MHBA 1SZRA 3SRFA 3KL0A 4W7WA 1GPFA 1BRLB 4UZSA 1XIMA 5K9CA 2F84A 5CC7A 5XIMA 2BY2A 3CTLA 4Y8EA 4I7WA 4REQA 3II1A 4RE4A 4D72A 4KRTA 2B7NA 1XYLA 3QPYA 2PWUA 3KX6A 3SAZA 2P3EA 1DP0A 4F8XA 4PMQA 2BVWA 2XDFA 3HQNA 1TPB1 3HPFA 3CAQA 1KTBA 4JY8A 3RLUA 3UWQA 3TW9A 1LG1A 5A6MA 4MAVA 1YE6A 1XYCA 3KBWA 2VGBA 3WF2A 2ZCGA 4PMOA 1DL3A 4AIUA 4B9ZA 2POTA 4RXFA 1UA7A 2CBJA 2PD9A 3TE9A 4LC6A 1TCDA 2Y0FA 2XHYA 3UESA 4JS3A 1NFGA 4AF0A 3V0TA 4JQ2A 4AZ6A 1R5YA 2WSRA 1GTEA 3L68A 1YNQA 1ECEA 3E02A 2TODA 3VKBA 3FAWA 3EEZA 5E70A 1XC4A 1A5MC 3C52A 2X2YA 1MZRA 3LHUA 3TXZA 2GVEA 5AZ0A 1VRDA 4DJDD 4NI8A 3T4WA 3EOEA 4G8TA 4C6OA 4LVDA 4PB3A 4CQDA 4DWSA 2CBUA 5C9RA 1DOSA 2YYUA 2YXGA 1KRCC 1GVYA 4OQVA 2CHNA 2I1OA 2PUZA 1HJQA 1EJUC 3WQ5A 2I7GA 1OBAA 4D6EA 4E3VA 2O92A 2WQDA 2XGIA 1H1ZA 3N9SA 4UTKA 3CEPA 2H9AB 1W3NA 2YZRA 2YBVA 3W7LA 2RJHA 3WLPA 5CPMA 2Z1KA 3G1AA 1GOXA 3B06A 3O7UA 1XIEA 3EEGA 4O8RA 2YFOA 4NY2A 3LRMA 4Z2GA 3DBPA 1PSCA 1SW3A 5AN7A 3MSRA 5BOEA 3UJEA 3EWZA 1LTDA 4IP4A 3SRHA 1JZ6A 5EPDA 4GI8A 4Q4MA 3S1GA 2E68A 1QI5A 2OVLA 3VAVA 4GFIA 1POKA 2OLSA 1E4MM 4QNWA 1W17A 1WKDA 4F0LA 4FNRA 3ZZ1A 2O9PA 1E1CB 2G3IA 1SPQA 4UMAA 4IUOA 5EKYA 3G0XA 1FFRA 4QX4A 3IRDA 1D3HA 4BS0A 2QR6A 4C6FA 2Y4SA 5BMWA 4CD7A 1WPCA 1WDRA 1EQCA 2PGRA 1GK8A 3LCXA 1SJAA 1H7WA 4OHQA 4A8NA 2WAGA 2GSJA 6TIMA 2PU0A 4KKXA 4G1KA 1MYRA 3WG6A 4S39A 4H9VA 3CUIA 3GHTA 5A6SA 2J75A 3T40A 3ANUA 3AOFA 3GIPA 2YCKX 2OYLA 1C8VA 3FK4A 1JCLA 4L4PA 4IMGA 4WOQA 3RM9A 1DJWA 7REQA 4PUMA 3OO2A 3L4XA 2W9MA 3ALFA 1MUCA 3WLSA 5A8OA 1DQUA 3VMOA 2E9LA 1YBQA 3V1HA 3AYSA 2X0YA 4JTDA 3VIKA 4AC7C 4QG9A 3UG5A 2NV1A 3WQ6A 1P0NA 1ME7A 2TSYA 7REQB 2PWHA 1V3LA 1SU5A 3TW6A 