5C7HA

Crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 in complex with nadph
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
281
structure length
281
Chain Sequence
MHDPIPTIAFPDGRKVPALGQGTWRMGENRAKTADEVRSLQTGLDLGMTLIDTAEMYGDGAAERIVGEAIKGRRDEAFVVSKVLPSNASRAGTVAACERSLRNLGIDCVDLYLLHWRGGYPLAETVAAFEELKKAGKIRAWGVSNFDVDDMEELSAVPDGGNVAANQVLYNLARRGIEFDLLPRCRAQGVPVMAYSPLDEGRLLHDADLIHIAKAHQATPAQVALAFLKTCSGVISIPKTGSPERARENRDAMDIHLTTENLAELDRHFPPPRRKTRLEVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase
publication title Crystal structure of aldo-keto reductase from Sinorhizobium meliloti 1021 in complex with NADPH
rcsb
source organism Rhizobium meliloti (strain 1021)
molecule tags Oxidoreductase
total genus 107
structure length 281
sequence length 281
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 5c7hA00
4JTDA 2IPJA 4GQGA 1US0A 1YNPA 4IJRA 4XZNX 4NKCA 3Q67A 4H7CA 3GHTA 1C9WA 1Z9AA 3M64A 4LB3A 4AUBA 1IHIA 3V35A 1EXBA 1A80A 4FALA 3DN5A 3CAVA 1ZUAX 2IPFA 2INEA 2IPGA 1PWLA 2FZ9A 2PEVA 3R8HA 2FZBA 2PDWA 1X97A 3R8GA 2P5NA 3G5EA 2FVLA 3H7RA 4ICCX 2I16A 3EB3A 2INZA 2IQ0A 4DBWA 2ACSA 1T41A 4GA8A 3LZ5A 3CV7A 1EL3A 2IKIA 3KRBA 4LB4A 1Q13A 1MZRA 4GQ0A 4JTRA 2WZTA 3RX4A 3Q65A 1K8CA 4PUWA 3D3FA 1PWMA 3VXGA 3ONCA 1HQTA 2PDQA 2A79A 5KETA 3EAUA 4IJCA 2VDGA 3CASA 4LAUA 4Q3MA 3UYIA 5M2FX 5JH2A 1ZGDA 4PMJA 2PFHA 4GIEA 2HDJA 3N6QA 1XJBA 3COTA 3LUTA 1VP5A 3LZ3A 4LBSA 5LIUX 3UG8A 3LNMA 2I17A 4QX4A 1JEZA 2DUZA 1PZ0A 3S3GA 3UZYA 2ISFA 2PDYA 3ONBA 3CV6A 2HVOA 2PDHA 3FX4A 4WDUA 4PRRA 1Z89A 1ZQ5A 2AGTA 1AH3A 5LIYX 1ZSXA 3R7MA 4ASTA 3LENA 3GHSA 2PDKA 4R9OA 3LQGA 4JIHA 1J96A 2IQDA 4HBKA 1ADSA 2IKGA 2ALRA 1S1PA 1RY0A 3NTYA 4EXAA 4JTCA 1X96A 4XVDA 4WDWA 3WG6A 4LBRA 4ZFCA 2DUXA 4WEVX 4JIRA 2PF8A 1OG6A 1RALA 1HW6A 1LWIA 4QR6A 2BP1A 2HE8A 1AH0A 4G5DA 2PDJA 3V0SA 2PDNA 1Z8AA 3FJNA 5LIKX 3WBYA 1PYFA 3V0TA 4YVPA 3WBWA 1YNQA 1AZ2A 2PDCA 4DBSA 3LBOA 3LEPA 4WRHA 4WDXA 3P2VA 3R6IA 1QWKA 3M4HA 1YE6A 4Q7BA 3WCZA 2R24A 2PDPA 4XO7A 4XZIA 4XK2A 3R94A 2F2KA 2IPWA 3GHUA 1M9HA 3V36A 4QBXA 4FAMA 3V0UA 2ACUA 4JQ2A 3U2CA 3EB4A 2HVNA 3B3DA 3ERPA 4YVXA 1LQAA 5AZ0A 3LD5A 1T40A 4FZIA 1IEIA 2PD5A 4XAPA 4JQ3A 3H7UA 5HA7A 3UZXA 3GHRA 3O0KA 2IKJA 5HNTA 1Z3NA 2C91A 4XO6A 4JTQA 4XVEA 4YU1A 1EKOA 3CAQA 2PDFA 2PZNA 4F40A 2HE5A 1Q5MA 1QRQA 4DZ5A 2FZDA 1S2CA 3BUVA 4H8NA 3CMFA 1S2AA 2IS7A 4JQAA 1FRBA 4L1XA 2PDGA 3T42A 3F7JA 5AZ1A 3LN3A 4WDTA 2ACQA 3O3RA 3RX3A 3UP8A 4XZMX 2F38A 2FGBA 2HV5A 4L1WA 4PRTA 4MHBA 3UFYA 1UR3M 2PDXA 3BV7A 3BURA 1EF3A 4GACA 4IGSA 1R38A 1XF0A 1GVEA 2J8TA 4JQ4A 3G1RA 2R9RA 1YE4A 5LIXX 3DOPA 3UGRA 3MC5A 3N2TA 5C7HA 5LIWX 1PZ1A 1AFSA 2BGSA 1AZ1A 4FA3A 1XGDA 2PDBA 2PDLA 4LAZA 2NVDA 4I5XA 3UZZA 3M0IA 5HNUA 1SM9A 1X98A 3GUGA 4PR4A 2PDUA 4XZHA 1VBJA 3R58A 4RPQA 4EXBA 3QKZA 3LQLA 3UZWA 4OTKA 2ACRA 4PUUA 5DANA 4WGHA 3BCJA 4XZLX 4JIIX 2PDIA 1RY8A 1MI3A 2BGQA 2CLPA 2HEJA 3UWEA 4QXIA 5JH1A 4HMNA 3H4GA 1S1RA 4GABA 2DV0A 4JQ1A 3RX2A 4YVVA 2WZMA 2IKHA 3C3UA 3MB9A 4GCAA 1MRQA 4DBUA 3R43A 2FZ8A 2QXWA 4JTAA 2NVCA 4YS1A 1AH4A 2PDMA 2PD9A 3WBXA
chains in the Genus database with same CATH superfamily
3T0TA 4CU8A 2BXYA 1PEZA 2IPJA 2WKJA 3SN1A 4LW7A 4XTIA 4XZNX 4AZHA 2QMKA 4KESA 1KR0A 2PWEA 3SY8A 4AUBA 5A2CA 3IVSA 1VEOA 1RSCA 3U57A 5XIAA 2ZRXA 1YKWA 3V1HA 1TVPA 2JGYA 2Y5SA 1SZNA 2OOFA 5I3FA 4XG1A 3VGFA 1G4TA 1KR1A 3N2OA 2P5NA 2VFDA 3WD2A 3L23A 1V6YA 1TWZA 1AG1O 4NJHA 1J12A 5AYIA 2PWFA 2EAWA 3SEPA 4O52A 4BA0A 3OIXA 3E0FA 5EGRA 1SMAA 3W1XA 1W5QA 4RUBA 4UUIA 5A6BD 1XPYA 1YMYA 3PAOA 5G2HA 3VIPA 1MDRA 3RF9A 4U3CA 3TJIA 3NVDA 2VM8A 1PKYA 2QDGA 4J2PA 1D7FA 3H54A 3BLEA 3HB9A 5KEZA 4LVBA 1WA3A 3ENLA 3ZSTA 5E9AA 4YYCA 4S1FA 1H0GA 2D2OA 3IUDA 3IARA 3WKZA 3PTKA 2NLIA 2Z2UA 3LNPA 4I90A 2QKFA 4HA4A 1ZS2A 2NUWA 3IANA 2JF7A 3CBWA 3BAYA 2PB1A 4O13A 2R91A 3TQVA 5D2TA 5CPMA 1KRCC 3S5YA 4UTKA 1JNDA 4HNTA 2J4GA 1E51A 2AMXA 2HS8A 3RK8A 3TJ4A 1UROA 3WDJA 5E6ZA 2BMBA 2XN1A 3L12A 3A5VA 3U2ZA 1W8GA 2NLYA 4Y9PA 4FP1A 1A5LC 4HU3A 4XUYA 4V28A 2OOGA 2OT1A 2Y8UA 3M41A 2ZX9A 3VOFA 4N9CA 1D3CA 4PMDA 1RBLA 1HJXA 4PRRA 1NAL1 1FFRA 1K8YA 3K8LA 1UA7A 4U2YA 4N7QA 1PCWA 1AJ0A 3KBVA 5MHBA 3KLLA 3VKKA 1KC7A 3TDFA 1NJJA 3S1GA 4JYDA 3BQ5A 4RCXA 4ICMA 4MZ1A 4DYJA 1RY0A 1TV2A 2XINA 1Q6LA 1PS9A 2VRJA 1OFOA 2QCLA 3EDDA 2EG6A 4O18A 3THQA 1BHGA 1WAUA 2GOKA 3CTLA 1I0DA 3CHDA 1DTNA 2ESCA 4J28A 3AHYA 3CHFA 1E6PA 4OUEA 1ICQA 3U2OA 3DFYA 4TV5A 3NGFA 4GYPA 4XUGA 3IAPA 1KW1A 3P80A 1H11A 3W7IA 4DJEA 2GGHA 3WJWA 4BEQA 1IIGA 4JTKA 2DUAA 1WX0A 4QLKA 2YL8A 1QO2A 3RDKA 1EPXA 5E1QA 1NY1A 1LUCB 5CC6A 4UTIA 3VKAA 1B3YA 3TTSA 2PSNA 4V2XA 2X7VA 4I7VA 3LX9A 1UP2A 3BOXA 3L0GA 1UOKA 1ITXA 2CZ5A 4RE0A 1V8EA 4Q8PA 3NUKA 1OGGA 2BDQA 2VWTA 3M46A 4KWUA 3W53A 4PN2A 4RXFA 3RPTA 2YXGA 1GW1A 2RDTA 2HVNA 3ALGA 3W73A 1TWDA 3WQCA 4J2MA 4RV3A 1NDYA 3WNMA 4UMAA 4UCFA 1W54A 3IRDA 2DZVA 1PTDA 3VYLA 3WLMA 4Z2JA 1I60A 4TTUA 4PBEA 2WWCA 1HJQA 2C79A 3K13A 1DEDA 4W89A 3W7EA 4CQCA 3B97A 1WNOA 1BGAA 1D8WA 3LXCA 1M01A 1CWYA 1XH2A 1TV4A 1K8ZA 5GQBA 3GK0A 4Y96A 1TJ1A 4J40A 3L2LA 4M6QA 3ID7A 1FRBA 3QQ0A 2VD9A 