5C8JA

A yidc-like protein in the archaeal plasma membrane
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
229
structure length
229
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNFSSSSIHWVRQAPGKGLEWVASISPSYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGIWSYWYMVYPHDNYGMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody fragment, heavy chain
publication title A YidC-like Protein in the Archaeal Plasma Membrane.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 43
structure length 229
sequence length 229
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c8jA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c8jA01
2VWEC 2VZTA 3MNVB 4ERSL 5KSAA 5LCVL 3SE9H 5BV7L 8FABA 5FFLA 1IMHC 2V2XB 3HZVB 1DP0A 1T6VN 4KZEL 3IRZA 3QA3B 1PG7W 1JHKH 4WY7H 5KSBA 2D0GA 1CDJA 4ZXBC 1N0XH 3QFJD 4JN2A 4RGMB 3ULUE 1BQLL 1XGUA 3BVNA 1IKNA 3GHBL 3I50L 4J1UA 4PJCB 3ULUF 5IVXA 1FYHB 4JREB 1QR1A 3I2CH 2LVEA 4YDVA 1BBJA 1Y0LA 3BP4A 1LD9A 1QBML 4GW5A 5D2LE 4PGCA 5J1SC 2APBA 4WU7A 3IJSA 4X0KA 5I74B 4PRHB 2OR9H 2Z92A 3QULA 1Z3GH 2MQ3A 4FQQA 1G7PB 1FPTH 4MQTB 2EDFA 3UP1A 3TNNB 1FNEA 5E8PA 1CGSL 3CH1B 2NZIA 3BXNA 1CXIA 3LPFA 1AHWB 3CVHL 1BM3L 3QG6B 3M8OH 3E1F1 3RWCB 2FHBA 5TGBB 3SBWA 1RK0A 4JZNA 3MYJA 4QOKE 3LRGA 4MXQD 2EEDA 3VGGA 3DVNA 1A6WL 3O2VL 2XZAL 1QHOA 4GG8B 2Q7YB 5KVMC 3KLAB 4R0LC 4KC3B 1OL0A 2MKWA 2F19H 3BQUD 4OM1L 2VLME 4K3EH 3K8LA 4R4FH 4KPHH 4JDTL 1HHIA 1BFVH 3KPRD 4Y16C 2QQLL 2QV2A 4KTDL 4QWWD 5EIQA 2SEBA 4LAJH 4I77H 1ZA6B 2A9NL 1MVFA 2R1YA 1PX4A 3KPQB 2P5EE 2FH8A 2WZPD 2K1MA 3RNKA 1JGUH 1Q94B 2I27N 3FOMB 1W0VB 4DFHA 5BZDB 1VEOA 1G6RB 2GT9A 5BRZA 4F8QA 4PBXA 4KDTA 3H9HA 1IM9D 1E4XI 3OJ2C 5TDOA 4HMEA 1NUNB 4OQ1A 3OX8B 5EC1A 2ICWJ 3ZHDA 3PHOB 3RHWK 4FMFA 3MLXH 4OCSH 4DUWA 5DJ8B 4OUUA 4LCCB 3SDYL 3B8SA 3MTRA 2MWCA 2R1WA 2H9GA 4MNGA 1IE5A 3L3GB 5J57B 3OKLA 1DVFB 2ICWB 3VXSD 4PRPB 3DRTA 4P46A 5JW5B 4JCMA 1YYMH 2AABH 5FXCH 1J8HA 1FZKB 3FQRB 3RJDA 4WGWB 5EG6C 2V7HA 1K6QL 1P5VA 3NFPB 3T2NH 4JPKL 1QOKA 4Q9QH 3X13A 4ZXBA 1YDPB 1EVUA 5D71L 5DQDH 5C07E 5ESAB 5GXBB 1CD8A 2X9WA 4K23L 2R2HA 5KOVC 4IRSD 1CDBA 2EE6A 1JGDB 1U3HC 1PX3A 2D31B 4RZCB 3DSNA 3V52L 1HXMB 3DUHA 5F3BB 3GRWA 2WQRA 1G9NC 1HXYB 4OD1H 4YHML 3B5HA 4K7PY 5C0NC 5GRYA 1XF1A 5BOZG 1MH5A 3MRLB 4BQCA 4YHYB 3B2UD 1C8PA 2XACC 1CZ8L 1J12A 1IC5H 1KXQE 3QEUA 5LGKA 1A0QH 3PGDA 2AJ3A 4OIIL 3RZCB 3T0VA 4QXUH 5GZND 1ODAA 3MOBL 2AGJL 1G84A 3VFMB 5CINL 4AEFA 4F58H 1XFPA 4PUBH 2DKMA 2MJWA 2QL1A 5TDPB 2EO9A 5B38A 2X7LA 3DHMA 4JGJA 3QQNA 4RX4D 2XN9D 2FSEA 1MCPL 3F6IA 4L8CB 5L88H 1MNUH 4R6UA 4WFHE 3I6LE 4HCRL 4R0LA 2ZOKB 2FJGB 1JYVA 3MMEA 4Y0GA 3NPSB 3O3AA 1Z9LA 4RNRA 4ZUUB 4I3SL 4Y16A 2DQHL 3SO3B 3ARGC 3TBWA 2BMKA 1TENA 5DYOA 2W0PA 3RWGA 4BZ2L 3VFSB 3U83A 5J9PB 1CD0A 4X6CE 3GSNA 3MLVH 4S1QL 5A16A 2JB5L 1AD9B 4X6CF 3VFOB 4P59H 3VMOA 4RIRA 5DDHB 5EOCL 4PJEE 2XI9A 5ID0A 1G9MH 1HI6B 4OGXH 3CZFB 3LN5A 4B41A 3DURA 4M93B 5LQBH 2AS5M 5FYLE 1DBKL 1EJOH 2YPVL 3B43A 4GUPB 1NMCB 3VFUB 4ZFZA 1HHGB 4HLZG 3DIFA 3D25B 5IJVB 2EXWC 3SE9L 5DEFA 1AY1H 4FFZH 3ARDD 5L2KB 1A2YB 1TZGH 3FQTB 4YAQB 2WNGA 1T5WA 2A6DB 3BMVA 4BQ9A 2HTLC 1MOEA 4DKFH 3H42L 1FIGL 5IB3A 4QOKA 1ZLWH 4M7ZB 4YBHA 4K7PX 4V1DA 4OI8A 4UTAL 3C5JA 3EYFB 1A7OH 3ESUF 1CDYA 3JWOH 1B2WH 2ED7A 1A7QH 5DJYB 1U3HA 4HKJA 1ZLUK 5HJ3B 1F6LL 1ULVA 4JFDB 3D48R 4U33A 4P5MA 1M6OB 4X8JB 4J3UA 4ZNEE 3BZDA 1F3DH 1IZKA 5L7XH 3M8OL 1HH6B 2QHRL 1P1ZB 1BFSA 2OL3B 5I2IA 3H9YA 1GIGL 1EEYB 1K4CA 4P9HL 2FGWH 3SN6N 1G7LA 3SDDD 3VWKB 3W81A 2IQ9H 2YK1L 5F72S 4PJCE 3SE8H 4X5LA 3PXJA 1TCRA 4A2LA 5ITFA 3L3IA 4NPYA 1CE6A 2HRPH 1NDGA 1Z0NA 3FKUS 5IG7A 4PRHE 3JZ7A 4K3EL 2VN7A 3T3PE 3QUZD 5GRJH 4O02H 1YMMD 2AEQL 3WO4B 4KTEH 3VFGL 1WCBA 2WLYA 4I77L 3TVMD 3FN3A 4HJJH 1R3LB 4H1LH 5EOQL 4CMMB 5H2BB 3RVUC 5EBWA 5BS0B 4NWTL 1JGUL 3ARGA 5EN2A 4JQIL 4G8IB 3LSOB 2VLKE 2J8HA 3BP7B 1CD9B 4LGPB 1N7MH 1F4AA 4G8EA 5DA4A 1G7QB 2WIIB 2V2WA 1R3HB 1NBYB 1FNLA 4ENEC 5BO1L 3VD5A 3ZTJG 1HNGA 3QCTH 5ALBH 1S78D 4HKZB 1HHJA 4LVNC 4DUVA 3LD8C 3KPPA 1ED3A 3WN5B 4YHIA 1QVOA 3RHWF 2YD3A 4LBEA 2WBJB 2KL6A 3SKJL 2DQGH 3E6FB 1UXSB 4BQBA 2JELH 2AABL 3C5ZC 2DIJA 5LBSL 3VWJD 2NY1C 2VLRD 2Q7NA 2BSTB 5MP6L 3MRMB 5TE7H 1T7ZA 5DHYA 1ZMYA 4R2GD 1NLBH 4Q9QL 1RHHB 1KIUA 5DQDL 4ACPA 3IFOB 1G9EA 1O7VA 2R0LL 1UM4H 2BSRB 3KYNB 3WDJA 4NQED 4OD1L 5FHBH 3VRLE 4LSRH 3VRLF 5FYKD 4LCYB 3HI1A 3QIWB 1IC5L 3FAWA 1EZVY 1NCDL 2BHZA 4G43A 4EJ1C 1RZJL 4PRPE 1LE9B 2VABB 3WXWH 4CN1A 4QXUL 2G9HB 1BZQK 3SDAD 3LMJL 4LPVA 4DCQB 4F58L 3QEQB 4M7LL 2UVFA 4NQCA 2YS4A 1AGDA 3GK8H 3CC5A 3RWDB 1I8MB 3S36X 1INDL 3RVVD 2YSSA 3VJ6A 1RUAH 1IC1A 3B9AA 4MJ6A 3UTTE 3MUJA 1MFBL 4LAQH 2YA2A 4M02A 2Z93A 4DGIL 2O5YH 4MNQD 3ZMRA 4JFPB 3O3BA 2YZ1A 4I0PD 2IEPA 3SHSA 3SKNB 4M7JH 1ZXQA 1IEBA 1UZ8B 4JFED 3QUKB 3MRJB 1I3RB 4P59L 4WFGE 1SYVA 3EDFA 1AC6A 4KHXH 5FYJU 4ZUWA 4ODSH 5BVPH 4R26H 1EFXB 2AXHA 1R0AL 3LKQB 3KLHC 4FABH 4S1DC 1DEEB 4KWUA 4YEFA 4HWZA 4FFZL 1KT2B 1TZGL 4YE4H 5C08A 2LU3A 5GGUB 1U58B 4XP9H 4P3CL 4GRMB 2E6PA 2I5YL 3ARFD 2CK2A 2FX8H 3GMNB 1S9YA 1YEHH 4NC1E 3I9GH 