5C8JA

A yidc-like protein in the archaeal plasma membrane
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
229
structure length
229
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFNFSSSSIHWVRQAPGKGLEWVASISPSYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGIWSYWYMVYPHDNYGMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody fragment, heavy chain
publication title A YidC-like Protein in the Archaeal Plasma Membrane.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 43
structure length 229
sequence length 229
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c8jA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c8jA01
4O51B 5HHQB 1CZ8L 1G0XA 3MX0A 5EC1A 2Z91B 2HJKB 4GRLB 3IXAA 3QWRD 3SE8L 1F45A 4GRLD 5T5NG 1I9IL 2Y4SA 4PV8B 4Z76B 4UUJA 4CMMA 1QBLH 4QXTB 2GW5A 4WDIB 3BYTA 4CJ0A 1S9XA 4LCUA 4ZFFB 3LS5L 2AJZB 1XGTA 2AJVH 1X5IA 3SO5A 3V7AG 1QRNA 4DKFL 2IBZY 2AI0L 1RU9H 4LEXH 3C08L 3R1GL 1LMKA 1U8MB 4IOFC 4OZIE 1E4WH 4KRLB 4M43H 3KPSA 2Z92B 5I6XC 2IAND 2ICWA 5CINH 2HMID 5I71C 1IC1A 3T04D 2I5YH 2VLLA 4M1CC 4ZODA 5E5RB 1ZHKB 1BOGB 3D25A 2Y7QA 3T0AA 3MR9A 3GMMA 3OKDB 3L5WB 1C5DA 3H7BA 1T0NA 2YD7A 2R23A 3MRLB 1WGOA 3GDBA 3VE0B 1EVUA 5EU3B 1GH7A 1MHHB 3PJSB 2EDQA 4Y4KB 3TYFA 1VFMA 1AP2B 4LSUH 2NW3A 4I3RL 4Y4KD 4NN7B 2RCSL 3FMGL 3N1FC 4IJ3B 3NIDE 5I15L 2D0FA 5LGHH 2R1WA 3VFNB 1PYWA 3QFDB 5E0QA 1G7JA 5F1IB 3UBXI 5LG1A 5BRZA 3D3VE 4GQPH 3LQAC 4WUUA 1JK8B 2W60A 4R26H 2GJ6B 2C3HA 4MA1B 3MLWH 2DL2A 2GJ6D 3KYKH 1QSFA 2P4AB 1VFOA 4PYGA 4XPHH 4ZO9A 4FHBD 3UPRA 3CFBB 5I8CA 1QTYT 3HNTL 1BX2A 3OF6A 5T1DH 2YXMA 4K8RH 4LLMA 1U3JA 5IMOB 4U3CA 4WTXA 4FQ2H 3MJ7B 4N0CC 4ODVL 4PGCA 2CK0H 5T3XH 3VRLE 5IT2L 3HZMB 2UWEE 1MUJA 1XGRB 3X14B 3DUHA 1T66D 1KXQE 1DN0B 2EEDA 3GMQA 5LGJA 4LASH 1NMAL 2VQ1B 1S7UB 3L95A 1JGEB 1G9NH 5LQBH 4Y4FC 3L5HA 4HV8B 2ZJSH 3C5SB 3IU4H 1DQDH 2GT9A 3NCEB 4I77L 2YUXA 1TMCB 1A1NB 1QQDA 2PUQT 2QJDA 4E0RA 5HD8C 1D9KB 1KYOJ 5J1SC 2W92A 2A6DB 1D9KD 4GG6B 1Q1JH 3M8OL 5A40E 2FGWH 4KVCL 5MEQB 3CLFL 4DCQA 5DZLA 3VXRA 4DKEH 5CEZD 3K81A 1UWGL 4MA3B 5J8OA 4Y1AD 1NFIA 1HH6B 4WFGE 2PO6B 3T0EB 2AXJA 5ITBL 2UZXB 5IK3A 4GG6F 1IAIL 3RPIA 1INEL 2P46B 1U95A 4MAUL 2ZCKH 4AENB 3L3DB 5E8NA 1XH3B 1I1AC 1AFVH 5BQ7A 4RZCB 2A9NH 1C1EL 1WVZA 3I6GA 2A77L 5E2UH 3TCLA 5ESVA 2HLFC 4TVPH 5CS7A 3MRPB 2WIIB 4B7IA 2YPVH 5JW4N 2D0HA 3FB5B 1DVFC 3LKOA 4FQQB 1NUDA 5DUML 1ORQB 3E8UL 15C8H 2KZ1B 3KYMA 5A2FA 1HHGA 1IGMH 4LU5L 4PJGB 3RWHB 5I1IL 4QRSA 5FUCC 4QWWC 4P2OC 4Q0XL 5FO8B 5C6TH 4JQVC 4C58B 5ILTH 1JZ3A 4LLVA 3U9PH 1HXYB 1HQRA 4PJGF 1HINL 2BY3A 2PYFA 4APQD 3VXME 2H26B 1X3DA 3JTTB 3MRMB 1JFQH 3RY5A 4RAUA 4RGOH 2KPNA 2ZUWA 1KJVB 4HJJL 1CXIA 3O8XB 3PNWB 1UCBH 2JK5A 3O8XD 4HJGA 4CL7A 1GPOL 4WJ5A 3LKQA 4BJLA 4J12A 5J56B 1GGIL 3FQUA 1NCNA 3GM8A 3SJVD 5LCVH 4BFBD 3ZKQD 5D7SH 4W4OC 4TVPE 2WLYA 1CGUA 3T3PF 3SGEH 3V6FB 5CGTA 4Z7NF 1NGPH 1JZ6A 3BQUA 5CSZA 5FCUL 2PTUA 5C07B 3HE7C 2GI7A 5KTEL 4ZXBA 1Q94A 1AGEB 3WFEH 3WYRA 1B6DA 5C07D 1WC7A 1G9EA 2GFBB 3L7EB 5C1MB 4XAWL 4GSDH 3P4MA 1BQLL 5C0AA 5GRYA 1P7QB 4M1GL 4JFFE 5EA0H 4R0LC 4OQTL 5FYJD 1P7QD 1DQQA 4PJ8A 3EGSA 2C5DC 2IFGA 5IHUH 5F7MC 1HHIA 1U8KB 1OGTB 2D7MA 2VABA 5GGUA 4K8RC 3D18A 4C57C 4Z77A 3SGDI 4YR6B 5HHNB 2FX8L 1RHFA 1K85A 3QB7C 4GLRI 2Q20A 4PRNB 1KIPA 1J10A 3LEXA 5KSBE 4LNRB 5IJKA 1GC1H 2XTJB 1Q9WB 1ZOXA 3EFFA 3NA4A 5F7FA 5CD5D 5GXBB 1MFEL 2XTJD 1UJ3B 1BIIB 4L5FL 3NIGF 5EORL 3VRJA 2ADJA 3OJ2C 3ALPA 1TJHL 3SGJA 3ULUD 3MC0A 2R2HB 3UPAA 3AB0B 3HR5A 2HFGL 2JTDA 5DJAA 3F62A 4BSWB 3PDDA 3ZKXC 3HUJE 3IRPX 3UTTE 3U6RB 1G9NC 6FABH 1MVUB 4WO4D 1WWWX 2E7HA 2NCMA 3H9ZA 4FZEL 1PY4A 3T4YB 3MTRA 2HT4C 3CSGA 1QR1A 1FZMA 2BJML 4Z7WF 3SDDC 2QHLA 2X42A 3QUYC 3BPCA 4MNQA 4UTAH 2FSEB 5T1MB 1UKQA 2R0ZH 3CMOH 2P5WB 1DEDA 4NQDE 3DX8A 4TUOB 3CUPB 3HMXH 3VFTA 3WD5L 1CE1L 3WNKA 1H5BA 4L8SC 4X4YA 2EYRA 1SJEA 3CLEL 3S36X 1BWMA 1QFWM 3IDXH 5GZOD 4K07A 5D7LA 4X9IA 4MJ6A 3TIEB 3LPGA 2DYPA 2OR9L 4N90E 2IPTH 4ENED 4PRHE 1A3RL 4HWBA 4LK4A 3K46A 5D1XA 4A6YH 2QHRH 3BD4A 1UGNA 4M1DH 4ONHB 5L88L 4QRPB 2BY1A 3Q6FA 4PP2B 5DI8A 1M7DA 1HWGB 1BP3B 1FFOA 1PEZA 3S4SG 4G8IB 3I2CH 3DGCR 4PJHA 4TNWF 1FFNA 3WJJC 4JGUA 3CSYA 4ZUVB 2HH0L 2YPKA 3D9AL 1FG2B 4IOIB 5LWYH 3RWFB 2XZCL 1MREL 3MRJA 5GRZA 4CGTA 3F5WA 2VLKA 3RP1A 4PLJC 1OGAB 3PL6A 2I26N 1H3WM 4HPYL 3X3GL 2CLVA 3VFRA 2YPLB 4KTEH 5GGVH 1ZLWK 1JYVA 2ZKHL 3NPSC 3OX8B 1JZ8A 5DS8B 4BQ8A 2YPLD 4UDUB 3LY6A 4G6AC 2YUZA 4QHNA 1MHPL 4PRIA 1UQSA 1AQKL 4OF8A 4P2RA 5DJCB 1P6FA 3G5YB 1ONQB 4BK4A 4MB4A 1ZGLB 1WUNT 1QFUL 5IW3A 5GGTH 3L1OH 5EOTA 2FJGB 5GS0D 5J6GB 4LEOB 1E4XL 3J7HA 4KVNL 1NEZA 4OLYH 3PQYB 2VQTA 2W65A 4MX7A 1A3QA 4N9GB 1U3YA 2IAMB 2J5LC 4D0DB 3PQYD 1Y6MR 1BAFH 1EZVX 1KNOB 3MLZL 4ONFH 2IAMD 1S8DA 3IXTA 3QEQE 4IRJA 1E28A 2VZ1A 5IIEB 4RFEB 2GJJA 2L0DA 4Z8FL 4MWFB 4I3SL 3GB7B 4TULL 4CNIB 3C5JA 5J12C 1HHJB 2X4PA 4NO3B 3T65A 1LEIA 3F7RA 2F19H 3N85H 2D4FA 