1O5QA 2PDGA 1DJWA 4EANA 3C8FA 3L7RA 4GIRA 2OVLA 1TB3A 3UP8A 1ZP4A 4XD6A 4GD0A 1ZJIA 4JEJA 4WLCA 1Y5WA 3LGGA 1T8XA 1EOKA 1GNXA 1GGOA 2PDXA 3V3WA 3B05A 4GY7A 1LLZA 1QO5A 5LSMA 3ZZ1A 3LI1A 1WYIA 1R38A 1XF0A 4WJEA 4HPGA 4W7VA 3BV4A 3H7VA 3VGDA 3C6CA 1F5ZA 4Z42C 5IDZA 1W32A 1KTNA 2XTKA 3FIGA 3UY7A 1K9EA 2J6XA 1WQ5A 2XFWA 5HR7A 3TK7A 2XH7A 2C13A 2NVDA 3CU2A 4Z2KA 5DMNA 5HNUA 2CLEA 4DM1A 5LYRA 4JFTA 1HTIA 2XIJA 1GYLA 1PZ3A 4LF1A 4UQEA 5KINA 3M0XA 2HRWA 1FWCC 5A8NA 2I5IA 4A6GA 4UR9A 2PDIA 3T6CA 4E4FA 5LXEA 4WX2A 2CLPA 4P8WA 3RCYA 3W2JA 1HKVA 1TJPA 4P7LA 2W67A 1NDWA 1YW1A 4D2JA 3MB9A 3SCUA 2NXGA 3WJXA 2OTDA 5JQ9A 2X1IA 4LEQA 3T08A 1ME9A 2HISA 3CWOX 3M0JA 3BICA 2FVMA 3OEXA 6PTDA 4LC8A 3QHOA 2PTDA 3GVRA 3DIPA 1FHUA 2OX1A 2WK2A 3P14A 2PD9A 4W8BA 4A2RA 3EKZA 1UBPC 3FJLA 4DJDC 4HOWA 2FMOA 1JPDX 1FWAC 4KS0A 4IJRA 3DBPA 1R6WA 1H1NA 2Y24A 4Q4QA 3JUGA 4H19A 2UZ9A 1R86A 3WIJA 1LUCA 3L5LA 3AUOA 3ZR4A 3KVLA 2RAGA 2DPEA 3NJ3A 3CUJA 4DO4A 4UCGA 1RHCA 4B4HA 3D3AA 5K3VA 2BBFA 4XAYA 4AZ5A 1ITCA 4A3YA 2E25A 3QGAC 3N73A 3TLQA 2X2GA 1CENA 1XSIA 1VB9A 4TMBA 3WL1A 3I7RA 5KZEA 3WLRA 1A0DA 3T0CA 1EZ2A 2OZ0A 2NT0A 3WK3A 3VX1A 1HP5A 2YBUA 1FX6A 4GHRA 4AD0A 4DBWA 1DE5A 5D8ZA 3EPNA 1OIMA 1T41A 3GXMA 1AD1A 4FS9A 3CV7A 5HATA 3TYCA 1QNVA 2FH6A 3G6LA 4LB4A 5E0KA 1EWDA 1K6WA 1HIZA 3TYUA 2PPGA 5KZ6A 5CG7A 2GVJA 3R10A 1LZOA 2Z6IA 1OQFA 4MNKA 4UTHA 3B0XA 4XKYB 3GZAA 1P0NA 4Q3MA 3QEZA 5JH2A 3O05A 2VCAA 9RUBA 3RPDA 4AVNA 4TTGA 2XIMA 1XYZA 4JFWA 2ZADA 4R7WA 5FF4A 3LUTA 1N55A 3M0HA 3HFYA 4M19A 1VP5A 3UXKA 1F3XA 3RHGA 4QX4A 1GVOA 2W79A 1XBXA 5CC3A 2CLHA 5C9WA 2PDHA 1GVQA 3RM4A 1Z89A 3CZGA 1T8QA 1WOBA 4MJMA 3EOEA 5IBXC 5LIYX 3N4AA 4LAKA 3A9BA 3DC8A 3GG1A 3NPVA 4R27A 1FWTA 3DESA 3IUIA 3GHSA 2QULA 4IPPA 1P6WA 3WSUA 1GT8A 1BVNP 2JEQA 5DMYA 2WSYA 3GAYA 2VRQA 3KDOA 1JDDA 2R1LA 3IIZA 4LUSB 4NZ4A 2B7OA 4EP8C 2X05A 3F4WA 2OQYA 4JS3A 3EMZA 1TMLA 4BK9A 4NG3A 3UPBA 4I7WA 1Q2RA 4X9SA 3VCNA 5F2LA 1IT8A 1QBBA 1UC4A 5HUPA 1XFCA 3CZEA 3LV5A 3QR3A 3PBMA 3DXIA 4HHMA 1ZZMA 3PBYA 2L5HA 1XBVA 1QU4A 2W92A 1FP9A 3QQ1A 3FYYA 3GG8A 5G2IA 1W5OA 1NFPA 3MUCA 3LS9A 4BWLC 5I00A 1R0MA 1NOFA 3F5JA 1N8FA 4RV8A 1Q2SA 4D9PA 1LRNA 5J5RA 2GJXB 1JQVA 3NPXA 5I78A 3BSHA 3CLMA 3O07A 5F2MA 4H9ZA 2YL6A 2YFNA 4GISA 2CXGA 3CPGA 1UZDA 3WEMA 2WMFA 2H8XA 2A0NA 2ATMA 2E28A 1L0PA 1OADA 1J18A 4HOXA 3PC0A 3LBCA 3OQEA 2VR2A 3IRSA 3OZOA 3QZEA 1QJWA 4UTWA 4H83A 1G7VA 2E7FA 1LLOA 4K7VA 2F6KA 4RZBA 2ACUA 4U5KA 1QHZA 2WM1A 1X8CA 3CO8A 2NT1A 4AD3A 5AZ0A 1T40A 1IEIA 2E6FA 5A6KA 4F0MA 3WBEA 1EYEA 1GJPA 1XIGA 2VC7A 1RCQA 1Z3NA 2C91A 1M03A 2NX1A 2UWFA 5E93A 1RD5A 2BNJA 3QHNA 3M44A 4AC1X 1W3KA 3MO4A 3MQTA 3LPOA 2EPMX 4TIMA 3A47A 3FYOA 3NQVA 2TYSA 4Q4PA 4A2SA 3TWAA 1MYRA 3WLLA 1E3ZA 4M5PA 3KBWA 4P8XA 5DCDA 1R3QA 1TWSA 1XIMA 3G1HA 3SAZA 3BLLA 3DU0A 2P50A 5H8MA 1V7YA 4NZFA 4Q8OA 4FIQA 3VM5A 3LHTA 3MHFA 4XKYA 3C2RA 1NTHA 3MSRA 3BV7A 3PZIA 1ZENA 3OW1A 1ITQA 1LF1A 3IS4A 4TX8A 5BXTA 1JYVA 3W07A 3M6YA 1VBHA 4JQ4A 2R9RA 1P6CA 5M3WA 4ERIA 2A7NA 4O17A 5LIWX 1XG3A 3GTIA 5CBIA 1WCGA 3UD6A 4JPGA 2JK2A 2J24A 1IZKA 5C71A 4UQ9A 3IJ8A 4Q6XA 4FNUA 1VD6A 3BPWA 3C8NA 1NFBA 2YDRA 5FJIA 4FB7A 4CU7A 2YDSA 4XZHA 3KBJA 1V3MA 1IWBA 3R58A 5I3JA 2WZHA 3VNLA 4S3JA 4HA0A 3HZ3A 4WGHA 1UPMB 3R2GA 1XCFA 2WCGA 1MEHA 2EG8A 3NQDA 4LUSA 1WXYA 2FIQA 4GJ1A 2J79A 3H53A 3XINA 5A8PA 3ZM8A 3GBDA 3HG4A 1YPFA 3GKAA 3MSDA 4KWWA 4D8AA 3FEQA 3JZEA 2D1ZA 4BI5A 5IXEA 2E4TA 4DBUA 4YTTA 1BWVA 5TQLA 2VZVA 1CBGA 1RCOB 3NPWA 4UNIA 1S5MA 3MVTA 1OFQA 3TNOA 5BYWA 3AYVA 1YRRA 4L64A 1XYLA 5HMSA 1E9LA 5LGZA 4UTFA 1R9ZA 1EJRC 2F61A 4JD4A 2Y2WA 4AWSA 2NXHA 3BLPX 3GS6A 3LHVA 2ZQ0A 3I6RA 4GE8A 3U5YA 2JIWA 2X1TA 4Q7NA 2A3EA 2ZTJA 3CIXA 3TTYA 3K8MA 2G95A 2GJXA 4HZ8A 3C2YA 5D2XA 1KRBC 2Q02A 3ECQA 1ZCOA 3F2DA 1SUXA 4LNYA 2IPGA 4NZ5A 2DSWA 4BR1A 1W9PA 4PMQA 1GVIA 1EX5A 4L9YA 3GNNA 3CL8A 3BC9A 4XV0A 1H3GA 3EB3A 3Q2DA 2EPLX 2G41A 4FO4A 4I5UA 3M9YA 4LV9A 2QJNA 3IJ9A 4GKLA 1EL3A 1ODUA 5K2ZA 4MPQA 1UUOA 2WVUA 2XG9A 4H9XA 1DWAM 1PL9A 3LTPA 2B7QA 2Q71A 1GJUA 1TR9A 1UJPA 3OBKA 4W7WA 1Q4NX 2VGBA 3HGRA 2DIKA 3POHA 4ZFMA 3SZ8A 1DWJM 1AQHA 2J7GA 2WHKA 1FBAA 1UWUA 3GTFA 3TR9A 2NQZA 4UTLA 3WLNA 2JKPA 8XIMA 3SDOA 3USBA 1GVFA 2XFYA 2WJDA 3AROA 3MBFA 1CI1A 3PFRA 2BVWA 1IWPA 4KGLA 5BRQA 4BCEA 2WPBA 3VI2A 4FR6A 3ITVA 4RE3A 3L4YA 2A7PA 1K9FA 3UVIA 1ZQ5A 4IMGA 3GX9A 3WMCA 1QI4A 5G1TA 1UPPA 4AY7A 1Q3NA 1ZBCA 1A5KC 3R7MA 1VR6A 3C61A 3QBUA 2WMHA 1ZBVA 2O92A 3ITLA 2HK1A 1JAKA 3EOLA 1CPUA 1DQXA 1ADSA 5T9CE 4GQQA 3EWUA 5DMLA 3STFA 4EXAA 4JTCA 2VX4A 4S3AA 2VDIA 2XIIA 2NX3A 2PTXA 1OT1A 2I9EA 1JZ4A 1BYDA 4OOUA 1Q6FA 3NEVA 4HKPA 1G0CA 5AHFA 2WMGA 3RN6A 2YDQA 1U33A 3R12A 3WBAA 2E6YA 2CZEA 5C2XA 3CAKA 3DCPA 3VD4A 3PZ9A 5FIPA 1IQ8A 1H4PA 1EH9A 2VX5A 2GUYA 1POKA 4RX0A 3MT1A 3QC3A 4G5DA 3LCXA 3V0SA 2AMGA 4LU0A 1ISYA 4FLQA 1CDGA 3BAWA 1OFAA 4A21A 3WJYA 5I02A 5E70A 2J7FA 1XRTA 1QXLA 1TMHA 3KTSA 1OC5A 2E77A 4X60A 3WD0A 2KZHA 3M0MA 3MA8A 3GDLA 5U7SA 1I2NA 2G8ZA 5I3KA 4NAFB 3WEZA 1E1CB 5AC8A 3V5FA 2QCMA 2CITA 4NY2A 2PE4A 1FOBA 1CIUA 2WOQA 2POTA 1EGZA 3LGEA 1KV5A 3WELA 3GHRA 4C6CA 4QROA 1OCQA 