5C7HA

Crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 in complex with nadph
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
281
structure length
281
Chain Sequence
b'MHDPIPTIAFPDGRKVPALGQGTWRMGENRAKTADEVRSLQTGLDLGMTLIDTAEMYGDGAAERIVGEAIKGRRDEAFVVSKVLPSNASRAGTVAACERSLRNLGIDCVDLYLLHWRGGYPLAETVAAFEELKKAGKIRAWGVSNFDVDDMEELSAVPDGGNVAANQVLYNLARRGIEFDLLPRCRAQGVPVMAYSPLDEGRLLHDADLIHIAKAHQATPAQVALAFLKTCSGVISIPKTGSPERARENRDAMDIHLTTENLAELDRHFPPPRRKTRLEVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase
publication title Crystal structure of aldo-keto reductase from Sinorhizobium meliloti 1021 in complex with NADPH
rcsb
source organism Rhizobium meliloti (strain 1021)
molecule tags Oxidoreductase
total genus 107
structure length 281
sequence length 281
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 5c7hA00
1EL3A 1YNPA 2INZA 2NVCA 3Q65A 3CAVA 4MHBA 3H7RA 1YNQA 2WZTA 4JQAA 1AH4A 3M64A 5DANA 1PWLA 4LBSA 2WZMA 4JTDA 1ZQ5A 1YE4A 4JQ2A 1RY8A 3O0KA 3UZZA 3LQLA 3O3RA 4PRRA 3Q67A 4JTQA 2PF8A 4LB4A 3UWEA 1Z9AA 4YVPA 4JQ4A 1S1PA 2IQDA 2PDQA 1PYFA 4JQ3A 2IKHA 4G5DA 5LIYX 4HBKA 3BCJA 1QRQA 4WDXA 2CLPA 2HEJA 4AUBA 4GIEA 4XO7A 1K8CA 2DUXA 4PUWA 4EXBA 4IJCA 2FGBA 1VP5A 1UR3M 2QXWA 2BP1A 2PDMA 2AGTA 2P5NA 2IQ0A 4XZNX 1RALA 3COTA 3DN5A 3WBWA 1ZGDA 3LD5A 3LQGA 1A80A 5LIKX 2ACSA 2ALRA 1EF3A 3LUTA 1SM9A 4JTAA 1C9WA 4WEVX 3LNMA 2HV5A 1XGDA 2IS7A 2PDPA 3B3DA 2HDJA 3NTYA 2I16A 3ERPA 2ISFA 3R94A 3R8GA 4RPQA 3CV7A 2PDYA 4WDWA 3FX4A 1XF0A 4H7CA 4PRTA 3ONCA 2PDBA 2PDCA 3V0SA 2A79A 2PDNA 3ONBA 3CMFA 1EKOA 2HVOA 1PZ1A 4H8NA 3R6IA 4L1XA 2DV0A 3LBOA 3GHRA 4XO6A 2IKIA 4HMNA 1Q5MA 1X98A 2BGSA 3H4GA 3BUVA 5KETA 1T40A 4WDTA 3UGRA 4GACA 4WGHA 3GHSA 4EXAA 3WBYA 5HA7A 2IPWA 1PZ0A 3MB9A 2PDLA 1US0A 2VDGA 4LAZA 3EB4A 3S3GA 1LQAA 4JQ1A 4PR4A 1HW6A 2INEA 2PEVA 4PMJA 1XJBA 2PDHA 4PUUA 3P2VA 3UZXA 3DOPA 1IHIA 4DBSA 3C3UA 4XZHA 3BURA 1GVEA 4XK2A 1ADSA 1AFSA 5JH2A 4R9OA 4WRHA 3V35A 4DBWA 3EB3A 3H7UA 3G5EA 2PD9A 4F40A 4ICCX 1X97A 3R8HA 4QXIA 2FZ8A 4LB3A 2ACUA 2PZNA 3LZ3A 3T42A 3VXGA 3LN3A 1MI3A 1ZSXA 3CASA 1JEZA 3LENA 3U2CA 2HE5A 4WDUA 3R58A 3UZYA 3N2TA 1AZ1A 5C7HA 3F7JA 2R9RA 4XZMX 3R43A 2PDXA 1Z89A 3LZ5A 1X96A 1AH0A 2NVDA 4GCAA 3CV6A 3RX3A 2ACRA 3LEPA 4JTRA 4XAPA 4QBXA 3UZWA 4GQGA 3G1RA 1IEIA 5HNUA 1ZUAX 4L1WA 3WG6A 1VBJA 4YU1A 4YVVA 4FALA 3UYIA 2PDIA 3CAQA 1QWKA 2J8TA 3RX4A 4YS1A 1T41A 4XVEA 1Q13A 4IJRA 2FZBA 4LAUA 4IGSA 4DZ5A 2DUZA 1S2CA 4LBRA 2PD5A 2BGQA 3UFYA 3UG8A 2PDFA 3BV7A 1S2AA 3FJNA 1MRQA 3N6QA 4NKCA 2PFHA 4Q3MA 2PDKA 3RX2A 2IPGA 1FRBA 2PDWA 3V36A 4DBUA 5AZ0A 3M0IA 1MZRA 2PDUA 2HE8A 4ASTA 1M9HA 1AH3A 4I5XA 4GQ0A 2IKJA 4GA8A 4JIHA 5LIWX 4JTCA 4XVDA 4OTKA 3M4HA 1Z3NA 3EAUA 4QR6A 3V0TA 3WBXA 2IPJA 3D3FA 3GUGA 1AZ2A 1HQTA 2F2KA 1RY0A 4GABA 3MC5A 4XZLX 1R38A 1Z8AA 4FZIA 4Q7BA 2IKGA 2I17A 4JIIX 1YE6A 5JH1A 3QKZA 4JIRA 3UP8A 2HVNA 2PDJA 5HNTA 4YVXA 4FAMA 2C91A 2PDGA 3WCZA 2FZDA 3R7MA 5LIUX 1EXBA 5AZ1A 2F38A 4FA3A 1OG6A 2FZ9A 2IPFA 3GHTA 3GHUA 1PWMA 4QX4A 2FVLA 1LWIA 2ACQA 1J96A 5M2FX 4XZIA 1S1RA 3KRBA 5LIXX 2R24A 4ZFCA 3V0UA
chains in the Genus database with same CATH superfamily
1EL3A 1G69A 1OM0A 4MTVA 1TPDA 1U22A 3S2NA 3KVJA 4UOQA 2J47A 5CH9A 2OPJA 2DGAA 3VIOA 1LYXA 4HMDA 4HCHA 1KLYA 2X1SA 4WXZA 4YYCA 3NQDA 1W9BM 2PB1A 4Z2IA 3O3RA 1XHGA 2IXUA 1PCKA 2QCNA 3B8DA 2QV4A 3P80A 1CDGA 1C3FA 4RLIA 3MI6A 3NYZA 1R86A 4ZQMA 2VZTA 3SM0A 3CMJA 4HJFA 1NVMA 2C1GA 2WMIB 2QJNA 1BYDA 1GHRA 2FTPA 4QEHA 4D6HA 4MWAE 2VXNA 3MKVA 1RA0A 1B5TA 1OFDA 4MB4A 4P2VA 5GPRA 2YBUA 3GRIA 4S2CA 4HPXA 2I5IA 3AU2A 4OBSA 3ZT7A 1XLDA 3L21A 3W07A 3AIWA 4H6KA 3GR8A 2D22A 3N13A 4M6UA 5F1UA 3BLIA 2ISDA 4GYPC 1I1WA 3PM6A 4B5TA 3VKDA 4AIOA 4B3KA 1LQ2A 1EF3A 3E38A 5M17A 4W87A 1TE6A 1LL7A 3CZEA 3AS0A 3DFTA 5AN7A 2PWFA 4ZTXA 4IFRA 1UR9A 1FCUA 4XB3A 4B5VA 1WZKA 2REQB 5IBXC 3KX6A 3LBCA 5FD0A 4RW5A 2REQA 1D3GA 1HG3A 1QVBA 3DI0A 1IIGA 2INFA 3YPIA 2NLIA 1EGZA 1E6QM 3MQTA 3G1HA 4GKLA 1K7XA 1G67A 1OSEA 3WN6A 5CPQA 3IIXA 3IJ8A 2LLEA 1R2SA 2P76A 3MKKA 1PXGA 1MXGA 3LCWA 1R3VA 5FSEC 1WDWA 4WVXA 1QK0A 1X7FA 1MFUA 2WBKA 2GSJA 1EGVA 2NQZA 4MADA 3TCSA 1QPKA 3EOLA 4ZOAA 3WNOA 3GHSA 4HPJA 1UD3A 1EWDA 2BWGA 4XBKA 3W1LA 1JULA 2CWNA 2IPWA 2OLHA 3PULA 1BEUA 5BXRA 2VRKA 1NWRA 4XD4A 2JIEA 4Q8PA 4Q8OA 1EF2A 3PPFA 2PCEA 1WQ5A 4DRSA 3LU2A 3PTKA 3EPOA 5BNKA 4DBSA 1XGEA 2I1OA 4BEUA 4MPKA 3L2MA 1YHTA 2QZRA 4DF1A 2V2CA 3FSUA 2B7OA 1XV8A 5LNRA 1WZLA 3UGVA 3VD7A 2D3LA 4D9PA 2VEIA 2Y7EA 4JKMA 1OFBA 5FJJA 1N7KA 1TG7A 1M53A 1YDOA 2C15A 3C0SA 5H8MA 1L6FA 3SCRA 3CHCA 4S3CA 3NYDA 4WSKA 4HNCA 3WDJA 3M47A 2POTA 4Z2GA 3IUIA 4GWEA 1D3CA 3ZMRA 3TR9A 4FLQA 2J27A 3ARRA 1FDZA 1K6WA 5REQB 1U1HA 5A2AA 1CI1A 3LEPA 5REQA 4ZQNA 4NAEB 2ZRUA 3SJ3A 2CBVA 2ZKMX 1V6YA 3N9RA 4LF1A 1L2QA 4NAEA 3N34A 1PX4A 3T4WA 3HGSA 5HNUA 4E2VA 4CQDA 1QCWA 1ZUAX 1F4AA 1H61A 1QPQA 3AS1A 4ZO7A 2CXEA 4LCQA 1J5SA 2XVLA 4D2JA 1XL9A 1PIGA 4O4WA 4CEUC 1A3WA 4RNHA 2PWEA 3GNNA 3LK6A 3QGKC 2G97A 4C6NA 1SPQA 1OT1A 4IGSA 4DZ5A 4IX0A 1RLDA 3PZVA 3ARTA 1MEHA 4A2RA 4LOCA 1EIBA 2BGQA 5BWFA 4ZBCA 4B9YA 2CITA 1P43A 2X1TA 3IS4A 