3VIGA 1WV2A 5ECUA 3O6YX 1Z89A 3EX4A 1LBLA 1RR2A 1XDMA 2C6QA 3S5SA 3HM7A 1HNYA 4BZYA 1LP6A 5E09A 1EJXC 3H8AA 1EX1A 4DWSC 4DXVA 4DO6A 2HXUA 5CC3A 1BSIA 4H83A 1W2PA 3LLFA 3WLRA 1BTCA 4E2OA 4MNLA 4DZAA 2AMXA 2VZOA 1CLXA 1XRTA 2CXGA 4UFHA 3RCMA 5CG0A 2PA6A 4K1GA 2A4AA 4L4MA 4OOUA 3W9ZA 3GR4A 3NPWA 5BRQA 4MJMA 5T91A 1FH7A 4IXHA 2HVMA 4YVPA 2Z26A 4P61A 3H4GA 5I3JA 1RXOB 2MUCA 3BL3A 3AHVA 3MKCA 4Q4PA 5TF0A 1ZB5A 1FCBA 1S3HA 4DF2A 3CH0A 3MDUA 5EYWA 1Y5XA 3WLJA 3NGFA 4HN8A 7TIMA 2PP0A 5A5WA 4WQ6A 1V3MA 4UFKA 3SM0A 1R46A 4QM1A 4FMVA 1Q4WA 3VIIA 3F1QA 4OBRA 3MO4A 1B3WA 2Q6ZA 4AMCA 3TSDA 1LLWA 1XLGA 4A8LA 5AYIA 2WSKA 3L12A 2P10A 3T2QA 3QQWA 4WXZA 3WF0A 2WQPA 1K8YA 3GLCA 3BJTA 1WAWA 3M0MA 1S46A 2FMNA 2B7PA 3LS9A 2QDHA 3N25A 3GD6A 2ADAA 1GW1A 4HPXA 4QS6A 5HK4A 1XSKA 4BQ5A 5BZAA 3B05A 3ANVA 2DPEA 4ZFCA 1KGWA 3VKKA 4HNVA 3FJ4A 1JCTA 3EX2A 2DQXA 4Q8UA 3S9YA 1S2TA 1QO2A 3DZ1A 3NG3A 1QCWA 2P0OA 3RRXA 4JYFA 3Q4DA 2VZTA 3WQCA 3AMKA 1PX8A 1TTPA 4IQDA 1C91A 4IWWA 2YL9A 3C3UA 1P0EA 2G3FA 4GBUA 1WDSA 3PAJA 3LY0A 1LZOA 2ZXBA 3M0VA 4QDMA 4JKLA 3MHUA 2FYMA 1J18A 4WXYA 3S6DA 2Z1XA 3HPZA 2QNEA 1QASA 2WZTA 3MMUA 2TYSA 2W27A 2W5FA 3NWRA 4ACZA 3PPFA 4DO7A 2IS7A 9XIAA 3PPHA 4A4AA 2PB1A 2ZZ7A 1SZGA 3W1RA 3G1SA 3KRUA 4YIWA 4QRNA 5AHLA 4JHOA 4HHHA 4I8DA 3VPLA 3URNA 2PC4A 1BG4A 2J7DA 3LX9A 4IIHA 3TN6A 3HV8A 3GHRA 3PG9A 5TD4A 1HUVA 3SURA 1BPLB 5AYXA 4UCFA 4P7NA 4EAYA 3VDBA 2Y8UA 3LPPA 3MBFA 4PR4A 1PBGA 4K39A 4FLRA 5A3HA 1CI1A 1E43A 1OFQA 4OIFA 4AZCA 2CLOA 1D3GA 2WB5A 3H2NA 2C1HA 4US6A 1O7AA 2IKHA 2A85A 1EC8A 1FCQA 1LORA 5EY5A 4LNCA 4DPPA 3O8AA 1V3IA 5JUVA 3W7PA 1SFJA 2X16A 2ODOA 2HPMA 3B8TA 2BDQA 3C0SA 1E0WA 