3VGBA 2OZTA 3A24A 1XIBA 3MP5A 3FKRA 1OCBA 3AZTA 5FJTA 2IXUA 4WZHA 2YKKA 2OSYA 2H3BA 3EYPA 1EZWA 1UZ1A 1BRLB 2RGMA 1U1JA 1ISVA 3A4AA 3NZGA 1B1YA 2VOMA 1LOSA 1LRTA 4O1BA 4QEEA 4Y9NA 5A94A 3O3RA 3ABZA 4KERA 3I7SA 3NQGA 1JCJA 3SADA 4PRTA 3KOFA 4QIUA 1K9TA 2D24A 3BDKA 2AOSA 3N2XA 4LYKA 4NSBA 3SCVA 3CWHA 3TOPA 4CVUA 2FFIA 4C7FA 3AYRA 3L66A 3NXLA 3FAWA 1VYSX 2QCEA 3EDKA 3W81A 4JTIA 3BXWA 1JR1A 4GQRA 1AFSA 2Z00A 2ADAA 4INFA 1S38A 4MWAC 4JIEA 2D2JA 1EHAA 3LXBA 3CS2A 3MYOA 4IFOA 4PFMA 3SSJA 1VFTA 4P8VA 1RR2A 1Z48A 3RAOA 3PBGA 2O0TA 2PTWA 2DQWA 4TVUA 3RXZA 3SCTA 1OFPA 3RRXA 4MYXA 1YDNA 4MZ8A 1YTDA 2EPNA 1JUEA 3WMLA 4ZQCA 4PFHA 3GZ3A 3CLWA 3LU2A 1JPKA 1HUVA 4NZ3A 3H4GA 3VA8A 1F76A 4MVAA 1JCLA 1KFKA 4WGXA 2CIPA 1BF2A 5I06A 3L4TA 5FACA 3GNXA 5JMUA 2QDEA 2GOUA 2XIOA 1QI0A 2BX7A 1AL8A 1MFUA 3I10A 1BF6A 3M16A 4N9DA 1DORA 1O6IA 3ZYZA 1MVYA 1HO4A 3UR8A 1EO5A 3EX4A 1YNPA 3NL6A 4IMFA 4J27A 5LNWA 3ABQA 1IEXA 3UZ5A 3EWYA 3GHTA 1B5TA 3QFWA 3FSTA 3THDA 5HAOA 1BAGA 3HOJA 5KZDA 3DFTA 3T4WA 1TSIA 3CAVA 1YLVA 1ZUAX 3PJWA 4WUIA 1THFD 2FMNA 4FI4A 3E74A 1QHOA 2FZBA 2YFOA 1BQGA 4QHRA 1X97A 2D69A 1ZB5A 1UIOA 3G1AA 2EGZA 3EXTA 4NAFA 2JIEA 1E1CA 2CLOA 5G1MA 2FHCA 4IQEA 3A3HA 4GQBA 2QV5A 1BSLA 4K3ZA 4D1JA 4PB3A 4S39A 1RK6A 3CHCA 1AQFA 3PPFA 3EMQA 1H49A 3VD9A 2HJPA 2VMFA 4QE1A 4MUZA 1GCYA 1BEUA 1EUNA 1WP6A 2V3EA 4UNKA 4LCRA 4ADSA 4GYJA 1KNWA 1OK6A 4GNKB 1X1OA 1GKQA 4L7ZA 2Z1BA 4OQVA 3HG2A 6XIMA 1DWIM 2ZICA 3KBNA 1J0ZA 1B0IA 1BRLA 3D3FA 4R7OA 5DCBA 2AL2B 4MPKA 3SN0A 3B9OA 1W5MA 1V5XA 3BOFA 3AU2A 2BOGX 3ARZA 3VGEA 1KFBA 1HZYA 2A79A 1F3TA 2I14A 3GFXA 2HBXA 3C0QA 1RLCL 2CW6A 3L2MA 3RGTA 5D37A 3BAJA 1OCJA 5RUBA 4JAWA 4E2BA 5EMUA 1KM1A 1FDZA 1TVLA 2FPYA 4QDMA 4C65A 4C5ZA 3O6YX 4FXRA 3N25A 3LNMA 5EL1A 4QSHA 3DG6A 2ZDSA 3HPZA 4G7FA 7PTDA 5I3HA 2H3DA 1BYBA 3BCDA 4ROPA 3REQB 5AC5A 3GC4A 3AICA 2Y0FA 3TYZA 1X7IA 2BFGA 1MZHA 4RDVA 4WY0F 3LPPA 1MEIA 4B5WA 3AYTA 3W3OA 4DLFA 2ZVRA 4ES4A 3H2FA 2Q3RA 2XH4A 4GUGA 3VUSA 4XKMA 3TN6A 3VCRA 3WD1A 1OK4A 2MNRA 4DZAA 1H7RA 3G3MA 4D1IA 2I9UA 2X30A 4DPPA 3LRMA 4MAZA 3SCPA 4W8LA 1R7OA 2R1KA 4IJBA 4GI8A 1GOIA 4WDWA 2JE8A 3MCNA 4UZUA 5CBJA 3SJNA 4S3BA 4DPQA 3A13A 4JIRA 3JU2A 1FTXA 1YEYA 1XI3A 3ZJ8A 3PS7A 3C0LA 4ML9A 2GGIA 2G3MA 1TIMA 2J8FA 2PDJA 2XFRA 1I8JA 5KITA 5A6LA 2RFGA 3MY9A 1GVSA 4GLEA 2DP3A 3M5XA 3I4EA 3A3XA 3GVWA 4ZTYA 3VKDA 2PDCA 2DH2A 3VK5A 4GPNA 3GR7A 4CQ9A 2I1OA 3W1TA 1RD6A 3MUAA 3B4UA 2QF7A 3SCNA 1XD0A 5T91A 2IPWA 3WQOA 2OEKA 4K38A 4OBRA 1J9YA 1OF8A 2DVTA 3LSBA 2P53A 3BK0A 3N14A 2QCNA 2P1FA 1XL9A 3KZPA 1U22A 1KGUA 5E09A 3D0CA 2RH9A 2RJGA 4FIRA 1QK2A 1RLDA 1S3TC 3LK6A 4GYFA 3ARTA 1W0MA 5CPLA 4Q4KA 4XO6A 1S2TA 2F8QA 4GIYA 2A85A 3CAQA 3O7UA 2Z26A 1ECQA 1UCWA 1LQ2A 2P8BA 3STEA 3ORWA 2IS7A 2V3FA 4HHPA 5AECA 4HNVA 3P74A 4UTJA 1XKYA 2OGYA 2PBOA 4B92A 4O8AA 1EJSC 3LY0A 4C6NA 1J8VA 3F5LA 5AHMA 4OBSA 5DRCA 2VFEA 2AL2A 1YADA 5G4EA 4PRWA 1J93A 1I2PA 4WXZA 5AYBA 1ZCCA 1NWRA 1H09A 5AKQA 2HCVA 4PMRA 3LLXA 4JKMA 3EWWA 3TQ0A 3DOPA 5AYYA 6TAAA 3PM6A 3GSMA 4GYPC 3GR8A 2Z28A 5HQLA 4DJEC 2BS9A 3ITGA 1H7WA 4EF8A 2QUNA 2PDBA 4X0NA 3S5SA 2NUYA 1QI3A 3REQA 1RQEA 3GUGA 3WK0A 1SQ7A 2YOCA 1JI1A 3URBA 1H60A 4MY1A 3QTGA 3CPUA 2X7WA 3TIMA 4AEOA 4HMDA 4DZIA 1W5PA 2RDUA 1KBLA 1XLMA 2IW0A 2PP1A 4ZXLA 1G6CA 2VEIA 1ALDA 3N11A 3JW7A 5K7JA 1GQIA 3BE7A 1JDCA 4X61A 3CYJA 1UKSA 3BSMA 3B40A 2CBVA 4GABA 2RDXA 3RPMA 3RX2A 3K46A 3FOKA 3VNDA 4DLMA 1LOLA 1R9XA 1UD4A 3SCSA 2Q6ZA 1TZ9A 4BI6A 3EWCA 2WZEA 1G67A 2NVCA 3AQUA 4DBDA 4F2TA 4MNJA 3H2OA 2AAMA 8CGTA 4B3ZA 5HWMA 1CXFA 4XZBA 4PUJA 1W56A 2J75A 2WHJA 5CZKA 4OKDA 5A8GA 4E4UA 1NWTA 1PKMA 1UP0A 3DN5A 2F6UA 1VBGA 1RAKA 5FF7A 2XN2A 2ZA1A 4JHOA 4LC6A 4MADA 2V2CA 3FA4A 1Q7MA 2HXUA 2QT3A 3T81A 3H2NA 1GQNA 3U7VA 3G5EA 1OYBA 3MANA 3UPMA 3LCIA 3QOMA 1D7KA 4GG9A 3G1YA 1ICSA 2YW3A 3EZ4A 3S2JA 1EFZA 2VEMA 3GIPA 4YHEA 1KQYA 2O4MA 2QEZA 1OD8A 3KRBA 1DXIA 3BLKA 3LGDA 4Z2IA 4AYSA 4KCVA 1XP3A 3Q65A 4JNMA 4O0ZA 1JFHA 3ICJA 4US5D 3B8UA 1B31A 7ODCA 3LA4A 4E8DA 3AJXA 1IXQA 4GMEA 3CUXA 4ZZ9A 4LS1A 4L65A 2PDQA 1SFJA 2C3ZA 4HU4A 1P0BA 4B5SA 4RNIA 4QS5A 3CAWA 1QAPA 2XFFA 4Y9OA 1Z6KA 2PWGA 3WD4A 3WQ6A 3B04A 4N9BA 1QPNA 3FHAA 4L4MA 4R33A 5A6MA 4PE8A 5CKSA 3CMJA 4W8AA 2DW6A 4CQ8A 3M0VA 3TZNA 1XC4A 4TR9A 1SZRA 3NDYA 1VPQA 3EX3A 4GZIA 1FP8A 2ASHA 4JYEA 2OJPA 3FGCB 1E1EA 3K4DA 2DZSA 2W63A 4MKNA 2G97A 1O68A 3O9NA 2AKMA 1QTWA 1HNYA 4JTEA 1UKPA 1FDYA 1SZEA 2JFEX 4F2BA 4HPNA 3S9YA 3TOYA 4H6KA 4S3FA 3WY1A 1TJ2A 5BOOA 4MF4A 4WOQA 1VFUA 2Y7GA 4NYUA 4HA3A 3U4FA 3L4UA 7TIMA 4JGDA 4XVDA 2Y63A 3W88A 4H2CA 3THAA 3H2MA 2R1PA 1LQ0A 5FAJA 5E0CA 1E6QM 3G1XA 1UW9A 3UERA 4ZMGA 2YX0A 2UV8G 2RUSA 1Q6DA 1UUQA 3QV6A 2YW4A 3N3MA 3HFTA 4NIRA 5EBAA 3UR7A 1TTPA 3DDMA 1Q6CA 4ZQMA 2DZAA 1YPXA 1EJTC 4UMCA 2XWDA 1PV8A 1FWIC 1YNQA 1IZJA 1NH6A 1GOMA 4O15A 3UT0A 4L4PA 3LBOA 1DKWA 3RR1A 4JN6A 4B2DA 3GLCA 3BOLA 4K8HA 1OT2A 4NT0A 1OEPA 3WCZA 2DQXA 3MI2A 1C29A 4RDWA 4GVGA 1ME7A 4CEUC 1ZPTA 4ZO8A 3R4IA 1M9HA 1BTMA 2G37A 3MI6A 3VMOA 3WDPP 3RLVA 2G4FA 1XIHA 4HYVA 5BMWA 2DT3A 3SCRA 3V1PA 4BQ4A 1CXKA 3DERA 1ZAJA 2FPVA 4E8CA 3O0KA 2IKJA 