2ZTKA 2E77A 3QEZA 3LI0A 3THDA 3EWCA 4UTTA 2DSKA 1LOSA 2WCAA 1W9UA 1XPYA 4TX9A 2OO0A 3CQHA 3CPGA 3B97A 3BZGA 5FAGA 5FESA 3GKAA 2YJQA 2CERA 1KCLA 1O95A 3EWZA 3SAZA 4FLRA 1GCYA 8RUCA 2E9LA 3PBGA 3PHAA 1XICA 3VGEA 1KBLA 1QNSA 1C92A 1H7PA 3MSGA 3CEPA 3F4NA 3WJWA 4OV4A 3QPZA 4E38A 4GY0A 4JIHA 1SSGA 4HOXA 4XZBA 3W38A 3ARYA 1QWGA 3GFZA 1QW8A 3B9EA 4EF8A 3W6LA 2GVEA 5EPDA 2ZZ2A 1US3A 4ZQPA 4XZLX 3A5FA 3FA5A 4FLOA 2I9UA 4JICA 4ROQA 1XRVA 1HVXA 1X6UA 4HVXA 2X0HA 3UCCA 1RHCA 4UTKA 5D38A 5H8PA 4US6A 2GSHA 1M3UA 3B8TA 3B9AA 4L6OA 2FZNA 2BNJA 2PU0A 1EXBA 1VD6A 4JY9A 4EACA 4RDZA 5AZ1A 4DJED 1IT0A 3B8IA 4GH1A 4WOZA 4GQQA 4EWND 2J78A 7REQB 5TQLA 3T8QA 1W2PA 7REQA 4LAOA 4QTGA 1GEHA 3K8LA 4YYFA 1H1NA 1ONXA 3E1F1 4TTUA 1LRQA 2DIKA 3AYRA 1TWWA 2VKZG 4LYRA 1EIXA 1Q63A 1ELSA 3PJTA 4NZ5A 1FWJC 1ZJIA 2WVUA 2QCEA 1UWTA 3VM7A 3F2CA 3UVIA 4F3HA 3QFWA 1Q2RA 2HMCA 1JFHA 1HJQA 3TDFA 1NQ6A 3TQKA 5HUPA 1VPQA 4H7ZA 4P8VA 1ICQA 3MSDA 1JDCA 3BJTA 4TOQA 5D9OA 5EFFA 4C1NB 1OY0A 3PN8A 1UKPA 3AU6A 4C1NA 3P3BA 2QCLA 4K37A 4XISA 4QAIA 1DIEA 3I65A 3S4TA 4OQVA 2MANA 1W3IA 3WQPA 3F4DA 1TWZA 3RRAA 4GUGA 1KV5A 3CQKA 4INFA 1XUZA 2WW5A 1PUDA 2VZSA 1K6AA 1JGMA 1Q8AA 4XO7A 3W83A 2JALA 4LNYA 3WL0A 2NWRA 4GI8A 2AGKA 4EXBA 3PJWA 4PEKA 4JDBA 4CVUA 2WKLA 3GXNA 4BCEA 2B0MA 3ARVA 1TJPA 5A6AA 2WMKA 1TSIA 2BVWA 2W61A 1EDGA 4MNMA 4A6GA 3UWYA 2VUYA 3E2SA 1LRNA 3AJXA 4DELA 3QV9A 5DRCA 2YXOA 1I9CB 7A3HA 5PTDA 2VEMA 3IVTA 2DP3A 4BF9A 3FSTA 3SADA 4C65A 3NSMA 5G2HA 3I68A 2HDJA 4X2RA 1BF2A 4UCFA 4MYXA 2XFWA 3W9ZA 1XKYA 4PRTA 3LRKA 1YPIA 4AHPA 5IDZA 2PDCA 4PTMA 1ZCCA 2QJHA 3T08A 4KBXA 1RCQA 1KFBA 3QVQA 3GLCA 1BFNA 3W7RA 1W2VA 4O0KA 4KFOA 4CU8A 2WZEA 4EANA 2DV0A 3NM3A 3VGGA 1UA7A 4HNTA 4L9YA 3GG8A 2VHLA 2OWXA 1ZENA 4IP7A 2FHFA 4Q7NA 4JN8A 3BO9A 2Z1KA 4DBEA 1EO7A 4D8AA 1QR7A 5DY2A 1OCBA 4O1BA 3M46A 1IWPA 1V02A 1VEPA 2MNRA 3ZSTA 2QGHA 2P53A 1GVOA 3P82A 3KTSA 3PZNA 5T9BG 5A2BA 1WKYA 3DFSA 4HN8A 1AUSL 3A6OA 3RAOA 5CBIA 3L67A 1Q6OA 3EX3A 3G6LA 2HJPA 2E9MA 1R87A 3IK4A 2Z2UA 2GOUA 3K8KA 4JTEA 4AD1A 3B9DA 1VJSA 1FP9A 2VFHA 3PZGA 1OFAA 4FNTA 1A5UA 1DJNA 4UTHA 1RP8A 3EWYA 2ACUA 5CQ1A 1CGTA 1B9ZA 5A3HA 3UF9A 1BWKA 2V69A 2H9AB 1BG4A 2QJIA 1W5OA 1MEIA 3N14A 2X1RA 3ZT5A 3GNOA 2H9AA 1HGYA 3ALGA 3UR2A 4OOZA 3E5BA 3VILA 1J5TA 4AF0B 4R9XA 1HFBA 3ABZA 4AF0A 4ORMA 1K1DA 1LLWA 3ABSA 4XQ6A 3D5HA 1HTIA 4KWSA 4KESA 1TRDA 3MZNA 2J4GA 3DBNA 1TJ2A 3WJXA 2DFAA 4XAGA 4JCLA 1BTCA 1C91A 3GH7A 3B9OA 4D1IA 3H2EA 4QQUA 4UR9A 2A6NA 4ICNA 4XWUA 2DUZA 3EKGA 1ITUA 1HO4A 3VDCA 3FKRA 3QH2A 2YCKX 3UQNA 4IH3A 3NQAA 1B90A 1Q8JA 4W93A 1JCTA 1E71M 3KS6A 2WLYA 3H7VA 5JXQA 3RJXA 2FGLA 4BFAA 1UR8A 7ODCA 2ZXQA 3EX2A 2CZ5A 4B5SA 1YIXA 2XFFA 4A05A 4GBDA 2F9RA 2Q6ZA 4KF1A 1KWGA 3RO8A 3AI0A 5K3VA 2E40A 4UXDA 3QQ0A 1SO6A 2VENA 2QCGA 4JXCA 3QOMA 3NFUA 3UZ5A 2PTXA 4UTMA 2Y1HA 1OGBA 4YTUA 1S2WA 5JMUA 4MFEA 1FCBA 1RXOB 1M03A 3ABRA 4LV9A 1VHNA 3NGJA 4ZFMA 1RY0A 4I9JA 3DHPA 1TFVA 4PMXA 1IYXA 5HWNA 1I2RA 1NELA 2J7FA 2BOGX 1QW7A 3NQEA 3BW2A 3TJIA 4RZBA 1GUVA 3T0BA 3SIZA 1AD4A 1JZ2A 2QNEA 4CNTA 3SEPA 2NWSA 1X1OA 1JXJA 4LVBA 4UTTC 4H9MA 5A8PA 1J0YA 4JEJA 4BS0A 1Y5XA 4XUYA 5FACA 1EH9A 3NO5A 5HNNA 3BVJA 4B3LA 2PTYA 3LHWA 4JD4A 5HULA 2NVAA 1JZ8A 4JOMA 4QDMA 4UNKA 1HJUA 5EMYA 4A8NA 1E40A 3KVKA 5HQLA 1XCFA 1Q6RA 2D3NA 3W1XA 3EOUA 3H7RA 3NJ3A 4DJFA 1F8MA 1W5PA 3CV2A 5FJUA 3U9IA 1JQVA 3RHGA 2WJEA 2C18A 4XBSA 2HS6A 1BLIA 1PIIA 3D6NA 3VOCA 4H9UA 2DJXA 3NSXA 3M1ZA 4JNYA 7TAAA 2FYMA 4UMBA 2YW3A 1PDYA 2PC4A 3BSHA 1EUNA 3PK7A 5LA1A 4JQ3A 2OSXA 3FIGA 1XISA 1XRTA 3IPWA 3O6DA 3BTNA 3MSRA 1S5TA 4K3ZA 1KA9F 2VFIA 4S39A 2VC9A 1T0OA 1RVGA 1DTUA 2Q8ZA 4Z2KA 3S6DA 3M0KA 2EG6A 3PR2A 1MRAA 4HU4A 3KBMA 2PDMA 3BLEA 3OIXA 1YDVA 3QMSA 4H9YA 3NQCA 4KPLA 3GX9A 4BA0A 3WJZA 1F4HA 1V93A 4MUPA 3H8AA 2PGRA 2OU4A 2BLEA 3NVDA 4QITA 2ALRA 1KKRA 2QS8A 1B9BA 4JTSA 4YNGA 1XDLA 1E9LA 2Z1BA 3HJEA 2VD8A 3EXTA 4W8BA 4P7NA 1CLKA 5LYRA 2NV1A 1XINA 3PJXA 4O1DA 2J9XA 1V08A 1ZBVA 1YEYA 3ARSA 3UR5A 3K5XA 1L9WA 4M1RA 4UTUA 1W17A 4Y8EA 1B3WA 1FWBC 4ZR8A 1W54A 2PURA 1HL2A 3HZ3A 7TIMA 2CIPA 1GVQA 1UC5A 4JX6A 3LBOA 4UTFA 1W31A 2VCBA 3QMTA 4KRTA 5I3FA 3GXDA 2C6QA 1XIGA 3BSMA 1Q45A 1M01A 2OEKA 2D2GA 2FTWA 3AC0A 3F1QA 5AC5A 1P5BA 3ECQA 4A2SA 5EB8A 2WKGA 5ABEA 2Z2AA 3VPLA 5A8MA 3OO2A 1TQJA 3IJIA 4HA4A 3IK2A 1KCZA 4XTDA 1DJYA 3EB4A 2VDHA 3E74A 1LQAA 1NDYA 4EVZA 3BG9A 4A22A 1UWUA 3BSGA 3FEMA 3OEXA 2NT1A 2VTFA 4PMJA 1XJBA 3MCNA 4BQ4A 1YNYA 1LBFA 4R7WA 1IZCA 2X8RA 3G1FA 1AJZA 4FHAA 3GIYA 4H6QA 1E6SM 3NURA 3FKKA 4BF7A 1M41A 3DXIA 3WLLA 1J11A 1FHVA 1UD6A 1XG4A 1A47A 3LTPA 3QHMA 3RPTA 3CGTA 4O0QA 2GQAA 1NH6A 4IMEA 4JL2A 3CEUA 3GFXA 4GCXA 1OFPA 1ZSXA 3URBA 4AMCA 3U2CA 4B9ZA 4GX8A 4HA0A 3I6RA 2Z25A 4CN1A 2XINA 3HO8A 1FH9A 4YWSA 3UWQA 2PWGA 1AH0A 4GCAA 3T44A 4KWWA 3WQVA 1OCJA 1SU5A 4DAFA 3HG2A 1B31A 2ISWA 2QCFA 3GR4A 3ZR6A 4XKYB 2V81A 3V18A 3ELFA 1BPLB 4XKYA 7ENLA 3U4FA 2FFIA 3VVGA 3RN6A 1EA0A 2VL4A 2Q01A 3AIVA 2OYKA 5EL1A 3EMCA 3PB2A 1ISZA 3BW3A 2FPYA 1L6SA 4H41A 4HHLA 4DO5A 2J8TA 2V63A 2YLLA 5E0CA 4PTWA 4H7VA 1KGUA 4FOUA 4UQDA 5D2YA 1C8YA 3O15A 5FF7A 4LVGA 3FXGA 