3A3WA 3EYPA 4MB4A 2ZA1A 1E51A 4GKTA 4PMXA 1VEMA 1EF2A 3R25A 4JNMA 2VVSA 4L1GA 4UWMA 1X97A 4JD4A 1OFPA 4J3ZA 4ILSA 3K13A 1S5VA 2HJPA 6A3HA 3CL6A 3SECA 1XLFA 3Q37A 4M29A 1KGUA 3A22A 2EPMX 2DT3A 3WF3A 2NUYA 3INPA 4POCA 3RGTA 3GXMA 1XDJA 2WLYA 2Z1VA 3TLQA 4CQBA 2WV8A 3ERPA 1MEIA 1OFBA 3BLOA 3EKLA 3OYXA 2ZC8A 5BRPA 4UCGA 1GOQA 3M7SA 5BXRA 1PHQA 1TJ0A 1JCNA 3CHFA 3FV9A 3N4EA 2V63A 3W75A 2PZNA 2PDGA 2V3FA 3NZ1A 4O0KA 3GR7A 3CPRA 3IGXA 1A0EA 1O95A 4HNLA 3PK7A 1UQYA 4IJBA 2A1YA 1MXGA 2W4XA 3GAKA 5B80A 1XICA 2VNCA 4BFAA 3TZFA 3KVKA 2IKJA 1TWIA 2BVTA 5A8QA 1UWIA 1RV8A 2XVPA 1E0UA 2XIIA 4Y9AA 1NP2A 1JXKA 4DAIA 5CJMA 1X6UA 1DJZA 4Z17A 1VZWA 1VBUA 4XZIA 4JX6A 1PZ3A 2QS8A 3OZOA 1QNSA 1VJZA 4W8LA 4DI8A 4Z1AA 3ONBA 3S83A 4EPEC 6REQB 3R2GA 2UZ9A 1HGWA 1PKLA 3TFXA 4TOQA 5HATA 1RY8A 1I4NA 1LRNA 4KEUA 5IXEA 3QKZA 1Q66A 1FDYA 3QHMA 1OGBA 3LERA 1BVZA 2FVKA 2WMGA 1K8XA 1J5SA 1K8ZA 2Z0IA 1YLVA 1BKHA 4QSFA 2NSOA 5FIPA 1UZ1A 4PTVA 3VNKA 3CEUA 3QBUA 1XSJA 4Z2HA 3W7MA 1OX6A 1YDOA 2DSUA 5A6BA 1A5CA 4NP7A 5FJPA 1EIXA 5J5DA 1B1YA 1VLWA 5JIPA 3TXVA 1G5AA 1OT2A 3DBNA 2CYGA 2FH8A 3W87A 3BLLA 1UPPA 4PA8A 1WXJA 3UGRA 1R3WA 4REQB 1FWAC 2VT0A 3U8GA 3CIXA 3BLEA 4XTIA 1RJQA 1XBZA 1SR9A 3L0GA 1U1HA 1CIUA 3V4BA 2G41A 2ZZ4A 3TSMA 4FR6A 1XP3A 3FLUA 1DTUA 4DBWA 3TEVA 3SFWA 4J35A 3W7NA 3STGA 3LGEA 1S5TA 3W0KA 1NWTA 4GO9A 3KP0A 4H6QA 4AY7A 2HK1A 3W28A 3GTFA 3W7RA 5HQLA 2QJGA 1C29A 3VTRA 1J79A 4UNIA 2KX9A 2ATMA 5FAJA 1A3HA 3F5LA 1R85A 5I6SA 4GNVA 2XFRA 3DYPA 4HK6A 3CXOA 4D8AA 2E1WA 5LZLA 3D5HA 1PZ1A 4JYDA 1UWAA 3R4IA 5DT7A 2XZ9A 3TYZA 1G94A 1Q5MA 3CLMA 2V2HA 5CPLA 1W8SA 4J3TA 1JPIA 4F48A 5LGZA 3LV6A 4RZ4A 2Q3RA 3ORWA 2FFCA 