3EOYG 5I30H 1CG9A 4NZRH 1A7OL 3RX8A 2XTLA 4LLDB 5I71B 5I6XC 3HZKB 5DTFB 3TFKD 2Q6WB 2XG4A 5C0IB 1CXLA 3TNNA 4UDTA 5BV7C 5ANMB 4XB8A 4YHZL 5L2KE 1YEIH 4RCAA 2X89A 3PQYB 5L8JB 3QG6A 3HG1A 3W11C 3RWCA 2BRRH 1DZBA 5CGMA 3MNWB 3DV6B 5D7LB 3BW9B 1QFUH 2BOBA 2VLKA 1KNOB 1SHMA 4LGRB 4DTGH 4GBXC 2ILLA 3GJFB 1URLA 2JF1A 5T33H 2XA8H 2IQ9L 3INUH 5DD6B 4HUXA 5JO5B 4GG8A 3RIAK 2Q7YA 3OR7A 1HEZB 1A6AA 1GAFL 5MEQA 2MCPH 4GSDL 1DBAH 4NCC1 3FRPG 2A77H 3ALXA 1KCVH 1P4IL 1R5IB 3NCYP 5CEZD 4D3CH 5FEBA 3T1FB 1KIQB 2P43B 4NFDA 4O02L 3ARQA 2OMNA 5TQ2L 3WE6B 1RI8A 1J87A 4KTEL 4JFDE 2W0LA 1ZA6A 3FB6A 2X70A 1IGIH 1OP3K 3QISA 2DBLL 4XBPA 1SYSB 3RVWC 4NC1C 5E2WH 5T5NF 2A2QT 4OIBA 1UCTA 4FZEL 4QY8A 3NIGE 3BD4A 3C6LD 3GJFK 1RJLB 4AJ0A 2EIBA 1HIML 3NIGF 3PWLB 1AJ7H 5FGBA 1JP5A 1TVBA 5KTEH 2C1OA 1NMCC 4HS8H 1DANT 1UXWB 3BH8A 1KC5L 1A22B 5ALBL 3QHZH 4NM4L 2AEPH 3ARXA 5KVFH 3STZB 4HUKB 1B0GB 4PBWD 1MLCA 3HR5B 3L3GA 5GS0H 2DQGL 2ICES 3FQRA 2PR4H 5BS0E 2R23A 1CXHA 1JF6A 2IBZY 4M7ZC 1VGKB 5TE7L 1VHPA 4IEFB 1BAFH 3C87A 3NFPA 4KJWC 1NLBL 3G08B 3LKRA 3HKFA 1KENH 2Y5EA 4PGDB 2GTWB 4OCYH 5B8CB 2XNAA 2NLJB 2D31A 1HXMA 1T1YA 4RSVA 1J88A 5HY9A 1MRCH 3V7MA 1HXYA 3UTTA 1VADB 3MLTB 5FHBL 1J9CT 5JXED 5C09A 4WTWA 4NNPH 3MV01 3B5GA 4S11A 2R2EB 3SJVB 3L9RA 4GJTB 3HLAA 4Y7MA 3HC0B 1P7KB 4YHLL 3PIQB 3VWKC 5CD3A 3GSRB 4JHWH 4LRIC 1M7DB 1C16A 2OZ4H 5TDPA 4GBXA 4UINH 3ARYA 2Y5TB 4OF3A 3RL1B 4XNMA 2FO4B 3GK8L 4YHOH 4JO4H 2ARJA 3S88L 4YPGB 4OCWH 1RUAL 4OZ4B 3ARPA 4CU8A 3MV7B 3JV4A 3PWNB 3P9MB 4ZUUA 3LIZH 4AT6B 4NJAL 4FP8H 4D8PB 1CDIA 3GM0A 5DMKB 3VFSA 1WUNT 4XWOC 1T20A 4M7JL 1AD9A 3RWHA 3KGRA 3BP5B 2J8UB 3VFOA 4HAFA 4W6YB 4YJZL 2W0KA 5GZOD 2CIIA 3IAQA 2B1AH 3QEQE 3CZFA 5F1NB 3QJHA 5DHVH 5F93C 5L0QC 4YC2B 5EZJA 5BVPL 4GUPA 4TSCL 1HHGA 3G6DH 5IJVA 2YEZA 5LAXB 3NAAH 4PB0L 2AEWA 4DZBB 2OP4L 5L2KA 1A2YA 5E9DB 4OLVH 4H1LB 3BE1L 3IXTA 4Z5RB 4E42A 3DX8A 1JYXA 1JV5B 2DKUA 1WVZA 2DL2A 5C07D 1YEHL 3W0WD 3ILPB 4POZD 1C1EL 1KBGL 5IFJA 1BOGB 4Y2OA 1KCKA 4GAGH 4N0CC 4EVNA 4Y5XC 2PTTA 5FB8B 2VR9A 2RAMA 5SWSD 1P4LB 4Z95L 1UWXK 1HHKB 2FIRT 2O5XH 3DUUA 5I75C 1R5VA 1KIRB 1HWHB 1PW3A 3KYOA 2V5MA 1RURH 5KVDH 4J8RA 5FYJH 5DZLA 5F21B 5F7KC 1HKLH 1T83C 5LGJA 3RU8H 1P1ZA 3V95A 1A6TB 1QFUL 2OL3A 4BELD 1EEYA 4UDUA 1EAPA 1JMXA 3VWKA 4K3JL 5KAQF 2W9DL 3C6SB 1FO0H 5F3HB 3CPLA 2MCPL 4WFHD 5DQJB 4KZDH 3IDIB 5C3TA 1KCVL 2V9TA 5CP3H 2VTFA 2PO6C 1OAYH 4LLUB 3HS0A 1VACB 3MQIA 1YEFH 2GFBB 5ANME 4JANB 5M95B 2D03H 3PQYE 1CS6A 1RJZA 1YN7B 3EYSL 5E2WL 2Y6SC 4UT9H 4XI5D 5D7LE 2FLRT 2CLZB 3BP7A 2W9LA 1G7QA 2WIIA 4TQEL 1R3HA 4X6FB 3MOQA 2QR0A 5I1HH 4KV5E 3KDMA 2FWOB 4KV5F 4HKZA 3ZHLA 4RGNB 2AEPL 5B3NA 1Y6MR 1DQQA 3DLQR 5BXFB 4KQ4H 2EXYC 4GKSB 1LDPH 4GFTB 4N8VB 5GS0L 1MFDH 3O9WB 4UNVA 1KJMB 2ESVD 4XCFL 3B6SA 4O4YL 2BSTA 2XICA 3MRMA 2Q76A 1HHHA 1BAFL 3KYMB 1KENL 1X5LA 2BSED 5I71C 3MRBA 5A2IH 1CCZA 1G6VK 2QQNL 1T04A 4PJ8D 4O2CB 1VDGA 5AD0B 1G0XA 2BSRA 1TETH 3GSOB 1BVLB 5IHUL 5DD3H 1I9RH 4S0TD 2R1XA 3V8OA 4RFNC 1PZUB 3D87B 4OSUH 2VDNH 2VABA 3Q1SL 1KIPB 2G9HA 3BAEH 4G5ZH 2F54D 1LEKB 4JHWL 4HT1H 4LQFL 3QO1B 3T4YB 5D7SH 1BJMA 4UINL 2NX5B 5I8OH 2DQDH 1OT1A 4XMLH 3RWDA 4C57C 2D7TH 1OOAA 3D85D 2XQBH 4PS4L 5F6HI 3S7GA 1OSZB 4UOJA 1SY6H 2DYPB 1CLOH 4OCWL 4JM2C 5JUEH 4RMSA 2PO6A 1NLDL 2DLFH 3DETC 2IBBA 1JYWA 1HYRC 5CMAA 4KXZH 2K7PA 3I02B 5CIPH 5T1KA 1PKQB 3SJVE 5FHAH 4Y1AB 2DWDB 1OPGH 1I3VA 1UZ8A 3GMPB 5MHSE 2EZ0D 5IW6B 5E08H 4WEMB 4QHMA 4EN3D 4ZFOB 3NABH 1D9KC 4Z7UF 2KKQA 3H9SB 5D2NB 3BDXA 5AWNH 1FSKB 3HRZB 1VPOH 3D3VB 5EUKA 4PYHA 1CLYH 2AI0L 3G6DL 1A21A 2HRLA 1IILE 5JHDA 4ZQKB 4GG6B 1DEEA 3U4BH 3QO0B 1KT2A 3AREC 3N1FC 5D96B 3MV7E 2DMKA 1MRDL 3BN9C 4P57B 4Q97A 3HR6A 1MCFA 2EIZA 5GGUA 3N1GC 3RDTB 3WL9A 5HHPB 1WCQA 5T3ZD 1WBXB 2AXFB 4KK9D 1JJUA 2AJXH 3BWAB 3TCXA 4FQCH 1A8JH 3GMNA 2J8UE 1N3NB 2VXUH 4TVPD 1OAXH 5IK3A 3ROLA 1G9MC 4WJ5B 2J8UF 3EYQD 4P3DA 2L0DA 4LCUB 4O5LL 3DX7B 2XKUA 4LLDA 3LQZB 3WIIH 3HZKA 1FFPB 3TA3B 2NXZC 3FZUC 1KCUH 4N90E 2Q6WA 2O5XL 1QD0A 1KCSL 3WKNA 1QSZA 5C0IA 1I8IB 3KR3L 3EFDL 2GJZB 1DQDH 5ANMA 2BNQB 3PQYA 4PRPD 3P11H 3PJSB 3HE6C 4TSBH 3MNWA 4N0YH 4M9OA 5E9DE 3BW9A 3FT3A 3JV6B 3P30H 4HHAB 1NFDB 4F8TA 5I0ZA 1T0PB 5F9WB 3H0TA 3VDCA 3OZ9H 5E1HB 4HFUL 2W1NA 5ICYB 3CUPB 3DX6B 5DD6A 3K1DA 4F33A 4QRRB 5JO5A 1P69B 4UV4H 2UZIH 1HEZA 2VH5L 5C0BA 3ZZ1A 3JWOC 4E5XA 2X40A 3WJJC 2EC9T 3FCTA 5IEHA 1R5IA 4ZUVB 5IUSA 3KS0J 1TCMA 3QJFB 2Z4QB 4WFED 1U6AL 3WE6A 4JFZH 4KVNH 3UTPD 1F3JB 1RPQA 2J5LB 2JK5B 1UYWH 4NZUL 3ZE2E 1RULH 5K9OB 2D03L 4OQTH 3RZCD 1Z5LB 3O6FB 1DJSA 5SWZD 1T1WB 1XH3A 3PWLA 5JR1H 2VZVA 3ZYZA 3DWTA 3GB7B 1H3VA 2GY5A 4JZOB 5CEYA 1CGWA 2IGFH 2JCCF 4N8PA 1UXWA 1D9KA 1NKOA 1ROWA 3BKCH 3MNZB 5DT1H 2FRGP 5HHOB 4PJGF 5DJ0B 1ACZA 3STZA 4IRZL 1J0KA 4P9MH 3K74B 3MROB 2GQHA 4M6ML 4J3VA 1MFDL 3HAEH 1JTPA 3U7WH 2HYMA 4PRNA 1CGYA 4QRQA 3BZFB 4EBQH 5HYSG 3AREA 1NBVL 4DEPB 1C5CL 1VGKA 4LLWA 2H45A 2RFXA 5IB2A 3G08A 4JFXB 1M71B 3IF1B 5J11B 4EI6A 1TDQA 2GSGB 2P46B 1EO8L 4J3TA 3NCFB 1ZVYA 2GTWA 4YWGL 3EDDA 1JE6A 3NA4A 1S8DB 3DXAD 3TLRA 5E5MB 5SX5H 1F2XK 