4I3GA 4WTWA 3RZCA 4J3WA 5KANG 4PRPA 4BK5A 5A3IC 4H0HB 3LMJL 1CGWA 4FQPA 1ORSA 4X6EB 2IJ0C 3LSOB 4QHLB 1XGYH 1AD0B 5ACMA 1GC1C 3ARPA 2AK4E 4JB9H 3L5XL 3BN9C 5FYKH 1ZEAL 2G60L 3WCYA 3I9GL 1V7NL 1I4FA 3FO2A 4I0PA 4LBEB 4UTBL 4DK3A 4E41A 4CBPA 1ZLUK 3VG9B 5JO5B 5EPMA 3V6OA 1QLFA 3VMNA 1A47A 3ZMRA 3QDJA 3WN5B 4XH2A 3IDYB 3QIBA 3WHXA 3F7VA 4X6FB 3RIFK 3IFOB 1CE6A 2SEBB 3H9SA 4OZIB 1TIUA 1BIHA 4GMSL 2H2PD 5DF0A 3I75B 3STLA 4KGLA 1MFBL 3MACH 4FQLH 3UCRA 1RI8A 2ARWA 5HD8D 3WEXB 3V0AC 2A83A 2Z0BA 1AIFB 1XZ0B 5F7EH 1A7RH 4K7PL 5FK9A 4ZYKA 2Z35B 4FNLL 1VGEL 5T1KD 3QEHA 3QCVL 1RZFH 4NJ9L 4OGXH 3RWEB 1EO8H 5FO9A 5IMLA 4K3EH 4J3SA 5IW1B 1PJ9A 3GSXB 5TH2B 1DTUA 4R90H 2ITCA 3SKUD 3F58H 2MSPA 4JFEA 4HDIB 1H3VA 1I1AD 4YEFA 1JF6A 3NCYP 4CDGC 2Z93B 1DBMH 2JIXA 5I76A 1ZXQA 3VDCA 1CXHA 3E3QC 4TNWK 1JZ2A 1EGJH 1HKFA 3AU1B 1JMXA 4U1GC 4P3CL 1I1FB 1I3RB 1B88A 3D3VB 2NR6D 3QUXC 2F58L 3MCG1 4KK8C 5CGYC 4CMHB 4YNYA 2O5YL 4NSKA 3D3VD 1EEZB 2X7LA 4XP6H 4JFOB 4LKCA 3QULA 2NY5L 3D87B 5IV2B 2AQ3A 4NUJA 3IGAB 2NTFA 3IFNH 4M02A 2ZSWA 4F37F 2CK2A 3ZTJG 2WANA 3WUWG 1G0DA 2MKWA 4B5EA 3V4VH 4V1DA 4N8VA 5DT1H 1XCQA 3DVGB 3CVHH 3BZEA 1DBKH 4P4RA 3OJVC 1HCFX 3ULVL 5DD1L 5DHXB 5TF1L 4Y5YC 4PG9A 3QZWB 3BPOB 1A3LL 5HVHB 4RGNE 5FDWA 2X4RB 4AEIH 4OV5A 1OTTC 5H94B 4B53A 1PKQB 1VENA 3QA3A 4NZUL 3WMSA 3C6LD 4Q74A 1BLNA 1S7TA 5GJSL 3KPOA 5E56A 4XP4L 5HGDA 4PY8J 3CGTA 3MLYH 1IJ9A 3MNWB 4NC2B 4JY4B 5DTFA 2G75B 3VRLF 4BFEA 3MPCA 5ALCH 5EO0B 1II4E 4HC1H 1NGYB 2IH1A 4W70A 3THMH 1P1ZB 3HCVA 1EFXA 5TDNB 1KJ2L 1HYSC 4OBRA 5F89A 3OKKA 3L3KA 1I7RB 2VE6A 4KGJA 4OLXH 3TZVB 3TZVD 5I1CH 1YEFH 5DQDL 4XNXL 5ETUB 2XZQH 4LHUB 4NZTL 3T0DA 4P48A 3MROA 4LHUD 4WFGD 4G8EB 1UZ8B 3WHE1 4MYWB 1CBVL 4GJTB 3FN0H 4GW1A 3O4OC 4LCWA 1XR9B 4UINH 5C0FB 1OD7A 4J8RB 3WSQL 2BRRL 1G9MH 1FAKT 5K9OB 1SM3H 4OSUH 4QHKJ 5TFSL 4NBXB 4LPCA 3RBGA 3NH7L 3NACH 1D5IL 3QUZA 3UBXA 1I1RA 5F7LB 2XWTB 5BZDA 4UZGA 2WBKA 3UYRH 4OTXH 1G6RB 1NKRA 4LIQL 4XPAL 3HZYA 4NNYA 3SDDD 1IBGL 5GRUL 5TE4L 1N59A 4AG4H 2GKIA 1RFDH 4ELMB 1OWWA 2BX5A 1MCJA 5KW9H 1S7SB 1R5VA 1CDGA 3MUGB 5INCB 2VDKH 3VXMD 1Q9LA 2OMNA 1XF2B 4YDLC 1RJZB 1TVHB 3CK0L 1CICB 4ELMF 1EBPA 4M7KH 4LPUA 1WSST 4NCC2 3FB6B 5DEZA 1CICD 2X4UB 1CWVA 3O3AB 1QFWH 5EH1A 2BVYA 1FG9C 4WCYL 3CVIH 5J13C 1I1YB 4D8PB 1JUFB 4R97C 1D5BA 2J6EL 1A6TA 3BH8A 3RY6A 3FZUD 4TVPD 5HYQB 1OD9A 5EZOL 4O4YL 2XZAH 3Q1SL 3SKNB 5J6HA 5DYOB 1XEDA 3BFOA 3EYOA 1VEOA 4YHYB 2A9MH 5ANME 4F37K 2NY3C 2FO4A 3FCTA 4FFZL 2F9BT 4JFFB 4PJBA 3VI3F 2X44D 3OJDB 2NY4B 5JA8B 3REWA 4KROC 4YHIA 2NY4D 4UOJA 1I8LA 5IB4B 3LZFL 3WFCH 3PIQB 4GBXB 1ZGLP 1A4KB 5ABDE 1HSBA 1QSVA 3MLSH 1GGCL 2NXZB 1MRCL 4GBXD 3A67H 1BEYH 2NXZD 1R3KB 4S1QL 5JPNA 2FJHA 4Q9RL 1BGXL 3D85B 5KSBB 2Q8BH 3D85D 1CLCA 4ZD3L 2C1OA 2HFTA 3B43A 3DX7B 4NUGH 2F74B 2XQYG 5DMGC 1RPQA 1HCVA 1MCEA 2HT3C 4G6ML 4JY6A 4GS7C 4F7EB 4UV4H 5TDPB 4EDXA 1UM6H 3OZ9H 3VJ6B 4NQEE 3V6ZA 5TQ2L 3BI9X 2CGRH 1M7IB 3HUJB 3QAZB 3ZTJH 5A16B 3UTTB 3FO9A 4U6HB 1XF1A 3SBWC 2YOCA 3UTTD 3MV9E 3ZYJA 5T3ZE 3NTCL 4JQIL 5CHNA 5EIIB 1QFPA 4ISVB 4JO1H 3HZKB 2YS4A 1HH9A 2JJUA 3JSSA 1EAPA 1T22B 4NQDB 5GZNC 4K23H 3WFHB 1DQLH 4NQDD 5I8OH 3O2DL 1NDMB 1OAZL 3GJFB 3RKDD 1N2RA 5C86A 2JELH 3QDAA 1DL7L 4OFYD 4I4WB 3O3BA 3T4AB 2VR9A 4YIQA 5GIRA 3SDAA 4HHAA 4PRHB 4DZ8B 3V5KB 2APXA 4UQ2B 2IPKB 3QEGL 4N90D 3HPLA 4HFWA 3HZVA 4PRHD 3TVMC 4MSWB 3QG6A 4JPWH 2QQLH 3DHMA 2OZ4A 3VU2A 3H42H 4GUPB 4K55A 4KTDH 2CDFA 4XCCH 1CXKA 3MRRB 4K2UH 1G9MC 3TGXA 4TSCH 4XX1G 3K2UH 3ARQA 2FHBA 3FT4B 4LSVH 1O7VA 4YHNB 5H2BA 3V4PL 2ITDB 4K7FB 5F1OB 4XC3H 3P77B 4YGVB 2F5BL 5E2VL 1X5KA 2WW8A 4M8QB 4U1LB 3W9DA 4L8DB 2WZPD 1N7MH 1UVQB 2EO9A 4F9LC 3OKMA 3U0PA 5C0GB 5I16B 1HDMB 4OZHA 3ESVF 3ULUL 5DRXB 4KZEH 4RAHA 2HTKD 4UILL 5DZNA 2AGJL 4QLRA 3TBWA 2AJ3B 3NCYS 3PG2A 4RRPG 1Z0MA 5KG9B 2P24A 5AG9A 4ZQKB 4Z95H 4HWEH 5C0CA 1ZHNB 1MI5A 3QQ4B 4EI6A 1KB5H 2DQFB 3UJTH 3DV4B 3W0WE 2VLRE 1S7XA 2V17H 1KN4H 3RWIB 4L3AA 4HAGA 1NGZA 1YEJH 1D6VL 4MNGE 4OB5L 4GAJH 1I1CA 3TA3D 2PW1A 3TBSA 3S35X 2J8UE 3BXNA 2F54A 3QEQB 3QWQB 3U30B 2PXYA 4MXVE 5IQ9A 3QEQD 2BCKA 2VL4A 2AQ1A 1R3HA 4PJDA 5FYLL 4FMFA 4YE4L 3IT8D 3DURB 2C3VB 3GRWH 5CZKA 1CDBA 2IBZX 2V9TA 4I18B 4NQXA 2JJTC 1Y18B 4GG8A 4P46A 3P3YA 4YFEA 4RCAA 3P0YH 4XBPA 4YDVB 1AXTH 2P42B 3B9DA 4KJQD 3ZYZA 1EJOH 5FHBH 3VWKC 5JR1H 4XNZC 2OK0L 1S9VB 4S1DC 1RMFL 2AK4B 3S37H 3OPZL 2R4RL 4HKBA 2AK4D 2ZNXA 4TOYL 5IM7A 1P9MC 1OQXA 4JRXA 3FQNB 2NZ9C 5H37H 2VISB 1KYOK 2W0FA 1UT9A 3WS6A 2YD9A 4NN5B 2WWMD 4P4KA 1TNNA 4M7LT 1WT5A 1G7MB 1FHGA 3QXTA 3ROOA 3MRCA 3O4LA 1UJTA 4L3CB 1MFDH 1W0WB 1MAMH 1GAFL 1JPST 1T1ZA 4ZNEE 3BE1H 2F5AL 1MHCA 1F2QA 3VD3A 4JPVH 4HMCA 2VRAA 3CFCH 5MHSE 3ARDC 5ECJE 5LGKA 2Y06H 4TSAH 2EIDA 5FA3B 5HHQA 2WQRA 4LP4A 3QWRA 4EJ1C 3I02B 1MCLA 4R4BA 2Z91A 4GRLA 2DDQH 2VZ3A 4JDTL 3IETB 3GJFK 3D39E 4YX2H 3UAJC 3OGCB 4OUUB 4PV8A 4Z76A 2FJFB 4M93C 1D3CA 4QXTA 2FX9H 4WDIA 