4XX6A 1AQ0A 3NQVA 4CCZA 3BAKA 1X39A 2PP0A 1ZBCA 1XIBA 5XINA 2CFFA 5DCDA 3IARA 3EB2A 3SR7A 2FB3A 1KFKA 3FJNA 4C6DA 3GNXA 1JF5A 4HA1A 4GIYA 4C6FA 2UY2A 1XC6A 4C1LA 5AC8A 4Q6JA 4M8UA 3PAOA 3W86A 5G2IA 3ZLHA 5K4XA 1JRBA 1ADDA 3W3OA 4BY3A 5H91A 4LRTA 1QI3A 3V4BA 2E7FA 1NJJA 2HNEA 4UFHA 2D23A 3DU0A 3M4HA 4Q4PA 3CB8A 1I75A 4CQ9A 1O12A 2ATSA 2OOGA 1UUOA 2P1FA 2F2KA 2OELA 5AYBA 4Q22A 3KWSA 3B8WA 4BI5A 2WYSA 3CL8A 3WEOA 4F4RA 1YTEA 2PP1A 5AHEA 1ZAJA 1VZWA 4QG6A 1OB0A 4IICA 2XH7A 5CBJA 2V5LA 3FNDA 2XIOA 1R2TA 3C2VA 2PDGA 4R53A 4UTIA 1AG1O 1UQYA 4QX4A 2C19A 4KWOA 2VX5A 1XR2A 2GDQA 3H24A 4I7WA 4XZIA 2PGFA 4CQCA 1EB3A 5TNVA 2R24A 3SCTA 4PH6A 1WZMA 1HKIA 4Z1BA 4UTWA 1YNPA 2OZTA 4FX8A 4J35A 4I7UA 4NI8A 1C29A 3O2LA 2PTDA 3M5XA 3CUZA 4RCXA 1FWTA 4V1YA 3M16A 1AH4A 1KM2A 1VCVA 4WF7A 1PWLA 2NQ9A 3AZSA 4J9JA 3NQFA 3IVSA 1LM1A 2WXDM 1XSJA 1D2KA 1TTIA 3H55A 1DPMA 5ABGA 4PFMA 1FUYA 3W2UA 3TW6A 5C70A 1Z42A 4L61A 3A5VA 2XSBA 3IGUA 1S1PA 2HXUA 1VQTA 4UCGA 1C8QA 2O92A 3QV7A 5D37A 4Q6XA 1B3VA 1DTNA 1WAUA 1SZGA 1J8VA 3CPRA 4DYEA 3W2JA 4ZOCA 4NY2A 3TC7A 3UYCA 3AMKA 3Q37A 4A3HA 2QUUA 4NF7A 5FJPA 4AZ5A 1WYIA 4MYAA 4W84A 4OGZA 1QNPA 4ZO6A 3L68A 2Z1XA 4RNFA 4JCMA 4UQEA 1H7OA 3WL1A 1HP5A 3TC3A 2P8BA 2E6AA 4GXMA 2WMHA 2BFGA 1W5NA 3NPUA 3O6YX 2QXWA 1DJWA 3LHYA 2VVNA 4XD5A 2OKOA 5FJOA 4HNOA 1CYGA 4U5IA 4XZNX 3WQEA 3WNMA 3MZ2A 1FWWA 1QDSA 1IEVA 4L4LA 1XP3A 1VPYA 2XGBA 4DJFC 3DG7A 1ME8A 4V28A 3QR1A 1OADA 1G01A 2PE4A 3E0FA 1OQFA 3FS2A 2ANUA 2QPSA 2A5HA 1QO5A 1XGDA 2IS7A 1R2RA 1W3HA 4ZE5A 2Z00A 3VKBA 1DWGM 1IWBA 5LSMA 5C9WA 2Z6IA 1RH9A 4P7RA 1VLWA 4KEUA 3CV7A 1TJ1A 3AHZA 4K68A 4P7LA 3ARPA 3TYAA 4HMEA 2EJ1A 1KXHA 2BMBA 4S3JA 2Q3OA 4AZBA 4FNQA 3HF3A 3MV01 4FR6A 1CNVA 1L0PA 3W29A 2GPTA 3FHQA 4K7VA 5DEZA 2VR5A 1X98A 1JNDA 1FKWA 2YSWA 1CCWB 3N04A 3SGUA 4Z17A 3Q4DA 2W4XA 3UGRA 4UR8A 3CUFA 1TV3A 4E5TA 3DHFA 3PTMA 5D32A 2PWVA 4K6AA 2CLHA 3UJEA 3MT1A 1GKRA 1OC7A 1G6CA 4LANA 3PC0A 3P5ZA 4WHBA 3JRKA 2PDLA 4JY8A 2I5GA 3S3GA 3NXLA 3LGEA 4LCRA 1PVNA 1D8WA 4PUJA 2GUYA 1IQ8A 1AVAA 1VS1A 5HJLA 1BYAA 4F9JA 2ZXAA 3EA3A 2WSRA 4O8AA 2R1MA 3RMEA 1IZJA 1N8WA 2ABBA 3U0HA 4D8ZA 1Q6EA 2Z1WA 2CLOA 2CZFA 3B8VA 4H6RA 4OU1A 3B05A 3W7LA 3CZKA 4O54A 5FKYA 4AYGA 1KRCC 1QHZA 4RXFA 1XG3A 3OU8A 1E4MM 4ICCX 2DY3A 4L4OA 3O1NA 1AL8A 2YKKA 3N4EA 1IXOA 1PKLA 4PC8A 3TYEA 3NDYA 3IRSA 5CC7A 5D09A 3SCVA 1MO0A 3GW3A 1E4LA 4TTGA 2C7FA 3CHDA 1F8IA 2XTKA 3C2OA 3WIJA 1F5ZA 3L65A 1FFRA 5C2CA 2GDVA 1QNRA 3FV9A 4NYYA 3SRDA 3W2MA 3SFKA 1Y0EA 3QOKA 1EJSC 4NHVA 2NVDA 1XIFA 4WQ6A 4W7VA 2G3FA 2G96A 3AXXA 3S9IA 5FIPA 4E6MA 2Z7GA 3PUEA 3A24A 1UZDA 4HQVA 1IZKA 1P6BA 3T1GA 1S38A 1EBGA 1T99A 4P7QA 1FWRA 4GPNA 5EYWA 1Q2SA 1K9EA 3FYYA 2I9EA 3RR4A 1XM3A 5CLTA 1SMDA 3SCOA 3MYOA 2G95A 1XLHA 1ZBKA 3TE9A 3ZR5A 4FO4A 1K7EA 2BG5A 4E2OA 1BF6A 1KNWA 4IJBA 2QVHA 3TLLA 5ABFB 4N7QA 3WFAA 4MB3A 1FWNA 2G37A 2PZ0A 5ABFA 4L4MA 1RSCA 4W88A 2DEPA 4ZENA 2V0TA 2IQTA 1G94A 2OT0A 3CB3A 2ZVIA 1LJYA 2PI6A 3PPCA 3C0LA 4O17A 1AODA 3TFXA 3Q45A 2VEFA 1S2AA 4QJ3B 4S3AA 3O07A 4JIQA 5JIWA 2G3MA 1J6OA 3EEGA 4W8LA 4PL1A 3KWXA 2XZ9A 1UBPC 4NZ1A 4FNPA 5FJTA 4Z42C 3GG0A 3W82A 6XIMA 2FHBA 3M0IA 1UP0A 2Y5JA 3DHUA 4Q8MA 2UZ9A 3W7IA 4V27A 3FAWA 4ASTA 3PUGA 1QNQA 1P1XA 1FH7A 3AYTA 3KVMA 1KRMA 3UJSA 4XVDA 4AWSA 1HXJA 1SMAA 3M9YA 1PO9A 3GVRA 3R89A 4R33A 2ZX7A 4Q4KA 1Z48A 1RLCL 4M6QA 3OPSA 2WJDA 4ONVA 1JDAA 3BANA 4FZIA 3VIGA 3AXMA 1PKMA 4LAMA 1U1UA 3KZSA 3PBMA 4KRZA 3RCMA 3HA1A 4AQLA 1W3KA 4WSJA 4NZFA 1MXSA 4JTTA 5KZMA 2G41A 3EOSA 1MQRA 1BKSA 1EO5A 3WQ8A 2F38A 4MFDA 3GHTA 1RBLA 1OG0A 2UY4A 3S8HA 4ZSUA 4GJIA 1DV7A 1LWIA 4NJHA 1E5JA 1MQPA 3WBAA 1DQWA 1PZ3A 4HT3A 4NRSA 2O7SA 2XISA 4HYWA 4IPPA 4H9XA 3H2CA 1L8PA 3W27A 4DPQA 4RE2A 3CIVA 4C7DA 4A8LA 3HM7A 3CV1A 4IUGA 1EBHA 1XBVA 3U5YA 4J2PA 1J01A 4H8HA 5BOEA 2WC4A 2WZTA 3KBNA 2YZ5A 3BE7A 1GPFA 2WZMA 3WQCA 1ZPTA 1UWAA 2Y2WA 3SDOA 3O0KA 3QY7A 4C6BA 3WMBA 4TV5A 1GQJA 4JYEA 2WJFA 3W0KA 1E0TA 2AMGA 1ONRA 1GK8A 2YL9A 5EMMA 3QMRA 3IIZA 5C9XA 1BKHA 2JQXA 2D20A 2HK0A 1SZFA 3BXWA 2YDQA 3OBKA 1I4NA 2VOTA 2FQIA 4POCA 1BD0A 2E6FA 1Z32X 2D0FA 3O05A 1HUVA 1CZ1A 1KQZA 2CXGA 4QSFA 5TAOA 1K8CA 2DW7A 2CLKA 4PUWA 3JUGA 2JF6A 3STFA 4U5KA 4WJXA 3QBUA 1VP5A 2X41A 8XIAA 4UTWC 1L6GA 4G6CA 3A9BA 3LLXA 2OX4A 4GO9A 1DVJA 1N55A 3CYVA 1NP0A 3W1PA 1PTDA 3WBWA 3NQBA 3W88A 3IJ7A 4IMGA 4IOTA 2YW4A 4PBFA 4EIVA 1RJRA 3WF1A 4Z1AA 1MW1A 1SM9A 2NUXA 4LBUA 1CLXA 2UY5A 1GVSA 3AHYA 2YB4A 1U83A 4IGNA 5HQMA 3ERPA 2JGYA 3MP5A 4B16A 4FF7A 1OGSA 3UPWA 4MWAB 3AYSA 1F9CA 2D0HA 2NX3A 5AC6A 4GI4A 2ZC8A 4YTRA 3VDHA 1DP0A 1C8XA 3WFZA 3DDMA 1G0CA 2J8FA 3MP4A 5AYXA 4R3UA 5CGQA 1R3RA 4QISA 1TMQA 1AMKA 3TR2A 1QOPA 4LU0A 3H70A 2OZ3A 4GOAA 2V30A 2X1IA 4HPGA 3RIKA 3W7KA 1K9TA 1GYNA 1AJ2A 3PFRA 3LOTA 1JXKA 3ZVIA 1FWHC 3WNPA 5HANA 4OBTA 3CQJA 3VCRA 1PHQA 1GVIA 1R0MA 3DFHA 1MDRA 4CN4A 3WBYA 3EYPA 2BHYA 1CGUA 4J4KA 3H2AA 3IJ6A 5DELA 4AZGA 1EQPA 1F3TA 1O5KA 3W7EA 2Y0FA 5DMMA 3WNKA 3KW3A 4JQ1A 3V5FA 3CHEA 2CLLA 2INEA 3AOFA 4KEMA 4GUFA 2HPIA 3MUY1 3VDBA 3UZXA 2FKPA 5JIPA 1UC4A 1CPUA 5CCZA 2ZUVA 3I6EA 2CCRA 3S1XA 1F6YA 1WA3A 1NU5A 1ZTVA 3QGVA 