4WI8A 1J1OH 5I15H 1KCLA 1OTSD 2X44D 4RGNE 1TETL 1G7HA 3CSPA 2CO6B 3TCLB 4KRPD 3QI9D 5DD3L 2DQIH 1HQ4B 4RAHA 2H32B 4UT7H 4D9LH 2DD8H 3SJVA 4XCYB 2JB6A 4M62H 1RFDL 4OSUL 2VDNL 3VD9A 2IAND 1P7KA 1PSKH 3PIQA 3BAEL 5HI3D 3HRPA 4X5WB 2LQRA 2QKIA 1WIUA 4PGZA 4Z7UA 1T1ZB 3QCUL 3OAYH 2GAZB 3ZKXB 4HXBH 5D7SL 1AD0B 3RKDC 5IB4B 4M03A 2YR3A 4FHBD 3D18B 2Y5TA 4JKKA 3OR6A 4FXKA 4YXLH 5I1LB 2DQDL 2I9LB 4XMLL 1KN2H 1EERB 2D7TL 5BVJB 7CGTA 2D0FA 4YPGA 3UPAA 4I18B 1T2QL 1WWCA 4OZ4A 5HDLA 1G0YR 2NNAA 3EGSB 5JUEL 3PWNA 2VLJA 1X6NA 4AT6A 3ZE0E 4D8PA 2IQAB 1UB5A 3ZE0F 5DMKA 3FFCD 3TT3L 3ZL4H 5FHAL 3SDCD 1OPGL 4LPUA 1ORQB 5EB9A 3BP5A 2J8UA 4YUEH 2N7AA 5E08L 4KK6C 5IM7A 3CCHA 1SM3L 2CDGA 2ADIA 3N50A 4FZ8H 4IRJB 2NX5E 5AWNL 3KYAA 4HKXB 1IC4L 3FO0H 1LEIA 5DSCA 5LAXA 3LQAH 4OLEA 5D1ZB 4BK5A 2DQEL 3ABZA 5H94B 5C0GB 5TF0A 4A6YH 3ZDXF 5E9DA 5D5MB 2APTA 5DC4B 1PKQE 5TDNA 1ZT4B 4H1LA 5JW4N 2ZCKL 4Z5RA 2IMMA 1ETZB 1D5MA 5D1QB 4MJ5B 4Y1AE 4K8RD 2YD4A 1LNUB 4ONHA 4UILH 4ODBD 1FL6B 4OCLC 4FFVD 3BZ4A 5CHNA 4XX1E 5IMOA 1JNNH 5FB8A 4JN1H 3H9SE 5D2NE 3JUYA 1P4LA 3D3VE 2H8PA 3G6JF 1M05B 1HHKA 1XT5A 3QXTA 1BJ8A 4F3FA 1KCUL 4XMKL 4WGVB 1BQSA 4L8SB 1T66C 4GG6E 4LSVH 3VGAB 1H8SA 2ZSVA 2VXQH 4GG6F 2IG2H 5C0JB 5I1EH 2A74B 3FQNA 4OCRL 4XPFH 4TSBL 1MCSA 3P30L 1A6TA 4BZYA 4TNVK 3MRPB 1RUKH 1FZMB 3QQ9D 3SQBA 5LKNA 2JCCA 5AAWA 4IDJH 3WIFA 3HZMA 3C6SA 5ACLA 4UV4L 1MREH 4PJGA 2UZIL 2F8XC 3IDIA 4KKAC 1DUYB 3VGFA 4WWKD 3O45A 4PY8J 4TUJA 3LEYL 1TJGH 1U3YA 4P3WA 1VACA 5JW4Q 4JFZL 4WO4D 2GFBA 5IFHH 3HAEG 2CIKB 2BNQE 4AMKH 1T1XA 1UYWL 5I8CB 3U6RB 2I24N 4FQPA 4B53A 5ISZD 4BKLA 4R8WL 5FGRA 1YN7A 2ERJB 4M3KB 1YEGL 4PFEA 3WSQH 1NFDE 4TSAH 1OAUL 3SKOA 4CKVX 2CLZA 1YQVL 3O2WH 1NFDF 3SOBL 3VXRB 5JNYB 1FSKC 1TJHL 4X6FA 3OPZL 1EUTA 5BJTB 4QRRE 5KS9B 1D5XB 1AFVH 2HFTA 3LZFL 1TVHB 1S5HB 2EDJA 2FWOA 3U4AA 3LS5L 5DT1L 1MCWW 2ITCB 2EDKA 4OZHB 2PW1B 4LKXB 5HBBA 5D96C 5BXFA 3T77B 4P9ML 4X6BA 2Q3ZA 3JTSB 1II4E 3O9WA 5JOPE 1YEDA 1B6UA 2W65B 4EBQL 4NN6C 4HIEB 3O6KH 3T04D 2IFFL 2XG5A 3RGVC 2AJUL 3EO1B 1H15B 5CIPB 4Z7QE 1KJVB 3ECBA 2R4RH 3Q0HA 3LEXB 4Z7QF 5J89A 3PE9A 4JM4H 3ROOA 3L95B 3IFNL 5F6IC 4BZ1L 5KVGH 5AD0A 1EO5A 3CJJA 3QBTB 3JWDH 2FR4B 1K9TA 5DC9B 3TBVB 1FVDB 4YDLC 4BSJA 1KN4H 5HHOE 4GAYB 1AC0A 1XGRB 3GSOA 2CR6A 3CVHB 5GS0C 1WWWX 2OYPA 2DQIL 2DQUL 2MHAB 3KPNA 2DD8L 5IBLC 4D9LL 1MSPA 4M62L 1QKZH 1XEDA 1L0YA 1HCFX 1J8KA 4Z78B 5AEAA 2V7NA 2FJFB 1LEKA 2Q87A 3ZT6A 3DO7B 4K7FB 4OF5A 3T4YA 3S97C 3L3OA 4MAYB 1X5IA 5GGTH 3GSUB 4LPWA 5J3HD 4HS6A 1FLRH 1EXUB 1KN2L 1A7BA 5IB1B 5GRVL 2J5LC 2XQYG 3G04A 4LHUG 2AK4D 5CGTA 1I9IH 1HYSD 3VG9B 3T8XA 3I02A 1PKQA 5I73B 5DMIL 4RISH 2AV1B 4KAQH 4Y1AA 3ZL4L 3GMOB 4KI5D 1ZT1B 1RK1B 3QRFM 4KRMB 4YUEL 3PDDA 5TH2B 3BN3B 3K4ZA 3D39A 3MRFB 1C12B 4L3ED 4FFYL 4TUKH 1E4KC 1I75A 3G6JA 3H9SA 1JWUB 3HRZA 3QPXL 3D3VA 3MFGB 2H26A 3WFDH 3NZHH 2WP3T 4O51B 4D9RD 3PL6C 1R3JB 3RVXC 2VITB 3FN9A 1OGAB 4K9EL 1DLHA 4ZQKA 4GG6A 3LQAL 4WUUB 2XTJB 3ARWA 3BOVA 4OLYH 3PP3H 4LSQH 1QG3A 2WP3O 4WI7A 3RA7H 6FABH 3RDTA 5HHPA 2AXFA 2MNUA 5CGYD 5JA9A 5FYJE 1P84J 1I4FB 3UAJC 1P53A 5E24E 4HW6A 4UILL 4U1GB 4WJ5A 2HWZL 3MRCA 4LP4A 1NFIB 4LCUA 1JNNL 1J0HA 3DX7A 4QHNA 2LVCA 1KLUA 3TA3A 1FBIL 2HJKA 1J5OH 1I8IA 5HHMB 3TP4A 1FGVL 2GJZA 1A1MA 4LSVL 3V4PH 2IG2L 4WIQA 3BEWB 2BVOB 3PJSA 3H7BB 3L7EB 2VO5A 1YY8B 5F6HJ 1D5ZB 3T0BA 1E6OH 5IQ9B 5D5ME 3JV6A 4HHAA 1NFDA 4ETYA 5D5MF 43C9B 1FVCA 5FKAA 4OCXH 3UBXG 5ICYA 2KQNA 5IOPB 3EYOB 3TN0B 4TNVF 4IDJL 5C9KA 3HE7C 4U3CA 1S9XA 2PYED 5EO9B 1H3WM 3QWRA 4RQQA 4BQ6A 4JAMB 2B5IB 3MJ8A 2I26N 1R3KB 4ZDHB 4X7CC 4ZUVA 1F97A 4ZTPL 5EOTB 5CSBA 3C8DA 2Z4QA 3BGMB 1TJGL 5C0CD 2FZ3B 3GKWL 4HWBH 1RZFL 2WUBH 5HYEA 3OF6A 15C8H 4KJPD 1S7SA 1F3JA 4F7MB 2JK5A 4RAUB 5LGHL 4AMKL 4PRID 5K9OA 4NP4H 1FH5H 2ZNWA 5DRWB 1JZ4A 1I9JL 5IV2B 3WSQL 4TSAL 3QHFL 4IRJC 3O2WL 2H3NB 1BP3B 1JPGB 4TULH 1OTTC 3PP4L 4ZAKD 1J1PH 1DQML 3BISA 3G5VA 4ODWB 5LXGH 2OZ4A 5D6DC 4GO6B 1MFCH 1T7VA 2JJWA 4L29B 5KSAD 1FDLH 5JLZA 3B3IB 3MNZA 1E4KA 5HHOA 3QFDA 1T22A 4IIQC 1FYTB 5D1ZC 3RGHA 4DVRL 4XNZB 2CDFB 5C0AD 3MROA 3PL6A 5ADOH 3CMGA 2P5WD 3EO0B 5DK2B 5F7WC 5T3XE 4BSWA 2HKHH 1G7MB 3BPLB 1GZPA 1SVZA 4I3GA 3O6KL 2VKWA 4LSSL 5FM8A 4OI9A 3MLRL 2HT2C 5I8KL 1RJYB 3CU1A 4Y5YC 2GSGA 3VXRE 3WHE0 1KXTB 1Q9LB 4JM4L 1X7QB 2CLVA 2GCYB 5IMMB 3MGOB 2HAZA 1I1YA 1M7IA 2UYLB 5E5MA 5KS9E 5KS9F 3JWDL 1F58H 4L8SC 5DHVA 1KN4L 4OZHE 3QAZB 3TCLA 4OZHF 1F45A 1HQ4A 4CAGA 1WITA 3OKKB 4G9DA 3RVTC 4DKEL 4MX7A 5GSVB 1LP9F 3QEHB 1HQRA 3QUXB 5B4MC 4LLYA 1FL3A 3EJJX 3TZVC 3UTZB 3BDYH 1QYGL 4OD2B 1X5XA 1S3KH 1AIFA 5DXWA 2GAZA 2V5SA 1N6QH 5IB4A 5SV3A 3AAZA 3D18A 3NIDE 3AMKA 1TPXC 3EW3B 1QO3B 3NIDF 4M6AA 2EICA 3HE7A 1HDMB 1I1FB 2XWJB 4RFOH 2QSTA 3V8CA 2R4SL 1QP1A 5JXAH 5JDSB 2YMXH 3P9LB 2AV7B 1S7QB 4G7YL 4FQJL 1CXEA 3RNQA 3VDAA 5BRZD 4QNPE 1MWAL 3ZYOA 5KSVA 2NR6D 4QNPF 1EK3A 5C0DB 1RSFA 2FGZA 3FN0H 1VEPA 1G7JB 1FRGH 2IC2A 5IHLB 2ZPKL 4PJXB 4IRJA 3VXPA 4TUKL 3BZEB 4HKXA 1JUFB 3NZHL 1FO0A 1C7TA 1LVEA 5D6DA 4U7SA 3HMXH 3TNMB 2F58H 5F1IB 4IIQA 1QSED 3KJ4B 3OMZA 5D1ZA 1AE6L 1RUQL 4AL8H 