4NC1E 4N8CH 2YZ1A 4ZFFA 1J1OL 2AJZA 4KJPD 1F90L 1CD8A 3CH8A 4JDZB 3F7PC 5EU6E 2VIRB 1SY6A 1JTPA 1RZGB 1EIBA 2XG4A 1U8MA 4YWGH 3AS1A 4M7ZB 2CRYA 1FGNL 3MYJB 4KRMB 2EE2A 4JN1L 4Y16C 3ZDZE 4HGWB 5E94B 3FOMB 3PGFL 1ERNA 1QYGH 3TPKA 1AR1C 5L0QB 4S1RL 4Z7UA 4IIQC 1S7VB 4PJCE 1FNSL 4PTTB 1A7NH 4U7MA 1KT2B 4Q9QH 3HC3H 1ZHKA 2BSTA 3LH2H 3ZKND 1BOGA 2HFEA 3IF1B 3WLBB 3UTQB 5MP6L 1NFKA 3L5WA 1UXWB 4AMKH 1KJ2A 3MRLA 4UT9H 5JUEH 1XCTA 2IBGA 2XY2A 3VE0A 3DV6B 3WNMA 2APTA 1MHHA 4Y4KA 1GOFA 4ZSOE 1AP2A 3VXTA 1ZLVK 1HXMB 4OM0L 3SHSA 2EIZB 4RGNB 2EDBA 3FFCD 5DD5L 4LFHG 3L3JB 4HPOH 3EOTL 2LTQC 4YHMH 3BDXA 1UWXH 5DJZB 1IVLA 3QFDA 5F1IA 2EXWC 4OZ4A 1MWAL 3DO7B 3VFUA 5BS0E 5JW4M 4C59B 2EXYD 4JE4B 4EZMA 1KENL 5JQHC 1RIHL 4NFCA 1OAQL 2H2SD 1CFQB 2GJ6A 2IBBA 3PABA 2VO5A 1F4YL 2VXVH 3KLAA 3O6KH 4IMKA 5F96L 1ACYL 4X5LA 1JRHI 4EN3C 1W0YT 3MV7B 1KELH 3CFBA 1YMME 4KTYA 5ESQB 4JM4H 2B2XL 1CL7H 4OCLC 2QEJA 4S1SL 2V9RA 3MLVH 1B4RA 3MBEB 5CD3B 4RFNB 4Y2DC 4YPJA 3MJ7A 3EUUA 2BVOB 3MBED 1U93B 2QTEA 1KJMB 4KK9D 3VCLB 4GAGH 3S4SB 2AJVL 3HZMA 2BVTA 4PUBH 4ZAKD 1QKZH 5JPMB 4PV9B 3SO3C 1RU9L 4Q6IC 2Y5EA 3VXSE 4LKXB 2V5SA 3ULVF 4KRPC 4M43L 2JJWA 4K94H 4QT5B 2B8OT 1DR9A 2VQ1A 1S7UA 4KKLD 1LP9F 4ZOBA 3UYPA 5CINL 5KSAB 1IGIL 5E24E 4HV8A 1ADQH 3C5ZB 5KSAD 5DGQA 4UMGA 5DQJA 2R0KH 2I5YL 3QH3B 4JAMA 1U3HC 1CXLA 4RQQB 3V0VB 1D9KA 4G3YH 1PVHA 3TCXA 1IM9D 2A6DA 4AEHH 4M6MH 4M5YH 3U2SB 4PJ7E 3DGGB 3RL1B 5HYEA 4LSUL 5JOPE 3WXWH 5L8LB 2VDPL 4NWTH 5CJQH 2AJXL 4PRDA 4LLYB 3RWDB 4BYHA 5ESAB 5E2JA 1HSAB 4AENA 3L3DA 3ZT5A 1WV7T 5LGHL 1P7KB 3U46B 3H0TB 4NO2A 4P5TB 1TPXB 4WHCA 1KACB 2AV1B 4Y5VC 3ILQC 3K3QA 4NBZB 2YKLH 3G5XA 2WIIA 3TVMD 4R26L 2VITA 1UZ6F 4W6YB 3BSZH 3MSPA 3CC5B 4FQQA 2XKNB 1IGTB 2XT1B 3MLWL 1XGPB 1ORQA 2W1NA 3PDOB 1KFAH 4QEGA 3D0LB 3KYKL 5D2LF 3RWHA 1JGVH 5E8PB 5IGXL 3JV0A 5AUMB 4K71C 4YUEH 5FO8A 4K8RL 1CFSA 3KJ4C 1RK0B 1HXYA 5ANMB 4YXHH 2E3VA 4GXUM 2DOCA 4XCEA 4UV7H 2H26A 4FQ2L 5FO7B 2CK0L 1D5XB 5T3XL 4JZJB 1KJVA 2E7LC 1YEIH 5EWIH 3O8XA 3MA7B 2GY5A 5T5FH 4C54A 1OP5H 4PJAE 2ED9A 2DKMA 2MQ3A 5BVPL 3ALXA 3SJVA 4LASL 4XBGA 1JNNL 3RWCB 2E27H 2MCG1 4UIMB 1G9NL 2KZWA 4R8WH 1DBJH 5E9DE 3IU4L 4PGBB 1DQDL 3ES6A 3V6FA 5IB3B 43CAB 1T7WA 5JIKA 5C7XL 5C07A 2BVEA 4MB5A 3BGMB 4F80A 4NQEB 3EDEA 1YEKL 2VWEE 2XFXB 1OP3H 5IEKB 3WIHH 5TDOB 4N1EA 1P4IH 4NQED 4AL8H 2EICA 2FGWL 3MV9B 1P7QA 2Y72A 4MZ3A 1RK1B 2HT2D 2EDRA 3U9UB 4FQXC 3MV9D 1HKLH 1IQWH 4DUVA 3VXQB 1BHGA 3FKUS 4IHOB 1FORH 4P57B 5T3ZD 1QLRA 1U8KA 1OGTA 4U3HA 5L2KB 3GEWB 4U6TA 1MCBA 4YR6A 5HHNA 4FTVE 3EO0B 1AFVL 2GY7B 3SE3A 1MJJB 3HB3D 2QLVB 1UXSB 2DQTH 2WLZA 1JWSB 4LNRA 5E2UL 4MD5A 1Q9WA 1ZA3B 4TVPL 5I30H 2FNBA 2VXTH 4JKMA 1UG9A 2BXYA 3BVNB 2YPVL 4XVTH 2ENSA 2EO1A 25C8H 4S1DD 1MH5B 1T83C 5BZWB 5L8KB 15C8L 4YO0B 2R2HA 1IGML 1KTDA 1YY9C 3FRPA 2KQMA 4K94C 1XF3B 4WO4A 5HGHA 4BSWA 2FWOB 5C6TL 3LEYH 4CDHA 5ILTL 1MVUA 4POZD 2PTTB 2Y5TB 4WI6A 3MGTB 3T4YA 1RUKH 4H0GA 1L7TH 2IWGA 3LN4B 4I0KA 1JFQL 3P4NB 4RGOL 1DBBL 1FVCB 5FIEA 2BVPB 2FSEA 2KBGA 3JVGC 5KVDL 2BK8A 2GAZB 4QHMB 2D7OA 3HNSH 4HLZG 4TUOA 3CUPA 1UCBL 4LVNB 5DDHB 1TITA 2LU4A 1X6NA 1FAIH 1N5YH 4MMXC 5IMMB 2XY1A 3C09B 2Z8SA 1O5DT 1N64H 5D7SL 4GKSA 2NXYB 1QACA 1NGPL 2NXYD 3UAJD 5I2IB 4ONHA 1B0RB 5IEHA 4PP2A 2E7MA 5F7YC 3X12B 3DARA 3W0WB 2VLRB 4F9PA 1L0XA 4GSDL 3LN5B 4H0IA 9CGTA 1ITBB 2VLRD 3ABZA 4FZ8H 5KAQG 5EA0L 4MNGB 1CGVA 1P4BH 4NNPH 4ZUVA 4IOIA 1FG2A 2VWEC 3RWFA 1J0IA 2I27N 3AMKA 3HG1D 1RIUH 2DWDB 5HY9A 5H35A 3DI2B 4OCWH 1WK0A 3ZE2E 2YPLA 5ICXA 2E9WA 1SYVB 5D71H 2P7TB 4JKKA 5DS8A 4LLUB 5FGCE 4UDUA 1UH2A 5CEYB 2UVEA 2KDGA 4MXVF 4P2QD 3PWPB 1JI1A 3UZVB 4OCRL 1CG9B 3JV5A 1BMGA 2QKIB 3EZJB 3VFOB 2O61B 2VDNH 1VGKA 1U92B 2J2ZA 5DJCA 4U6XB 3BD5A 4HIXH 1AKJB 2DLFH 3G5YA 3R0MA 3KHQA 2XXCB 3T2QA 3WLWD 2EDXA 1AKJD 4UOW1 4R2GB 3QNXB 4UBDC 3S3SA 5AZEH 2FJGA 3T0WA 5LXGH 1MCCA 5MERA 4G9FE 4R2GD 1FDLH 3PQYA 5GGRY 4N9GA 2IAMA 4D0DA 5E00A 4JFPB 2EXWD 4G80B 3TT3H 4XGZB 2FO1A 1KNOA 2DQGH 4OCXH 4OGYH 3TESA 4UTAL 2Y23A 5IIEA 4RFEA 2R0ZL 2I9TB 4MWFA 3WFDL 1BWWA 3HMXL 3GB7A 4CNIA 2APWA 3G6JA 1BFTA 3C8KA 4GOSA 3IDXL 5F88B 3AXLB 2IPTL 4WW2C 3UJJH 5MHSD 3GSNB 5D1ZB 5KN5B 1QPPA 3PF2A 1U41A 2H32B 4A6YL 4KMTH 5D1ZD 5B38A 4QHLA 1ZV5A 3VRIA 1AD0A 3KHOA 3S8WA 4LSPH 3D39D 3I2CL 4HUXB 2XWJB 3JUYA 5HI4D 5JO5A 4ACPA 3CXDH 3HNVH 2DI9A 4PD4K 3MFGB 5LWYL 3ZE1E 3MRNB 5EU6B 4YHPB 4X6FA 5EU6D 3IFOA 2SEBA 4YZFE 2DIJA 4OZIA 3WNOA 1BM3H 4X7CC 4KTEL 4QTIH 4Y4HB 5GGVL 1PSKL 3U0WL 4KKNA 2OQJB 1U3HD 4Y4HD 3RPKA 1AQDB 3KPQB 3WEXA 3MGOB 4PJCB 1VADB 5JMOC 4NWUL 5J9PB 4WGWB 1AIFA 1XZ0A 3ZDZF 5T1KA 2D7PA 1FE8H 1FL6B 3MMEB 1MRDH 3NCFB 3P0VH 4O5LH 5E4EB 3RWEA 1RUPH 4PJCF 5GGTL 3IDIB 1RSFA 4YBQC 3GSXA 2AJUH 5TH2A 2FH6A 4ZSOB 1NAML 4OLYL 2A73B 4HDIA 4WGVB 5HDOA 4JHWH 3O81A 2XYCA 2Z93A 3O6ML 1BAFL 3JV6B 4ONFL 1DUZA 2FLRT 3BH9B 1AXSB 1ZVHA 3KYNB 2NY2C 1MCWM 1T2JA 1WEJH 3GO1H 4IBLT 5IVZB 3QIUB 1LK3H 