4NAFB 2F7FA 2FTYA 4Q4QA 2F6UA 5CAHA 4AWEA 3CL6A 1GJPA 1SO3A 4NAFA 3WUFA 3N2XA 1GGOA 1P6WA 3LZ3A 5AHMA 6XIAA 4NUWA 3LN3A 1LL4A 3CHVA 1NF7A 4DNHA 4LYPA 4QNWA 1TV4A 2ZCGA 1J10A 1KM0A 3CASA 3N3TA 2GJNA 3DFNA 2W62A 4YL2A 1V3MA 4NXKA 3W76A 3WUBA 1QI0A 3NQ2A 4MDPA 3C2EA 3EDFA 5C7HA 2VOMA 5CC5A 4O8RA 5EFDA 1BYCA 2Y7GA 3WF0A 1ONEA 3AFBA 1VYRA 3NL5A 1TPH1 1O66A 3CUHA 1RCXB 3G1RA 5FF0A 1IEIA 2XU2A 3AAMA 1NFPA 3SCSA 3NGFA 1R7OA 4L1WA 3WG6A 3W7HA 3JS3A 1PB0A 4M3PA 1W1PA 5DMLA 1XWYA 3KOYA 3XISA 4H19A 4LV4A 4REQB 3ATYA 4OWGA 2G3JA 3GYEA 1W1ZA 4Q4SA 1EUAA 1Q6DA 4GMEA 2NSOA 2ZX8A 1ZFJA 5I3IA 4LBRA 5LZLA 3F2BA 3BZJA 3VDGA 4WK9A 2H90A 1ZL1A 4PMVA 2H3BA 3I7RA 3ITGA 2GVGA 3BQ6A 4GQBA 4OOUA 1VBUA 2Y6ZA 3CJPA 1H62A 1DIDA 2GJPA 3ATZA 2CLMA 4S3FA 2Z1SA 3GTXA 4AIBA 2PFHA 1JDFA 2JKPA 4M19A 3SBFA 1MXDA 2VFGA 1X1NA 2XPKA 1PX8A 1GZ1A 4Y9OA 3ABQA 1W1YA 1K02A 2YOCA 3P93A 2ZC1A 2ZA2A 1HKVA 2BASA 3V1HA 4PGLA 4OE7A 2CHRA 4JL1A 4DM2A 1A5AA 3WLSA 1W56A 1NDZA 3V0TA 1R46A 3UA3A 4O4VA 1HNYA 5I3KA 3GUGA 2R91A 1GWJA 3O63A 1J4EA 3MC5A 1YYAA 4HYVA 3LHUA 2DU2A 2FH6A 2Y85A 2I17A 3TJ4A 3B0PA 1Q85A 1F76A 3PG9A 4JIRA 4YMZA 3VE7A 3WLNA 3V1PA 4C6PA 3B0VC 3O0FA 3CWNA 3LXAA 2V9DA 3QYSA 4LYQA 4QJ4B 5I3GA 3SI9A 3FA3A 1R7AA 4WJ8A 1ECEA 5IOBA 2VX7A 2G4FA 1HP4A 3IRDA 1KB3A 3DG3A 4Z0SA 5F4XA 4EOUA 5LGZA 5A8OA 4DUVA 2J25A 1VAHA 4UBPC 5GNXA 1KLZA 1VKFA 2JKAA 1VEOA 5E9AA 3VIJA 1BVZA 2DSWA 3T78A 3HU7A 3M44A 4GJ1A 1PSCA 2G3NA 1OGGA 1K8ZA 1VJZA 3MPGA 2JIWA 4WIWA 3W1TA 2J6VA 2PS2A 4QGCA 4LH8A 5CC3A 5EBUA 3VX1A 2R1PA 2W3ZA 4LS1A 5I6SA 3L0GA 4IP4A 4IIHA 2WHJA 4N02A 1O60A 1SVDA 3HV9A 4AAJA 4DN1A 3HG3A 5FF4A 3TC6A 4WDXA 3T7VA 4AUBA 4HSNA 3GU1A 2PLJA 5G1YA 4GIEA 1Q4WA 3WFLA 2Y89A 5FJRA 4U31A 2D1ZA 1JPMA 1FY6A 3URNA 4QDPA 1FOBA 1KKOA 2ISVA 4G1KA 7XIMA 2Q02A 3LI1A 4PB4A 4DY1A 4RPPA 3W26A 3PZIA 3EDKA 3U2ZA 3UNTA 3QFEA 1ZGDA 2WPGA 3BOXA 4EX4A 1BYBA 2VC7A 3T55A 4Y9MA 5CG0A 2ZXBA 3GG1A 2G4JA 3GZ3A 4URIA 3QJAA 1M7XA 3GW0A 2HV5A 1H7XA 4B4FA 1IEXA 5C5YA 3KCLA 2PCQA 4KWVA 3KP1A 3VTRA 3T0CA 3L4WA 3WLIA 2FJKA 4CNPA 1H0IA 3KOXA 1OF8A 5I77A 1UWRA 1XF0A 3E02A 2RHGA 1CGWA 7PTDA 3V3WA 4K7YA 3TXVA 3CMFA 2PPGA 3GDMA 2HVOA 5CZKA 1FBAA 4WUIA 1TTJA 3ZJ8A 1MEWA 3KBSA 4TV6A 5E5CA 1V3LA 2XIBA 1PL9A 3UR8A 3S5NA 4B2DA 4O53A 3UD6A 3DHDA 2YXXA 4XG1A 1IR1A 1KBKA 3KS5A 3TQPA 5GNYA 2XN0A 3C6CA 5K2ZA 4AISA 3BAXA 2Y62A 4K39A 1SYTA 5FCZA 4AD3A 3KP0A 2DQWA 2V5JA 3MP3A 2QF7A 4PMZA 3K4AA 5HMSA 1HKJA 4Q33A 3NCOA 4EAMA 3PSWA 1TR9A 5J8LA 1ZZMA 2XVPA 1SFTA 4IX2A 5LNUA 3FCPA 4AEEA 5MF5A 1XYMA 4HCLA 1F07A 4ZE4A 4L65A 4NZ4A 1AFSA 1TJRA 4R9OA 3V35A 3DFQA 2PD9A 1E73M 4CQBA 4QXIA 4ROPA 1J0IA 1O5QA 5AFDA 1XUUA 1FDJA 4NJIA 4C6MA 3PF3A 1C93A 3G1DA 3MANA 2ASHA 3AS3A 3N2TA 4LXFA 3P62A 2VZOA 4O1AA 3W1NA 2WZHA 3EA1A 2IUZA 4PULA 1ZCOA 3T81A 1KQYA 5LA0A 1V4YA 3LGDA 1HL8A 5I3JA 3RLGA 1H7RA 2Z28A 3GU2A 1UASA 9CGTA 4LGXA 1BVNP 2PC8A 3C2YA 2PDIA 4JYDA 4GNVA 1SJBA 4YTTA 6CGTA 2ZADA 3UJFA 4KEVA 2AL2B 1UWIA 4JX5A 3ZLGA 5IFTA 4GY1A 5BXPA 2AL2A 2NV9A 1GYMA 1AQMA 3QTGA 4WR3A 2CWXA 3GG7A 4BZYA 2GWNA 4F0RA 3VNLA 2PP3A 4M0XA 5AY7A 3IUDA 1JCJA 5G2WA 3JZUA 3OLIA 1ZALA 2QV5A 4L9ZA 1UOKA 3PTQA 2HBVA 3P7YA 1ONWA 2D69A 2QEZA 3QTPA 3VKKA 1TIWA 3MUIA 1A0DA 4JFWA 4PODA 3P61A 3VNZA 2DSVA 3UJ2A 2OQLA 4NKCA 5DCBA 1EJUC 2FVKA 2BX7A 1XLIA 3VDAA 1QUMA 1U1JA 1IGWA 4LVFA 4DBUA 2O0TA 2NQ5A 4GISA 3S5YA 4FXRA 1SZRA 2WNNA 4JTLA 2RDUA 2QCMA 1ODZA 1DJIA 3NPXA 3VKAA 2D2OA 4FK9A 4NSBA 4JTJA 3T0AA 4CNOA 1HQTA 2PRMA 1R8LA 1SSDA 4U2ZA 1W5MA 4RNJA 1CLVA 1M68A 4Q4OA 1EJVC 1TUXA 2C3ZA 5DLCA 4Q4MA 3SCPA 3I4EA 4IP5A 1DKWA 3UP8A 4YHGA 2WHLA 3HGRA 4F48A 3C4UA 2X1UA 4J5NA 3ANYA 3BWWA 2BDQA 3GDKA 3CQ0A 3ABOA 4LC8A 4L1GA 2E6DA 4YPJA 2CETA 4P7OA 1LG1A 4WKHA 3ZLFA 4R88A 2C14A 4P61A 4FB7A 1U30A 3PVFA 2GVLA 5A8QA 1QT1A 4K8GA 3OLDA 1V3KA 3WK2A 4AB4A 2HISA 4G7FA 3LSCA 4IXXA 2QCCA 1ISWA 3T2PA 4H4IA 4PBGA 3VC5A 4IZGA 4RV3A 3VO0A 3WF4A 5LNVA 4IHCA 5AOUA 4PRRA 1E0VA 4JTQA 3OVQA 1RVKA 1QNVA 3F4CA 2QAPA 4GINA 1LORA 1EPXA 2YDAA 3IAQA 2DZVA 4J27A 1NFGA 4JN7A 2R82A 5FF2A 4LEQA 3UG5A 2BXYA 4H00A 3OVRA 4PTVA 4YIWA 2YCLB 2W92A 3MHUA 5CPSA 5D05A 3N2CA 4DWSB 2I5QA 1QRQA 1NM9A 3T0TA 7CGTA 4DWSA 1ADOA 3NEVA 3EWUA 4QG8A 3IGHX 3M7SA 4A8IA 3LERA 2GDUA 3HQNA 3VIPA 3RGTA 5A6JA 1WDPA 1TMHA 3ARXA 2RJGA 3ZJ6A 2VX4A 4Y6GA 2IQ0A 1CWYA 3DN5A 3KZPA 1H5VA 4IWWA 2CLEA 1CW2A 2HSAA 1D7KA 3VNKA 4FNRA 4L6DA 4MNJA 3M6YA 3W22A 2E9BA 1P0KA 3MS8A 4ADUA 4Z2HA 4BEQA 4XAZA 1V79A 3LSBA 1G4PA 4KCTA 3NOEA 4MPQA 1A3HA 1AK5A 5CBBA 1W32A 4H9TA 1E9ZB 4HMCA 4Q8WA 1LOQA 5AB3A 4UFLA 5DCEA 3WEZA 3R2GA 2YYTA 3L4VA 2VFEA 5HQEA 1ALDA 1PHWA 2Y61A 4MVAA 4DX3A 1DQXA 1BHGA 2PDBA 3BDKA 1SZEA 2ZBTA 1IWAA 2ZZ3A 1VGAA 3GVQA 2BZNA 3PWGA 1YBQB 3A21A 2V5KA 1KR0A 3WQWA 1J93A 4GX9A 1KRAC 1YBQA 4AWTA 2QUMA 1RJQA 1H7WA 4PEEA 5F4SA 9XIMA 3AMLA 4GVHA 4P8UA 4AVOA 1JR1A 1ZP3A 4GXWA 1NSJA 4UUIA 2OTDA 4IIBA 1D9EA 1K9FA 4IPIA 4WZHA 4O1EA 3WMSA 4WGHA 3SSJA 2VGIA 1UP3A 2YFOA 5HPOA 1VBHA 3GH5A 2OXNA 4C7GA 4CCEA 4B91A 4LAKA 1RK6A 4O13A 1G4SA 4WXYA 3SUSA 3RM4A 4Z1DA 4HN4A 2NX9A 3GY1A 3TQVA 3GYCA 2Y70A 1MVYA 3A3XA 5DXXA 1QHOA 