1LOQA 1TUXA 2J66A 8A3HA 3A3HA 2E5DA 2VM8A 4H9TA 4F2TA 2H3DA 1DJNA 1XLIA 2VCCA 4LC8A 3EBVA 2G3MA 2TMDA 3WKZA 2WZIA 2YX0A 4IX0A 2ZZ6A 4HU8A 4XK2A 4P8XA 4JIIX 4AWUA 3ZJ7A 1R7OA 1BF6A 4J27A 2VEIA 1S2VA 4NAEB 1OEPA 3B9DA 1JEZA 1OWQA 2WHMA 3NOYA 3KUMA 2QUNA 1WCGA 3M07A 1GYNA 1HJSA 2PDQA 2ZDRA 2BY0A 2C3ZA 3EXRA 1ODZA 1A5KC 3CQHA 3UF9A 4GQ0A 1YRRA 4O1FA 1D8CA 3BAKA 3C0JA 3UWVA 2PDYA 1O12A 2NQJA 5BXTA 1AG1O 2VMFA 3W29A 1A3WA 2E7FA 4HGXA 2CLLA 3NTYA 4K36A 3FN9A 1I60A 1T5AA 1YXCA 3CUZA 4LUSA 1XUUA 1WP6A 4HJFA 5IM51 5FACA 4MJZA 1YNYA 3K4AA 4A3UA 3ZJKA 1YDYA 3T4CA 4Z0JA 5BNKA 4C5ZA 2J9YA 3D3AA 4HP5A 1SO6A 1UB3A 2WLZA 4CQCA 2ZVIA 3AALA 1KGXA 2GK1A 3NL2A 3TP4A 4S3JA 3R11A 1OM0A 3GXTA 4ZO7A 2G3JA 4KEMA 2WCSA 3R58A 1ZBWA 3AZRA 4UFMA 3SCNA 5K2ZA 3E2VA 3IVUA 1V6TA 2I5QA 3TC6A 3K5XA 1GZ1A 3LRLA 4US5D 4TTUA 1ENUA 1F3EA 4H04A 5HWNA 3UERA 3CV1A 1JCXA 1K9FA 2P88A 2GUUA 2Z29A 4TUFA 3R8HA 5ABTA 3G1DA 5C54A 3PFMA 5BMXA 3NSXA 1O66A 1J0JA 5TIMA 4OUEA 3PTDA 2PDWA 3LHVA 1E3XA 3LDVA 4A8IA 1TX0A 3NPXA 2I17A 4E4PA 3WNPA 3PZIA 1HKKA 5A6KA 3GHUA 1ADOA 3CWHA 4FNTA 3VOFA 4DWSB 1V0LA 3R13A 3ME3A 4MLRA 3DAQA 3AYRA 4YJ5A 3HBLA 4HMNA 4IG2A 2QJJA 1WZAA 2DJLA 2YA1A 1EO5A 3VILA 2PEVA 4LUIA 2V3EA 3MUY1 1FWNA 3SUSA 4ZB0A 2OZTA 2CHOA 3FJNA 1NSJA 4J9JA 2QJIA 4KFNA 3DECA 3TZNA 3U9IA 2BVYA 1G4SA 3BAWA 1GKQA 4QLKA 1JDCA 1IXQA 3W1TA 4H6EA 3TU9A 4HZ8A 3K4DA 4Y9NA 4DXXA 1B3VA 1SMAA 2FB3A 2I56A 4HZ7A 2CLPA 2WWDA 5DCEA 5G1TA 3HQOA 4Q6XA 3WBYA 4PMDA 3ITXA 4MB3A 3VMPA 1IGWA 4JFUA 1J2BA 3WBWA 2PDFA 3S5YA 2DJXA 2QCGA 1KM1A 2Y62A 1L6SA 5M1TA 1AH4A 2J8TA 3MS8A 2ZC1A 2V5LA 4N9EA 4XV0A 3UNDA 3ZO9A 3AQUA 3ZSSA 2WHJA 2J6VA 3WJXA 2EKCA 3PANA 