2YD5A 1FN4A 4HEPG 5BS0B 3D3VA 4Z7QF 3QIUD 5BS0D 1F13A 3RFZC 1MQKH 4J2XA 3GSVB 1EEZA 2L4OA 2VUYA 4WENB 4P49A 2F19L 3N85L 5IV2A 1F11B 3EFDH 1REIA 2CH8A 3IGAA 5CJ8A 3IKCB 1NCBH 4HXAH 1T3FB 4LLAA 1YMMB 4ELKB 4ALAH 1HILB 1X5GA 1FNFA 2R2EB 3WNPA 5IFJA 2F15A 4HS6B 1XGYL 1YN6B 5L8JB 4RMUA 5L7XH 2J8HA 4TYUA 2AK1H 4JB9L 3DVGA 2ORBH 1U9KA 3JTSB 1NCUA 4ZO7A 1H3GA 5LVEA 2ICEB 4OJFH 1F58H 3GGWB 2X4RA 3C6LA 1LO5B 3S98A 5HGGS 1WAAF 4EXKA 3O11B 4BSVB 2UWEA 2BY2A 3J8F7 5HDQL 3OKLB 2HG5A 3MNWA 4OLVL 1YQ2A 3VXSB 4H26B 1Z6JT 4X4ME 1E6OH 1U8OA 3VXSD 3PWLB 4UDTB 3DPBA 4Z7OF 4Z7VE 3WL9B 3CFIC 2D7QA 1NGYA 1D6EB 5KANI 4FQLL 5F8RC 1P1ZA 2GHWB 3VD4A 3DETD 2A0LC 5F7EL 3P9MB 4M6OH 5TDNA 4ODHH 1LD9B 1HI6B 5CILH 1A7RL 1OTUD 2EDLA 1RZFL 1I7RA 4FQXD 4OGXL 3H2WA 3BKMH 4PY8I 5D9SA 1EO8L 3TZVA 3O45B 4HWBH 4QXGH 1CVRA 4NRXA 1F2XK 2QR0A 2IADA 4PJ7B 5EN2A 2X6MA 5ETUA 3F58L 4LHUA 5BV7B 5ACZA 4PR5B 5JOPD 4J3OC 1DBML 5C0BE 2P8PB 1CGSH 4PJ7F 3MXVL 1KUMA 1EGJL 1DVFB 5JOFB 4L4TE 1Q8MA 1XR9A 2D7NA 4J8RA 1QLEH 1D5MB 3CH1A 5K9OA 4P2OB 2WBJB 4I0CC 1VFBB 3T8XB 3TNMB 2WBJD 5IBLC 4X99B 2XWTA 3IFNL 1FSKB 1NUFA 3MRBB 3FB8B 5E70A 3WXVH 5DJDB 1G6RA 3SDDA 3G6AA 1U8QA 3V4VL 3QIWB 4U49A 2AJSH 1OPGH 5DT1L 1IGYB 2CLZB 2Z4QB 3G6DL 1RUML 1JN6B 3BPNC 3OAZK 3PGCA 1DBKL 3R8QA 4WEBH 3VXMA 3G5VB 1MOEA 4AEIL 4YC2C 1S7SA 3CZJA 4QXUH 4R7NB 5HGBA 5HVFB 3MUGA 1J5OL 5DJ2B 1XF2A 1RJZA 2CIKB 2DMCA 1CICA 4U1IB 3QG7H 1WCBB 3MLYL 4PJAB 1G7LB 2X4UA 1NBYB 4KRNA 4L1HA 5ITFB 3O3AA 1Z0NA 5I1EL 5ERWB 5ALCL 1QBMH 4HC1L 1UENA 1I1YA 4D8PA 3THML 1JUFA 4PJAF 3C08H 5E9DB 4GRMB 5I17B 3GMPB 5HYQA 4QRTB 1YUHA 4NQTA 5E9DD 4BQCA 4PJ8C 3UBXG 5DYOA 1CT8A 1W8OA 2DB8A 5EO9A 1CDJA 3OB0H 4OLXL 2Y6SC 3OGOE 4ZFOL 3EYSL 3R06B 3L3HB 3QCTH 1QO3A 1YEFL 3TH4T 1MFAH 5GJTH 5IJKC 4LRIA 1S9YB 2XZQL 5HYFA 2EYSA 4EQ2A 1R3LB 5IB4A 3TBYA 4NBYB 2AV7B 3PIQA 4GBXA 5B3NA 1A4KA 4U31A 4GAYB 4YXKH 4F33B 5ADOH 3SGJC 3FN0L 2XWBB 4I3RH 5DFVD 3U36B 4FTVD 4JLRB 3R8BB 3D85A 5KSBA 4UINL 5A43C 1YNTA 3K4ZA 3FMGH 1FZKB 1G9ML 1LK2B 3DUSB 1SM3L 3CFJB 1U6AL 4OSUL 5HI3C 2F74A 1IGFH 4OD3H 4N0YH 2F53E 3NACL 4WY7H 2IQAB 4GRWE 4UBDD 5TDPA 2EE9A 4OLEA 2HN7A 5E99H 3EYQC 3VJ6A 5HHPB 3OAYK 3ARBB 3UYRL 4OTXL 1S5HB 4LSQH 1M7IA 3HUJA 3RDTB 3UTTA 5A16A 4U6HA 4J23A 3RDTD 4F15C 4AG4L 1UA6L 5HPMB 1RFDL 5ID0A 1H5BC 3TEUA 4AM0A 1BQSA 5KW9L 4ISVA 3HZKA 3MRDA 5DVLA 1LE9A 2IALA 3QQ3B 1T22A 3F12A 5I73B 3TBTB 4NQDA 3QPQC 3TT1H 4M7KL 4OAWB 5D1XC 3WFHA 3UTZB 1QA9B 3C8DA 4HIJB 2EDEA 1ZS8A 4HKJB 1MCHA 1BJ1H 1NDMA 4OFYA 3RJQB 4LFHD 1I3UA 2OX5A 4Y5XC 3KWWB 3T4AA 4DAGH 3CVIL 1OM3H 3SQOH 3H3KA 1A9BB 4MXWH 1J1PH 4PRHA 4OKDA 1C8PA 3P4OB 3NFNB 2IPKA 4YFDB 4F7TA 3KNBB 4MSWA 1PZUB 2XZAL 2LAAA 4GUPA 3ULSA 3MRRA 3KXFE 3HFMH 3RWJB 2A9ML 3FT4A 1IAOA 4U6VH 4I77H 3FN3A 4YHNA 5C2BH 3PV6B 4K7FA 3P77A 3IDGB 3RGVB 3BJLA 3WFCL 4U0RB 3M8OH 3MLSL 1KPUB 3RGVD 4HGMA 1AXIB 4U1LA 5GSVB 3OKEB 2VSCA 4C4KO 4L8DA 4LVOC 5J1TC 1WZKA 1UVQA 3A67L 1KLUA 3AREB 1VA9A 5ITBH 2MWCA 2Q8BL 1N5AB 4GQ9H 3ARED 5FGCB 1HEZB 5ICZA 1HDMA 43C9B 1Y6NR 3NGBC 2WUBH 1C08A 1A6AB 2A2QT 5DRXA 4PJ5E 4NUGL 3ZE2F 2DIAA 3AC0A 1RZ7L 2WWKO 5I66A 4UV4L 4X6BB 2BSSB 5KG9A 2EE3A 1PW3A 4FFWD 5EDXA 1UM6L 3OZ9L 5C0DB 1ZHNA 3QQ4A 1QD0A 4GKOA 4IRJC 4A6YA 2H3NB 1GZQB 2DQFA 3DV4A 3QCUH 5EBMB 1LNUB 2BOBB 3H3PH 3Q6GH 1KJ3H 3E8UH 3Q2CA 4G9FB 3IDMB 3HC0B 3TA3A 5I1IH 1GGUA 4G9FD 4HUMB 5J12B 1CF8H 3HC4H 4JO1L 1VPOH 3QEQA 5C9KA 5DA0B 4K3GA 1A6VH 4Z6AT 5HDLA 4K23L 1DQLL 4NM4L 2R69H 3DURA 2C3VA 5CBEB 1MFCL 4HSQA 2BC4A 1KIUA 1R6VA 2JELL 4NZDA 4F57H 1GL4B 5CWSB 4I0PC 4LSSH 1JPTL 2W9LA 1DBAH 4YDVA 5MENE 1GPOH 3SDXE 1VESA 3V6OC 3RJDA 3MXWH 1FC2D 1GGIH 4JPWL 1S9VA 4EOWH 1TZIA 3H42L 2AK4A 2VZUA 4UAOB 2NNAB 4KTDL 4XCCL 5GSRB 1X5ZA 4K2UL 1AJ7H 1ZT1A 2R9HC 3MRHB 4TSCL 3K2UL 3BO8B 4LSVL 1JHTA 1NAMA 2ADFH 3FQNA 4XC3L 2VISA 2FYYB 1P5VA 5SWZB 4LHQB 5E08H 1G7MA 3BDYH 3R0NA 4N68A 4HWZB 3SCMC 4PJEE 2JCCB 5D7KE 1G1YA 3E1F1 1N7ML 3V5HB 1W0WA 3DX9B 4G9DB 3ZE1F 2UVFA 2EC8A 3GBNL 4YK4B 1JCKA 4XI5D 1U8LA 3QXWA 1EVTC 2JCCF 3ZKMC 4WU5B 2VJXA 2GITA 1RUAH 4KZEL 3K4AA 2JB5L 4FQ1H 1Z9OA 5FA3A 4LCYA 5EZJB 4L9DA 3RNQA 4Z95L 1CI5A 2R1XB 1KPRB 3I02A 5CKGA 1KB5L 4ZUTB 4KI5C 4IRSB 4DTGH 3UJTL 2V17L 3VDBA 1KN4L 3OGCA 4OUUA 4IRSD 4QY8B 2FJFA 1W72H 4JFZH 1OHQA 1YEJL 4L4VB 4M61B 4GAJL 3JZ7A 4JDZA 3QDME 4WI5A 1J0JA 4TUJA 3RTQB 2VIRA 2ATKB 5E1HB 3VDAA 4GKZB 3RTQD 1RZGA 4M9OA 3TFKC 3MYJA 4BKLB 2HLAA 3DX6B 1HWHB 4HGWA 5E94A 3GRWL 1NGXB 4PJ9D 2YA2A 3O41B 5IBLD 2WP3T 3KPTA 7FABH 1S78C 4TTDD 1S7VA 5F3HB 4PJFF 2EZ0D 4ESKA 2ESVE 3E2HC 3P0YL 5K59F 3WLBA 1AXTL 3IF1A 1NCTA 5CLWA 4P5KA 5JR1L 1B0GB 5D1QB 3DVFA 3S37L 5D1QD 5EBGA 3QJHB 1A3RH 1CXEA 1XF5B 5FGRA 4QCIB 3PXHA 3LKPB 3FFCA 4QO1A 3BKCH 2EIZA 1MLBB 1U8HA 4F7MB 4PLOB 1A21A 3CX2A 3L3JA 4ZG1A 3QNZA 5I9QC 3KPNA 3QXVA 1VSCA 5DJZA 4KKCC 1A5FL 4Z5RB 5F9WC 3LDBC 3ZHLA 4NJAH 3DMMB 1BD2B 4P23B 4MVBC 1MFDL 2NY0B 1MAML 3GFUA 