3NUKA 2DSZA 1VBGA 4FMVA 1Y8BA 3GTIA 1B3YA 3ARZA 4GY7A 3DOPA 2WC3A 2VDIA 4DNMA 1TKKA 1DYSA 4J7RA 5A69A 1JZ5A 1JJKA 1MUWA 2W66A 1MZHA 4PMUA 5C55A 3L4XA 4DBWA 5JQ9A 2GUUA 2XN2A 2VGBA 3R8HA 3I3BA 2EPMX 4M7TA 2UY3A 1OFEA 3KUMA 3UESA 1FA2A 2NQJA 1MI3A 5H1WA 4GNJA 1EGMA 1JCLA 1E1FA 2OEMA 2HE5A 4KW2A 1F2JA 1LLOA 2QPXA 3T9PA 5C6MA 4XZMX 1PYMA 2O56A 5E1QA 1YTKA 2ACRA 5HDRA 4A3RA 4QBXA 3TIMA 3UZWA 2WBGA 5BZAA 4DUXA 5AVHA 1YW1A 1JI2A 2RDXA 5GJMA 4MGGA 3RRXA 1W9XA 4UFMA 2VM8A 2E8ZA 1TR1A 1J9YA 1WPCA 4EPKA 1GVFA 1A0EA 1WCGA 2OWCA 3RX4A 4LVAA 3V16A 1U5VA 1GKPA 1QOQA 2XIIA 3FW6A 3IAPA 5XIMA 1X7IA 1XC4A 3G3DA 4PE8A 2EO7A 5D4YA 2HRWA 2XM2A 5A6LA 3BL3A 1OEPA 1NWSA 2EPKX 3PTDA 5GVJA 4X3ZA 1BGAA 1LCOA 4H9VA 1EP2A 2G5WA 2ZRZA 4NP7A 1GW1A 3S83A 3LB0A 2GSEA 1FWAC 4AD5A 2FPVA 3T05A 2OODA 1U5HA 4EK7A 2YX0A 2J66A 3RX2A 1FX6A 2VNCA 2PDWA 1W9PA 2E09A 4LFYA 3VFCA 4KCVA 4OJYA 4EWJA 4QAWA 5HMDA 3NA8A 3AZRA 2ADAA 2GGIA 4GQ0A 1I1XA 4MLJA 3W7MA 1NWTA 2X05A 1VFHA 4JTIA 4I9MA 4MNKA 1LG2A 2GWGA 3SGGA 3L9CA 5LHEA 2FDSA 3U7VA 1E6RA 1L8NA 3H2NA 2YL5A 2VR2A 4Q4RA 3CTLA 1VRXA 1JYVA 2EAWA 1VH7A 2QDDA 3O6AA 3LHZA 4AIUA 4DIAA 3T2QA 3QKZA 4GYKA 3LPOA 3VOIA 4PZVA 3SN0A 9XIAA 2CBJA 4WCJA 3OP2A 1ESWA 1OG6A 4QEEA 5KZDA 5K9CA 3CYJA 4AEOA 3WSUA 1PWMA 1NDVA 3GK0A 3LCGA 4AW7A 1JDDA 2A0NA 3TSDA 1EC7A 2ZTJA 1V6UA 1OX4B 3MI3A 1JDEA 3IV8A 4GD0A 1XBXA 4DQWA 1OX4A 1WB0A 3QY8A 2V5CA 4TUFA 4MG4A 1XIDA 4PCNA 5LXEA 3BLDA 4F9DA 3QW3A 3CAVA 2WM1A 3BK0A 3AISA 4E8CA 2A1YA 4E2DA 4X22A 1UR0A 4IT1A 1T7LA 4GJJA 4LBSA 3PUDA 1LF1A 4XTIA 1IXNA 5D2XA 1YE4A 1BAGA 5I3HA 4O52A 3RITA 4IMAA 1YDYA 3VC6A 2NQLA 4F8XA 4C6EA 5JU6A 2E1WA 5RUBA 5A6BD 4Z0JA 3BC9A 2IQDA 1HKKA 3NL6A 2WCSA 1O4UA 3EWWA 1EHAA 3KOWA 1PYFA 2V6AA 3AO0A 3NOYA 3S1VA 2OX1A 2EKCA 3EKZA 5BOFA 4Q7IA 4PBEA 2HEJA 5DRIA 2GVJA 1P0DA 3ZQ9A 2BSLA 5T8GA 5F2IA 2ZUWA 1GQNA 4AXNA 2H8ZA 1AJ0A 3W7QA 4GIRA 3WY1A 5B80A 1EZWA 4RK8A 3TCEA 2V2HA 3NDOA 2VP8A 4DXVA 5FOOA 1UR3M 3PPGA 2PODA 2C79A 5G5IA 4PCPA 4LPCA 2CZDA 4KMQA 1RALA 3FN9A 3TKFA 4L6HA 2WHMA 3NEHA 4QS6A 1VFFA 4AEFA 3URQA 1OZMA 3KXQA 1HO1A 4WLCA 4HU0A 3TN6A 1TPFA 2VWSA 3LUTA 2XVNA 2PDPA 2QUVA 2DJLA 3P5YA 3LX9A 1NF0A 3TAKA 3KCJA 3EZ4A 1ICSA 2H6RA 5D9MA 3R8GA 4F0LA 4HSHA 4MY9A 3WJSA 1KWKA 1RQBA 1FWIC 4IIFA 5K9DA 2A79A 3MO4A 3QV8A 2Y8KA 3E9AA 5EKYA 2X7WA 2V3EA 4DWSC 4TO8A 4D6FA 3VKCA 1B2YA 3AIUA 4RE4A 2QKFA 1HL9A 4K38A 2ZDSA 4X63A 4WDTA 3NPWA 2L5HA 4GACA 4RE0A 3APYA 1W1B1 3N9SA 2WOQA 3W7GA 3N12A 2AMXA 1OK6A 1OJXA 3ME3A 3LS9A 2NXIA 2VZUA 3BJFA 1BGGA 1GONA 5AYIA 4IGHA 2WAGA 4IPNB 3W2KA 2NUYA 2E1DA 3P2VA 3L0NA 3TA9A 3MCMA 4OZOA 1B30A 3UW6A 1SFSA 2V8ZA 3FXYA 4D1JA 1XIIA 1RR2A 3B04A 5EMJA 2ATMA 3BMWA 4ADSA 2J88A 1JL8A 2OG9A 3W25A 4GVGA 1YADA 1X97A 4TXEA 3WH6A 5IFPA 1VFTA 3WELA 4LUSB 4MJ4A 4LUSA 3L5MA 1RD5A 4UNIA 1WXYA 3PAJA 3OOQA 5CPTA 3QC0A 1ZBWA 3ITLA 3F4WA 4YCOA 1HF6A 3CAWA 3LMYA 1KTCA 4FNUA 2E4TA 1Q6CA 5KZEA 4JTRA 4ZXOA 3WQ6A 4Y8FA 2Z0IA 1SO5A 2NSXA 6TAAA 1WXZA 3E5PA 4V1XA 1DWJM 1CB2A 1A0CA 3TYBA 5D2WA 4NILA 1XD0A 4J40A 3N2OA 4XIAA 5D9PA 1SJAA 3PS7A 4Y96A 1W1IE 1UW9A 5M5DA 4G7EB 2TODA 1EYWA 4PMDA 5G4WA 1AW1A 1UUQA 2ODOA 4G7EA 4UB9A 5A8GA 1RD6A 2OZ8A 4DM1A 4JPGA 1NOFA 5BXTA 3AUJA 2PD5A 1F6PA 1XX1A 4MF4A 1Z7AA 3SSZA 3UXAA 1Q6QA 3R11A 3S5SA 3OJGA 1XFCA 2A3AA 1S5WA 3OBAA 4C6OA 3B0UX 3IIOA 3OG2A 3NR0A 3T07A 3CQIA 3MY9A 4ZZ9A 4Q3MA 3RO6A 1C7SA 2V5BA 3MUCA 3STCA 1QPNA 2KAUC 4M6PA 1FRBA 3TX9A 1XD1A 2VQTA 2FVMA 1JPHA 4EKJA 4Y7EA 2AQWA 1ZAIA 3VFLA 1KCXA 4FI4A 2VGFA 2GOKA 1TWSA 4GA8A 2VVSA 4ZO9A 4AZHA 3CXOA 5CG7A 5LIWX 1GG1A 1PS9A 4OTKA 4PSPA 1NAL1 1Z3NA 3WBXA 5KMYA 3MMTA 4FXFA 4P5UA 3WK0A 4PA8A 1PAMA 3U7BA 1LT7A 5E9XA 3E2VA 1Z8AA 2GJXB 4Q7BA 3WLTA 3W7NA 2GJXA 5KSWA 2PBOA 2D0GA 2OSYA 3QW4B 1BSIA 5JUVA 3ZS4A 3EBVA 4NI3A 2C91A 1UQZA 3H2FA 4A3YA 3PFMA 4GUHA 3QLDA 1PCWA 1K8YA 1YTDA 5D8ZA 3KRUA 4UOZA 1VJIA 1E15A 1E6NA 1CGXA 3NDZA 4FIQA 1GQKA 3M5VA 1J96A 1TREA 3W75A 4ZOBA 1XRFA 1X6LA 4DBDA 2QT3A 5KINA 3VKJA 3UJRA 4G56A 3WUEA 1E55A 3Q65A 4H3DA 2BXZA 1SW7A 2E25A 4LSBA 1A3XA 1RZMA 1ITQA 1OYCA 2A21A 2DDXA 1S3TC 5GJNA 5DANA 3MMDA 4ATWA 2J7CA 2C1HA 4XUGA 3KLKA 2QJGA 4AHOA 5H8UA 2CLIA 1CB7B 4I9AA 3VCNA 1XLEA 3MBDA 4V15A 1JD7A 1Z9AA 5FI8A 1WAWA 4YVPA 3T0DA 2WJZA 4JGDA 1EZ2A 3WDIA 3N6HA 3NQ7A 3V5CA 1XW8A 4KS0A 1O5XA 3TXZA 3UXDA 3CIWA 3GIQA 4C5ZA 1US2A 1W3NA 4C1KA 3HG5A 3SUTA 5I0DA 1HT6A 2XH2A 5DT5A 4FF5A 1W3JA 4ZQRA 4U10A 2B81A 1M04A 4FX6M 1EFZA 4AD4A 4JEQA 3UU0A 5C7VA 2TAAA 2UBPC 4MZ8A 2GGEA 4WSHA 3HJZA 5CPLA 1RCOB 4LF2A 2RJHA 1G5AA 3GDLA 3COTA 3L5AA 1CTNA 4J3ZA 1V6XA 4AZIA 1AQHA 1E1EA 4TX6A 2WQPA 3H4WA 2AKMA 3CLWA 5LIKX 3ZJ7A 2P88A 1RBOB 2BVTA 4WEVX 2XFYA 4ZQCA 1QATA 1XLFA 2J75A 3H21A 2CW6A 3UPBA 3B3DA 2XUCA 5JBFA 2PAJA 2QMKA 1UZ1A 3OHIA 1WX0A 4NNCA 1KFEA 4DZAA 2OJPA 2HBXA 5A1AA 3P8IA 4KIRA 1Y7VA 2HK1A 3OVGA 4OUIA 3VIIA 2CZEA 2Q8LA 2Z4GA 1XI3A 3GVWA 3V0SA 4L56A 4LYKA 3OA3A 3SQSA 4M7SA 3GKFA 5TF0A 3MTWA 3RLUA 3NPVA 4ZCWA 2VD9A 4IPJA 1KGWA 6A3HA 2BVDA 4UTJA 2V38A 4FXJA 1MNZA 4OBRA 2IKIA 1Q5MA 1K70A 3H4GA 1AW5A 3O7UA 3DC8A 3HBLA 4B15A 4N42A 1YLVA 5HATA 5HMFA 1M7OA 3S5ZA 3ITOA 