2FJHB 5C0GA 2VDRL 2DJUA 5D5MA 3CFEB 4ZXBD 4HUWA 3MA7B 5DUBA 4XC1H 1ETZA 3L5XL 3N1QC 4HF5H 4OGZA 4ZFGH 3P4OB 1JN6B 1N59B 1FL6A 2CKNA 3F7YB 4TVPL 5CJ8A 3ZO0A 2R2BB 4Y5YA 3C60C 4G6FB 4G8FB 4V2BA 1YC8A 1MY5A 5E2VL 4MS8D 2QHLA 3QPQC 4U0RC 2NY7L 1OGAE 4JY6B 4L8SA 1KYOK 4WUUE 3V4PL 3SPVB 1PDKA 2XTJE 5C0JA 5C0RH 4GLRI 5F7UA 2A74A 5E00B 5FF6A 3T4AB 1QQDB 4D0CA 1Z9SA 4CNIA 1E6OL 2ATKB 2Z31B 5FYKU 3GSVA 5E95B 3V2AR 3L5IA 5DS8B 3E2HB 3MRPA 3TZVA 3BRDA 4Q7DA 4PRAB 4HX1B 4W4NA 1LO3L 3IDYB 5EBLB 2DIAA 4EEEA 3MJGX 4PGBA 5C0EA 1JWSA 5DMGC 4LIQH 1NCWH 1EV2E 4UBDC 5HHME 4XRCA 4ORGA 2NTSP 3AS1A 2L7JA 1MFEL 2YKLH 4LK4A 5I8CA 2NY0C 3U6RA 4XPHH 3AGVA 4M6OH 2B4CL 2XZCL 4K07A 4HD9A 3LKNB 5JPNA 3B9KC 4R4NC 1NGPH 3P77B 1EFQA 1ES0A 3VXRA 5JNYA 4XP6H 2VAAB 1OAQL 1MI5B 25C8L 4LKCB 3RBGA 3MCG1 3FO9B 2QSCL 5TPWH 5BJTA 5KS9A 3OAZH 3ARVA 1MFCL 4G8GB 1S5HA 3R06B 5EU7C 4UAOC 2ITCA 2E9JA 4OZHA 2PW1A 5CJBA 1K5NA 3S96A 2XTJC 3T77A 5ALCH 1IT9H 3G6AB 3VXNB 1U8NA 5ADOL 1LP9A 5E4EB 3JTSA 3QXDB 1SY6A 4MB5A 3OSKA 2Z35A 4HIEA 1ZGLP 5CWSB 3GMRA 3QDHA 1KB5H 3QIBB 1FNFA 5CIPA 5DZOA 1UJ3B 4U1GC 2X41A 3VXQA 5DEGA 3LEXA 3CDYA 3W9DB 3MV9A 4QYOA 3L95A 1U3HD 5I18L 1JHLH 2FX9H 4QHUB 4JFFA 5E6ZA 2NY4B 1BQUA 4XBEH 2F5AL 1N64L 1FVDA 3C60A 3O3EB 4GKZA 1AR2A 3DVGB 1Z6JT 4GAYA 1ORSB 1P6AB 4LCWB 1FYTE 3ARSA 5E2JA 2MHAA 3PWJB 1U8MA 2CDEA 3NMEA 3MODL 5L2JA 4XAWH 1WBZA 1QNZL 2GTZB 4HGWB 4U0QB 1SJHA 4JE4B 2B2XH 4LEOA 4RAVB 5J13C 3TN0C 2Z8SA 3BDYL 3BGFB 3DO7A 4K7FA 1EPFA 3MACH 1N6QL 2BVEA 4R90L 3T0AA 1P2CA 2H2PC 1I1AB 3GSWB 3IFLH 5IIEB 2OK0H 4ELKB 4PLNC 1CICB 5ACZB 3ULVL 4RFOL 4HAGA 5IB1A 4J2XA 2YXMA 3CK0L 1TTUA 1CLCA 2VIRA 2BNQD 2A73A 4JDVB 1S9WB 3RI5K 4ELMB 4NKMA 2AV1A 2P1YA 4UV7H 4KXZI 3QWOB 4LLMB 4KU1A 4TNWF 2VXVH 5D8JH 4KROB 1F02I 5FCUL 5TH2A 2VDKH 1ZHLB 2P8MB 1FRGL 3B9KA 1QLRA 1AP2A 2E9IA 3RIFF 4QRRD 1C12A 3O4LD 3MRHA 3OXSB 3TJEH 3FL7A 2W0FA 1WBYB 2F74A 1MQKL 5BW7C 3QXWA 1R3JA 2EXWD 1OGAA 2OXHA 2F58L 4G6KH 3EO9L 4W70A 3WIHH 3L3DB 5EC2A 2CGRL 2HTLD 1NANH 4G6JL 4AL8L 2IH3A 4XCEB 2E27H 4CN6A 2R0ZH 4Q2ZA 2JLLA 1Q1JH 2Y06H 3REWB 3O6FD 4EI5B 4OQTA 2AXJA 1I4FA 5GJTL 4XP4H 1PZ5A 5EPMB 2XKSA 4HC1A 3KAAA 2CXKA 1QPXA 4NKIL 3WNLA 1YNTB 2YD2A 43CAB 4WENB 4PJXE 1NFIA 3EDEA 2BVPB 5FA4B 1JNLL 4HULB 4U6TA 3QAZC 5DK0B 3VFVB 2GSIB 3LQAC 4GQ9H 3WFCH 4F7CB 4U1SB 4KDWA 4WNQB 4GOSA 1EHAA 5HGDA 3QUYC 3BEWA 2C9AA 2FD6L 3NCMA 3L7EA 5DURB 3V4UH 1YY8A 4MDIB 1D5ZA 3KYKH 3NIFE 5IQ9A 5I1KL 2K7QA 3RAJL 4LRNL 3NIFF 3MLSH 4M7KH 4NQCD 5HTSA 4ONFH 2CUMA 4GMTL 3STLB 1DR9A 4P2RA 5C92A 5IOPA 3EYOA 4QHLB 3TN0A 4JG0L 4JY4B 2BHYA 3O11B 4RWYH 4UOW1 5F7YC 1R3KA 1B6DA 3C5SB 4M5ZH 5H35A 3KNBA 4YK4B 1NGYB 1W72B 4JY5H 2G75B 3RVUD 4F7MA 4YQXH 4YR6A 2RR3A 3MCLH 4XPHL 3OB0H 2XZZA 2C3XA 1NGZB 5EU6B 2FLBT 5BCAA 3E3QC 2JJSC 2FHCA 2DDQL 4QRUB 3SEPA 1NGPL 1BZ9B 2H3NA 4N5EC 4RFEB 4OM0H 2DI8A 4ENED 3JV5A 4ODWA 4JRXD 3O8XB 4HV8A 4MZ2A 4Y2DB 1T4KA 4Q9BA 5J1AB 3KJ4C 1FYTA 3NZ8B 5C08D 2VRAA 2NPLX 2VZ3A 3OKNB 1YJDH 4WW1A 5BW7A 4PLKD 2DQTL 3P2TA 4CBPA 3C5ZD 1KGCD 1G7MA 1ADQL 3D9AH 1B3JA 2YC1A 2EECA 2NY1D 4LPYA 4GXUM 3QFJB 2CSPA 4JCLA 4JHAH 3WHXB 3KHQA 5I76A 1PAMA 4AQ1B 1R3IH 2H6PB 5M94B 1CFSB 1NSNL 3TH2T 2XYCA 3MPCA 1PYWB 2XPGA 3LAFA 3O6LH 3IDJB 5GS1C 5BMFL 4AM0B 3HI6L 1Q9LA 4XH2A 2GCYA 1MI5E 1UWEH 5A2JH 4OTXH 4DJMA 2UYLA 4DOHB 2FX9L 1AKJD 1A02N 3GNMH 4G8GE 2WM0A 3CIQA 3N85H 4Y4KD 1IGJB 1KEML 2X89D 3QRGH 2XRAH 2C3GA 3HG1D 2ICEA 3IU4H 1XF2B 4NCC2 2R8SL 3FRUB 2AJZB 1JVKA 3QNXB 3OKKA 4IOFD 4KTYA 1DDHB 5FKPA 4PJDB 1N4XH 3V6ZB 4HWEH 3QUXA 4GMSH 4XAWL 3MFFB 3QUYA 4A6YA 1REIA 5CLWA 4M1GH 3UTZA 2B2XL 3MUGB 4P2QD 1WEJH 1UQSB 1EBAA 3MACL 3AUVA 3ZKMC 1JHTB 4R4BB 1KLGB 2ZUYA 4POUB 4I4WB 5GGSB 4AIOA 3BQUB 1QO3A 2DLGA 3IFLL 2OK0L 3GIZL 3JWDC 1HDMA 3SGDH 3QCVH 3MLUH 2OSLA 3JBG7 1TLKA 3KPRB 3MRKB 1YZZA 2EDNA 4HPYH 3RWIB 2P24B 4LCWE 4N68A 1ITBB 2Q86A 4H5SB 4PP1D 3P9WB 1ZHBB 2VYRE 4MLSA 3BT2H 4M43H 1FC1A 4ONGL 1H3PH 1DN0B 1DFBH 4HK0A 3RI5F 3IKCA 5E8OA 1IM9B 3IFPB 4C56A 2JJSA 2VDKL 4I13B 3BPOC 5F71A 4RDQG 3R8QA 2GUOA 3QUMH 3L3KB 4J23A 3SKMB 1XF4A 1OM3L 2XWBB 1SEBA 5D1XC 2ATPB 3EJYD 5E4EC 3KLHD 1IKFH 4S1DD 4YHNB 1FG2A 4LLVA 5I0DA 5F1IA 2BVTA 3VXSB 3EBAA 3FHAA 3WIHL 2IPTH 5IBTH 4Y19A 1N5YL 2FJHA 5DI8A 5I8EB 4UOW0 1CR9L 1UJ3C 2E27L 1V8HA 5C6TL 4JFHE 2BNUA 4DW2L 4ELME 1NC4D 1Q1JL 1XF3B 3P4OA 2CLRA 2C3VA 1U41A 1FG9C 1JN6A 1P4BL 3CFDB 3MRRA 1IEAA 4KKLC 4C55A 5HGHB 1N59A 3F7YA 4U6XA 1CVSC 5CEZH 3LH2H 2NY4C 2ZUQC 3QXVA 5GS1A 4G8FA 3U1SH 5C09D 1BLNB 2WWMD 1JCKA 1AO7A 2AK1L 1GH7A 1NJ9A 1FZOB 3V0VB 4W6WB 4OCMC 5DJDA 1MCNA 5EBGA 4YDIH 4JY6A 1YY9D 4LPTA 1INQB 3NA9L 4NNYB 4CU7A 2HN7A 4HEME 3D2UA 3T4AA 1CFQA 1QQDA 3U46B 1SEQH 2ATKA 2Z31A 1GPOH 3LVEA 2MPAL 3ARBD 4GBXD 3HNVH 1A5FL 1EIBA 5DS8A 1J05B 2JE8A 3MLSL 4ONFL 3MJ9L 4PRAA 4HX1A 4U1MA 3RZWA 4DZ8B 3T0EC 3MUZ1 4DAGH 2UUDH 5GGRA 2AKRA 1MCJA 3F65A 4FQXD 4XPAH 4D9QD 1L7IH 1J7VR 4OZFH 1T03H 2EDTA 3NFSH 2AJYH 3BESR 3MJ6A 3U7AA 2OXGA 4HSQA 2KH2B 5SX4H 1A6UL 5HYJD 2DMBA 3ULUH 2DLTA 1DE4A 4NZTH 3RVWD 3GSNH 4R9HA 1X5FA 5I66B 3DUSA 4MD4B 3VXUD 4KROC 