3DMMD 2XZCH 2DI7A 5HI5C 1MREH 2YRZA 3BE1L 2NY0D 4Z7VB 4N0UA 3QFJE 1YC8A 2CQVA 5ALBH 2E7BA 4M7JH 1SEBB 1AGDB 3BAEH 5JW3H 3NCMA 5JOEA 5JW4R 1Z5LB 4TSAL 1UH4A 5ESQA 4EUPB 4X7FC 3VMPA 2AXFB 2K3TA 1OF2B 3ARUA 2VNCA 2OBGA 1EPFA 2DDQL 4XPTH 4YX2L 3QQ9D 3MBEA 5CD3A 2OZ4H 1G7HB 2FX9L 1U58B 3HAEG 2BVOA 5I1HL 1U93A 1S3KH 3VCLA 4G43B 3S4SA 4ZAKA 3L7FB 5JW4Q 2OXHA 4HEME 5C0BB 3OHXB 2WAHA 5JPMA 4PV9A 1FZJA 3QUZC 3CDFA 5C0BD 2X4SB 2ZWLT 3OTTA 2BNQE 4L4TB 3DVIA 2UV3A 1CGYA 4LKXA 4YWGL 5HI3D 4MJ2A 4E5XA 4FXLA 4L4TD 4QT5A 2PW2B 3BISA 4C83B 2ED8A 5DJ8B 4KWUA 3IJSA 2IGFH 1QYGL 5KSAA 2YN3A 3C5ZA 3VI4E 4NQSB 2XN9E 3QH3A 1A7NL 1FIEA 2H6PB 4Q9QL 3HC3L 4MJIE 3ARFC 3LH2L 4RQQA 3SGDH 5I1AB 1IM9A 3FT2B 4X8XA 1A2YB 3ZSSA 4AMKL 5F1KC 4X4XB 4GLRH 3BYYA 4UT9L 5JUEL 5AYUH 4YDLB 3U2SA 3PDGA 3RL1A 3LMJH 4WHDA 2VAJA 5FDYA 1WITA 4KY1H 4LLYA 3RWDA 1KBGH 4HPOL 1HSAA 4YHML 3BUYB 3I9GH 2OR7A 4BUGA 3CD4A 1P84K 4MDIB 1EBAA 1P7KA 3U46A 4ODUB 3DIFA 1CLZH 1KN2H 3VD7A 2AV1A 2FX7L 3TVMA 3QXDA 2DMKA 3HRZB 1A8JH 2AQ2A 1QSEB 3IU3B 3Q0HA 3T3MF 2WINB 2C3WA 3CC5A 2XKNA 2R8SH 2DWEB 1XGPA 4QTHA 3O6KL 2V2WB 3PDOA 1PY9A 1JYXA 3D0LA 1SBSL 5E8PA 1I8LC 2ZZUT 1CL7L 5AUMA 4MD0B 3OG6B 3FTGB 3CFDA 4XPFH 3AAZB 1TETL 1RK0A 4XXDB 5EU4B 3TJHC 1OSPH 5ANMA 3MLVL 3Q5TA 1FYTE 4KJYB 3U79A 4MQ7B 1U8NB 3CVHB 4K3HA 1E27B 2IC2A 3GMRB 1X4YA 5ID1A 5IROA 5F9JB 4GAGL 5FO7A 3NCJL 1D5XA 5FOJA 5IWLA 5DWUH 4PUBL 1QKZL 4OCMC 5KVEH 1FIGH 4KDTA 1SHMA 2AAVA 1Q9KB 4Z78B 4GS7B 4RSVA 1NBZA 3P73B 5I74B 4UIMA 3KG5A 4HK3J 1CLOH 1ADQL 2F53B 1ZTXH 4P3CH 1KXTB 5IB3A 1T20A 4OD2B 43CAA 2F58H 3I6KB 3DJ9A 3KLHD 4NQEA 4ONOA 5I1LB 3G04A 4YBHA 4J3VA 4AEHL 4M6ML 2ICES 4OIIH 3MV9A 1CK0H 3LCYA 1RK1A 2DTMH 4LSTH 4JHBA 3VXQA 3WXWL 4IHOA 4NWTL 3S37X 2CSPA 5CJQL 2QSVA 3SDAC 3EO0A 3KS0H 1DDHB 1MJJA 3LS4L 3GSUA 1UXSA 3ZYIA 4X80H 1I8KB 1JWSA 1JNLL 1VACB 1OARH 1ZA3A 1SY6H 5B39G 5GQBA 5FA4B 1R5IB 3BSZL 5JORB 1EHNA 5BZWA 4X4ZA 2ZUQC 1KFAL 1IMHC 5IVXE 3DLQR 1P9MA 4J1UB 5CIPB 4YO0A 5B8CB 1LEGB 5K9KB 2GK0B 3B6SB 1A7OH 2FWOA 4YUEL 3KXFB 4IS6B 2W0LA 2ICWJ 4P9MH 2H8PA 2PTTA 3B8YA 4YXHL 4QRRE 2Y5TA 3KXFD 3WUWA 2ARJB 4LPYA 4PB9L 3CXHJ 1ZGLM 3TJEH 1JGLH 4WEUD 4LCCB 3SCMD 4UV7L 3LN4A 4Y19E 3BP6B 3DRTB 3P4NA 2YD1A 5C0RH 1DJSA 1FVCA 1UC6A 3P11L 1EZVY 1B2WH 5EWIL 3UDWA 4QHMA 1T80A 3BGFC 4HT1H 2V7NB 5DDHA 2P1YA 4XNXH 2ATPB 3ORJA 4AT6B 4WUKH 4XNYH 1GGYA 4OF3A 4R8WL 1CBVH 1ZKAA 1DBJL 4PJ5B 1HHKB 5EZIH 4FXKA 4PJ5D 2C1PB 3OMZA 2F8OA 3VH8B 1RY7B 2W07A 5I2IA 1LDSA 1J0KA 1B0RA 3TO2A 3MREB 1ULVA 2GUOB 4QKXB 3WHE0 3X12A 1B9ZA 2PXYC 2VLRA 4YFLF 3WIHL 4JM2C 1P4IL 2HAZA 2NY6D 3NH7H 3LN5A 3MYZA 5EBLB 1WIOA 3RBSA 4MNGA 1IQWL 3HG1A 5HGAB 2B7DT 2J8UA 4NPYB 3BPLB 3U7YH 3G9VA 1IBGH 4P46C 3QRGH 5GRUH 1D7FA 2UUDK 3EO9H 4HULB 1S78D 1SYVA 2WNGA 2DQTL 2P7TA 5DQ9A 3I3BA 2YMXH 1FVDB 4P2QA 3VWKB 4LLUA 4JPIB 5I30L 4XNZB 3QDGE 2VXTL 3CK0H 5B3JE 1IM3B 3QO1B 3MJGX 5I1DB 2QKIA 3BEVB 3VFOA 25C8L 5MENB 1BBDH 1U92A 4GT7A 4U6XA 3SDXB 3GMNB 4CU6A 1AKJA 2A6KA 5MEND 3BMVA 3ZO0A 3WS6C 4WCYH 5IMKA 4P4KC 5KS9B 1IC5H 1WT5C 3IRZA 3LEYL 5HTSA 3QNXA 3O9WB 1U8PB 3DROB 4ODXB 3SDXF 5KSUB 5EZOH 4KKCD 3Q1SH 5AZ2H 1RUKL 1M05B 4JKWA 5FF6B 1L7TL 4JFPA 2OLDA 4JFXB 4G80A 4XGZA 5CEZH 5KS9F 5AEAA 2EYTB 1G7PB 3BP5B 1KULA 3EJYC 1NMCB 4PJEB 4FFZH 2I9TA 3ARDB 3BX7C 5EOCH 2I07B 4WWKB 5D7KD 1C12B 1FAIL 1QRKA 2CPCA 2FBOJ 4A2MA 4ZNEA 1N5YL 1NJ9B 1KLGB 4WWKD 4XNMB 3VXPB 4GRLC 2IMMA 1YY8B 4PJEF 1FL5B 1GGCH 4RA0C 1N64L 2XIDA 1KC5H 5DUPL 4JREB 3ME0A 4S1QH 5D1ZA 4J3XA 5KN5A 4M93B 2X9YA 4OQ1A 3AS3A 2IG2H 3VA2C 3CCHA 4ZD3H 3UZQA 3AFLA 1HNGA 3D39A 4GMTH 4OF0A 1N3NB 2QADB 2R15A 1NQBA 4HUXA 2XWJA 2HMIC 4FZ8L 5DVNA 3U82B 2QADD 4WHTB 4NNPL 1LEKA 1ZLWH 1PD6A 3MRNA 3QDMB 5EU6A 4YHPA 4IRZL 1RIUL 2CIIB 5E5MB 4AH2B 4GG6E 5GRJH 1CTNA 3QDMD 4OCWL 1X9QA 2N7AA 1RAMA 3NTCH 4EVNB 1U3HA 4Y4HA 5DMKB 3T0EE 4JQIH 5D71L 3PGDB 3IAPA 1C5CH 3ARFD 1AQDA 3KPQA 3MGOA 3STZB 4PJCA 1VADA 1QEWB 4Y4KC 5L9DL 5TE7H 4ZS6D 3OR7B 2ESVB 2VDNL 3GJEB 4NN7C 3QWOB 4HIXL 2ESVD 1FL6A 2DLFL 1OAZH 1UADC 3ZLQC 1DL7H 5JXAH 4CVZB 3LD8B 3IDIA 1ND0A 1DEEB 5AZEL 4ZSOA 5LXGL 5JHDE 1CFNA 1FDLL 3LKSB 2A73A 4PJGE 4R6UA 4U2ZA 4I9WE 3TT3L 3JV6A 3MRQA 1JPGB 5FYJH 2P47B 2DQGL 2CLRB 3BH9A 1AXSA 4MA1C 4OCXL 4OGYL 5E8DH 3KYNA 4KI1A 2HTLD 4IMKC 3VFSB 3E6FA 5IVZA 5DO2C 3QIUA 1BVZA 4Y88A 5BS0A 4PY7A 3O6FB 1AC6A 3V4PH 3IDJB 2M1KA 3F7QA 3O6FD 3VGAB 3GSVA 3QFJB 4U6YB 3QFJD 1U8IB 3UJJL 1T3FA 1KSRA 4ELKA 4UNTA 2AXGB 4CRPA 1ZLUH 1HILA 4KMTL 2R2EA 5D7IE 1T66C 4HS6A 1TZGH 3TPUA 4OFPA 3ULUH 1YN6A 3UJIH 4CADB 3JTSA 1A1MB 2DBLH 1JWUA 4UILH 4LSPL 4FFVD 2ICEA 4Q6IB 5TGBB 3GGWA 4KRPB 3CXDL 1LO5A 3PWVA 1JNHB 3KAAA 2ZNWA 4BSVA 4OKVB 4UT7H 4XWGH 2BNQB 3GI8H 1IARB 3RRQA 3VXSA 4H26A 3VGFA 3OBAA 4MCZB 1BM3L 2BNQD 5C0JB 2CKBB 1D9KC 4UDTA 2YUWA 2X05A 3GSOA 3WL9A 3EYUH 3LVEA 4W4NA 4LDEB 2OTWB 2XN9D 4MJIB 5SX5H 3P9MA 2PO6C 5F72S 2WM0A 1LD9A 1HI6A 1H8NA 1FE8L 2DLEA 3LKRB 