2XN1A 3USBA 1HO4A 4PMZA 3LZ5A 3KWXA 2CLHA 1DJGA 1XRFA 1QW8A 3KVJA 4QJ3B 5A8NA 1EUAA 2WO5A 1L2UA 1BWKA 2X0SA 3C0LA 1TPFA 4F40A 4QBXA 2HNEA 1UC4A 1R3RA 2WWCA 1O1ZA 2F2HA 2PTXA 1E6ZA 1OF8A 3M16A 3WF4A 1HTIA 4P8UA 3IAPA 3CK5A 4KRZA 4XD5A 5CEWA 1OB0A 2VOTA 1V3JA 1F3TA 1TPWA 3ZR4A 1GW9A 5I2UA 3ITYA 3NUKA 2ZWZA 3VIFA 4ADUA 4YVXA 4CD5A 5AVNA 3VZZA 3GDTA 4ZTYA 3B0PA 2PLKA 1WUEA 3BW2A 1LRQA 2WMIA 4RZ6A 4RW3A 2QULA 5F4XA 4WDXA 4AG0A 1UZDA 4X61A 1J8VA 3BQ6A 4G2DA 5DT5A 5DRIA 2IPWA 2DU2A 3LHTA 4XVEA 4PYSA 3B9NA 4LQ1A 4IQLA 4X60A 2NVAA 1H3GA 1NWSA 4OWGA 6PTDA 5IDZA 2EHHA 1J0HA 1V3HA 3NZRA 2V67A 4H4IA 3PSVA 1UR9A 1A4LA 1BD0A 1XBYA 1W9BM 1W54A 1HKJA 4LF1A 2EPLX 2C18A 3TH6A 3PUEA 3C2RA 3LEPA 1R9ZA 3SY5A 1SO4A 3S9IA 2HSAA 3SCRA 3W07A 3HB9A 3E2RA 3WUBA 3PBGA 1YXDA 3W7QA 2J25A 3WNKA 1VFFA 1GVEA 3WMBA 1XIJA 2ZX5A 4W88A 3IV8A 4TV6A 1UYQA 1GUVA 2GSEA 3VCNA 3IIZA 2OKTA 4Y2WA 2E5BA 3QFEA 1AL8A 5HMFA 5LNWA 4BCEA 4LAKA 4A05A 2GVLA 4YCOA 4XWUA 3R0KA 3SDOA 3M47A 1VBRA 4AZ5A 3SZ8A 3I6TA 3VFLA 3SIMA 3GU1A 2ZICA 4DY1A 3MZ2A 5C9XA 1J6OA 4XKYA 1W1TA 2QV4A 5ENLA 3QGKC 4UTUA 3LPOA 3TN4A 5DCDA 4JQ4A 2EPKX 4AU0A 4ZE5A 2XIBA 4Y8FA 3KLLA 4EWJA 2FTYA 1HVQA 3WQDA 3OW1A 3C2YA 3H23A 5B7ZA 1PIGA 3H12A 4NNBA 5FI8A 4IJRA 4GX8A 2GLKA 2ZRYA 3TFCA 3T07A 4CNPA 4V2XA 4ECLA 4CNSA 2FLIA 3H53A 3VFCA 5LNSA 1AL7A 4L1XA 2NVCA 4ZMGA 1UP0A 2GDUA 4QEHA 1UKQA 1RPXA 3NOEA 3TONA 1ZU8A 3QY6A 1TQJA 3JZEA 1Z8AA 2B4GA 1NDWA 4C65A 3UA4A 3NM3A 3W38A 5D9NA 5CZKA 4XKMA 1ELSA 5H8UA 3N2TA 1F74A 3UPMA 1XXXA 4ATWA 4MB5A 5GJMA 1REQA 4JTIA 1YADA 3ZVHA 1JD9A 4HCHA 4NIRA 4GMEA 3CAWA 5G2IA 3BCDA 2WMFA 3HFYA 2PWDA 3V1PA 1UD6A 2J88A 3WNMA 2A3EA 2Q02A 