4JFQA 4XBGB 3VH8B 2A6KA 1MI5A 4Y5VB 3FO9A 4AY0A 2NCMA 4JGUA 1VFAB 3UBXI 4H88H 3QZWA 5GGTA 2ADJB 5EBMA 3ULSB 4WCYH 1ZSDB 3ARDB 5D1XA 1A4JA 3VXNA 4CVXA 4R97B 2YUZA 5DD1H 3QXDA 3HC3H 2C7UB 4PYGA 2F9BT 3U30B 4PR5A 3DYOA 1VCAA 5ETUA 3BO8B 1AI1H 2VE6A 2D7PA 4M48H 1IAMA 2P8PB 4JHAL 2VL5B 1RZ8A 5EU6E 1UJ3A 3EJZC 2AQ3A 3F58L 4ODUB 1UACH 3MLWL 1B90A 1NGXB 1BGXL 3BWUC 4PJ9C 5DR5H 3W9DA 5CP7B 5DD0H 3ZTNH 3O6LL 3EDKA 4UIKL 3BKMH 1ZTXL 1L6ZA 4OTXL 1F90L 1S7RB 4BK4A 4XVTH 3GNML 3SQOH 1RIVL 1SVCP 3N85L 1GSMA 3O3EA 4LASL 1I7TB 5A3ID 3DVGA 1AH1A 4Y4FD 2NY2C 3QRGL 5HVHB 1X4XA 2IPKB 2X4UA 1AGEA 4YBQC 4YXKH 4JO3H 2HTKD 2LAAA 1FGNL 1U8HB 1AGBB 4EXKA 1N4XL 3WCYA 4NCDA 1KACB 2GTZA 4GMSL 1F4YL 1JF1B 3K4DA 3U9UB 3VU2A 3QFJE 2ORBL 1TTFA 3UTSA 1A1OA 3DOSA 3SDDB 3O2DH 5I1AA 3MLZH 4PJFB 3TV3H 4KMTH 2NW3B 1NBZA 3RWJB 3EOBA 3NPZB 4F7EA 3WKMH 3O0RH 5I16B 3U4EB 1FJ1A 5E56A 5IIEA 4ELKA 3QEGL 1RVFH 4DOHE 4Z76A 3T0EA 1KJ2H 3IGAB 5IT2L 4YK4C 1OTUD 1YMMB 4MSWB 1EHNA 5HI4C 4N9GB 5GRUL 5I19L 5DJCB 1CT8B 1DSFL 1RUML 5E99H 1TZIB 4YX2H 3SDXB 2NY3C 4JDVA 3BT2L 4XNQB 4M43L 5AYUH 1E0OB 4XWOD 4Z77A 4PJDE 4U6VH 2KZWA 1CDCA 4MA1B 4ODVH 1OLZA 4PJDF 2R56L 2PXYD 1C5BH 1QFHA 4IMKC 1RZ7H 3V4VL 2FIKB 5TFSH 2P8MA 1MCKA 5IVZB 3QUML 5HYIA 1LO0H 4LU5L 3K4AA 3GSQB 3T1WA 5KJRL 4OBSA 5DJAB 4OGAD 5CCKL 1IKFL 2AJVH 3KPRE 4DQOH 1WC7A 3HPJB 4JLRB 5IBTL 3BYYA 2H41A 4HWBA 3VWJB 4XCEA 2VLRB 3X3FH 4U1LB 1JGEB 2R29H 4HUVB 1MF2L 4WI9A 3ZDZE 5B38G 4MXWH 5L6YL 2GJ6D 3QDMA 2AXGB 1BEYL 3ZDZF 4UNUA 5EPMA 3WO3B 4IJ3B 1SBSH 1YNTA 4PJ9A 1JZ3A 4N0CD 4WUKH 1QSFA 3LH2L 3GRWL 4RMUA 5ICZB 4HPOL 4O2FA 1HN1A 4JFOB 3U0PA 4NQEB 5J12C 3GHEH 1MHEA 5I1JL 3UYRH 3MLPA 3IETB 2GSIA 3MR9B 5HYSB 4F7CA 2PETA 4UB0L 3O41B 3VXSE 4HUMB 4WNQA 4BA8A 1JRHH 4LIQE 3QXAA 4MXQC 4JG1H 1U8LB 4FFWC 4PJ7B 4JZJC 1GPOL 4GS7B 2VLLA 5EZIH 5FYLH 1XCQB 1VFBB 2VZUA 5E8EB 4U7KA 2LTQB 3MGTB 1NCAL 1JBJA 4P23B 2BXZA 4WEBH 3CLEH 4Q6YA 4DAGL 3VA6A 1JWMA 1MCOH 2EKJA 1S7WA 2PO6D 2DWEB 4K7PL 4WVRA 1P5UA 3Q48A 3NFSL 3DV4B 5T1KD 3NCBB 4MNQB 1HK6A 4I0PB 3ULUL 5DD5H 3GSNL 4XPGL 1NGZA 1HSBA 4JFEB 4HFWB 5JPMB 4G3YL 1C5DA 1U8KA 2BY0A 4ZS6C 4HEPG 1W0YT 1TZHB 7FABH 4IMKA 3LN4A 3CX2A 4QRPA 4AG4L 4U6YA 1KPUA 4H88L 1ZT7B 3S5LA 5JHDD 4HJGA 4OJFH 1MPAH 1N5AB 4YXHH 1JTTA 2F5BH 3P3YA 4JO2L 4HKBA 2EXYD 3NGBB 4H26A 2NW2B 3OKNA 4KJQD 3PWUA 3FO1A 3I3EA 4YFLF 5IMKA 3WNNA 3IU3B 3HC3L 3C8KB 3A0OA 4U2YA 5J6HB 4U1KA 3NCEB 3HTLX 4U1HB 1AI1L 3CFBB 4M48L 3DECA 4OFPA 2WUCH 4PP2A 2BVQB 3WHXA 5DRNA 3UYPA 2BDNH 4YGAB 4YGVA 3NCYS 3I6GA 3CDGB 4PRBB 4IRSC 5E2TH 1K4DB 4ODTH 3IDJA 4AM0A 1UWGL 5GGSY 3BKML 1Q0YH 4NRZB 4DK3A 5B39A 3B2UC 4EDWL 4F7TB 1IGJA 1WFUA 2ZOLB 3NBNA 1LO4H 3HMXA 3HCVA 3BSZL 2AJZA 4H20L 4YXKL 4JO3L 3KVQA 1UVQB 4PJDA 1BIIB 1U93B 3PHQB 4PTUB 1NCBH 3ARRA 1X5GA 3MFFA 3MXVL 4JKWA 2JKXA 1X6LA 4K94H 4G6AC 5CKGA 3X17A 5EZOH 4R3SA 3MUGA 4JZJA 3MLZL 5C0BD 4KMTL 3HFMH 1UQSA 3CFCH 2ZKHL 4BFBD 4MHHG 4KY1L 1KLGA 3BH9B 5JZ7D 2F53A 3EDJA 3WKML 1QSVA 2YRPA 5E6ID 3WEXA 5HPOA 2QTEA 3QNZB 2WANA 5GIRB 1KB9K 1KJ2L 4YFEA 3KPRA 5K59E 2BC4B 4LOUD 1OY3B 5HDQH 3VFWA 1CK0H 4JM2D 4KRNA 3RWIA 2P24A 5K59F 3GEWB 3CX5J 5CZXC 4BH8B 3MRNB 5T3ZH 5E99L 1IGYB 1ZHBA 4Y4HC 4KJYB 4QRTA 4NUJB 1OF2B 1PD6A 5EFIA 4X9FA 2Q20A 3TYGH 1DQLL 5EULV 4NO5A 5E4IA 3ZT7A 1G6RH 2W38A 3EOTH 1BECA 3OKMB 1DN0A 5HVFB 3C6LB 2HT4C 3BUTA 2ZWLT 2YRLA 3EFFB 1IM9A 5GPRA 3IFPA 1D9KD 1LQSR 3PXHA 3H9ZA 1QLFA 3WUWA 4X80H 4PJFE 1A6ZB 1LO5B 3V0WH 1F00I 4N0FA 5TF1H 4E9LA 1K85A 5F96H 5CJQL 1LO0L 4ZSOB 2YN5A 1A7RH 4ALAL 1EEZA 5I17B 4YHNA 4KK8C 2ZG1A 1YMME 4G7VL 1TNNA 4DQOL 3ARED 4X7FC 4OZFB 1J0JA 1S7UB 3BN9D 1V7MH 3AY4A 4PG2C 3S36L 4OLXH 3SDXE 3ZDYE 3SDXF 3ZDYF 5DZNA 3X11B 2EH7H 2ZCLH 5TQ0H 1F11B 3WD5H 4LVOC 4N8CL 1XF3A 3CXHJ 4TPRH 1EUUA 3CFDA 4QTIH 1Q9WB 4JKLA 4IRSA 1SBSL 3AXLB 4WUKL 5F9AC 3FZUD 3ARUA 5ACMA 1FZOA 1U8JB 3V0VA 5D72H 3KHOA 5IGXH 5IW1B 1IFHH 1DLFH 1XIWC 3FTGB 2OJZL 2ADGB 5GHWH 5IF0A 3HE6D 1INEH 1JRHL 2V6HA 4W81A 5CSZA 2VXSH 1LK2A 4HZLB 1K8IB 3FB7B 3TIDA 4F9PC 1UENA 2VLRE 4ZUSB 5IWLC 12E8H 1KB5A 5EZIL 4UQ3A 5FYLL 2BFVL 4RX4A 2XN9A 4X4XB 1EMTH 4DZ8A 3QUZC 1HZHH 4WEBL 4YNYB 3CLEL 1QLEL 1BQHB 1MCOL 1L7TL 2BOCB 2JTDA 2YD1A 4M00A 5D93B 1A14H 4WHTB 2VLJD 4GT7A 4NQEE 3TVMC 5B22A 4LCWD 5FAAA 5JIKA 5FYKE 3UO1H 5ICXB 4XXDB 5EA0H 3AU1B 3ORJA 2Q8BH 3SE3C 5DD5L 5I66A 1YPZB 3NTCL 4MD4A 5KVEL 4P5TC 2G5RA 4MWFB 5D9SB 1ONQA 3CMOL 4PJ7E 4NN7B 4QXGH 3WLBB 6CGTA 1PLGH 4HH8A 4HIJA 4PJ7F 3VH8A 4OKVA 1IQDB 3TBYA 4YLQT 4L5FH 1L6XA 2HMID 4L9LC 3SY0B 1S78C 1KTKE 5A2LH 1ZA3A 2YPLA 2CKBB 2OI9B 1VFAA 1RMFL 1BD2A 5GRVK 2X4PA 1MPAL 1Y18A 3NN8A 3KPSA 32C2A 4YXHL 2BSSA 2WLZA 3BEVA 4YHKH 1SMOA 2DLHA 3VWJC 5EIVA 2C7UA 5K9JH 5J1TC 3PGFH 4MNQE 1X5AA 4R2GC 3TBSA 1MJ7H 3GGWB 3UMTA 1MHHB 1YUHA 4LSTH 4PG2A 2VDML 2P8PA 4RWHA 1J0IA 3QDGA 5IB5B 1ZLVK 5FO8B 4JFEE 3AVEA 4ODUA 4L8DB 5DUPH 3W0WB 5E2TL 3Q6FB 1ZE3C 3PDOA 4Z7OF 4ODTL 4MGXA 3THML 3VE0B 4NQSB 2EE3A 5SWSB 3G5ZB 1Q0YL 4ZOEA 3BHBB 1QFOA 2XQYK 2OR7A 3IJHB 1I7TA 1IVLA 4L4JA 2OTUA 2XIDA 4HJ0C 1YJDC 2IPKA 1LO4L 3FONB 4LL9A 3VFPA 3UJJH 