3PWUA 4MJID 4M7LH 1X7QB 4O5LL 3P0VL 1E4JA 1FO0B 1ZK9A 1NCCH 4RRPA 3HI6H 3ARGB 1MRFH 2AJUL 4PJ7A 5IESH 2EH7H 3ARGD 4XXCA 2R1YB 4K7PY 4JHWL 5GGRB 3PHQA 2HKHH 2FECL 1CDYA 1A7BA 2OL3B 4Z7WE 3QZWG 5J4MA 5GRVK 2P8PA 5F3BB 3GKWL 1TVBB 5MEOB 4TOYH 3JUZA 3GO1L 5GISH 1LK3L 2ILLA 3IJHB 1D5MA 4XP5H 5D2NE 1MQKL 2WBJA 3IJYB 2DJSA 3PHSA 5IJVA 3T8XA 3N1GC 3TNMA 1OSZB 3EFDL 2EDKA 3MLTB 4X99A 1NCBL 3GUTB 4KMLB 3M1BB 3MRBA 3NZHH 2V2TB 4ALAL 3FB8A 4MS8D 5DJDA 2FR4B 5BCAA 4NM8H 5SV3A 2AEPL 1HQ4B 3O8XC 1IGYA 2AK1L 1H15A 2ORBL 2Z4QA 1JN6A 3QPXH 5F7HA 1FYTB 3JVGA 2EDNA 2HVKB 3MBXH 2XTLA 1FYTD 4ORZC 4OJFL 4P99A 1F58L 3TWCL 5GS0H 3HS0B 4R7NA 5DJ2A 4LHUG 1KTLA 4JDTH 1LO2H 2CIKA 1MJUH 4FMKA 1WCBA 4PJAA 3NIFE 3DRQB 1CXFA 3MRGB 3UP1A 5IBTH 5ITFA 1E6OL 3QSKB 1DFBH 3VW3L 3KDMB 1JTOA 3PHOB 1BVKB 1T7XA 2Z31B 4DZBB 4P5MB 5E9DA 1A6ZB 2Z31D 4GRMA 5I17A 3GMPA 1FGNH 3K8KA 4QRTA 4JM2D 4M6OL 4ODHL 5CILL 2I25N 3IDUA 1VFAB 1SJHB 3MLXH 3MLUH 4HWBL 4QXGL 1CFTA 3SE3C 3R06A 1CN4A 5CD5C 3D69A 1S9YA 2XTJC 5AD0B 1R3LA 5F6HI 2AV7A 4BH7B 4HUNB 1PDKA 4OZFG 4F33A 3FN9A 1VEMA 3ULUC 1CGSL 1GZPA 4FTVA 4Y2OA 3BGAA 4JLRA 3AB0C 2CUMA 2LQRA 5JLZB 4U1MB 2XKUA 5IG7A 2DQUH 4WO4C 1QLEL 1FZKA 1LK2A 2VL5A 3DUSA 1HIML 4WHYG 4NT6B 1A64A 4CW1B 4OD1H 2LU7A 4EQ3A 5DJ6A 2IQAA 5IVXB 2P48B 3O2WH 4WNQB 4JRYB 2M8XA 4HK3N 5HHPA 2E5EA 3CDYA 4XMPH 3WXVL 1S5HA 3STBA 3RDTA 4RISH 4NKOB 1FNAA 3PP4L 1R3JB 1OPGL 2AJSL 5IVXF 1S7WA 4OZGB 2MQCA 5TE6H 5IHZB 5F96H 2BSRB 5GZOC 3EJYD 3K2MC 4G6KL 5D8JH 4QRRD 4G7VH 4Y19B 1IGJB 4QXUL 2ADIB 4ENEC 4S1SH 4Y19D 7CGTA 3QQ3A 4OZGF 5EU5B 3T2NH 1FZOB 3TBTA 4LGPB 1X5XA 3QG7L 4HXBL 4OAWA 3UTZA 1QA9A 4WW2A 2EH8H 4KXZI 2WMPA 1IEBA 1IE5A 4HKJA 4XVSL 5I18H 4U7SA 2X4QB 5IQ7L 1QBML 5B4MD 3NCCB 3KWWA 4F9PC 3T1FB 1A9BA 1M71A 3KR3H 4M03A 1W8NA 3P4OA 1BJ1J 3NFNA 3T1WA 3OQ3B 3SGKA 3KNBA 2I60H 3CDGA 3VGHA 3JWOH 2YHGA 2YXFA 1IGIH 3C9NA 2UYLA 5C8JB 5I1KH 5JW5A 1W0VB 1M6OB 2IF7A 3RWJA 1PQZA 3U0TA 4LARH 3QCTL 5HXMA 3DVNB 1MFAL 3PV6A 5GJTL 5C6PB 1AHWB 5KVFH 1F00I 3RGVA 1F42A 3DO3A 1MIEH 3SE9H 4LPTA 4U1SB 1KPUA 3EAKA 4YXKL 5GSVA 3HAEB 3LRGA 3OKEA 5ADOL 4MHHI 1LO0L 4JJ5B 3UTSE 5F6IB 3AREA 4JDVB 4NDMA 1ZT4B 3A6BH 2VDPH 4MLIA 1N5AA 1HEZA 1FFPB 2AJXH 5GS0C 1UYWH 3QDGB 2Z9TA 43C9A 3WS3B 2JF1A 3BZDA 2Z8WC 2AVGA 1IGFL 4OD3L 4N0YL 4WY7L 1V7MH 2R56L 2IAMC 2BSSA 2X89D 4X6BA 1UB5B 5E99L 2VDQH 3KPRE 4JFDE 5ACLA 4WW1B 5C0DA 1UWXK 5B3JF 4QRUB 4LSQL 5GGSB 2XG5A 5EBMA 4CVXB 3FOLA 2LFGA 4RIRA 4G9FA 3IDMA 3DOSA 1IL1A 1J12A 3HC0A 1IAMA 4XHQA 5IGXH 4V2BA 1HHHB 5DO2D 1QNZH 4KQ4H 4I5BA 3SQBA 4WV1B 3IXAB 3RVUD 2VR4A 1ZWIB 3TT1L 4JHAL 5K93A 4WI9A 1PKQE 5DJYB 3TC9A 5TPWH 1XGTB 3S36H 1MFNA 5I0DA 4DAGL 5GS1B 1OM3L 3SQOL 4MXWL 4S0SD 1J1PL 3TO4B 5BVPH 2MFNA 4LLWB 4JZNB 1JNNH 3TO4D 5K9QG 3UROR 3WN5C 3X17A 1CDUA 1XIWB 4MA7H 4LQFH 4HK0B 3IDYC 1KB9K 1VHPA 5GSRA 1B0WA 2VAAA 1F3JA 3RUGA 1XIWD 1A22B 2H2PC 4DVBB 3HFML 5IVOA 3MRHA 1FLRH 3BO8A 4X7DC 4U6VL 4YPGB 1G6RH 5C7XH 5C2BL 2BNUB 3EDJA 5A2IH 3MR9B 3GMMB 1YEKH 2FYYA 2PCPA 1BPVA 2R23B 1WISA 2E7CA 1JRHH 2J3SA 1NGQH 1ZSDA 3TYFB 1AE6H 4ZUWB 3B2VH 3V5HA 2NW3B 4GKNA 3DX9A 4G9DA 1K6QL 4KMQA 4NIKB 2P8LB 4GQ9L 3M07A 3T0ED 2PO6D 3GMLB 4KJWC 1FGVL 2N4IA 2K7PA 2WUBL 4WU5A 2RIKA 4OCNC 5IOPB 2IQ9H 2Q3AA 4ORGB 3H9HA 1ZHLA 1F3DH 1RZ8B 4UB0H 5EZJA 1FVEB 2R1XA 1KPRA 5D7JB 4AK1A 2UZIL 2W60B 4JO3L 4ZUTA 4IRSA 5D7JD 3E6HA 3GSQB 3QCUL 4NRZB 3H3PL 2OJZH 2NR6C 3EJZD 3Q6GL 1KJ3L 5JHDB 4IMLB 5IVNA 4CMHC 4M61A 3UPRB 1KG0B 4G8FA 5JHDD 1CF8L 3JWOC 3HC4L 4ZPVB 3LAFA 3RTQA 1VPOL 4LLMB 4I9WD 4GKZA 1A6VL 4PJ9A 4BKLA 4ELME 3DX6A 3BKJH 3RWGB 3PXJA 2R69L 4PPTA 5AG8A 3O41A 2P43B 4PGCB 3LHPH 1DBBH 4A2LA 1BZ7B 4F57L 1Q38A 5KVDH 2B4CH 1F4WL 4LSSL 2JKXA 3BDBA 5EC2B 1DBAL 4KZDL 1Y0LB 3BPOC 5HVHC 3GMQB 5B39B 3C6LC 1MJ7H 4XZUB 1M4KA 4Z0BH 1B0GA 3MXWL 5D7IB 5A1AA 5D1QA 1FV1B 4EOWL 1OP5K 1AJ7L 4XTRD 3QJHA 4JZOA 1V3MA 2GT9B 4QCIA 5E1AB 3TF7C 5D7IF 1MLBA 1T1XA 2DF3A 1FNGA 3VI3E 4QOKE 5I0ZA 2ADFL 3VA6A 4HUWB 2CMRH 2Y36H 3QI9B 1RULH 3TIDA 4Z5RA 5E08L 3BDYL 3QI9D 5FECB 3I3DA 4NYLA 3DMMA 4X4MA 1OTSD 3BIKA 4ODWB 5IBUG 4EIGB 4Z7VA 1MY5A 4R9HA 3TZVC 4HGKC 3RPIB 1U95B 2PYEE 5SWQB 2V5YA 4HIHB 4O02H 5E8NB 5BQ7B 1RUAL 3GJFH 4IDJH 1Z5LA 4FQ1L 2FIRT 4MCYA 5IB2B 2DM3A 2AXFA 4D94A 1OF2A 4B0MM 2FD6H 4DTGL 4OCRH 3LKOB 5JDSB 3RVWD 1W72L 4JFZL 1G7HA 1U58A 2WV3A 4G43A 3CSBA 3L7FA 3UZEA 1CDCA 4Z7WB 5C0BA 1ZVSB 3OHXA 3QJFA 4ERSH 4YDKL 2LVEA 2R39A 1G7QB 2X4SA 4L4TA 1D5ZB 3I50H 2XZZA 2PYFB 2PW2A 3RIFF 4C83A 5DJ8A 4GXUN 5D2NB 1ZMYA 4UOW0 7FABL 4EIZC 4DOHE 3WUZA 4WI7A 4YBLB 3WFDH 2H6PA 1J8HE 3ESUF 2YEZA 2P5WD 2HVJB 1KGCD 2AP2A 4JFQB 3GM0A 1ZLVH 5I1AA 1NAKL 1A2YA 4BZ1H 4X4XA 5AWNH 4K9EL 1CICC 4XMLH 3QDHA 4RMVA 1NC2B 3BQUB 4OF5A 3BKCL 4GXVH 1NC2D 2FHFA 4ZXBB 1OAXH 2PNDA 4PRBB 3FZUC 3K7UA 1XGUB 4QRPD 4Y5XA 3P4MB 3MFFB 3EDDA 4RGMB 4ODUA 5E6IB 4NJAL 3ILPB 3O2VH 5E6ID 3HRZA 3EGSB 3NABH 4DGYH 1NCWH 1H8SA 4WVRA 3IU3A 