3ZO9A 4NL1A 3EKLA 4J1OA 2YYUA 3FDKA 3MB9A 4P8WA 3SY1A 1QFEA 4AU0A 1ZB5A 4AWUA 4GXPA 1V5XA 2ALDA 4RDYA 1H1ZA 5GQBA 1P0BA 3LLFA 1L6WA 4UQAA 1GTEA 1UKOA 1KCKA 3TYDA 3AXIA 3PY2A 3G24A 3C3UA 2DT3A 4LT9A 3RYSA 2IXVA 2OYMA 3K4DA 5EY5A 1SQ7A 1H3GA 3TYCA 5J04A 1V6TA 3EOOA 1MW0A 5I23A 1W1TA 3CT7A 1TX2A 4F40A 3A9IA 1B54A 1TA3B 1OX6A 2WWDA 4FPSA 4LB3A 3APGA 2O9TA 4ECLA 3MUZ1 5FL0A 1TA3A 4WGXA 3ISIX 2B7QA 3KBWA 4UZUA 1GOXA 4O10A 1GJUA 3EPMA 4HU3A 1VLIA 4X0VA 1PKYA 2WSKA 2BHUA 2ZUNA 2ZE3A 3LZ5A 5F2LA 6TIMA 4LUIA 2TSYA 3RX3A 1UJPA 3MMUA 1TVLA 2O7QA 4KH2A 1UOZA 4XAFA 3R5EA 3G3MA 1Q6GA 3OZOA 3A3HA 4DJEA 1CGVA 3G1VA 4ZB5A 2TMDA 3GC4A 3LXCA 3VNYA 5LKYA 1AD1A 4YVVA 1J12A 4GNKB 4HGXA 1QWKA 3A3WA 2AAMA 1XYCA 2DT1A 3ITYA 1TV5A 4LAUA 3NO3A 4A8RA 1VENA 3STPA 2ZX9A 3KL0A 1SZNA 1S2CA 2F6XA 4RKAA 2Q8XA 1JZ4A 1OD8A 3N2BA 3H12A 3PB0A 3GS6A 1W37A 5DF0A 2FHCA 4N9DA 2BB0A 1BTMA 3CAKA 3G1SA 3W1MA 2GGGA 3K46A 5CSRA 1GVRA 4DZIA 3G1XA 3FVMA 1KTBA 3M0VA 2UWFA 5KTLA 1K77A 1V7AA 3UG4A 1ME9A 3OODA 1SGJA 3L4YA 3HGOA 5T26A 3N9KA 4V2XA 3TA6A 3MUAA 4MJMA 5BRPA 4NZ3A 4GVIA 2HTMA 1XBZA 3B03A 4UFKA 5BU9A 3ALFA 2GYIA 2POZA 2PDUA 2HZGA 3A64A 2OQHA 1YPFA 2QIWA 5DQPA 1S5NA 2NUWA 3UNDA 2NXGA 4B5NA 4GO8A 4BI7A 3AHXA 1O1ZA 3EAUA 1V3HA 4QE4A 3BAJA 3CH9A 4ML9A 3UY7A 3U3HA 1AZ2A 2HROA 3CZLA 1V3JA 4FR1A 2O4MA 1XXXA 3TVAA 1WE5A 2RKXA 1VPXA 4W5UA 4AY7A 2EJAA 5HAOA 3VOHA 3OLEA 3PZUA 4JIIX 2NXHA 4UMCA 1UD5A 4D6EA 4Z08A 2HVNA 1W91A 4E4UA 1GQLA 2AQOA 4FAMA 3PUOA 4UC5A 3GWQA 4H01A 2BTMA 1EX5A 4HNUA 3TROA 3HN3A 4J3VA 1UWQA 3GHUA 1NEYA 4NXSA 3WD3A 3VMOA 4S23A 3TJLA 5D2TA 3B40A 1S1RA 2AKZA 5CZSA 5LIXX 4CD6A 2OWWA 3VIFA 3FK4A 1VIWA 2YDRA 3AXHA 4MAZA 5U7SA 1H60A 2B31A 1BQCA 3NG3A 4H83A 2X16A 3RU6A 3G6MA 3USZA 1H50A 3LTYA 3QGAC 3NO1A 5A95A 2W91A 2BOEX 1TMLA 2OMAA 3LQLA 4HHPA 4LW7A 2YBTA 2ZOXA 3BG5A 3SECA 3UR7A 2WANA 4AZ6A 4A35A 1H0GA 1EQCA 3GVGA 1XLBA 2PDQA 1A5KC 4IF2A 1PBGA 1GKQA 5D04C 2V3GA 4GYFA 3V7PA 5TIMA 1QPRA 4G5DA 1PIFA 5LIYX 1CXIA 3POHA 4F2UA 5T9CE 2CLPA 5BOOA 5I24A 1H4PA 3VNIA 3P81A 3NM1A 2PWHA 1FQ0A 5CZJA 2C1IA 1F74A 5HJYA 2C8NA 1I0BA 1KXVA 1D3HA 2I57A 1TTQA 3U2EA 3DKLA 3FDGA 3CWHA 1T5AA 2VURA 3MYPA 1JPDX 3LPPA 3K2GA 2V82A 4IISA 4WOQA 2WB5A 3R8RA 2XIMA 1GVYA 3M0JA 1ML1A 3LDVA 4PMRA 4OVXA 4UTLA 1CXEA 2WQDA 4QFUA 1DJZA 2ACSA 1J0HA 1TX0A 3P8JA 4JIEA 1EC8A 3D3AA 1F6KA 1UKSA 2ZRYA 5BCAA 5G1TA 3LHVA 1Q66A 3AROA 1T96A 1EX1A 1A5OC 2ZWYA 2F2HA 4B4HA 1LWJA 1SO4A 2GLKA 3GXFA 4GFSA 2IMRA 2I16A 1HGWA 2OO6A 3V75A 3TLQA 3N29A 5L9FA 3BPWA 4PB3A 4H7CA 1V7YA 4TVDA 1GZJA 3W7CA 4BQ3A 3GBEA 1JUKA 4O16A 3W02A 5LGXA 2J7GA 4DUWA 1DORA 5DT7A 1EOMA 1JPKA 3ANVA 1ZJAA 4H8NA 1GW9A 3A4WA 4W5ZA 2WSYA 3OGVA 4LVDA 5HXMA 5HK4A 1X1ZA 4KFNA 4PUDA 4MY1A 2DUAA 1LUCB 1AW2A 1JVNA 4Q8NA 4EXQA 2FZMA 4JTFA 4QLJA 3GDRA 1LUCA 2X42A 1P7TB 2XDFA 1JYNA 2BS9A 1R3QA 1GJWA 4JFVA 1P7TA 4MKVA 3H2OA 1R9XA 3USBA 1Q6FA 4QSHA 4AMAA 1OZQA 1GYLA 3ANUA 4B5WA 1VHCA 1US0A 3GAYA 5HR6A 3ZT6A 3KBVA 1V3IA 4BQ5A 3O8AA 2XYLA 5DFAA 2WMIA 1TYGA 2A7PA 3UG3A 4MNLA 1GVEA 2YA0A 1GOOA 3P60A 5BRBA 4S3KA 3IVUA 2D2HA 4HTBA 3C2RA 5HMEA 3HMJG 2ZIDA 1EEXA 3AIBA 3N73A 3U5UA 4XSMA 3C61A 5EGRA 2GQ3A 3G1YA 3PBYA 4LTSA 3H22A 4F0KA 4MB5A 4W7UA 3S1GA 3QZEA 4CD8A 1DE6A 1K9DA 3EMQA 1VFMA 1AZ1A 4M24A 2XN1A 3F7JA 3R43A 4GZJA 2HS8A 4BWLA 1Z89A 4J3WA 1X96A 4KEZA 2DZSA 2OQYA 4KWUA 2ZZ4A 4LY4A 4XAPA 9RUBA 3TUUA 3B8UA 3O16A 1ZU8A 2VX6A 5E6ZA 3OQEA 4GC3A 3MDWA 2WZIA 5FF3A 3L12A 3AWNA 3N3MA 5G4HC 2J6XA 3SN4A 3WNNA 1VCFA 4C6KA 4FALA 2HQAA 1G4EA 3TEVA 1E70M 3CAQA 4GFIA 4B90A 1GORA 3W87A 3LYEA 2EBNA 4XVEA 5BRQA 1Q13A 3EA2A 2BY3A 4I8YA 4N6EA 3NIYA 1C9DA 2E5CA 3GAKA 4K2SA 5D02A 1UPPA 3S0CA 5AC4A 4JFUA 5K4ZA 4H2HA 2J79A 4DXKA 1LBLA 2DPEA 3OB8A 4HIBA 1DJGA 1XIMA 1MNSA 3DGRA 1Z6KA 1EPVA 4QROA 1KC7A 1RQEA 1NOUA 1TV8A 3ZM8A 2E67A 3O06A 3I6TA 2Z26A 1O68A 1TELA 1QU4A 2X30A 4UMAA 1A5CA 5FEZA 4E8GA 3STGA 1IXPA 3TW9A 1Z69A 4DJEC 4GZEA 4IQDA 3C8NA 2OVLA 4MDOA 1KM1A 1DBTA 1PDZA 3BW4A 1AMYA 2FPTA 2GVYA 4JTCA 1Y65A 3F03K 1DWIM 8CGTA 3W7JA 3GXMA 5A8NA 2VRJA 4PTNA 3D3FA 2OCZA 3BLPX 2CNCA 3G0SA 4UFIA 2W63A 4AC7C 1R38A 4JHOA 1MW2A 2E0PA 4Z2JA 3HB9A 1MDLA 3P0WA 4B5XA 1XRSA 3P74A 3U8GA 3GO2A 3S6OA 3TK7A 4U28A 3G77A 3BQ5A 3RXZA 3VMPA 4Y9AA 4FS9A 3SJNA 5I78A 4JFTA 1XGZA 1TRIA 4WY0B 1E9IA 4HTYA 3E2QA 1XPGA 4AIEA 2RFGA 4Q8TA 4WY0A 1A5LC 4JNZA 1H09A 1TIMA 1M5WA 4GVFA 5K7JA 3UXLA 4PL2A 5IRPA 3CUXA 3SRFA 1XQLA 3W00A 4S1FA 3W2NA 5EA9A 3ORWA 4MHBA 1DHKA 2EQDA 3AHTA 1I60A 3HFTA 3M64A 1B4EA 1XKJA 2GJLA 3WQDA 1E9YB 4N2YA 2HXTA 2W0UA 3S9ZA 3BLOA 4C6QA 3W71A 3FJ6A 3FOKA 1GEQA 1QI4A 3TN3A 2FH8A 2DIJA 1T8QA 4HNNA 4JQ4A 5CC6A 1KRBC 1BWVA 4MJ2A 3W6YA 5DN1A 1OCQA 3EX4A 3HQ1A 5LNSA 1R6WA 2XVGA 3BCJA 2CLFA 2NT0A 2CPUA 5CEWA 2DUXA 3S1UA 4JDYA 1MW3A 3PP7A 2FGBA 4F79A 4ML4A 1NWUA 5B7ZA 3UERA 3GFYA 4UQ9A 1FHUA 3ENLA 2AQVA 4DZHA 3GUWA 1QI5A 3WLJA 3W73A 1A80A 1ENUA 3A4AA 4U3CA 2CKSA 1EC9A 3SB0A 2ZFAA 4W7WA 3CMGA 1EYEA 3QYQA 1YXCA 4R27A 3OW1A 1BRLB 1D8CA 1BRLA 2ISSA 3H6OA 4WDWA 3SQLA 3FX4A 1QBBA 2V67A 2CBUA 2P50A 3U57A 2PDNA 3ONBA 1G9HA 3AIRA 3VOJA 4K36A 2GGHA 1J79A 1X38A 