2NTFB 4OF7A 3S4SA 3SCMC 3SDAC 2DM7A 2G5BA 1XIWA 4FTVB 3K46A 4JKPL 1IKNC 3U9UA 1NCBL 4NYLB 3BIKA 3Q5OA 4K94L 3FT4B 2X1QA 4F9PA 5EZOL 4LF3A 5F1KC 5A2FA 2G60L 2BVUA 2QBWA 3HFML 3RWJA 2EYSB 4P4KC 2D7QA 2X4TB 5I16A 1KOAA 3B2VL 4AEEA 3VW3L 4OZIB 3QUZA 1AGFB 3IGAA 3QIUD 1YMMA 3S3SA 3C09B 1S5IL 4UUJA 4CJ1A 1CT8A 4CVUA 3M1BB 1PGRB 3TVMA 4G42B 4F15C 4N0UB 3H3PL 3SDXA 2JIXA 3SBWC 5J7CC 2OJEB 3LKSB 4K8RH 4MB4A 3I3BA 3FAXA 3EOTL 2BNRD 1KJ3H 1DQTA 1OCWL 5IW3A 2VDQH 3UBXB 5CBEA 4KK6D 2A6IA 4P5TA 4CMHC 5DO2C 2FIKA 4F9LC 1YMHB 2R0WL 1T5XA 2AJSH 3O6MH 4X80L 3H2WA 4HDIA 1IAIH 4L9LA 4WWID 3OGCB 4BJLA 2EH8H 1MCEA 4N5UA 5KN5A 5CEZE 3GSQA 5DFVC 5DJAA 2V17L 3F7VA 1MJUL 2X1XR 4JLRA 1V7ML 2ESVB 2VDPH 3S34H 1BX2B 2QSVA 1E4JA 3ARFC 2GK2A 3VWJA 5GSRB 1JPSH 1VFUA 4MA7H 3GMQB 3ZKND 2WMPA 2ZCLL 4KHTL 4KDTC 2YXFA 4PGEB 3OV6A 4MCZB 5DVKA 4K2UL 3WD5L 4U2ZA 3PUCA 1XGPB 4TPRL 1A47A 1B4JH 4TRPH 1UG9A 2HLAA 2LABA 1XCTB 2GW5A 3CNKA 2UWEF 3WNKA 4PJ8B 1I7RB 5ICZA 2A6JB 3QXUA 3O8XD 3K80A 1I3GL 4UTBH 4ZSOE 3HC4H 4WU5B 3LKPB 1ZHKA 4M9PA 4P46C 4YDKL 1MRFL 1T66D 1GGBH 4B7IA 5IGXL 3LS4H 3MR9A 4AEHH 3OL2A 3O41A 1DBBH 2PKDA 1J1XH 1BVKB 3SCMA 3SDAA 4PJ7A 2F54B 12E8L 3ARTA 5IMLB 3DARA 4NIKB 1MFAH 2ENSA 1QZ1A 2O26U 4NQVA 5D7IB 2ARJQ 1GVIA 3C08L 4ZUTA 5E8EA 3V5HB 1B9ZA 1BFOA 1DUZB 1IGCH 3GO1L 5D2LF 4KKAD 3D85B 4XCNB 4ZO7A 4P4KA 5ITBH 1W8OA 1C08B 1A14L 1S7VB 2DWEA 1RIUH 2EO1A 4P2OD 4J6RH 4M8QB 4LHQB 4X4YA 3UO1L 4MNQA 5EA0L 5MEND 4S2SB 1MWAB 4X9GA 2BRQA 3C6LC 2YRZA 3X14B 3KPOA 1NEUA 4F37K 1BZ7B 3V5KB 3MBXH 1KPVB 3EYVA 3D39D 4HFWA 4MQSB 3MJ7B 1DBJH 1MJJA 3BJLA 4PJAB 4EN3B 3MREB 4QGTA 4R7NA 4NWUL 2DQCL 3T09A 1JIBA 2LAGB 4F9LA 4GQPH 1XGQB 5TE4H 1ZT7A 1S7TA 3EYUH 2KPNA 4UU9B 1X4YA 4QRSA 1OHQA 1A7PH 4AEIH 4YHKL 4HWNA 2VQ1A 4FXGA 2MKLC 4GW4A 1I7ZB 5HGBB 3IU3A 1YN6B 3C8KA 3CFIC 3HUJB 2VISB 3ULUC 3PGFL 3RUGB 2Y7QA 1MJ7L 3RGVD 3RWFA 4LSTL 2DTMH 1E4WL 1LO2L 3OKDA 1YPZE 3ARFA 5BQ7B 3P4MB 3TF7C 1IC7H 4NQDD 1YPZF 4N0RA 4OGYH 1NUFA 1KTLB 4LVEA 3RPKA 5C8JB 5HVWA 4PTTA 3LQMA 5HDOA 4NRZA 5F88A 5T5FL 4JR9L 5FM4A 3QUMA 2J2ZA 3CFJB 5HGAA 2DLEA 5LVEA 2ZOLA 5JMOC 5GS0D 4NRXB 5EO1B 1OP3H 3UJJL 3FMGH 1I7UA 1KPRB 3ZE1E 3AFLA 2OL3L 5HD8C 1U93A 3PHQA 4X99B 3GJFH 1ZLSH 2VZ1A 2YBRB 3PABB 3W0WE 4D0BB 3JTTA 1CFTB 3FB8B 3B9VA 3UJTH 2V5RA 3BH9A 5FO9A 5SWSE 4LVHB 5GIRA 2EEAA 3IXAB 2WAHA 1TIUA 2FX7H 1KV3A 3F5WB 4LNRB 5B21A 2GEEA 3NCJL 3AS3A 5CD5C 1RIHH 1XR9B 5F9JA 1UH2A 3MBED 3GBMH 1IGYA 2HJLB 2CUHA 4WV1B 4NUJA 3EHBD 5ADPH 3C6LA 1MEXL 3H8NA 1KJ3L 5SWZB 3U36B 2VDQL 4AENB 2UWEA 3LPGA 2OI9C 2NZ9D 1LO5A 2AJSL 2HH0H 2F8VA 1RU9L 3IRPX 3X3GL 1FNAA 2YD7A 2EH8L 3PL6D 2PN5A 3TYFB 1NCCH 4GW1B 4K55A 1OQOA 4OZIE 3UZQA 1MVUB 3BIAX 1TJIH 1R6VA 5I17A 1UKSA 1U95B 4ODXB 4QHKI 3PWVB 1UFUA 4OZFA 3NACH 2CK0H 1S7UA 3U0WL 1DQJA 2VDPL 3S34L 4N0UE 5CZVL 1AXTL 1ACYL 2AEIT 2V9RA 4FQHB 1NEZB 1XR8B 5DFTA 3X11A 2DQJL 1OGTB 1OVZA 5IBUG 3UAJD 4WDIB 4X6DB 4EUPH 4JJ5A 4HH9A 1B4JL 2HLFD 2FL5B 2D7NA 5D2LA 4PJIB 4PJEF 3DXAB 3TPUB 3AXLA 1K2DB 5ILTL 2GK0A 1MUJB 4UTBL 5MEOB 4L1DA 1U8JA 2FYYA 1PKOA 4KRPB 2C26A 3QI9B 3VA2C 1OSPH 2HFGH 2YUVA 3FTGA 3W39B 2ADGA 4M61A 4P5KB 2IAMC 3IKKA 2ESVE 2IANB 5C86A 2BCKB 1JHKL 3FB7A 4WY7L 1RZIA 1N0XL 1JZ5A 1CFNB 4X83A 5ERWB 1MFAL 4YBLB 5IESH 4I3RH 4MCYB 4FQLH 3I2CL 5D6CA 1M7XA 4XPTH 2A9MH 2W59A 1IAKB 3ES6A 4IHOA 1BQHA 5IHZB 2BOCA 3K7UA 5EU3A 2OR9L 4IOIB 1Z3GL 1ZKAA 4GRLD 4WHTA 3UTOA 1HE7A 1FPTL 1JGVH 1WGOA 2B7DT 4EDXB 2ADFH 4XXDA 5IVOA 5HXMA 2P5EA 1YECH 3PV6B 1U8PB 2IALB 3FFCB 2GY7B 5KAQG 1YPZA 3NFNB 2A83A 3SDCB 4AIZB 4MWFA 2G2RA 2NY5H 5D9SA 3MBXL 2OLDA 3WLBA 2F54E 5F1OB 2EYRB 2RHEA 4F37F 1OTTD 1V5JA 5D7IE 1AGCA 1SJEB 3P0GB 4NT6B 4ODHH 4TN9A 1U8IB 5D7JC 5F9OH 2GIYA 3O2DA 5HDBE 3VFRA 4PJCF 5HDBF 4I2XB 2CKBA 1UWXH 2CD0A 5HYQA 1K8DB 3GMLA 2OTPA 2PTUA 3EYUL 3RTQB 4YHPB 1ERNA 2F19L 1NMAH 4R4FL 4KPHL 3T3PF 1BFVL 2GITB 1QRKA 1KJ2A 4AEIL 4OCNC 1WT5C 1JGLH 1OWRM 2UVEA 3IDMA 1KUMA 1U92A 3GGWA 5T1MA 2Y07H 4OLWH 5TJWK 4HIHA 3QQ3B 2DTML 2CMRH 3H3KA 4GAFB 3L7FB 3TBTA 5FO8A 5C07A 1A6VH 4L8DA 5EWIH 3FO2B 3Q6FA 4OGYL 4Q6IC 4PJAE 4A2MA 4PJAF 4NQSA 3HMWH 3LKOB 1U2CA 3MLXL 4OCSL 4D0DB 2C1PB 1QA9B 4U31A 3P0VH 4GKNB 4HBCH 1JL8A 1WQVT 2HG5B 5KBNC 4XZUA 1GYAA 3FONA 2X09A 3RVTD 1T0MA 1WSST 5B3JE 3LRSA 3QWQB 1A6PA 1YYML 5B3JF 3HUJE 5F44A 3BP6B 3A67H 4GAJH 4RGMC 3TZVD 3RUGE 4YO0A 5I9QB 5T3ZE 2VDLH 3CZJA 4R96B 2C3HA 2IAMA 5EZLB 3RUGF 2IH1B 4JREC 5DRXB 5FECA 3T2NL 3P73B 1H0DB 1A4KA 4TVPE 2AAVA 2CJUH 2BJMH 2B1HH 1AXSB 5I74C 1K3IA 2APFA 3CXDH 2X4TA 1NAMH 4PPTA 3HPLA 4ZNCD 3O4OB 2HP4A 4NHUA 4WWKB 3CFKB 1AGFA 3FQXB 4LFHG 4QF1A 1AHWC 4L4VD 4NO2B 4RA0C 4WO4B 5ID1A 3IAGC 1RIHL 1MHCB 4N0UA 1FVEA 5FA3A 5ISZB 1A0QL 2OJEA 3VXMD 4X6CA 2O5ZH 4NO0A 4K94C 4PUBL 4PJEA 5DLMH 1NCTA 1GZQB 3I84A 2AW2A 2HH0L 1YYLH 4XGZB 4P23D 4MNHB 3GMMA 5D7JA 3ZKQD 3OGCA 5L88L 1MNUL 3SE4A 4MHHI 1NCCL 4HMCA 3QQ4B 1TJIL 5KG9B 4DN3H 4WFEE 4OAWB 1MY7A 4LP5A 1U8QB 3NACL 3UTPE 2ESVA 4GRWB 1SMAA 1BX2A 5D4QA 3D0LB 1WT5A 3L1OH 3GMQA 2OQJA 1TTGA 4Z7NE 2MTPA 3BDBA 3MLVL 3MV9D 4MAUH 5FGBC 4PGEA 4WI2A 4MCZA 4Z7NF 