1JULA 3NXFA 3WQ8A 4HVXA 3UXLA 4W5ZA 1YPIA 1Q5MA 3OZMA 1R3YA 2J7DA 4GINA 3KOYA 2QGHA 4OJYA 4BQ5A 2YB4A 1AUSL 3TEVA 5FD0A 1UMLA 1P5BA 2SFPA 2ZE0A 4IOTA 3HG5A 4G56A 4J3UA 4LAOA 2TRSA 5LHFA 3AIEA 3PFMA 4WSKA 3R25A 4QAWA 5HPCA 4H6QA 1XM3A 2CBJA 4F8XA 2YZRA 1XLAA 3NQMA 3W1QA 4QFUA 7ENLA 3WH5A 1WDWA 4PMNA 4NJIA 4MAVA 4WK9A 5IRPA 4C6FA 4IM4A 4ACZB 1WDPA 3G1RA 3TV8A 2G96A 4HK7A 3UYCA 3OQ8A 4AG0A 1I75A 4M1BA 3ZFHA 1D2KA 1J5TA 2VFFA 3LDVA 1IEQA 4KWVA 4YWIA 1VPXA 4PTVA 3N2BA 3B9NA 3TAOA 3N1AA 1R3WA 1US2A 3FGCA 4GGBA 1GZGA 4YTSA 1VF8A 3G1VA 4DEFA 1Q8JA 3QKZA 3LHWA 3HGOA 3ZJ7A 3KRZA 3KP1A 1OFRA 3G8RA 2E5DA 4RZ6A 1KB3A 3T0AA 3QYQA 4NASA 4TX6A 1WBJA 1RY8A 1UD2A 4ZSTA 2HEJA 1IGSA 4QXIA 5HPOA 4HMEA 3L4XA 4UNLA 1OFEA 3GYEA 4YIWA 3M5VA 4AB4A 2IKHA 2CLIA 2NV9A 1W9BM 3WF3A 1OX4B 4QDPA 1MNZA 1TFVA 4CQDA 3BWWA 1EF2A 3P6LA 5MF5A 3TMQA 5BCAA 2ZZ5A 1C8YA 3HIJA 3O0FA 3W1UA 1M6JA 5CPNA 4M51A 4DWSD 3Q67A 4F79A 1X6UA 4B15A 4F0RA 2WANA 4IFKB 2ZIDA 1OFBA 2XUCA 2H9AB 2CEQA 2QJJA 4DWSB 2HZGA 1MXSA 2VNCA 1ZAHA 1BFNA 1EYWA 3SUTA 4WXYA 4H8UA 2A6LA 2DIJA 4YPJA 3CQKA 1H5YA 3WDHA 3C5QA 3ES8A 1GQJA 4L6OA 1W1B1 2TSYA 3KS6A 4U2ZA 4V1YA 5AHEA 3UVAA 1HKJA 2QGYA 2ACSA 4KT2A 2OX4A 4LANA 2WVVB 1KM5A 3EXRA 4ZEPA 1TWWA 1XKJA 1OCNA 2V82A 2W91A 2CCRA 4GQ0A 1G4SA 5CG0A 2CHRA 1BGGA 4NAEA 5MKGB 1EOMA 1W9XA 4H01A 5EFFA 3UR5A 2FTPA 2CKRA 1Z7AA 1N7KA 3KBSA 4A3HA 3EOOA 5GNXA 3WZ0E 1UBSA 1XSJA 3ONCA 4WIWA 3AHTA 1FWEC 1GW9A 2CLLA 3MUY1 3UYIA 4C7DA 1F6PA 3TLLA 3D47A 1XH1A 3HQ1A 1XPGA 4IP4A 1OIFA 4X9YA 1JZ6A 5HMDA 2HDJA 4Z1DA 2OPJA 4H41A 4DHGA 2VXNA 4WSJA 2W27A 3AIQA 4OZOA 3WX7A 4NUWA 4ACZA 3W76A 3FN9A 3UBPC 1PZ0A 2PC8A 1E0VA 3T78A 2GUBA 2D0HA 3PBWA 1XLHA 4RE4A 4J7RA 1NFGA 1CLXA 2VDHA 5BU9A 3KTCA 5H91A 1DTUA 2AGTA 1UQZA 5M1TA 1XCXA 1I1XA 3SGGA 4GI9A 1ZSXA 1IT0A 2BHZA 1BD0A 5LNRA 3TCSA 5F4SA 3FV9A 4CNUA 1UWIA 3VIMA 2O56A 3CC1A 3KZSA 5BRPA 3G24A 4LJ3A 4GUHA 4LYQA 3NTYA 2R82A 2BVYA 3BANA 3UWUA 4HCHA 5BU6A 2ZFAA 5A6TC 3TA6A 1K77A 2VHLA 3OZYA 3AS1A 3NYZA 3H12A 1S5NA 2DZUA 3N15A 3P8IA 2BTMA 2I7GA 2ZUMA 3XIMA 3B8WA 2HROA 1TCMA 4NHVA 4TXEA 3W1AA 3BCFA 1L6FA 1BXBA 1UJQA 2VEGA 3S6OA 5LA1A 2BY2A 1OX4A 1UZHA 1EC9A 3PJUA 4JL1A 4OE7A 1Q85A 2VZOA 4JTTA 1CEOA 5CSUA 4D6EA 4DI9A 3H4WA 1VJSA 2FDSA 3BQ6A 1JPIA 4NYYA 3WFLA 3VZYA 3SY1A 3M4HA 2BGNE 4IFKA 2PDPA 2F2KA 1WOAA 1XS2A 9XIMA 3NOEA 3MYPA 5I3GA 2ZRVA 4DWSA 5HULA 2A3BA 1X6NA 3V0UA 4FAMA 4JQ2A 4HK6A 5ENLA 1ZAIA 3Q37A 1P6BA 4YVXA 3ZLFA 3MKCA 4FNRA 4WJXA 3VX0A 1B3OA 1BKSA 1FH7A 4P8UA 3GIYA 2OKTA 1B30A 3S8HA 2QMJA 4QTGA 2J9YA 3GB6A 1CGXA 4XBJA 1Z32X 3PUOA 3VPLA 4OIFA 2XDFA 2EPOA 4F40A 4ZOBA 4DX3A 1KA9F 2PGRA 1W1ZA 4F2UA 3SRKA 4HOZA 3NEHA 4N6FA 1FCQA 3VIHA 1TVNA 3B0VC 3MI3A 3QQWA 1P1MA 3VDAA 3QPEA 3WENA 4C6OA 4UFHA 3DFQA 3T42A 3OLIA 3T2QA 5MKGA 4JTLA 3WF0A 1M7JA 1O12A 1TCDA 4ICNA 2GSJA 2FGBA 3TSDA 5I3IA 1UR3M 4GO9A 3UETA 1F8IA 5EU9A 2PTYA 3OBEA 1Q7ZA 4BI7A 2JKEA 1GORA 1PIFA 4IGSA 3C0SA 2VCCA 1GUVA 2PI6A 1GQLA 2XHYA 2JQXA 3PSVA 4IMEA 1JZ5A 4OU1A 3TC7A 3WUBA 5EY5A 2E9BA 1DPMA 1LL7A 1TPFA 5BOFA 1ITUA 3WH7A 3KL0A 3UA4A 1MMFA 3FK4A 4A4AA 1J0YA 3HQPA 4HNLA 1KM6A 3OBAA 1R8LA 2Y1HA 4KIRA 1X98A 3PUEA 5CZSA 4YNGA 2WC3A 5A2BA 1W2VA 3TNBA 2ZBTA 4IL2A 3L65A 1D9EA 3CMGA 2V3GA 4TMCA 3E2QA 4IQJA 1B3VA 1JGMA 1UWRA 5BZAA 4KRZA 4Q32A 2NWSA 3RMEA 4GX9A 3B9DA 1V02E 4DI8A 2E68A 2QV4A 3C2VA 1A4MA 3AMLA 4PGLA 5C70A 3T07A 4B9YA 2YSWA 1J2WA 4P7NA 5AOUA 1S5WA 1AODA 1P0EA 3CEPA 3T40A 4GI6A 1UH2A 1E4LA 1XCWA 4N0RA 3CZLA 5IHSA 3PZMA 2WHMA 4E5TA 2QXWA 1REQB 2EJ1A 4NRSA 1AH4A 2V5CA 3STPA 4PSRA 5HINA 2A2IA 2PDMA 1EWEA 4IGHA 4L6HA 4LYPA 3GVQA 2TMDA 8XIAA 5HNNA 4C6KA 3TTQA 2PP3A 5C6MA 3V35A 2QVHA 3R5EA 3W29A 5LKYA 3RR4A 3WQVA 4NNBA 4J3ZA 2R1NA 5HBFA 4GX8A 4DYEA 1NDVA 5G4WA 1F61A 1XDLA 3N4EA 2ON3A 3AJ7A 3URNA 1G1YA 3SB0A 3B0UX 5E9XA 5B80A 2CU0A 4AY8A 1RVGA 2I16A 4PMXA 4AZ6A 3VOCA 3F4CA 3MKVA 2V9DA 4AD4A 2YA0A 4GFSA 4FLSA 3EX6A 2EPKX 2X40A 1J6OA 3M0LA 2IKIA 4D6HA 1E71M 5CZJA 3APTA 3RM8A 5CGQA 1J0JA 3CL7A 1UASA 2WB5A 3E6EA 1KFJA 1AJZA 4PMUA 3NM3A 2WBKA 1AMKA 1BKHA 1TRIA 1QATA 2JEPA 4IIFA 4N4PA 2QJHA 1T99A 5KZMA 1TJ0A 4AU0A 1VQTA 3II1A 5CLTA 3OODA 3BMWA 4Y2WA 2XZ7A 2E40A 3PN8A 3N12A 1SFSA 3TJLA 4C90A 1VCGA 4G9PA 3NL5A 2VP8A 3N6QA 3S1VA 3ARSA 2E0PA 3W74A 1VCVA 4JFUA 2OB3A 4IIBA 5TBOA 4LBSA 3IEBA 3NZ1A 4OWGA 3S1UA 2ISWA 3UQNA 3ABOA 2I57A 3QHMA 3UZYA 4WKFA 1XUUA 3MDUA 4LY4A 2DVXA 1XIEA 3OTRA 2X42A 2JGQA 3E9AA 3NYDA 2YGYA 5J5DA 3GFZA 3S2CA 4BHYA 4ATLA 1AH3A 3RLUA 4W88A 1EIBA 3OGRA 3PPHA 1A5NC 3OPSA 2YL5A 1VLIA 3OB8A 2WM0A 4B5NA 3PB0A 4JCLA 3TXZA 4A8NA 3KAOA 2NSXA 3TAKA 3OIHA 3G0SA 3HO8A 4LCQA 3NSXA 4UFIA 5CSSA 1F6YA 5M5DA 1TTQA 2PRHA 1VIZA 4J3SA 2VGIA 4JIQA 1F3EA 1NVMA 3HV8A 4HSOA 5DXXA 3TYDA 2POZA 2XVNA 4QR6A 2A1YA 1FCUA 1UC5A 3WDIA 4TV6A 5M03A 5FJRA 5EPDA 2PAJA 1C7SA 4HNOA 3AUJA 1REQA 2X41A 1DBTA 5IM51 1TPWA 2Y70A 2VTFA 2A7RA 1JCTA 1J5SA 4AZCB 5D9MA 4DBSA 2DU2A 4O16A 3BZJA 1RJPA 1KFWA 3H26A 2GGEA 1QWKA 4PCPA 5D9OA 1W3HA 4IPJA 1KKRA 2ZUSA 4KEMA 1EUAA 1RPXA 1P1XA 1EDQA 3TQKA 5BW6A 3NO3A 4OT7A 5LGXA 2ZA3A 2VZSA 4HCDA 3NFUA 3GHUA 1O7AA 3GTHA 