3EXRA 4DJFD 2TPSA 3TNOA 1VCGA 4GE8A 1HJWA 3LCHA 1O94A 2QCHA 3WDQA 3A22A 3L2IA 5BU6A 3KL3A 4HK6A 1OVDA 3AQUA 3UETA 1UWSA 3ARQA 3G2GA 3S2CA 3H4XA 1WKFA 4MB1A 2ZWZA 3CZGA 4RXGA 1P6CA 3HQOA 3PZMA 2KZHA 5HA7A 5HR7A 2ZX5A 3JU2A 5EMUA 3S2JA 3PWAA 4NNAA 1PZ0A 4XSLA 3A4XA 3B06A 1NQKA 1DWFM 2OEJA 1MQQA 2ZA3A 2XIQA 4Z1CA 2P10A 1TPUA 1IT7A 3VGHA 3KDOA 1WP6A 4S38A 3WD0A 3L23A 3A23A 1TV2A 1EDQA 1O7AA 2QF8A 5I00A 3WX7A 4WRHA 5C71A 1LL6A 3H7UA 4O12A 3TTYA 5FSDC 4EPBC 5CJ5A 2O4QA 3ZVHB 4EE9A 3EWXA 2E8YA 4PUNA 3L66A 3ZVHA 1J18A 2VCAA 1TJ0A 2Y63A 1IEQA 5DX7A 3CUIA 1Z41A 3BCDA 4CQ8A 4DXXA 3OBEA 3INPA 2ZUTA 2VEPA 1B1YA 1EP3A 3RCYA 2QHAA 3JZEA 5FL1A 4D6GA 4B92A 5K9XA 3HMCA 4O14A 3TSMA 1K03A 2E6YA 3K13A 3LNPA 1QBAA 1C8VA 2X40A 3AALA 5AHLA 3AICA 4GGHA 2RH9A 3L7RA 3RNDA 3OZYA 5E93A 2HWGA 3EWDA 5AVNA 2WMJA 3QKEA 5MHBA 1H5YA 3IUHA 4YS1A 1T41A 4O1CA 2A3BA 3E12A 4XBJA 2GGJA 5CGMA 1JI1A 3G0UA 1KM5A 4I90A 3OIHA 4QCFA 3G8EA 3UT0A 4UQCA 4C5YA 4NJGA 2X2YA 1OCNA 3BV7A 3E0WA 4RZ5A 1KXTA 3OG3A 3UPMA 3E49A 3CS2A 3LCXA 4TQTA 4U4MA 1TUFA 4FSAA 4IQJA 1SR0A 1XIJA 2TYSA 4R7JA 4BWLC 1KFJA 5CKSA 3NZQA 2BY2A 4U33A 4JHZA 1DIKA 4ZGYA 2VR4A 4JKKA 1JCXA 2ZRWA 2Z7KA 3CM4A 1FXPA 4O15A 2BY0A 3M0YA 2HE8A 3CBWA 2DT2A 1GOWA 4N9CA 3C5QA 3NZ1A 4HZ8A 4JTHA 2DH3A 5CZ0A 2JFEX 3LXBA 4S3BA 1V6VA 1H11A 3QY6A 4LRSA 4W8AA 1ZNNA 4E3VA 3PSVA 4N9EA 3AJ7A 1WDDA 4J3XA 1J0KA 2XHYA 4GABA 4KETA 2YFNA 1K7FA 2A3LA 1OFOA 3CO8A 4ZB0A 4ATLA 3NSNA 1ZS2A 2VUNA 2IKGA 4HA3A 3SQMA 3DUGA 1UH3A 3QV6A 5F7UA 2Z27A 3EX1A 3W4RA 3VIKA 1GT8A 3U4AA 1RK5A 4QE1A 5DY3A 3TOYA 1E51A 4DI8A 3UEQA 2WSQA 2CYGA 3B0YA 1BWLA 1R85A 1VR6A 4F0SA 5AECA 1DXIA 5IHRA 1LRTA 4IMFA 4F0HA 2OZ0A 3VGDA 2QVNA 4JKLA 1CXLA 4JHMA 5FA5A 3KOFA 1XH0A 1CXFA 2ACQA 1N2VA 3E6EA 2C0AA 3TTOA 1YKWA 5CPNA 4IPLA 4DVOA 1IF2A 2QGYA 1NP2A 4ZFCA 3V0UA 2A4AA 3FEQA 2INZA 4AX6A 3WLQA 3BGJA 4IXHA 4BKNA 2OOFA 3VNJA 1KM3A 1YNQA 5KZ6A 4ZOEA 3SY5A 1HKWA 5ABTA 3DFYA 5ECVA 4S3EA 4JTDA 2ZDRA 2V3DA 2I7GA 3BGAA 1E43A 3Q67A 3SZ8A 3TYZA 2NX1A 3S42A 3UWEA 1QTWA 3UY8A 2RGLA 1VF8A 3NXFA 1X8FA 4QE5A 1RP9A 4I5UA 1NFBA 2VT0A 4DYKA 3XIMA 1XLLA 1UA3A 1JYXA 4IQLA 4X0NA 2EXOA 1XLMA 4IL0A 3CUJA 3LV6A 4E4FA 4JIPA 2O9OA 1RJPA 2PF0A 2WC7A 2SFPA 4FIRA 4RNIA 4GKTA 1E72M 1KXQA 3LLDA 4ZTYA 4DO4A 4GIAA 5E0FA 4M51A 1M7JA 4PUMA 5BWAA 3C86A 3C52A 3E2RA 2YL6A 4RV8A 3SUVA 1FDYA 3URAA 3WEMA 2WNZA 1DJQA 1IV8A 2PUZA 3H2MA 5DO8A 2ON3A 3A4JA 4I9TA 2BGNE 3THAA 2Y4SA 4TU1A 5A6KA 1OX5A 3KBJA 2YCJA 3VZYA 4HHHA 1WBJA 4QG9A 3MBFA 3SFWA 3P84A 3IJ9A 3Q58A 1OC5A 2DZTA 2ISFA 3R94A 1CX9A 2P3ZA 2C16A 5F4WA 2QCDB 4I6KA 5A94A 3QC3A 2QCDA 3M0MA 1CIUA 1XYZA 2FFCA 3DBPA 5CXPA 4HU8A 2J7EA 4OHQA 1PZ1A 1A4LA 5KEZA 2BXVA 4L1XA 2VELA 3MU7A 4LNCA 4K8EA 1UR2A 4XZWA 1NIUA 3II1A 2G50A 4F2BA 3NWRA 3KE0A 4JBRA 4GUJA 4HSOA 3M5ZA 4EXAA 1DXEA 1GOQA 3DAQA 3DI1A 3GNPA 3MO7A 1OIMA 1GZGA 1B0IA 3AWOA 3VUPA 4Q32A 1QXLA 3IV3A 1ZRQA 2Y7DA 3VIMA 2BBFA 4PR4A 4YXGA 3MCOA 1HW6A 3GXPA 2R6OA 1XCWA 4D6IA 2D73A 4PUUA 3SURA 2G8ZA 4JYFA 3I3DA 1EP1A 4L4PA 4HB7A 3I7QA 1TPB1 4XK2A 4HJWA 4D6JA 2W27A 1UPMB 1TPWA 3S1WA 4UNLA 4X9YA 3DESA 3KLLA 1GHSA 2ZYFA 3F5KA 3LCLA 4JAWA 3T42A 3VXGA 1MYRA 2ZXDA 5DMNA 1RV8A 1Q7QA 2Q3RA 3W23A 2YA2A 4PMYA 5I03A 4RX0A 4XAYA 5CPMA 1RPXA 2QDHA 5D9NA 5E70A 4MOZA 2HCVA 4RJEA 4KQNA 4D71A 1TO3A 2PBGA 3C56A 3GBDA 5H6HA 3H23A 3PZTA 3KTXA 4GUIA 4C91A 3FFSA 3RF9A 4YCPA 4X9SA 2GL5A 6REQB 1VFLA 5KITA 4DF2A 4NASA 3CNYA 6REQA 1I45A 2EPLX 4UZSA 3A13A 3QR3A 4DHGA 3LCIA 3HOJA 3RMJA 4R7OA 1XFBA 4KIEA 3P0XA 1BXNA 3T09A 2XZ7A 5B7YA 1H49A 4NQ1A 2G0WA 3B8SA 4QDWA 1V0LA 2Y7FA 3CUGA 3VGFA 3EX6A 3RFAA 3ID7A 1N8FA 2R1LA 3LM7A 3VAVA 3H53A 5AHNA 2OKTA 4BQ2A 1HJXA 1JAEA 3TJXA 2FMNA 2PLKA 5A6SA 1K3UA 4ADTA 2Z1VA 3WJYA 3PZOA 1E4IA 3AMGA 4U2YA 2PDFA 4MLRA 1E3ZA 3W01A 1WUFA 3CO4A 1EDTA 2PLCA 3FJ4A 1W9DM 4DJDD 1TPEA 1W8SA 3WMLA 3WYZA 3DH7A 3WNLA 1MRQA 4PFHA 3N6QA 1BG9A 3PG8A 4M5PA 1KFCA 3RUBL 4J2MA 3W7OA 3R10A 4OV9A 2A3EA 1M1BA 3MA8A 4CLMA 1B3OA 1U5JA 2BY1A 1UYQA 4C60A 4PMQA 4O1FA 3A47A 5AYZA 3H54A 2E3ZA 4O0ZA 2ZZ6A 1ZJBA 5TD4A 5F2MA 3WF3A 4ORIA 1XH2A 4HK7A 5GJPA 2YDSA 3DYMA 4LX4A 3TOPA 3WKZA 3ZFHA 4GG9A 1THFD 4TR9A 3KEHA 1KBJA 4ES4A 5JH1A 5CZTA 1J0JA 2FDMA 3CZ8A 2WK2A 4GHRA 1XLCA 1FTXA 1QASA 1VFOA 1XDMA 3C0QA 3WCZA 4ZEPA 3W72A 3NNTA 1PEZA 4FA3A 2J62A 1OHLA 2ZQ0A 2FVLA 1QHPA 3WLPA 3N2MA 1AQFA 4C6CA 1F3EA 4UFJA 3LTSA 1WXJA 3SCQA 5C2XA 2C71A 3MVIA 4HKPA 1JPIA 1PZ2A 4C90A 1E0WA 3BICA 2I56A 2YCIX 1N82A 1XLGA 2A6LA 3FYPA 2JEQA 4M56A 3HPSA 1Q65A 3HGJA 3GNRA 2XSAA 5E09A 3W85A 3IJDA 4I5RA 3K4WA 4W85A 4JQ2A 1A4MA 1RY8A 2VWTA 3BLFA 1L6YA 4ZA0A 3CK5A 2V68A 1EJXC 4OUEA 2PF8A 3MWCA 1UIOA 4KT2A 4IUOA 3UWVA 3VUSA 1P4CA 1XIEA 4GQRA 4UQBA 4PTDA 2VC5A 2DVTA 2BHZA 3AMDA 3SUUA 3L2LA 4LUJA 4O28A 3KM8A 3S6TA 4H8UA 4JTUA 5F2GA 3D0CA 4RE3A 3S2LA 1Q7MA 4QP0A 2XH4A 1O1HA 1DL3A 2YA1A 4KGJA 4PUEA 1X6NA 1GOIA 2YB1A 4E2BA 4JR5A 3ZOAA 4I8DA 1YX1A 4IMDA 2VEKA 1VYPX 2AGTA 3N11A 2Q71A 3M5YA 5FJIA 4AD0A 3L5LA 1TWIA 4WKFA 1WDQA 3LD5A 3LQGA 4DPPA 4IFOA 1FWDC 4R85A 4G8TA 3U48A 3RCNA 3LNMA 5EBAA 2NZLA 4A4AA 3D46A 1QPOA 3AUOA 5A6TC 3P67A 