5HYJE 3H9YA 4YHYC 3JWDH 1HHIB 4RNRA 3V8OA 3F6LA 3CFKB 2WINA 2IPUK 3D18B 3NIFF 2DWEA 5ALBL 4M7JL 2V2WA 4S0TD 3WKNA 3BAEL 1OGAD 2NY4C 4LRIC 3V52H 1U3ZA 5JW3L 3S96B 4POUB 1PSKH 3AY4A 3U0WH 2FZ3A 3EFFB 4GBXC 3FTGA 3K4DA 2NXZC 5EU4A 4XXDA 4NWUH 5C9JB 4XPTL 4KJYA 2K7QA 2NYYD 8CGTA 2B4CC 3EO1B 2ADJB 3FFDA 1U8NA 2OZ4L 1QPXA 1TXKA 1DANT 1E27A 5IP4A 5MEPB 3GK8L 3GMRA 1S3KL 1H8OA 5F9JA 5DJAB 4KUCD 5FM4A 4U1HA 4HH8A 4X6DE 2RGSA 5DA4A 2VTFA 4QYOB 4MXQD 1NAMH 1Q9KA 4KUCF 3RL2B 1MIMH 2MTPA 3QISA 3QNYB 1YECH 12E8L 4KHTH 3O6MH 2IGFL 3QAZC 4ETQB 4MNQB 4PGDB 1OOAA 3VFTB 2BERA 1I9RH 1H5BB 5EIVA 4ZMAT 4X4YB 4LOUD 2EYRB 5IKCA 1MLCB 4ZO6A 5I1LA 1T89A 3RKPA 2GTWB 4XPGH 4MJ6B 4HBCH 5AYUL 5DEGB 3D5OF 4PRAB 3MJ9L 3RKDC 2D0GA 3TN0B 3C60B 1ZT7A 1X5HA 4UNVA 2VZVA 4R96A 3B9KB 3TN0D 1AGFB 1QHOA 3C60D 2Q8AH 1BF8A 1K3ZA 4IEFB 1MCPH 3B9KD 4KY1L 3B5HA 1KBGL 4Q9CA 4P3DB 3W81A 3OL2A 1DDHA 1T04B 1CLZL 1KN2L 1TQBB 3IFPA 4JQXA 1I8KA 1VACA 3CU1A 2YPKB 1WFUA 4F8QA 1BZ9B 1WBXB 3L6FB 3UTPE 5FA4A 3KS0J 1MCWW 5HDQH 3PL6B 5JORA 3VWJB 2R8SL 4OLVH 5MI0B 4J1UA 5CIPA 1R0AH 3VWJD 5B8CA 1CD0A 2BP3A 1LEGA 5K9KA 2GK0A 3B6SA 2W59A 4XPFL 1CR9H 3KXFA 1UQSB 4IS6A 4WIQA 4HD9A 1V5JA 1OSPL 3SCMA 2ARJA 4PBXA 2ED7A 1TQCB 1UWEH 4LCCA 1CS6A 3BP6A 1QVOA 3V2AR 1KCSH 3EYFA 5CEXA 2HTKC 4D9RE 3FJTA 4MA8L 3N9GH 5DWUL 1NGWA 5K9JH 5KVEL 1FIGL 3WO4B 5E03A 4KJWD 1GVIA 5EO1A 3UTSB 1FL3B 4LGRB 3WE6A 3UTSD 4EBQH 3Q5OA 4FQCH 3IXTB 3EOAB 5IHLB 4YHKH 3MXVH 4PJ5A 1CLOL 3MOBH 1HHKA 1EK3A 4BH8B 2C1PA 2GIYA 3C2AH 1ZTXL 3TA3C 1K8IA 5DLMH 3VH8A 3CX5J 4DUXA 3C5JB 1A6WH 2ZPKH 3KPRB 4JFDB 4NN6B 3MREA 5JIPA 2GUOA 3KPRD 4JFDD 2HRPH 3U30C 1QG3A 3EDKA 3C87A 4P59L 5EBLA 3JWDC 3RZCB 4OIIL 2ZUTA 1CK0L 2DTML 4LSTL 4PP1D 3WIFB 4RX4D 3V4UL 5HGAA 2DQIH 3SDCB 1ORSB 4I18C 1Z3GH 4C56E 3SDCD 3G6DH 1NBQA 1RUMH 4KJQC 3QUMB 4WWID 3H3BC 4X80L 5EPMB 1FVDA 1J5OH 4JPIA 1OARL 1OP9A 1SY6L 5J11B 4TVSa 1IM3A 3QIBB 2X1WL 5I1DA 3BEVA 1CE6B 4QF1B 5MENA 3KPPA 3SDXA 3GMNA 1MVFA 1ZHBB 2WWMC 5I1EH 3STLB 4LPXA 2X2YA 4NN5C 1A7OL 3FO1B 3DROA 4P9ML 1L9NA 2ZCHH 3KLSA 2A83B 4FQJH 1T6VN 5KSUA 2Z8VC 3TJEL 1M05A 3MV7E 1JGLL 4ZYKB 5FF6A 2RFXA 4JFXA 3QEHB 2EYTA 4K3JL 5I1JH 3BP5A 5C0RL 5IMLB 5L6YH 1B2WL 5EZLA 3HLAB 4PJEA 3EYSH 4LVHB 3RU8H 4HT1L 2ITCB 2A6JA 1P5UA 2FL5B 1J88A 2H9GB 2I07A 4WWKA 3IDNB 1RV6X 1C12A 3ULVE 4WUKL 1NJ9A 1F4XH 2DICA 1KLGA 2YRPA 2CO7B 4XNMA 4KDWA 4XNYL 1YY8A 1LP9E 1FL5A 5FV2A 5EOCJ 4YHZL 3S9DB 5EZIL 2DJUA 2IANE 5DK0B 4KJPC 4NCC1 4JJHA 5CMAB 4YNYB 1LVEA 5LKNA 4FG6D 5CJBA 1U6AH 4LKCB 4JO2H 2C9AA 5FUZH 2Q1EA 4L9LA 1JYNA 1N3NA 1EAJA 4M7ZC 4LLDB 4WHTA 4Q97A 5L0QC 3VXUE 1TCRB 3QDMA 5CJXA 5E5MA 3U7YL 3ZKNC 4ZUUA 3QRGL 1UACH 5GPRA 3EO9L 1UA6H 4P4RB 1MSPA 2VDLL 5DMKA 2JB6B 3ARFA 4OV5B 4OZFB 3NVQA 2YMXL 2GK2A 4EXPX 3ET9F 5KJRL 4N0RA 1EMTH 3ZHKA 3GNML 1HK6A 3VFVB 3IKKA 4NO0B 3OR7A 4HKZA 1UZ6E 2ESVA 5I19H 4G5ZH 4NO0D 1BBDL 3QWOA 4RGNC 3HI5H 1OAYH 3DYPA 4RBPH 3UX9B 5D2LE 2MNUA 2VKWA 4CVZA 4XBEH 4MD4A 1BREA 1IC5L 1K4DA 1LO4L 1DEEA 2EXYC 4UU9B 4M9PA 4P9HH 4RMTA 1T4KA 5FM5M 3LKSA 2H2SC 4WFFE 5AZ2L 4QOKB 1W72A 4KK6D 4NZJA 3EOBB 2IEPA 5CEZL 1JPGA 5J1AA 4JVWA 1FPTH 4QOKD 2CLRA 2C3XA 2WK2A 1S9KC 5T3ZH 2FLBT 4LIQE 3VFSA 5HBBA 4K7PX 5EB9A 3O6FA 4JFFD 5EOCL 3IDJA 1KLFA 4EI5B 5ICYB 3OB0K 5DXWA 4XP9H 4U05A 4EI5D 3QFJA 1NC4B 2PYEB 2COQA 5JNYB 1JF5A 5HYSG 4U6YA 3MBEC 1NC4D 1KC5L 2PYED 1AY1H 4KK9C 4RFNC 1U8IA 4XVJH 4LCWB 1H3UA 2DRUA 4ZAKC 4DUWA 4JANA 2IG2L 4U1NA 4CADA 1J8KA 1YN7B 3WNLA 4LF3A 1A1MA 2ADGA 4GMTL 4YDJB 4D0CB 1RZ7H 1OT2A 4JGMA 4KKLC 1QHPA 4CU7A 5BZDB 4PB0L 2VZTA 1JNHA 5KSAC 1EEYB 3CZFB 1RUQH 3C5ZC 2VXQH 5IUSA 1WTGT 4NNYB 5GRJL 2LV4A 2BNQA 4Y1AE 5KSVB 3GZKA 1DQJA 3C6SB 5DHYB 2O5XL 3F7YB 2CKBA 5DD0L 1MCQA 2VZOA 2BFVH 1C5CL 5SX4I 1NDGA 1CIUA 2OS7A 1Q9LB 5L2KE 4DEPB 4DOHB 3MRFA 2ZG2A 3X3FL 2XN9A 2Q76B 3FRUB 5TE7L 2G5BA 4Y0GA 1BF2A 1J8HB 2ERJB 4NNXA 2OTWA 1DLFH 1IQDA 1CDHA 2WUCL 4MJIA 4NM4H 3PP3H 1AGCA 1J8HD 5GGVY 1MFCH 1X7QA 1ZA6B 2YD6A 3MRIB 5JXAL 1NANH 1FO0A 1T2XA 2HP4A 1JPTH 3ARGA 3WFBH 1OLZA 3W11C 3WDJA 1A6TB 5E95B 4WI8A 2Q7YB 1TPXC 4KUZH 2YBRB 3O6LH 2FEDD 5BVJB 1C5BH 2R1YA 5GGRA 4NQVB 2GTZB 2OL3A 5DJ0B 2VXSH 5FYJL 4Y8DC 5F3BA 1INQB 1TVBA 1KOAA 5EU7E 3LKNA 5E8DL 5MEOA 3BP4B 5KVMC 1MNUH 3FCTB 1JPFA 3QP3A 1DE4A 4F3FA 4MAYB 1FQ9C 2XPGB 1WWCA 5E2WH 3IJHA 1NSNL 4MAYD 2R4SL 4DN4H 1B90A 1MF2H 3L3OA 3LOWA 4ODSL 4YHIB 5HYJB 2A38A 3N06B 3IJYA 5HYJD 5FKPB 1OSZA 1LO3H 1CLYH 4HMDA 3GUTA 5JPNB 4L8BB 3M1BA 3GBNH 2V2TA 5IROC 3DUUA 1WJ3A 2APBA 2FR4A 5IWLC 1TZGL 4BFIA 1HQ4A 2C1OB 1JHLL 1F4AA 3UJIL 1YPZE 4KDTC 1FYTA 2DBLL 2HVKA 2JB5H 5D93B 3LRSB 1IKFH 4QRQA 3MJ9A 3BESR 2VSDA 4J3UA 3T77B 1K4CB 4X6DB 1H0DB 1RIVL 3FO9B 2VZSA 4UT7L 4XWGL 5D96B 3X13B 4MMZC 3GI8L 4JR9H 2QSTA 4JVUA 5JMRA 3DRQA 4P9HC 1KCRH 3MRGA 1K8DB 1X6LA 3GSWA 3KDMA 4X6DF 4WI2A 2X40A 1BVKA 3PHOA 2MJWA 2BOCB 1J18A 4OCYL 2Z31A 1X4ZA 2HT2C 4DFIA 3EYUL 1EAPB 3KPLB 