3DC0A 4C6MA 4E4PA 1TTJA 4U3AA 5FJOA 2VO5A 3ZR6A 4R5EA 3A4XA 1L6GA 4IGMA 3W2UA 5EBUA 3F4NA 1WB0A 4YHGA 1ZJAA 1MO0A 3CUZA 4ACYA 2E67A 1XHGA 4UTTC 3PSWA 2E9MA 1DE6A 3UWWA 1QNQA 3PZOA 2FZNA 4G2DA 1GYNA 3T8LA 3VIGA 4DXXA 1MWOA 1S2CA 2G5WA 4NJJA 1PUDA 3OGVA 5E0FA 4CUCA 2R6OA 3SM0A 3DFOA 3GXFA 1QOQA 1ZHAA 3AXMA 2X1RA 2VFIA 3Q94A 4FLRA 3FFSA 4KCWA 3DG7A 5AHNA 3I3DA 4GZEA 3GO2A 1KFCA 4C6BA 1YBQB 4J3VA 1A50A 1XGZA 3QVQA 3RFAA 1MSSA 1MUMA 2VWSA 1W1PA 2PA6A 4E3VA 5K4ZA 4L1WA 2XVLA 2OYMA 2PGEA 1R47A 2YB1A 3AMGA 1DHKA 2ZWYA 1YYAA 3W7PA 3BURA 1X7FA 4Z1YA 4JX4A 4Z0JA 3UG3A 5AVNA 4Q8WA 1KBKA 1NEYA 1FWNA 2ZRYA 1A49A 3RITA 4UFMA 1UD8A 1OGSA 5FJPA 1QDSA 3NQAA 5C7HA 1R3VA 5K9DA 5K9CA 3DX5A 4GH1A 2YLLA 3R1ZA 1TPUA 1VS1A 5ECVA 1XGDA 4LCSA 2YBVA 4KEVA 4KFOA 2W9MA 1CW2A 1MXGA 1NDZA 3E5PA 4I5XA 1GQKA 2Z2AA 4PR4A 2HTMA 1EX1A 3AC0A 1FWBC 3SECA 2H90A 1V3KA 1U1UA 1LT7A 4L80A 4O10A 2NUXA 4Q22A 4MY9A 3SRDA 5HMFA 1H7NA 4XB3A 4GXWA 2KAUC 5JH1A 4DUOA 1QNRA 2VX7A 2OEJA 4M24A 2PUZA 1HFBA 4PCSA 3DUGA 1NQKA 4I9MA 1Z44A 4YVVA 2HWGA 3P81A 1MRQA 3WUEA 3L5MA 2AKZA 2EBNA 3HGJA 5I03A 1C90A 2WHLA 3VD3A 2DSKA 1H41A 3NM1A 3EX2A 1E6RA 2O9OA 3PZTA 3EA3A 4HSHA 4DJDA 1W17A 4HU8A 4WOZA 1DQUA 4Q4MA 4GC3A 1WZAA 2J9ZA 1G01A 4HJFA 2WC4A 3G0XA 5C2CA 1EXPA 1YDVA 3VILA 3GW0A 2CPUA 1Z9AA 4U31A 1XW8A 3TE9A 4ORIA 3MUZ1 1B3WA 4NI3A 4AZCA 1Q66A 4KIEA 3A23A 2ZUNA 3GU2A 1KD0A 1GOXA 5SWUA 3QPYA 4AWUA 1DJYA 2ONEA 4LRTA 3HMJG 2E8ZA 1JCNA 1TX0A 3RIKA 3E5BA 4E6MA 3DKJA 4NZCA 2DIEA 3O1NA 4PTDA 2G3JA 5T9BG 1CTNA 3W7HA 1JYXA 3CIWA 1QW8A 3LLDA 3SBFA 2FKPA 4DXKA 3U3HA 3NQ8A 1TR1A 3GTXA 1Q13A 2PWDA 3BAXA 2Z7GA 1JRBA 4BJHA 2MANA 1SVDA 5EB8A 3ARPA 3P8JA 1K9DA 3GBEA 4AVOA 3N04A 3QY7A 1S3HA 4LBUA 4KH2A 1IGWA 4OFCA 1PDYA 5KETA 4FNTA 3LYEA 3IGSA 3BAKA 6TIMA 4WD0A 4RE2A 4D6GA 3L4WA 2FPTA 2QDDA 4HNNA 2PFHA 2BG5A 5FJUA 4O19A 3USZA 1FVPA 3WLOA 2ZZ2A 4IQLA 4EE9A 1L2QA 3I6EA 4ECLA 1TPEA 4Z1AA 4RNJA 3MO7A 3LZ3A 4JR5A 1B3ZA 5FI8A 1CNVA 4Q4OA 5LIUX 3KL5A 4RK8A 1E0UA 4BF5A 5C9RA 2DFAA 1EA9C 3DHFA 4L4LA 1JNEA 3FX4A 2WMIB 2NQ5A 1VC4A 1VFMA 5F2IA 1N8IA 1IEWA 1FKWA 2Z24A 2QZRA 2VGGA 4A8RA 3WLJA 4IX0A 2Y5JA 3TX9A 1H7PA 1FH8A 2E9LA 5JBDA 4V1XA 2G0WA 4EACA 4ATWA 2P3ZA 5A6BA 4I9JA 3W37A 4R7JA 3W1MA 3CXOA 1NOWA 3O2LA 3DYMA 1SR9A 1QNSA 4QITA 3OGSA 3QZAA 3VM7A 5CBBA 1EDTA 1GG0A 4R85A 4Q6JA 3PZGA 1TUFA 3EEZA 4NF7A 5E5CA 1Z69A 4O1EA 2I56A 1RALA 1DOSA 1K03A 2ODOA 3TONA 1H7OA 4M6PA 1A4LA 2A3HA 4HHHA 1UR1A 2HK0A 4BWLA 2Y7DA 5LIKX 1PYFA 1GK8A 4FNSA 4GJIA 2E5BA 4C7GA 1SJAA 1A0EA 4F9DA 3T0BA 4FK9A 2WSKA 1W8SA 3UJEA 3L0KA 3G6MA 3LEPA 3SY5A 4DJFC 1TPB1 3VNZA 1EQCA 2V38A 3OU8A 4O28A 3BJSA 1M53A 3KWXA 3MHGA 4PTXA 4HNCA 3W23A 3WQPA 9XIAA 3SQSA 3GH4A 5DT7A 3PTDA 3PB2A 2D22A 1XLGA 1XFBA 1RPKA 3L4ZA 3ZJ6A 4QBXA 3ZIZA 4HZMA 3B3DA 5D8WA 3DAQA 1A5OC 4JQ3A 1VH7A 1P43A 5FF0A 3IV3A 1A3HA 2QJGA 2J7EA 1ONXA 3CEUA 4ZQNA 2QPSA 1S2VA 4PUMA 3FEMA 1HL2A 1POJA 4XVEA 1OC6A 2GL5A 2PZNA 3U6WA 2BVDA 3QRHA 3BUVA 4HZ7A 1K6AA 2OO0A 2XSAA 2YR1A 4AWEA 3GKFA 4HA1A 4E2DA 1HGWA 1YXDA 2CZFA 3CMFA 1AW5A 1E6ZA 2WMKA 3EXSA 5ABGA 1E4NA 4XAGA 2YCIX 3FJ6A 4AIUA 2BHUA 2Z0IA 4AIOA 4GOAA 3CT7A 4ADTA 3BAIA 4ZB0A 1Z41A 2XWEA 1E6XM 2XH2A 1E0TA 5HR6A 3U4AA 1Z42A 1PX8A 1KCLA 4HN4A 1ELSA 3U5UA 1D3GA 4NVTA 3UJFA 1U2YA 1BWKA 1JIBA 2UY5A 3SURA 1DXFA 2PS2A 3A64A 4DYKA 1EF3A 3TVAA 4S3CA 2Q3OA 5I07A 5LHEA 5CAHA 4RDZA 4TO8A 3LTYA 3PUGA 2FGLA 5DN1A 3O6AA 1IZCA 1G69A 2F6XA 3AIUA 4LYRA 1ZBKA 3MVIA 3TYEA 4KKXA 3PULA 1CGYA 1AW1A 2PDLA 4XD4A 1OHLA 4P5UA 1GJWA 4D8LA 2WMIA 1BVWA 3VDCA 1ZLPA 3IACA 5DXYA 5EMKA 1DJHA 2FZMA 3ATYA 5A2AA 1VBJA 5J8LA 2J7BA 4RPQA 1NF7A 4JKKA 2J8GA 3C2OA 2ZRZA 5FSDC 4D6CA 4CNPA 3UCQA 3R0DA 2QW5A 2FQIA 4WSHA 4WQ6A 1EDGA 2VQTA 1V6TA 5DF0A 3E0LA 2J88A 1LM1A 1PIIA 2X16A 1HVXA 3TUUA 4Q8MA 3HN3A 4HSNA 1KM3A 4S3DA 2ZUUA 1NWUA 2ZZ3A 4Z1BA 3FW6A 1NWSA 3HMCA 1ZJHA 2X2YA 3IIPA 4U28A 1EJXC 3NGJA 1AK5A 1OY0A 3GDRA 1R2SA 3B0YA 1GEQA 4ZO7A 4HB7A 4AMCA 2EHHA 2XVGA 1CXHA 3N29A 4UOJA 4KRUA 4CD5A 3PANA 1B4EA 1OJXA 1HJUA 3P62A 4K7YA 3BO9A 3WLPA 4AZIA 1KXVA 3VKJA 3F4VA 1ZU8A 4ZE5A 2E09A 2FDMA 5C9UA 3E1F1 1A5MC 3RILA 4EVZA 4EPEC 1V6WA 4RW3A 1F07A 4O1DA 3IVTA 3UWZA 4PB4A 3R8HA 2GWNA 1V3LA 2NVAA 1JDAA 4B4FA 3AS2A 3R8GA 4GXPA 1VEPA 4LXFA 2HPIA 2C0HA 1VYPX 4RKAA 1FXQA 4CKQA 3K1DA 3BMVA 2VKZG 5HJYA 3NQ7A 3CQ0A 4BFAA 2WQPA 5K4XA 1O1ZA 3C86A 1J11A 3RO6A 4DAFA 3EWZA 4W93A 3SN4A 3LPFA 5DLCA 3C52A 2GUUA 1C9DA 1LCOA 4PCTA 3NL2A 1LBMA 1IT7A 1FKXA 2BHYA 3VZZA 2NQJA 4YXGA 4AX6A 1Q7QA 1O1HA 4XSMA 3G0UA 1LT8A 1PWMA 3S6TA 4GBUA 2WVTA 1SZFA 3GWQA 3SQLA 1WDDA 3VXGA 2BOEX 3NO5A 3GRIA 1RQHA 2CBUA 4QJ3B 3CASA 1L6WA 5D04C 4MWAD 1PX3A 4LGXA 2GPTA 2ABAA 3CYVA 5I5RA 3N2MA 3W75A 3KCJA 2Y4SA 3ISIX 1S39A 3NDZA 3W1NA 2XISA 4XSLA 1JQXA 3DI1A 2TAAA 4MWAB 3ZT5A 2ABBA 2OYLA 2NQLA 2VEFA 1R30A 3W7OA 3W38A 3W25A 4Y8FA 4R34A 3THCA 4A8LA 4A29A 4XZ9A 1ZFJA 1XLBA 4NZJA 3TTOA 1MW0A 4FX6M 1W5NA 1PTGA 3QXBA 3RJYA 1GTEA 1FCBA 3UWVA 3W1LA 5EMMA 3GXDA 5I77A 2PU0A 1DIDA 3LLFA 2IKGA 2O4QA 5HMEA 2ZC8A 3GDKA 4AD2A 1SO3A 5TIMA 1UD3A 3U48A 3MPGA 5F2GA 2ISVA 3UR2A 2Z2BA 3GNDA 2WMJA 4NILA 1GOKA 