2GUBA 1YRRA 3AIQA 4QRNA 1REQB 3KTCA 3C3NA 2DW6A 3IIPA 2OYLA 1IT8A 1REQA 1FWEC 1JCYA 3LPGA 2EG8A 1TZ9A 1WOBA 5FAJA 3WDPP 3N4AA 4ZXLA 1ZLPA 4PTXA 2JKEA 2XWEA 5HWMA 1JD9A 2D24A 2JF7A 1XLKA 4CUCA 2QULA 1S39A 4N4QA 2HPMA 1PV8A 5HPCA 3N19B 1F73A 4TMBA 2VCCA 2J74A 3GHRA 3WLMA 5AYYA 1CXKA 4XO6A 4ENLA 4Y2WA 2YLAA 5CJNA 2VI0A 4C6LA 2P8CA 3HTWA 4HMNA 4DWDA 2BGSA 4FLSA 3DENA 3VD4A 4KCWA 1T40A 5HBFA 4YTQA 3NQGA 4LWWA 3N15A 4ZQOA 2ZZ7A 4J28A 1KW1A 4V33A 5CJMA 1SW3A 4OT7A 3GM8A 2VFDA 3THCA 1GG0A 4JX4A 5DMYA 5LNWA 4PCTA 3GQYA 4MZ1A 4F2TA 2C13A 3U2OA 4QIUA 1XSKA 4A3QA 2PEVA 2J24A 8A3HA 2YXGA 3FHAA 3SW6A 1PPIA 1JZ7A 3M0LA 1W6TA 5HOSA 1F3XA 3WD1A 1M7PA 1JGIA 4IFKB 1P0NA 1JUBA 1NOWA 5JH2A 1OABA 4CKQA 4Z1YA 5AHFA 4C6JA 3DX5A 3K30A 4GI9A 4IFKA 3EB3A 1POKA 3G5EA 1XLAA 3RLVA 5CLWA 3IJLA 4YLWA 3RLHA 2BODX 3SN1A 2XM1A 3AIEA 4K8HA 1NDWA 2WVVB 3GVVA 4LEFA 1WZAA 3BCFA 5HINA 2OB3A 2WVVA 3TTEA 3OZPA 3R58A 1Y5VA 2PRHA 2X09A 1BVWA 3L4ZA 3JW7A 4MKNA 1CBGA 2JBMA 2C0HA 2Y8UA 4WD0A 1E0UA 2X0SA 4PMOA 4UWMA 4PMNA 1U33A 4MWAD 1UR4A 4LS0A 3QSTA 3WF2A 1P0EA 1OD0A 1R30A 1MWOA 1PE1A 1GOMA 3NL2A 4L80A 2PU1A 1EEPA 3FVDA 3UYIA 3UZJA 3WLOA 3E3HA 2WVTA 3GSMA 1QW9A 2WNQA 4AHQA 2ZVRA 1F05A 3THUA 4KFPA 4GYJA 1TWDA 2FZBA 1K8XA 4H8VA 4O50A 1UG6A 2YCEA 6ENLA 3VD3A 1JAKA 4TIMA 1YDNA 3KFTA 2WVSA 2HNHA 2VYOA 1KV8A 1VRDA 3C8FA 4KERA 1GTHA 2R94A 2ZA1A 2BOFX 2E5BA 2X2GA 4NX5A 1WNOA 4DJDA 2A3CA 3ZWTA 4HPHA 4GK8A 1ME7A 3UCQA 2DSUA 1FH8A 3ABXA 4H9ZA 3CPUA 1FKXA 2PDKA 2CHNA 2QUNA 5C8BB 4C6IA 2QW5A 1Q7ZA 3ZZ1A 3MUXA 1MZRA 4DYJA 2F6KA 5I2UA 4IGMA 1NARA 3OLGA 3M43A 5D03A 1ZHAA 5CSUA 3SCUA 5IXEA 4HZ7A 3GD6A 2YZRA 2DZAA 4OFCA 5M3WA 3W2LA 1R3TA 2AAAA 4NZCA 4CGTA 2GFTA 1E6PA 3CL7A 2Y8VA 4CNSA 3WQ4A 1SW0A 1V77A 3WO8A 1UR1A 4N9BA 2HVMA 4PCSA 2NW0A 3R0UA 3IWPA 2XJ7A 1DOSA 3LHTA 3R13A 3OYZA 4ZVJA 1YE6A 4HOZA 1O5RA 1WKEA 1PJ9A 5L6UA 5C2GA 1W3LA 2PDJA 1S2UA 1G1YA 2WSPA 4QNEA 2J7BA 2J13A 8TIMA 4IL2A 4HP5A 4W4QA 3W1QA 1TQXA 3QR0A 1JFXA 1IE7C 4JFSA 1B57A 3HIJA 5M2FX 4ICMA 3KRBA 1W3TA 4PYSA 1QAPA 1YQ2A 2R1NA 4NT0A 2R14A 3G22A 3WH7A 3QM3A 1QI2A 4DEFA 3H26A 5ENLA 1CGYA 3KHJA 4MIMA 4H6EA 3EGJA 1DIOA 1A5NC 3VK5A 4A29A 3BLLA 3KL5A 3TNBA 1QK2A 1S3HA 3WMCA 3AYVA 4PUKA 2DZUA 2QMJA 3BMXA 1TV7A 3LMZA 3T8LA 4BJHA 1JZ3A 3WD2A 3WZ0E 1M6JA 3ITXA 1JRCA 1TB3A 5LXXA 2WLZA 1IEWA 3GTFA 3R0KA 2PTWA 2VO5A 1VC4A 3NQ6A 3OVPA 3ES7A 3BARA 1UZHA 2FMOA 4NRRA 3TTQA 3RR1A 3TN5A 4HHMA 2ZUMA 3GDBA 1XSIA 3OQ8A 4G1NA 3OGRA 2GJRA 4J3SA 1UHVA 2J7DA 4AXKA 5CSSA 5FEPA 3CHFA 5C9UA 3GNDA 1RBAA 2Y88A 3GC5A 4PN2A 1FCVA 1DQUA 1UD8A 3RDKA 1I6NA 2AL1A 2Y5EA 3WBEA 3XINA 3MDUA 2P5NA 1YPXA 2ZE0A 5I7GA 3JR2A 3LA4A 3TU9A 4MZYA 1FHDA 3D47A 1PKNA 2ICSA 5I3DA 4AD2A 5A2CA 1IIHA 3VD9A 4C7FA 1J2WA 3QLLA 1UKQA 1V02E 4E0CA 1VYSX 4L5ZA 4WKAA 3DC0A 3MV11 3MVTA 2XGZA 3LRMA 3DERA 4Q8UA 3ZSSA 4H1ZA 3TZFA 3ARUA 3IIVA 1EWEA 3LRLA 2V2DA 3PNUA 5IM51 2EPNA 2YR1A 2PDYA 4QS5A 2QR6A 3L4UA 2ZX6A 4GGBA 3QSRA 4GC4A 3U6WA 2QIIA 2WMFA 3TYUA 4O57A 4RL3A 4AYSA 1VBRA 3UBPC 4DUOA 3WENA 1TVPA 2CESA 4HNLA 1EJTC 4JZ5A 3FA4A 3TWAA 3M41A 3G1AA 4D8LA 1EHNA 4DI9A 3BOFA 4AZCB 1Q6LA 3A12A 4IG2B 3S2MA 3VD5A 1V6WA 2J77A 3TONA 4FOKA 1NTHA 3NZPA 3MI2A 4AZCA 4IG2A 4PCFA 1A5BA 2JGQA 1GNXA 1I2OA 2RDTA 3RJYA 3TH6A 8XIMA 3DYOA 3P14A 4ZO8A 5FEWA 1XS2A 3F5JA 5GNZA 4HNVA 3DYPA 1SFJA 2DVUA 4G9PA 1WOAA 3CIXA 3W81A 4M82A 5I5RA 3E0LA 1QJWA 4H04A 3EDEA 3UA4A 4BF5A 2MUCA 3QN3A 3ZR4A 2OLSA 1DXFA 1HX0A 3TMQA 2WV8A 3KRSA 3VE9A 1DWHM 3VOGA 2PWDA 2WKJA 4IIDA 1JCMP 1PTGA 4RDVA 4HK5A 3N17A 3BGGA 4DO7A 2ONEA 2FZ8A 2PZNA 4J3TA 3HQPA 4WJEA 2E28A 4MSSA 3BH4A 4HZ6A 5D2VA 4K1GA 1C7TA 1DEDA 1N8IA 2DORA 5AC7A 1V51A 4D6DA 1JQXA 4ZL1A 5C54A 4F66A 3VMNA 5H2ZA 1G7VA 3QZAA 4OKDA 3CV6A 1EXPA 3B4UA 1P48A 3ARWA 3SCNA 1KM4A 1WV2A 1XDJA 5CPOA 3REQB 3TTSA 1AA1B 4M6VA 3HURA 4OECA 3REQA 4MWAA 2EKGA 1OWQA 1V8EA 1HJSA 3SIMA 1QMLA 3W70A 3E0IA 3OA5A 3F2DA 4L7ZA 1TPVA 3GIPA 1IXQA 3R4IA 2BVYA 1DJXA 4EF9A 1TCDA 3HPAA 4UR7A 1K4HA 3LPFA 1XIHA 2RDWA 4D72A 3SRHA 4B2DD 2NLYA 3NZRA 3W7DA 2QAFA 2V3FA 2VEGA 3N25A 4DLMA 1JIBA 2VJXA 4ZODA 2Z24A 3DGBA 5D8WA 4RR4A 4BHYA 4M81A 3FYOA 6PTDA 3IJQA 4NG3A 4BR1A 4CNUA 2XH0A 4CQAA 1UB3A 4AZ7A 2O55A 1OFRA 1OK4A 3PBUA 1ZY9A 5J5DA 4FXSA 1Q4NX 5BYWA 4DAIA 1FWFC 3TAOA 4D6CA 4MY8A 3GTHA 1M9HA 1PX3A 5BMXA 3WQ5A 2EF9A 2BV9A 3KVLA 1UD4A 1WKDA 4QR6A 3ZXWA 2VQUA 1ECQA 1E6XM 1CENA 4HCDA 4LC6A 1MFVA 1F61A 3DFOA 1S5VA 5AHIA 1AL7A 1OYAA 3AMCA 3STEA 4AG0A 4QJ5B 2PWUA 4W86A 3QQ1A 2YPIA 2A85A 2WPBA 3W7PA 1WO2A 4EP8C 5HNTA 1WDSA 4JN6A 2FIQA 4Y9NA 5DBTA 4GBUA 4YVXA 5T91A 4CD7A 2FZDA 3KDNA 5LIUX 2WWCA 3W37A 4LUYA 3N6JA 1KTNA 3EDJA 4DJDC 4AX7A 4DB7A 1RA5A 2CBIA 3WDRA 3WLHA 4N0RA 4NIRA 1XCXA 3TZNA 5E6YA 1LOLA 4GZIA 2CKRA 1KD0A 2J7HA 4REQA 3MJMA 4UOJA 1J6PA 2DZBA 5IHSA 1I2NA 4X60A 3DFPA 3QF0A 1ZP4A 2FJUB 3TSBA 2QDGA 2PMQA 3C0JA 2TRSA 5I09A 3P6LA 4JQAA 1KGXA 2WO5A 4CVWA 3AZTA 1EJRC 1ZQ5A 3ZIZA 3UZZA 2G3IA 3DZ1A 3W1AA 3VZXA 2AOSA 2QJJA 4LB4A 6ALDA 3BLKA 3BAWA 3VNMA 1M65A 1V03A 2F61A 4RZ6A 1TE1A 2VZVA 4S3GA 5EU9A 3DIPA 4KCUA 1YXYA 2DQXA 1LQ0A 4ERIA 5BROA 3QZ6A 1U2YA 1JUEA 3VA8A 3UCDA