5SWZE 4U1NB 3B9EA 2VERN 4BFEA 4JFFD 4RBPK 1G9ML 4JQXC 4OGXL 4PJ8A 2AP2A 4KFZC 2VZSA 4Q6IA 5CAYB 3VD4A 3C60D 2RIKA 4LCCC 5EORH 3TEUA 4ZPVB 5LQBL 5E2UH 3V79C 5KSUB 1EJOL 1NDMB 4GXUN 4G80B 4WU5A 1DVFC 3LKPA 3QPQD 3MNVA 1L0QA 1CYGA 1HH9B 1QTYT 1AY1L 3BMWA 4ZNEA 1TQCB 2V2XA 3HZVA 1CFVH 4G9FD 4NQXB 4Q9RH 1GL4B 2GJJA 4DKFL 3QA3A 1DTUA 4WTZA 2F54A 3K81A 1QHPA 5IFAH 2X1WL 1JRHI 4NM8H 5F1SA 4BH7B 4PJCA 1NGWB 2VXTH 4I3RL 4O58H 4X6DE 3V5HA 1FFNB 1CQYA 2UZXB 1MCRA 4X6DF 1DUZA 4IOSD 4XPTL 4PJIE 2A9ML 4ETQB 1JNHB 3DXAE 4PJIF 1EZVX 4ZPTB 3JWOL 1B2WL 4PRHA 1A7QL 4YHYC 2ICCA 5DMGD 1C08A 3WS3B 1ZANH 1G7PA 1JPFB 4YDJB 2AK4B 1JGVL 3CH1A 4M8QA 3N1MC 4W68A 3RZCC 5JHLH 2ADFL 1YECL 2NY0D 1AHWA 1T7WA 4H1LG 3RBSA 4H0HB 5L7XL 2VJXA 2I9TB 2IANE 5TGBA 1H3XA 1YNLH 1GJIA 3V5KA 2NY5L 1KPVA 3B9KD 4R4ND 1BIHA 2FGWL 4PJAA 1AQDB 4PJHB 1D5IH 3SE8L 4L3EB 4ODHL 5FV2A 2RBLA 5F9OL 3KLAA 1VB9A 2EDBA 1HOCB 4IM8A 3GDBA 2HRPL 1GOGA 3NPSC 4UU9A 1NCNA 1NMAL 2X4OB 5GRJL 3PWPD 3SO3C 4MA8H 4KH2A 1JGLL 4PV9B 3DO3A 4HJJL 3KPQA 5EIIB 4BSVB 1Q94A 4OLWL 5E0QA 3FFCE 3FOMA 1U8OB 4OLUH 1W0VA 3P4MA 4XP1H 5BZDA 1G6RA 1FNGB 1Q9OB 3DNKA 4HXAH 3CSYB 1N7ML 4M93C 1KG0B 5AUMB 1OTSC 2D4DA 4FQ2H 5JOFB 3QCTL 2A1WH 3VGBA 3WBDA 3OX8A 4I2XE 4JQXA 5HPMB 4KRPC 3PHOA 5DJ8A 4UNTA 4LCCA 2NXYB 3KXFB 4TYUA 1ND0B 5EO1A 5C6WH 1DVFA 3ESVF 2ICWA 1FZJB 4PRPA 4C4KT 5JW5A 5HI3C 2JELL 1FZKA 4KKNA 3A67L 4ZS7H 2JJTC 4Q0XH 4P2RD 4I48B 2VDLL 2C4FU 4CDGC 2X10A 2MQ0A 1NH6A 1MCBA 2XFXB 4N1CA 4C4KO 1YDPA 2ZUXA 2X4RB 4O2EB 5ESAA 1IBGH 1CFTA 4EUPB 2PYEB 2BJML 1MJ8H 2H2PD 1JGDA 5DGQA 3CXDL 4FMKA 4RZCA 5H37H 1UM4L 5F3BA 3IDXH 3IXAA 2Y36H 3MZGB 1W0WB 5C0CB 3F5WA 3MRLA 5FO7B 4LNRA 4LSRL 5DWUH 3PNWB 3KS0H 2HJLA 2P7TB 3OJDB 4PRIB 3RZCA 3WXWL 1RZGB 1Q9KB 1VA9A 1NFKA 3VFMA 4NJ9H 1FL5B 3U36A 4LSPH 4ZAKB 5F7EH 2PW2B 5C7XH 1Z0MA 1WZLA 3VDBA 1YYLL 5KSAB 5D7KD 4L8CA 3EIFA 4KKCC 3TYFA 8FABB 3WO4C 4GW1A 2ZOKA 3V6FB 2FJGA 2QJDA 5C0AB 1CD1B 2P5WB 5KSBB 1FQ9C 5JTWA 4LAQL 4JN2B 3BGAA 3LPWA 2ICWI 2YD8A 2O5YL 4RGOH 1XGUB 3BVNB 4J1UB 3DMMD 3BRFA 5IVXB 5ISZE 4FQHA 1NEZA 5J9PA 3L1OL 1OGTA 1LD9B 4GW5B 4PGCB 4MAUL 1CXFA 4FFVC 4WDIA 4X6DA 4WU7B 5CJ5A 5DDHA 4U4BA 2Z92B 1HI6A 4PJIA 3FOLB 1GGIH 3TPUA 1P6FA 4KHXL 4DWHA 1F5WA 1FNEB 3W2DH 4ODSL 5E2UL 5EDXA 4R26L 1EX0A 4NOFA 3VFUA 3BXNB 1CGXA 3WN5C 5MEOA 1D7FA 3D25A 4FQ1H 2WBJC 2B0SH 1QBBA 4I5BB 4LHUD 2IBZX 2H32H 4FABL 1BHGA 3FQTA 4YAQA 2D3VA 3QUYD 4JZNB 4YE4L 2A6DA 4P5KA 4GRWE 1MIEH 2IANA 3DVNB 1FAKT 4XP9L 5C6PB 3UYOD 5IFAL 1I1CA 1CFNA 3WV0A 2JJTA 5ERWA 2DBJA 2FX8L 5E70A 4MCYA 3I9GL 4O58L 4I9WD 5I30L 4NZRL 3EYFA 1HHIB 4WWKC 1IAKA 3HN3A 2H1PH 4WFFD 3EOAB 5MI0B 3V7AG 5DJYA 2R1YB 4IOIA 4WO4C 3QIWC 5HJ3A 4U1JB 1ZANL 4UQ2B 4JFDA 1CF8H 1S9VB 4G6MH 1M6OA 4X8JA 2GT9B 1YEIL 5BRZB 2IALA 5C0FB 5IQ7H 1HH6A 2BRRL 2XY1A 4FTVD 3NFNA 2BXYA 4C56D 5TDOB 2P49B 2CQVA 4FG6D 4DTGL 3T2OA 2EYRA 1PG7H 4N5ED 5EC1B 5T33L 5AZEH 2XA8L 4DGYH 4XVJH 3INUL 3CLFH 4OUUB 4FS0A 2XZQH 2VDOH 2R1WB 4MNGB 2C5DC 2F15A 1K8DA 1DBAL 3RIAF 4YHPA 2A77L 1NAMB 4HWUA 4D3CL 1QSEB 2V7HB 3KWWB 2AK4E 1IGIL 2VAJA 3WUZA 1R3LA 4CMMA 5BS0A 5H2BA 3X13B 4ZXBB 4JHBA 3MOAH 3QDJD 2W9EH 1LWRA 4G8IA 4OLUL 3LSOA 4KI5E 4XP1L 1NC2D 2RGSA 4HXAL 3WMSA 4KI5F 4XVUC 1RHFA 2X6MA 1AJ7L 2E3VA 4PJHE 3PDGA 1AO7D 2ZG3A 1NBYA 5KTEL 4L3EE 1U91B 4HS8L 4FQ2L 3LKOA 5H37G 1JK8B 2KQMA 1BJ1J 3QHZL 3QEUB 3EAKA 5DJXB 5KVFL 4D9RE 3PGDB 2AJ3B 4GKNA 4X9HA 1TQCC 3WN5A 3U9PH 5DMYA 2WBJA 2X4QB 3E6FA 1UXSA 3UEZA 3D69B 3I85A 4H0GA 5ELIA 3BP6A 3DYPA 2PR4L 3OHXB 4AYFA 4ZS7L 5B38B 2X7LB 4Q0XL 5EZLA 3SGKC 2IH1A 2FSEB 1RHHA 5J3HC 3LDBB 3AROA 4R0LB 4BUGA 3IT8D 3ZKMD 3IFOA 1AXSA 4OCYL 1O0VA 1NMBH 4XMPH 3O3AB 4WWKA 5T3XH 1HYSC 1MRCL 3CFKA 4Y16B 1F4WH 3KYNA 1B0RB 4OF0A 3TBWB 4TTDC 5DYOB 4XPBH 4NGHH 5C2BH 3KXFE 2CR3A 2J88H 3MV8D 5DWUL 3RWGB 4WO4A 4LCYA 1A7NH 4NNPL 3P4LA 3QIWA 4O9HH 1N6UA 3K8KA 1IRAY 2ZJSH 1LE9A 4ZOAA 3LN5B 4NJ9L 4JB9H 1JFQH 4DCQA 4PD4K 4LSPL 3BPNB 3PV7A 3QEQA 2OZ4L 5F7EL 2FB4H 4ZFZB 4UI2A 4ERSH 4Y8AA 5LCVH 1NPUA 2PYEE 4H25B 5F7NC 5DEFB 4YHOL 5D1XD 1I8MA 4HIXH 4L4TD 4JO4L 2KBGA 4KZEH 1UEMA 2FEDD 2IPUK 5KG9A 4JJHA 4E41D 5C0CE 4OAWA 3CDCA 1U8QA 5IB3B 3LIZL 4FP8L 1BQLH 4JFPA 3D0LA 3GHBH 3I50H 5A1AA 4PRIE 3GI8H 4V1DB 1UB6B 3SKNA 4JKMA 5HHNB 3C5JB 3QUKA 4U1NA 1LILA 4KKLD 5AG8A 3MRJA 1WTLA 1I3RA 3QDAA 2D7OA 2IBGA 1U3HB 2B1AL 4XTRC 1CGSH 5KSUA 4DKAA 5EUOB 1EFXA 4W4OC 4P5MB 1UA6H 1U42A 3CVHH 1EEUA 3LHPH 4JRYD 4HGKC 3LKQA 3RY6C 1HH9A 3MYZA 3NAAL 5C0AE 4P2YA 1OB1B 2P5WE 5KSBE 5I2IB 1OQXA 3Q2CA 4NQXA 5KSBF 3UTSD 4I0KA 1MIEL 3O2VH 1A6WH 4OLVL 4LDOB 2XZAH 1U58A 5IVXE 4GRMA 4X9IA 5ITFB 5IVXF 2IJ0C 3L3IB 5FM5M 4NPYB 4BH7A 3SGKA 5B8CC 4OM1H 5IG7B 3T0ED 3UDWC 2QSQA 4GAGL 2QQLH 4K71B 4KTDH 5DVNA 2H1PL 1IARB 4CGTA 2DJSA 1WCBB 1RUPH 5DTFA 3WS3A 1JPFA 3SGJA 2AK4A 4ZYKB 3GUTB 3MUY1 4Z6AT 3KPLB 2DQFB 5EN2B 2EEBA 2MQCA 2HJFB 1RURL 5KVDL 5FYJL 2D9CA 1JPTH 5IQ7L 3GM8A 1HKLL 1PY4A 2V2WB 3DV6A 4M1CD 5D7LA 3RU8L 1KNOA 2FNBA 3HB3C 3GJFA 2BZDA 5FM5O 1HHJB 4XVJL 4DGYL 4L3EA 3SDYH 4AH2B 3O4LB 5F7LB 1Z2KA 1FO0L 1HOCA 3KPPB 1ED3B 4XNUH 