3ITCA 1TV5A 4FXFA 4M6VA 4QISA 4ZFCA 2Y88A 1KGXA 3WDQA 1G7UA 3B0PA 1OG6A 4GYKA 2NX9A 2XGZA 2PZ0A 4GIAA 1UR4A 2P0OA 3F4DA 3TSMA 4ERGA 3UCDA 3RCMA 5HDRA 1KBBA 2BWGA 4ZOCA 3ZLHA 1Z8AA 4IP5A 4A3UA 1PE1A 3ZWTA 2DJXA 1IR2A 4L56A 1EC8A 4DO6A 1LP6A 5F4WA 4ROQA 1K8XA 3E12A 4KFNA 1W37A 1RH9A 3E3HA 3R6IA 4FR1A 1R3SA 3GG0A 1XINA 2R24A 3NOYA 4XO7A 4RZ4A 4WY0B 3R94A 4FF7A 1AMYA 1YNYA 3OVRA 4UR7A 4XTDA 3VGGA 3QMRA 1YXCA 1CT5A 4X22A 4GO8A 4CCEA 1O4UA 1SYTA 4Z1CA 2WBGA 3EB4A 1PZ2A 4B5TA 4P7RA 1B3XA 1EJ7L 3NURA 3W7JA 4KGJA 4LOCA 4IHCA 4WKAA 3WLTA 1VBRA 1PKLA 2BY0A 3OOQA 1TA3B 1XLFA 2CHOA 2Y7FA 4UQDA 4MLJA 4AHOA 4HIBA 2YDAA 3C4UA 3UW6A 3FXYA 3KUMA 5A95A 3IAQA 1FCVA 4DZ5A 1EGVA 5KSWA 1X38A 2D23A 4M0XA 1XYCA 1Q65A 2VUYA 5AYXA 4XWUA 3GXIA 4W5UA 2DJLA 2BY3A 4LF2A 1O66A 3TW7A 3WK2A 4IGNA 4U33A 5LA0A 5H8PA 1W3IA 5DCEA 1JRCA 1QFEA 1H1ZA 3BGGA 4D6JA 4CNOA 4TQTA 3ANVA 2QHAA 1PYMA 5EMLA 3T1GA 4EAMA 1P7TB 1VRDA 2J13A 3W4RA 2GQ9A 3SR7A 2ZTKA 4DAIA 4GACA 4IIDA 4IXXA 1NF0A 2KX9A 1DJGA 1PPIA 4U10A 1G4EA 3FDKA 4BY3A 2BXVA 1YE4A 1PJ9A 1GOOA 4MWAA 3GH5A 1RXOB 4AXNA 1WZMA 1BWLA 3CH0A 1X8FA 1ZY9A 5BXRA 1N2VA 1WZLA 4J35A 1UKQA 3ARUA 2OELA 5A69A 3WFZA 3AHXA 2INFA 3FKKA 3PZUA 3LHZA 2V63A 2OR2A 3WNLA 1CZ1A 3BCJA 1RA0A 1H0IA 5CEWA 2QLYA 1W2PA 3M6DA 2UY2A 3LSCA 3U0HA 1HKIA 1SW7A 4N4QA 1A53A 1QBAA 4JFSA 1UD5A 2W62A 3L68A 3F03K 4RR4A 1BSIA 3PTQA 3TKFA 4BQ2A 4POCA 3M0KA 2PLKA 2ZC1A 3TQPA 3UXDA 3GDBA 2HXTA 4JY9A 3VINA 5GNZA 3HJEA 4D6IA 4EPBC 1C3FA 4NNAA 2B0MA 2PCQA 1GOQA 4XBSA 2QUVA 3QOKA 4AMAA 4ENLA 1XDMA 3AU6A 1FHVA 1KCZA 4P7OA 4GRSA 3UJRA 1GKRA 4GQGA 4NL1A 4H7CA 5A3HA 3H70A 5DEZA 3ZVIA 1P0KA 4DF0A 2PU1A 1MUWA 4F0HA 2EPHA 4RLIA 4YLWA 4H6EA 3WNOA 1A80A 4FALA 2HVMA 1E55A 5BXPA 3ZMRA 4GY1A 3PJTA 3R0KA 1S5TA 3MKKA 4YMZA 4AAJA 3VU2A 4DIAA 3E38A 3O63A 3R8RA 2PDWA 4I8YA 3D6NA 4WY0A 1FWFC 4GUIA 1KCKA 2FVLA 2YLAA 3URAA 5GJPA 3W87A 2OMAA 1KXHA 3ARYA 3BSGA 1LORA 1TO3A 1V93A 1I2RA 3SIZA 1V79A 1LOQA 5DRIA 5I09A 1ME8A 3DGRA 4AIBA 5DBUA 1AD4A 5D2YA 1OF6A 1TA3A 3WH9A 1XIIA 4M8UA 5B7ZA 5FOOA 1PHWA 1OFDA 3OHMB 4QG8A 5EYWA 3AS0A 1A5BA 2B7PA 3LCFA 3MJYA 1C8QA 4AIEA 3LMYA 6ENLA 1WAWA 3VOGA 3PJXA 3S6DA 4F0SA 3ZWSA 2PLCA 4XD5A 4US6A 1MEWA 4IJCA 3S4TA 5TAOA 5FL0A 2B7NA 4DJED 4O12A 1OABA 4WJ8A 4RW5A 2B31A 1M7PA 2C16A 3SQMA 1Y65A 2XZ9A 4I6VA 2C1GA 1P7TA 2V69A 2Q01A 2VENA 3B03A 1CECA 1VEMA 1G9HA 5FEXA 3H21A 2ISFA 1R3RA 1J4EA 4R88A 3ONBA 5AHIA 3H4XA 1JFXA 2WNWA 5ABFB 4LWWA 2TPSA 2V5LA 6CGTA 5C5YA 4LRSA 4ZOAA 2YCKX 3E2RA 3OYZA 1UG6A 4E2VA 4GBDA 4IICA 4MJ4A 2Q8XA 2QIWA 4R9OA 1WKYA 1J96A 1DJQA 1SO6A 2YA2A 1UWTA 4JTUA 1F05A 3KCOA 2HNHA 3QV7A 2QIIA 1JDEA 1E15A 1G4PA 3SFWA 3K30A 4ZB5A 1XG4A 1QASA 2ZXBA 1I4NA 3LV6A 2V3DA 3GXNA 3VFLA 4AFYA 2VZTA 4C6QA 3OJGA 2GK1B 4MKVA 1FWRA 2X09A 3PBVA 4EOUA 1OINA 4LTSA 2PF8A 3DBNA 1KRAC 4OHQA 1S2UA 2ZCGA 3CTTA 1HW6A 3BW2A 4Q8NA 3MMWA 1LG2A 3PP7A 1OZMA 3QGVA 2Z25A 1DYSA 1XUZA 2FYMA 3MZNA 3W6YA 3WLSA 1KBIA 2PDNA 4YCOA 4A22A 3QY6A 3WK1A 5DMMA 1RV8A 3O06A 5K9XA 4CEXC 2JBMA 3VNKA 4ZCWA 1GHRA 1V4YA 1UR2A 3EB2A 3G8EA 1Y8BA 3WL0A 1YE6A 4Q7BA 1QR7A 1SPQA 3S9ZA 1FDJA 2XVPA 3ZT6A 5C55A 1T7LA 4O4VA 4IPIA 3N9KA 4KPLA 3U2CA 2HQAA 1E0WA 2V5BA 5TD4A 4HYWA 2VX6A 2ISDA 5HNRA 1ZNNA 3QMTA 4UFKA 5HQMA 3VD5A 2ZXDA 3SUWA 5FCZA 2Z6JA 3HQNA 3UWQA 4YU1A 2CKSA 3BZGA 2PDFA 4JTJA 3SUVA 4G8TA 1FWHC 2VI0A 2W6RA 1HO1A 3SUUA 1OWQA 2EEXA 1HF6A 2A4AA 3ARQA 3MP3A 4UIOA 4CNSA 1ZBWA 3G1SA 3RX3A 3C0JA 4RNHA 4P7QA 1EA0A 3WNNA 5IOBA 1U5VA 4H4IA 2OYKA 4AY1A 3MMTA 5D33A 1MW1A 1VHNA 3W7DA 2Q09A 3IJIA 2F2HA 4DRSA 1XYBA 3H8AA 2GVLA 4PTWA 3E2VA 4TUFA 5DT5A 5LIXX 4A3RA 1MFVA 1NSJA 4MB5A 1PZ1A 4PTMA 2IUZA 6ALDA 1J10A 4NP7A 1VAHA 1SSDA 4K2SA 4PMVA 3EDJA 4QJ1A 3UA3A 5C9XA 1M7OA 4MGGA 2E6DA 1A5AA 2GLKA 2NSOA 3W22A 3WUFA 1OC7A 2BSLA 2IMRA 1K70A 3UZZA 3OHIA 5L9FA 1HL8A 4CGTA 4RDYA 5ABFA 2V2DA 3ARXA 3S46A 3LM7A 3QSTA 4EXBA 4MNMA 3LQLA 3N6JA 1W1TA 3NQ6A 4OTKA 1XQLA 3WLQA 2PP0A 1ADDA 1O95A 5AC6A 3RMJA 3M5YA 1KM2A 1AQ0A 1M5WA 3W82A 1R46A 2RDWA 1IWAA 4IF2A 1KGWA 3B8DA 3PG9A 4HMNA 7A3HA 1J2BA 3VCCA 3APYA 2ZWZA 3PG8A 2GVYA 4P2VA 3UEQA 2GK1A 1WDRA 3H6OA 4I7UA 3DFPA 4JTAA 4MB3A 5C7VA 3L2IA 1H51A 5JBFA 4GXMA 2HBVA 2UBPC 5IFPA 4LVDA 1S5VA 1CGUA 3ZS4A 3FJ4A 3P84A 3O16A 3ARRA 4RNFA 3T4CA 3W1RA 1ISZA 1GOWA 4XBKA 3MUXA 3VDHA 1C9WA 3OVPA 4IZGA 2OSWA 1RCXB 3LHYA 4E0CA 2WPGA 4J3WA 2INEA 2Y5EA 1B2YA 1DHPA 1PWLA 1GG1A 2OU4A 3P67A 3AZRA 1Q4WA 1W1YA 4M29A 5JIWA 3N4FA 3WO8A 2J27A 2BLEA 1CB7B 3W7QA 1TPDA 5BXSA 3W72A 4M7SA 4ICCX 2PWUA 4W7UA 4LNCA 4L9XA 2ZOXA 2QS8A 1PSCA 1R85A 3A9IA 2YPIA 5IFTA 4C6EA 3ZQ9A 2Z1KA 4GZJA 3RNDA 1MZRA 2GSHA 4EWND 4BQ3A 2CZDA 4OBTA 4UR8A 2V0TA 1FUYA 1OYAA 3WQFA 2Y7EA 1CGTA 2QPUA 4L4OA 4CN4A 5D4YA 3N18A 3EPMA 3Q4DA 1RK5A 3CV2A 2VZUA 4AZ7A 3WFAA 5GNYA 3G1DA 4G1KA 2ZZ4A 2D20A 1AA1B 4ZB2A 3B8VA 3HTWA 1PIGA 3FS2A 4QGCA 1TQXA 4RZ5A 4XIMA 4C1LA 5CPOA 1MQPA 3F2CA 2DY3A 2E5CA 5D9NA 4UFJA 4L9ZA 4LEFA 1I45A 3SSZA 1K4GA 2DUZA 1ZP3A 4D8ZA 1V0MA 3MCMA 3KCLA 3MJMA 4WDUA 4EWJA 1M7XA 4AD1A 3EMCA 3LB0A 4KEZA 3EKLA 3M0ZA 1RP8A 1D3HA 4U5IA 1CGVA 2PRMA 1M1BA 3FA5A 1PAMA 3KRSA 3LQGA 