3NZGA 3LI1A 3ATZA 3H2AA 2REQB 3QPZA 3WENA 1N7KA 2WKJA 4MLJA 1TKKA 5AC4A 3N04A 5G4EA 3SR7A 3M5YA 1UUQA 5A2BA 2HCVA 3QYSA 2C15A 1VH7A 3GQYA 5CJ5A 1P0KA 1RJRA 3JW7A 1OFAA 1M7PA 1JRCA 2QUMA 1GZGA 5EBAA 3EMZA 2WMHA 2AL2A 2OELA 3GTXA 5E0KA 2Y5JA 4GNKB 2FB2A 3L4ZA 4U3AA 2ZX7A 2JKEA 2PGEA 3W85A 3DGBA 1XCXA 4MGGA 2ZRXA 4GCAA 3BMVA 4UQ9A 2YSWA 3UZZA 1Q2RA 3MQTA 3F2DA 1QHZA 1KV8A 5DFAA 4TX9A 4DIAA 4LJ3A 3BW3A 1R3TA 3R94A 3HO8A 4Q8NA 5A95A 3NQ2A 3L0NA 1AQMA 2PWFA 3P81A 5BW6A 4JTSA 5KZDA 4WKAA 3URQA 2CZDA 5CCZA 2ZZ3A 3NPUA 2DSVA 1NM9A 1HJXA 3CTTA 3FIGA 1HIZA 1BGGA 1PS9A 4ZZ9A 2VVNA 1T99A 1OD8A 5DF0A 1FDJA 5C6MA 3V0SA 1ZJAA 3KOYA 1CBGA 4JTKA 1FHLA 3WL0A 2F6UA 1XYZA 2PRMA 2Y8VA 4FF7A 3RYSA 3TC3A 1YDNA 5K4XA 1ISVA 3OZMA 3W70A 1KXQA 2GGHA 1CNVA 1OCNA 2EG6A 4I8YA 3QH2A 3LTPA 4MPQA 1I1XA 2R82A 1XLDA 1G4EA 3TROA 3W27A 3CU2A 4NI3A 1CEOA 1EH9A 1R38A 2Z1SA 2F2KA 1JNEA 4Z42C 3W73A 1DJQA 1GQIA 1TWWA 4IPPA 4YS1A 3B8WA 3RRAA 3V18A 1D8WA 4WK9A 3UG4A 4GJIA 2A3AA 4B5SA 1YNPA 1P43A 4AHPA 1RVKA 3JRKA 4MWAD 1DKWA 1FFQA 1OG0A 1PAMA 3WK2A 4L1WA 1JPKA 4LUYA 1UD8A 1KWGA 1MFVA 1US2A 4MKNA 4JDBA 1QK0A 3O6DA 4MWAE 1ZBCA 4JCLA 4J2MA 2GJLA 3MYOA 1BYCA 3WZ0E 3B97A 3I6EA 4WCJA 4B5NA 1KRBC 3H7RA 2XN0A 2OO0A 1IT8A 2GUYA 5AZ1A 4EF8A 3LA4A 1U30A 5LNUA 3BCJA 2ZOXA 4O17A 1LQAA 2FZNA 3GXNA 4LBSA 3URBA 3N2MA 1I6NA 3N18A 3N4FA 4MY9A 3HTWA 5EBUA 3IRSA 2WM0A 3FHAA 1ZCCA 2WMKA 2D0GA 1KRMA 1V6YA 3ITVA 3T8LA 3CMJA 4MJ2A 4HPJA 3I3EA 4JFSA 4G9PA 3KW3A 3KFTA 3P6LA 1EOMA 1AQFA 2WSPA 4HYWA 3UA3A 3WBAA 3VC6A 1XG4A 3UCDA 3VIPA 4IGSA 3M5VA 2QQ6A 2C91A 3W7OA 2C71A 4MWAA 2WHKA 2VCAA 6XIAA 4R34A 1TE1A 3ES7A 3LB0A 4KESA 1UBSA 4GIYA 3RF9A 1UPMB