4YHIB 2BX5A 5AG9A 1MLBB 3S6CA 4KZDL 5JOEA 3T1FA 1KIQA 4P0DA 1OAYL 4DK6A 1XAUA 1K6QH 3QSKB 1YEFL 1L4IA 5DHYB 4PV9A 1QEWB 3IDUA 5EIIA 4MJID 5D71H 1QRND 1SYSA 2YA1A 2DRUA 3QDMD 2VNCA 3ZE2F 5BRZE 2IFGA 2NY5C 4K23H 4UT9L 1U8OA 4HC1H 3EJZD 4PJ9D 1FNGA 1RJLA 1QSFD 4HZAA 1X5HA 3OJVC 4LCIH 1B88A 1KG0A 3VGEA 4YC2C 4YHMH 5I1HL 4W6XB 4MNGE 2VWEE 4G43B 1B0GA 2NY2D 3B8YA 4KQ4L 4W4OA 3MOBH 3HR5A 4YBQD 3RX7A 3VRJB 1LDPL 3U9PL 1QSEE 3RY6A 5CINH 1EVTC 2YN3A 5DF0A 1N8ZB 1GOFA 2NMSA 4I48A 3T0WA 1FV1B 1IAOB 4NQCB 1AGDB 3CC5B 4XHQA 4O2EA 3RKPA 5F8QC 1MAKA 1FC2D 4HCRH 4PGDA 1G0DA 3QG7H 2YSSB 5MI0C 3U0TB 4EUPA 3IYLW 5B8CA 4YIQB 4MJ6B 2NLJA 4XMPL 4OF6A 2E8YA 3UDWA 2Z93B 5T3XL 1RJCA 5CSGA 5HI4D 1W0WA 1VADA 4M5YH 3MLTA 5C2BL 3E8UH 3K0WA 1FORH 1I9RL 3PNWA 1RV6X 3IB4A 3QHTC 4I8DA 2NR6C 2R2EA 1IEBB 3OJDA 3B4NA 2NY3D 3HC0A 1TXKA 3GSRA 4G5ZL 1M7DA 4JB9L 3EKCA 1JFQL 1SJVA 4HT1L 3F8UB 1QBAA 4ZUWB 2YPVH 4QRPD 2DM3A 2PW2A 2FB4L 2QQKH 1OD7A 2WIMA 4JRXB 5I8OL 3RL1A 2FO4A 4HWZB 3ULVD 3LEVH 3TWCH 4JQVC 4HIXL 1VKXB 2XQBL 4LVNB 3V6FA 3LD8B 5C08B 3SGEH 5IROA 1SY6L 5C0AA 4EZMA 3H42H 1CD1A 1CLOL 3MSPA 2P5WA 1A64A 3MV7A 4U3HA 1FIGH 3C5ZB 2DLFL 3P9MA 3FT2B 2NY1B 1S9YB 3GI8L 1A9BB 4UTAH 1JNJA 2EDLA 1RZKH 4NNXB 1CG9B 1OAZH 1DCLA 1ZK9A 1BPVA 2YA0A 3NABL 4HLZH 3RX5A 3FOLA 5F1NA 4GH7B 5J0BA 4MS8C 4RGNC 1AKJB 1VPOL 4UDTB 4HK3N 1CLYL 3IJYB 4P49A 4Y4KB 3RTQD 1UA6L 3HG1B 3O9WC 3LHPL 4I5BA 2DL9A 2QHRH 5GGVY 3C2SA 4DZBA 2BOBB 3U4BL 1GIGH 2VLKB 1UC6A 2BHUA 4URTB 1VFOA 4EOWH 4P9HH 2LU7A 2VKXA 3H3BC 2YK1H 4FFWD 3LDBC 4HUXB 4V1DE 3OR7B 1JV5A 2AJXL 4P2QB 1A6AB 3VCLB 4FQCL 3T08A 5MEQB 5HVGB 3AMLA 2F53D 4KK5C 3ILPA 2VXUL 1OAXL 1CBVH 3L3HB 3LRHA 1BOGA 1R24B 2AEQH 3EOAA 3VFGH 1NQBA 2WK2A 3WIIL 3FB6B 2X70B 1RUPL 5EUOE 5EOQH 4U1JA 3PG2A 5EUOF 4NWTH 1KIRA 2E5EA 4XBPB 4UQ2A 4OFVA 1S9VA 4YH6A 1DQDL 4JQIH 4QY8B 3P11L 2HVJB 1JI1A 5C0FA 1JPTL 4NSKB 5JIHA 4RMQA 1TVBB 3BPNC 4N0YL 3WS6C 1X44A 3ISWA 2C1OB 5BO1H 2FATH 3OZ9L 4XCCH 3BH8B 4ZS6D 3AS2A 3S98A 2WWKT 2VOTA 5F3HA 4MMZC 2P45B 1MLCB 1GXEA 4XNUL 5DQJA 2XWTB 3SKJH 3T0XA 2CO7B 4L3AA 1NAMA 4LEXH 5LBSH 3RWEB 1J0ZA 3GSXB 4LLUA 2R23B 4JQVA 1QSEA 3KWWA 5MP6H 2WWKO 2D9QB 4KVNL 5JORB 4JANA 4ESKA 3LKRB 1RULL 2A0LD 1IGTB 4OQTL 1VEMA 1NC4B 3D0VB 2XKNB 3BI9X 4HC1L 2XNAB 3ZTJH 2R0LH 1ZVSB 1F42A 3OKEB 35C8H 5D2NC 1T1YB 4JPWH 5JR1L 2J1KA 5T1LD 4LCIL 5HY9B 1JZ2A 2EC8A 2ZUSA 3UTTB 3FJTA 5I6XB 1U91A 5JQ6H 4CRPA 2IGFL 3O4LE 5C09B 5KZCD 4X7EC 1JK8A 3BKCL 5DJXA 1NCDH 3WJLC 1RZJH 5BV7B 3L9RB 4H0IA 3HLAB 4NUGH 4GKSA 3ZT5A 4N8VA 3T65B 5CD3B 2X4QA 3RDTC 3LMJH 3D69A 3U7WL 1KJMA 1FLTX 1WIPA 5GS2H 1C16B 4APQD 3OHXA 4M7LH 3ARBB 4GBXB 1BBDH 4G6AD 4I0CC 3KYMA 4XNMB 1FHGA 3BKYH 3DBXB 4K71C 1INDH 3QG7L 2ARJB 1X5ZA 1I8LC 4PJ5D 9CGTA 4O2CA 3TA3C 4FQXB 1MFBH 3JV4B 3A6BH 4KQ3H 1MCIA 1J1OL 5I15L 4DGIH 1B0RA 4XAKD 5JDJA 4M5YL 1BOYA 1U3ZA 5CZXD 1H3UA 1BVLA 3E8UL 1FORL 2HFEB 4Y4HD 1T20B 3WFEH 5HYJB 3RWHB 4UT7L 2WBKA 5F9WC 1HSAB 3VXUB 1KIPA 3TO4D 2CIIB 1BF8A 1PSKL 2HT4D 3N06B 3QJHB 2YPLD 4NQCE 3WS6A 5EZJB 3QO1A 1QFWM 2DAVA 4HXBL 2QQKL 1BD2D 1R0AH 2NX5A 4FNLH 2YEZB 3KPSD 3MA9H 3WNPA 4H25A 4YXLL 3PGCB 4KRLB 4E0RB 1UZ6E 3LEVL 3TWCL 3HI5H 1UZ6F 1OSZA 4KK8D 1NAKH 4LPCA 2DYPA 4RRPA 4P3CH 3WHE1 3IXTB 4EIGB 4E42B 3DX8B 2I5YH 1JZ7A 3O6FC 3DI3B 3QDGD 3K2MC 1UB6A 2DWDA 1RZKL 5IFJB 5HHNA 4LLQB 3LCYA 1OAZL 4EVNB 3GMPA 1P7QD 3G5YB 4HG4J 2PTTB 5IW6A 3ZLQC 4ZFOA 2FECL 3DUUB 4FZ8L 1R5VB 5D2NA 3KYOB 4JRXE 1P9MC 4XNXH 5EUOA 1PJ9A 3FO0L 4YHZH 1L9MA 4J8RB 4Y4FB 5C08E 2W60B 1PBYA 1XIWD 3WJLA 1RD6A 5LGJB 1X5KA 3QO0A 1OB1A 4KUCF 2MOVA 4P57A 5HI5D 1KGCE 4UDUB 4EOWL 5BZWB 4DEPC 1EAPB 3CH8A 2PYFB 4A6YL 2X9YA 3GZKA 3T3ME 3WFZA 1WBXA 1VGEH 2OMBA 5J11C 3T3MF 4X7TB 3BWAA 1GAFH 3CPLB 4GSDH 1N3NA 1LEGB 1P4IH 1CBVL 2QLVB 4HG4K 4TTGA 5TQ2H 3U79A 3HS0B 4JN1L 1WZKA 3LQZA 4KDVA 1I8LA 2EE9A 4HS3B 1FFPA 1LE5B 3VMPA 4HUUB 2DBLH 2JIXD 2NXYD 3KXFD 3HG1E 1RJZB 4ZYKA 3GUTA 3KPLA 2DQFA 2EDQA 2D2OA 1XMWA 2BNQA 4FZEH 4BFIB 2VXQL 2HJFA 1HIMH 5I1EL 4KKBD 2Z8RA 4J4PD 4P5TD 4XPFL 2Z9TA 3TPKA 3QH3B 2PXYB 3TH4T 3ZKXC 5FIEA 2QR0B 2FATL 1RUKL 3KDMB 4XCCL 5DVMA 1KC5H 4P2QE 4NM4H 3CUPA 3DX6A 4QRRA 1DQQB 5L0QB 4AH2A 3O4LA 4EQ2A 2RCSH 1MREL 1MLBA 3F12B 3VMNA 3X12B 4I18C 4PLKC 3CSBA 3QJFA 4LEXL 5FUOH 1OP5K 4PB9H 3B6SB 2Q76B 1HHHB 3LV3B 5IFHL 5EOCJ 1NBQA 1YEEH 1QEWA 1CXKA 2E9WA 5C71A 4WHYH 1Z5LA 1JZ8A 3O6FA 3MRBB 5GS3A 4P4RB 2GJ6B 2J6EH 4NZJA 1T04B 1T1WA 3S35H 2QADD 1F2QA 35C8L 5L8LB 4JPWL 4CW1B 1HCVA 3GB7A 4Y5XB 4JZOA 1EGJA 4Y4KC 1AFVL 3V5DB 5JQ6L 4LSDA 5I75B 2VB5A 2R1XB 4NFBA 5DJ0A 1P9MA 2Z91B 4IOFC 3UROR 4HJ0D 1CL7H 3Q5YA 4NUGL 4YHLH 3VRJA 4HGMA 3SCMD 1YEKH 3BZFA 4ZODA 2K9UA 1H5BB 1MCCA 4PG9B 5D1QC 1N8ZA 5IBUB 3VXOB 1ZWIB 1BBDL 1FV1A 2GI7A 5IKCB 1IAOA 4JFXA 2R4RL 1M71A 3IF1A 3BKYL 5AAMA 4QEGA 4ZFFB 3QZWG 4P4KD 3U0TA 3S88H 4JPVH 1S8DA 4YIQA 5KVGL 2PO6B 3A6BL 4KQ3L 5C09E 4NJAH 4PP1C 5CMAB 1W72H 3VGAC 4X4ZA 5T1KB 2ZZUT 5CUSH 3WNMA 3T0DA 4OD3H 3WFEL 3B5TA 2H32A 4PRDB 4XCYA 4QHMB 1QKZL 1XF5B 5F89B 4X5WA 3LB6D 5DO2D 5EUKB 1T1ZA 4TSCH 1AD0A 2NY6D 4FNLL 4JRXA 5GGTL 3MA9L