1ISWA 3E96A 3TFCA 1V03A 4ZE4A 1OM0A 1S1PA 3I4KA 3DHUA 1IXPA 3J7HA 4DF1A 2ZE3A 1WXJA 4DB7A 3A4WA 4OECA 3WQGA 2NZLA 3PPGA 1PHQA 2H6RA 3W02A 3WLKX 4IUGA 3KRUA 4LBRA 4Q8QA 4LY8A 3W2LA 5CH9A 1E3XA 4HPXA 1JG9A 4MMWA 3W24A 1S46A 3ZJKA 4M3PA 2VJXA 1VYRA 2GJNA 2AQOA 2PWHA 2WJEA 1FWJC 2OT0A 3IJ7A 4AISA 1A3WA 1UB3A 3CM4A 1L8NA 1KXQA 4L6DA 4B3LA 3BH4A 4ML4A 3WF1A 2VELA 4N6EA 2OWWA 3T05A 2DDXA 3W6LA 3UPWA 4Z2LA 4NJGA 3K8KA 3M1ZA 4LT9A 1EP3A 2CESA 1J0KA 3CQHA 1B54A 3S1WA 1LWJA 3VE9A 2R1MA 3EWDA 3VTRA 4ZSUA 1EJUC 1E9IA 3W27A 4NU7A 1CLKA 3ZT7A 3QH2A 4N42A 1T0OA 3WYZA 4JDBA 3IWPA 2J66A 3GU1A 3MWAA 1TKKA 3FVMA 3ZLGA 3O6CA 3V36A 3NL3A 2CFFA 4TVDA 3TCEA 4HP5A 3HA1A 5C54A 3V18A 2NQ9A 1JF5A 1CXLA 4FZIA 2YA1A 5HWJA 2C19A 3QJAA 3OG2A 3QLLA 3ES7A 4FX7A 3ABSA 3HJZA 3QZ6A 1Y5VA 4O14A 1UUMA 2D3NA 3P7YA 3CNYA 4H8NA 5LA2A 5CAKA 5IHRA 4TU1A 1KTCA 3EEGA 2Z1VA 4L1XA 1EQPA 3OZPA 4YTUA 1IIHA 3IK2A 3NSNA 1VFHA 1KV8A 3F7JA 5FAGA 1F9CA 1VFLA 4GUJA 3T9PA 2DSZA 3LN3A 5CXPA 4BZYA 3VOHA 4HHLA 1L6YA 2Z1XA 2HS6A 3TU9A 2BVTA 1XQKA 4ZTXA 1XLIA 3BTNA 2XU2A 3ZR5A 3W1PA 4I9AA 1JCMP 3AXXA 3VNJA 5JBEA 4IISA 1LBLA 3A21A 4JCMA 4KCTA 3N2TA 3B4YA 3IIVA 1BXCA 4X2PA 5FEPA 3U7BA 1J0IA 4HD5A 4JFVA 1ONWA 3G1FA 4UC5A 1C93A 5HJXA 1XRVA 3NSMA 4IQDA 4QNWA 1DIOA 4AXKA 4Q8VA 2ZRUA 4LPCA 2ISSA 5T26A 2HSAA 5FSEC 5C2GA 2ZZ6A 3UZWA 4R3UA 4PUUA 4PA8A 3ZXWA 3A12A 1MUCA 3HGSA 5C9ZA 1LTDA 3MS8A 2QJIA 3VKCA 2WW5A 1MQRA 2G50A 3E0IA 1RVKA 2VR4A 3M07A 4PC8A 4PZVA 1UWQA 4KETA 3I65A 1WPCA 2E3ZA 1JJKA 2DV0A 4ADUA 2FH8A 4O1FA 2WXDM 3CT2A 1F73A 4K39A 4L61A 5D2WA 2OCZA 4P61A 4IG2B 1QOPA 1UH3A 1J0HA 4IWWA 1R7AA 5HANA 3BLFA 4CD7A 5AB3A 4HN8A 2A5HA 6XIAA 4JXCA 1T5AA 2GYIA 5XINA 3TC6A 1PKNA 1L2UA 4S38A 3TN5A 3TYAA 3BW3A 1Y7VA 2O7QA 3VABA 1XSKA 3AIWA 1H1YA 3L67A 4JX5A 3C2FA 4I8DA 4QQUA 1XLLA 4ILSA 1E5NA 4W9TA 2D0FA 5BOEA 3EA2A 1UWAA 2WKGA 3F1QA 4UOZA 5D30A 1BXNA 3P0WA 3GAKA 3AIVA 2AQWA 3PNUA 4EK7A 1JPHA 1A47A 1KLYA 3GR4A 4M6UA 3KVJA 3OLGA 2EJAA 5AFDA 3MHUA 3A5FA 2WLZA 3BW4A 1ECEA 1RUSA 1QPKA 4YL2A 4JZ5A 2QCHA 1LL6A 1F4AA 3IIXA 3NR0A 4Q4SA 3W7MA 1IXNA 1PVNA 5F1VA 3WN6A 3AWOA 4MYAA 3LZ5A 3IV8A 1EBHA 5BROA 1UOZA 3VMNA 2VD8A 1E9ZB 1F7BA 1UKTA 4WCJA 5H8UA 1HL9A 2EQDA 2HPMA 3GQYA 4PODA 1KCXA 5AY7A 2YCEA 3CO4A 1UQYA 2Y62A 4J3TA 1HQTA 3EAUA 2DVUA 4LAUA 3ITTA 1LYXA 3WEOA 2XSXA 3RUBL 3H24A 3IK4A 3QMSA 3UXAA 1K7XA 4L1GA 5JVLA 3T2PA 3IJQA 1U5HA 1XJBA 3QV9A 4EPDC 4XZWA 3E0VA 4H3DA 4DF2A 4HK5A 3W28A 4TOQA 5LNVA 3ALFA 5CPQA 3K2GA 4HU0A 1HG3A 3LPGA 1Q6GA 3PVFA 4K36A 4F0LA 5DY3A 2V8ZA 4W4QA 2WNNA 3LRKA 1FH9A 2ZDRA 2YBTA 1BQCA 1O5RA 1KBJA 2DSVA 4I5RA 5DBTA 3LENA 3MUIA 1SJBA 3BLIA 3JS3A 3ABXA 2CLFA 3ANUA 3L4VA 3FHQA 4B16A 3KLKA 1EC7A 2CC0A 3S5NA 3N19B 5F4XA 3CB3A 4G1NA 3W6MA 2A3CA 2DT1A 3E2SA 1JGIA 1JI2A 4H04A 3S42A 1XICA 4H9TA 3W85A 4QLLA 1BYCA 4I3GA 4US5A 3H2AA 1JZ8A 1MQQA 2QQ6A 4AZGA 4JNYA 3WQWA 1LG1A 3PZVA 3MTWA 3UGVA 2BP1A 3LM3A 4KCUA 4IG2A 1Q6OA 4REQB 2CHNA 1V6XA 3FJNA 3WBYA 1QMLA 2AQVA 2ZXAA 2NV2A 1KQZA 2RJHA 4F48A 2DZPA 2PMQA 2YCJA 2P88A 3KOXA 4H9YA 1YTKA 4H00A 1AZ2A 1UA3A 4FPSA 1AW2A 3AHVA 4S2BA 3JRKA 3P2VA 3ITYA 4UBPC 1TV3A 4ZO9A 3O8AA 1RP9A 5C8BB 3CZ8A 3I68A 4JTHA 3B8IA 1XLJA 5G2WA 4C6PA 3S2LA 1KWKA 4PYSA 1XDJA 3GVGA 4LVGA 1JUBA 4YCPA 3W84A 3V16A 4EF9A 3MDWA 2YYUA 1JYWA 3KOWA 2WYSA 3VC6A 4UTWC 4GJJA 2BV9A 4GKTA 3WJZA 1E43A 3N3TA 4C60A 1QNPA 1HGYA 2QAFA 3LD5A 2WAGA 4QQ3A 4XAPA 1IXOA 3FLUA 4QE4A 3H7UA 5REQB 3WQ4A 2DORA 3H2CA 2FGZA 1XX1A 1EKOA 5DO8A 1TMQA 3SW6A 2CETA 1H50A 1G5AA 3HF3A 4QRNA 4FHAA 2C1HA 1I1WA 1DWGM 2NQHA 3SIMA 1H2JA 3UCCA 4MDOA 1NOUA 3JVAA 2O9TA 4ONVA 1AVAA 4WDTA 2ACQA 3W2NA 2OEMA 1B4KA 1JAEA 4GK8A 1OX5A 4ZXOA 5CSRA 2F38A 3DYOA 4ORMA 5A8MA 2YXOA 2UY4A 2NXIA 4K6AA 5BNKA 3WNPA 4MHBA 3V75A 2Y8KA 1W9DM 2VFHA 4IX2A 3DFNA 4FXJA 1A3XA 3FNDA 5H1WA 4Q33A 2OODA 5BWFA 3INPA 3TROA 5C0QA 1XRSA 1GVEA 1HP4A 4L5ZA 4ZVJA 4PUKA 4WF7A 2IXVA 3C3NA 4AW7A 5CJNA 1Q8AA 1E4IA 4CCCA 2OQLA 1SW0A 3H2EA 4J3XA 1TG7A 4LALA 4GCXA 4F0KA 3M0IA 1SM9A 2CWNA 1VPYA 5I79A 2PDUA 3I3EA 2ZX6A 4ZA0A 1TRDA 1N82A 4Q8TA 5HXMA 1VIWA 4ERAA 4CD6A 3FDGA 2OLHA 1TREA 3DEQA 1XBZA 1F4HA 4PMZA 4UXDA 2XGBA 4IPNB 4ZR8A 2OZ3A 1GZJA 3S5ZA 3ELFA 3MP4A 2EG7A 3W7GA 4XZLX 3QM3A 1KFLA 5JXQA 3I7QA 5KTLA 3LMZA 1KM0A 3CK5A 1WKEA 4GVHA 4JTSA 5BMXA 1HKMA 4BEUA 4W84A 3BVJA 2OKOA 3W7CA 4AF0B 3VIKA 3H55A 3L21A 5GPRA 5LNUA 3QW4B 2FZ8A 2X0HA 2PLMA 1HT6A 4IFRA 1CB2A 1IV8A 4PBFA 2XJ7A 3F2BA 1U83A 4FMVA 5FA5A 1OD0A 4N2YA 1GONA 5CSYA 2QUUA 3R0UA 1SFTA 3NZRA 1YIXA 1V6UA 4CLMA 2P0IA 1SJCA 2V68A 4WHBA 3HV9A 4REQA 3QGKC 3AO0A 2XGIA 2CXEA 3S0CA 3RLGA 3M64A 5D03A 4LB3A 3UNTA 3ARVA 1E72M 2G3FA 2Q8ZA 4A8IA 3BJTA 2BZNA 3N2CA 1EIXA 2IPFA 3QR1A 4W86A 1V3HA 4MFDA 1CX9A 2D73A 1V08A 2QR6A 3GU9A 3V4BA 4QJ5B 2Z29A 2FB2A 2QDHA 3VE7A 3M0YA 1AQMA 1KFEA 4LVFA 4O8RA 2ZYFA 1WKFA 3VNMA 1E70M 4CVWA 4Z08A 3GIQA 4EKJA 5D09A 1SJDA 4MZYA 3T44A 1RA5A 1R2RA 1XLKA 4GWEA 5REQA 3CHVA 3OA5A 3BGAA 3IJ6A 1BG9A 3G18A 3MCOA 4MTVA 3VIFA 1TIWA 4M1RA 4HCLA 3FCPA 1VFOA 4JTRA 5D02A 4LUJA 2WZTA 5LNSA 3RX4A 4EXQA 1XXXA 4GY0A 3PPCA 4PULA 4PUWA 3W83A 2VR5A 3N17A 3S47A 1E9YB 1GEHA 1DXEA 4MKSA 5CC5A 3VNYA 4AD5A 1VRXA 1XYMA 4J1OA 3S83A 2GGJA 3AAMA 1XBYA 3M5ZA 3AXHA 2R8WA 1BPLB 2XH0A 2H9AA 1GTHA 4B90A 2A3AA 8TIMA 3W00A 4HJWA 1VBUA 2J78A 3DZ1A 2JF6A 1G94A 3QC0A 2G4JA 2H8ZA 3W7KA 4NQ1A 8RUCA 2EF9A 4B5VA 3GUWA 3UG8A 2WZIA 3O6DA 1GVYA 5FL1A 1WUEA 2PDYA 4YJ5A 1TV8A 4NX5A 4PH6A 4OVXA 3W2MA 4RL3A 2Z4GA 3BG3A 2WVVA 3MMUA 4PEEA 4QE5A 4C6IA 3NZQA 2GQAA 1F2JA 4XAFA 2EXOA 3AOFA 3OVGA 2DZXA 5JUVA 1JVNA 3AI0A 2VQUA 3QW3A 4XD3A 4H1ZA 1TZ7A 3DYPA 4HZ6A 3TW9A 3R11A 1MW3A 3V5OA 7CGTA 3MBDA 2DZWA 1X96A 3P60A 4Q8UA 1F3WA 2R14A 1W31A 3MU7A 4O11A 4B9ZA 1VJIA 1WZKA 3G22A 1QW9A 4O4WA 2BASA 3T55A 3GDTA 5B7YA 3CZKA 3HQOA 5EFDA 1Q6RA 4M81A 1DJIA 2J7CA 3LG3A 4AHQA 4OOZA 3NA8A 4JTFA 5F1UA 1E1FA 1HJWA 4V33A 4HPJA 3T09A 5FJJA 1ZJBA 3SUSA 1GPWA 1LWIA 3O15A 4AF0A 4E2OA 1HJVA 2J9XA 4MJZA 1LWHA 3AXIA 3KBMA 1OB0A 4PCNA 2X8RA 2PURA 3V0TA 4QCEA 1I6NA 3UESA 4QAIA 2WC7A 3VDGA 3B06A 4QLJA 1LRQA 3KTXA 3EOUA 3VUPA 4UZSA 4WDXA 1NARA 1W9VA 3QFEA 2ZZ1A 1ML1A 4LUYA 2CNCA 4MFEA 1FHLA 4XZIA 4XK2A 2X0SA 1EP1A 3NWRA 4BS0A 2C6QA 3NQCA 2YIHA 4LS0A 4M82A 3SJ3A 1XLCA 5DQPA 5LXXA 3VOIA 1PB0A 3ERPA 4IUOA 3W7LA 3GH7A 2LLEA 1LQAA 2DZBA 4PB5A 1NP2A 2QCFA 3AIBA 3LTSA 3GXPA 4UTTA 2QCCA 4WKHA 4ZODA 4JTQA 4LUIA 1EPVA 2P10A 1P4CA 3DGBA 1J6PA 1QOXA 3CUHA 3DECA 2ICSA 4KWOA 1XWYA 5EKYA 1S2AA 4K68A 1UD6A 4WR3A 4MOZA 3NIYA 4Y7EA 1J79A 2OLSA 2GDVA 2PGWA 4GVIA 3MWCA 3NG3A 4UFLA 3IPWA 3HM7A 4MLRA 2VVSA 4KMQA 1EGMA 2DZTA 4CCZA 1TELA 4GFIA 5D05A 1V0KA 3GDMA 4UTMA 1UR9A 1M68A 2B81A 2GWGA 3WD3A 5A6AA 2J8TA 3UGRA 3R13A 2CYGA 4CN1A 2RKXA 4V15A 4QG9A 3B9AA 3ZOAA 4GH3A 1HJSA 1LROA 1E4MM 4I9TA 4Q4RA 3WQDA 4X2RA 1UR0A 3A4JA 4NNCA 3UG5A 3FYPA 3GFYA 3F5KA 4K37A 2REQB 3K1GA 3KOZA 1W6TA 4X63A 3WQEA 3DFHA 1PBGA 3KHJA 3LI0A 4PBGA 3CUFA 3WF4A 1IEVA 2RHGA 1L8PA 3JR2A 2BGQA 3T2OA 2BY1A 5FF2A 3DI0A 4PTNA 1O5XA 3GE7A 1MRAA 4JQ1A 2VRKA 5G4HC 1JD9A 2WZMA 4BKNA 3G3DA 4K1WA 4DJFD 4JOMA 1YX1A 3UG4A 2WNZA 4NI8A 4O1CA 1DJNA 1C8XA 3M47A 2XPKA 4LAMA 2CERA 4IIHA 3AXKA 1ZL1A 4XAZA 2PC4A 4U4MA 1B9ZA 3QV8A 4F3HA 3EWBX 3I6TA 1US0A 2VC5A 2GZXA 1CYGA 4URIA 3WMSA 1D8CA 2B4GA 1Y0EA 4E8GA 1GKPA 1IHIA 4QJ4B 1EXBA 2VL4A 2GVGA 4DY1A 1LBFA 4J5NA 5AN7A 1YQ2A 1VZWA 1P0DA 3T8QA 3QTPA 1OSEA 2VEKA 4PEKA 1W3NA 5I6SA 2VVNA 5ABHA 3FA3A 1E56A 4ZGYA 3VIIA 1KWGA 4AHPA 2FTYA 3TSBA 1JXKA 3GD6A 1ZRQA 2BOFX 4H9VA 1PXGA 1O60A 3PZQA 1QT1A 2OG9A 3GNPA 1JL8A 2PTZA 3W2KA 2W5FA 1Q63A 4GA8A 4MG4A 4D72A 1NU5A 4LX4A 2OLAA 4HTBA 4DVOA 4J4KA 3FXGA 2V5JA 1H61A 3TN3A 4AC7C 1E6NA 2ZA2A 1XGEA 4MJ2A 3K5XA 4AZBA 1XRFA 3SGZA 1PCKA 1JPMA 4QDWA 4FXSA 4W87A 1XLDA 2PGFA 1K3UA 3RG6A 4PUNA 4AH7A 1K1DA 1CLVA 1E0XA 1HKWA 2Z27A 2VDGA 4EPKA 2P76A 5EMYA 4X3ZA 5M2FX 3BLDA 5I23A 2CBIA 4OV4A 3VO0A 4FOKA 4JX6A 5I2UA 3D5HA 3NQFA 4BF9A 5CPTA 1IR1A 3ARWA 2FJKA 4OUIA 4JTGA 3CHEA 4O53A 4B2DD 4GGHA 4Z2HA 1OGBA 1MW2A 3A6OA 1KKOA 4KWSA 4ZENA 1C91A 3N13A 3VZXA 5CZTA 4IT1A 4FEZA 4G7EB 1IYXA 3IIOA 4MB1A 2V6AA 4CU6A 1GHSA 4FX8A 3W9ZA 4DO5A 4IMAA 5CGMA 3K4AA 4PSPA 2OGJA 5ABTA 3QN3A 4Y8EA 1ZALA 4C1KA 1TWIA 3THUA 1NM9A 2FHBA 4M56A 3L0NA 4M7TA 4C6DA 4HBKA 1SFLA 1VHCA 2ALRA 2PRLA 2O9PA 1E5JA 2REQA 4H6RA 4FOUA 3N6HA 4CN6A 3RJXA 1YXYA 2G3NA 1FWSA 3W71A 2A3LA 2OWCA 4QSFA 5L6UA 3PK7A 4KRTA 4O50A 2DUXA 4WEVX 1LDCA 2QUMA 3HU7A 2Y85A 1RJQA 3QPZA 3V5CA 5HOSA 4F4RA 1TE6A 3DKLA 1JF6A 3EGJA 4TX9A 4KW2A 4MSSA 5A1AA 4ZQPA 3K4WA 2ZUVA 4O54A 1GWJA 1DIKA 5FKYA 3P5YA 1JZ2A 3PZNA 1XH0A 3RM9A 4DJFA 4D6FA 2GJPA 2ZRWA 1O5KA 5DELA 3GNOA 4PL1A 2C0AA 1RQBA 2YYTA 3DG3A 2WSRA 2OZ8A 2Z7KA 3KP0A 2HMCA 5T8GA 2GQ8A 2O55A 1XIJA 4CD8A 1E6SM 1F8MA 1I2OA 4JEQA 4R53A 5A6SA 4QEHA 4F9JA 2F7FA 1WBHA 3CJPA 3HURA 2PD5A 2C18A 2YZ5A 5GJMA 3CWNA 1TUXA 2OFJA 2QPXA 3W7RA 5HNTA 1U1HA 3AIRA 2HE5A 1U5JA 6REQB 1K7EA 2QF8A 1SR0A 3HPFA 3QKEA 3EA1A 4H7VA 1FXPA 3NVTA 2J77A 4H9UA 3OYXA 2A21A 3D46A 1WUFA 3UXIA 1V7AA 3LRLA 1JD7A 4IIGA 3TH6A 4NX0A 3VNIA 1S2WA 4Q7IA 5FF3A 3WLIA 1GVRA 2OSXA 1V77A 1QNOA 4F66A 3IVUA 2W3ZA 1DWHM 5FESA 4D6DA 1DWFM 3BMXA 4C91A 2AL1A 2WQDA 1RBAA 4JL2A 3KVMA 3ZO9A 2GVEA 3E02A 3MC5A 5D32A 4JHMA 2WLYA 2BGSA 4B91A 5D2VA 4MM1A 3SCQA 4ZO6A 2ZX5A 4J9JA 1Q6QA 4NXSA 2WCAA 3TZFA 2W61A 3PWIA 3GTNA 4G7EA 4FF5A 2VFGA 2GDUA 3VMPA 1XYAA 1M65A 2XSBA 4UOQA 3KWSA 3N34A 3S9IA 1UH4A 3Q58A 1L9WA 1HX0A 4IXHA 4S3KA 3QF0A 4PUEA 1B57A 2O7SA 7TAAA 2J7HA 3SGUA 5H2ZA 2YCLB 1SO4A 1YBQA 3H22A 2Z1SA 4LFYA 4G6CA 1S1RA 1NQ6A 1A5UA 3TR2A 3C3UA 3PR2A 2UY3A 4H7ZA 3CL6A 3R43A 3OO2A 1V0NA 4XISA 3DENA 2O9RA 1H62A 1JCYA 1HVQA 1TYGA 3AWNA 4NAEB 3GVVA 1YTEA 1DVJA 5CZ0A 3UNDA 3WBXA 1JXJA 3FSUA 1YDYA 4JTDA 5EMJA 2CLKA 3T0DA 1W1VA 1M41A 4NKCA 5IBXA 1JCXA 3TN4A 3GC5A 4CD4A 1A5SA 2FB3A 3RRAA 2QNEA 4Y6GA 3RO8A 4NZ1A 3WLHA 1XD1A 5ECUA 4UMBA 1V6VA 4DUVA 1VLWA 1JZ7A 2V2HA 1H7XA 3EDEA 2XIBA 3WJSA 1R9YA 3CV1A 2WVSA 2XYLA 2QJMA 3AHZA 4DELA 3E49A 4ALDA 3AALA 3VVGA 1M04A 1XIDA 4RJEA 2OO6A 2QCGA 2INZA 1OYCA 2VC9A 2WCSA 5D9PA 3QY8A 2WSQA 2VGFA 4O0KA 3URQA 4BF7A 1J01A 2VUNA 3AMCA 4JNZA 2C15A 1FA2A 1Q45A 3WH8A 4I6KA 3ME3A 2EKCA 4GVFA 5CGTA 6REQA 5JU6A 1FWWA 4UB9A 1UZ4A 1K8CA 1QHPA 3LCGA 1C92A 3P93A 3KHDA