4P5MA 1A6ZA 3O3EB 4JM2A 1AO7E 3Q3GA 2VXUH 5FM5O 2CR6A 5F9OH 3AS0A 3MV8E 3RVVC 4M6NH 4H1LB 4M7LL 3V5DB 1MCIA 3HB3C 3PWPE 1SJHA 5GIRB 5FUOH 1NCCL 3OR6B 3HI6L 4PFEA 1LILA 3SDAB 1MRFL 2H32H 4M5ZH 4HG4J 4HHAB 2FIKB 1JZ4A 4OI7A 5IESL 2EH7L 3D48R 4OLZH 1EXUB 1UKTA 2VYRE 1T0MB 4PGEA 3QG6B 2HKHL 3WFZA 1G6VK 2CDFB 4YHOL 5F7DB 5BOZG 3B3IB 4AIZB 2NY1B 1I3VA 5DVOA 2YC1A 4HS3B 5GISL 2NY1D 1CFVH 2V7HA 5JLZA 4U1MA 4POZC 3VD5A 1WFOA 3K8MA 4XP5L 3MV01 4HBQA 4NP4H 1MCKA 4NT6A 4CW1A 1A5FH 1PLGH 3UTPD 2YR3A 4N0FB 5ENWB 5IVXA 1MHEB 3FB7B 3OAZH 5CP7B 4ZS7H 5JA9A 2MCPH 3OKMB 1A4JB 4WNQA 1OAKH 5FYLE 1P2CB 3NZHL 2DQHL 2HFFA 4NM8L 1I7TA 4NKOA 2CR3A 3UDWC 2J4WL 5DHVB 1F8TL 1R3JA 4GW4A 1I7ZB 1GSMA 2J8OA 3QPXL 4LVNC 5IHZA 4QRRA 2BSRA 3BGFB 3EHBC 3KPMA 4M62H 5A2JH 3MBXL 4N1CA 4O51A 4Y19A 5GS0L 1IGJA 2ADIA 1RHHB 3C09C 1TFHA 4FP8L 5C0CB 1O0VA 3ALWA 5EUKB 4UQ3B 4NRYB 2HJKA 4Q2ZB 5EU5A 1S7XB 1LO2L 1FZOA 2DI8A 2NXYC 4D9RD 1ZANH 1I3GH 3DHJA 3W5MA 1MJUL 4JEGB 1NGZB 1MPAH 5I1HH 2O5ZL 1IEAB 5IBTL 1RVFH 1DFBL 2PW1B 2X4QA 1WFNA 1NPUA 5F7NC 4HCRH 2EDTA 3T1FA 1OAUH 4QGYA 5IB1B 1R3HB 3BOVA 4PJDB 5IBUB 3RNKB 2Z92A 4NZRH 35C8H 5C8JA 5E7FA 1YA5A 4KHXH 1W0VA 3MLXL 3MLUL 1GGBH 4JG0L 4PJDF 3VGDA 4JGJA 2E6QA 1VDGA 3EYVB 4HJ0D 4XBPB 1AGBB 4L4JA 3OKDA 1BFVH 5DMJB 4C56B 3RI5F 3G08B 4OLUH 4U1SA 4AJ0A 1EX0A 3HAEA 5EU3A 3VGBA 4HKBB 3FONB 3PJSA 4JJ5A 3WLWC 4JDVA 1NMBL 3BN3B 3LEVL 2XICA 2AS5M 3W82A 4PGZA 2DQUL 4Z7QE 4RGND 1AR2A 2AEIT 2G9HB 1YNKH 4R2GC 4V2CB 3OAYH 3VFNA 2X89A 4OD1L 3KGRA 3CJJA 2FX7H 3MV11 1UB5A 3G6JE 1WIUA 1GGTA 1T1ZB 5E8EB 3O2WL 4WW1A 4D3CH 4AQ1B 1JK8A 4XMPL 4P3WA 4ZFZB 3W39B 5GGSA 3DSFH 4CVXA 4RISL 5JXED 5TE6L 4TQEL 2C4FU 1SBSH 3SKJH 5D8JL 4G7VL 3NA9H 2IH3B 1HHHA 1U36A 3MV7D 4NFBA 4DQOL 5EUOE 4R4BB 1TETH 4WV1A 1WAAE 3T2NL 5IMOA 5BV7H 1IAII 2E9BA 1ZWIA 5D1ZC 3WV0A 2EH8L 1J0ZA 3NCJH 5I18L 5DJYA 3TH2T 3ULVD 1ED3B 1LP9B 4Z7OE 5GGQL 5GS1A 5HI4C 1XGRA 2QQQA 3X14A 4CN4A 1PAMA 2LU3A 2R0LH 3KR3L 3NN8B 1DN0A 3TO4A 2IANB 1P53A 4NC1C 4LLWA 4JZNA 1VERA 2I60L 3JWOL 1S7RB 4JKPH 3ZDYF 1XIWA 1JGEA 4NHCH 2DLTA 4HK0A 2NW2B 1X5YA 5I1KL 4N5ED 3C5SA 4DVBA 1L0QA 4M4PA 4DGVH 2X1OA 3C5ZD 4TNVF 4YPGA 2BSTB 2EC9U 1A1NA 4Y4HC 1GHFH 2BNUA 2HFEB 4LARL 4PS4H 3WJLA 4K3DH 3VXUB 5KVFL 1KJ2B 3QUML 3QHFH 5CAYB 1MIEL 1XCTB 3SE9L 3VXUD 4GG6A 5MEQA 5IF0B 32C2B 2BRQA 3QO0B 1EO5A 4ZUWA 4MNHB 3VXTB 4MA3A 3CPLB 1HH6A 3A6BL 2PO6A 3T0EA 1CQYA 1XAUA 5E4EC 3TNNB 2P8LA 4MJ4A 4KAQH 3GMLA 1UYWL 4NGHH 3U83A 2CXKA 1KIRB 5IOPA 1XH3A 1IKNA 4ORGA 3LS4H 4RZCA 4OZ4B 4R4FL 2HJFB 1V7ML 1GRWA 1RZ8A 3VFUB 1JNLH 3W11D 3I84A 1FVEA 2VDQL 4P5TD 2VB5A 5D7JA 5D2LB 1DCLA 5FUCE 5DGRA 3MRPA 1T2QL 3PABB 1MCOH 3GSQA 3FB5A 4NRZA 5IR1B 1F3DJ 2DM4A 3KLAB 1HOCB 4J6RH 2HKFL 1CCZA 3QIUC 2QQNH 5JHDA 4IMLA 4PJGA 4LAJH 1KG0A 3BEWB 3RVTD 3B83A 4WFFD 1IILE 4G6JH 4ZPVA 1QNZL 4KQ4L 1TTGA 2OI9C 2QV2A 4KC3B 1EEQA 4PB9H 5CCKH 3RI5K 4PG2C 3RWGA 3UMTA 3OWEA 3JTTA 3MRMA 1FCGA 1BZ7A 5TPWL 3P11H 4XP1H 3S36L 4F58L 5DR5H 2FATH 3PNWA 5EC2A 3AMLA 5I75B 1Y0LA 5B39A 2UZYB 4KQ3L 1FNEB 4XZUA 3TYGH 5I8KL 3N1PC 1CU4H 5D7IA 4UIKH 4MA7L 1FV1A 4LQFL 4LHJB 4PJXE 2P44B 3FAXA 2VLME 1MEXH 2PETA 5FEBA 3T0VA 4ZTPH 4X5WB 5DQJB 3S88H 1FLRL 4JAMB 5E1AA 3WNNA 5EG6C 1A6UH 1G6RL 1MAJA 1UH3A 1AGEA 4HUWA 3DETC 3QI9A 3ZDXF 2GFBA 3L7EA 1JRHL 3ZT6A 3RX7A 5FECA 1Z2KA 1OTUC 4Y1AB 1NGQL 1AE6L 2NY7H 3B2VL 3MUY1 4OFDA 4ODWA 1AD9B 2VH5H 4PRDB 5F9DC 5HVGB 5SWQA 3RVVD 4HIHA 1U2CA 5L2KD 2IQ9L 5T3XE 4I48B 1P69B 4TRPH 4XXCC 4NO2B 3V0WH 5K9QI 4KV5F 5BV7C 4PRNA 1T21B 2D7TH 4HFUH 5FAAA 3S7GA 4UB0L 5IB2A 3G5XB 1UJ3A 1BIIA 2VITB 4HUKB 5JDSA 4DN3H 2OJZL 4F7PB 2OTUB 1U91B 4HIEB 3HMWH 2BMKB 4XPBH 4B50A 2GSIB 5HSFA 2WBJC 1AI1H 4Z7WA 4MQTB 1CFSB 1ZVSA 2BXZA 2RHEA 4TNVK 4W6XB 3U6RA 4NHUB 1G7QA 1TVDA 2APFA 2H45A 2KL6A 4APQB 5KVGH 1D5ZA 1FSKC 4XCEB 3BKJL 2K1MA 4AIOA 3GBMH 4NFDA 5D2NA 2P5EE 3LHPL 3QIWC 3DBXB 1Q0XH 3FL7A 5T1MA 3S5LG 2B4CL 2P5WA 3NBNA 2EEBA 1TZHB 2HVJA 3SJVB 1MJ7L 4XBGB 4JFQA 4Z0BL 4RWYH 3EHBD 3T2PA 1TCMA 2BNRE 4EUPG 3TIEA 1YPZB 2DQCH 1JE6A 5DUPH 2QQKH 1BFOB 4G7YH 3ES6B 1NC2A 3CX5K 2EKJA 1PX3A 1PG7H 1E4XI 4QRPA 1YPZF 4PRBA 2CMRL 2Y36L 1XGUA 3DNKA 1RULL 1I9JH 1R24B 4D9LH 3MFFA 4G8IA 3W0WD 5E6IA 3ILPA 2B5IB 4PBWD 1QLRB 2BHYA 1U42A 4IRZH 3CFKA 2Y07H 3KYOB 1OGAA 5FFLA 4O02L 1AO7B 3I3EA 3GIZH 3MNZB 3ZL4L 3S96A 4ZOAA 4IDJL 1AO7D 4U7KA 3U4AA 3MV8B 3V7AE 4PBVC 4MD5B 3OX8A 5JHLL 3DTXB 5CFHA 4NO5B 3MV8D 3REVB 2FD6L 4DW2H 5DFVC 2FBJH 3EIFA 5L9DH 5C9JA 3TM6A 5FYKU 4KK5D 3PWPD 1IGCH 3EO1A 1RZJH 1F6FB 1ONQA 3HE6B 5MEPA 2X5PA 1KTDB 1ZGLA 2C7UB 4WO4B 3HE6D 5HGHB 5JQ6H 3ULUF 4ERSL 2E9IA 4QYOA 5J6GA 3WBDA 3D2UB 4LEOA 4OT1H 1DSFH 3GHEH 3RL2A 3I50L 3D2UD 2B1AH 1EA9C 2MPAL 2BVUA 3QNYA 3ARBC 2FGZA 5C0NC 3RDTC 4ETQA 5B21A 3SN6N 4PGDA 3CFEB 1CFBA 1J11A 4QHUB 1HHJA 4NO3A 3MJ8B 1K3IA 1MLCA 5F97E 4ODTH 4BZ1L 5FYLD 2GTWA 4X7SH 5AWNL 1SBBA 5I73C 2GJZB 4XMLL 5DEGA 3TP4A 4PREB 2XQBH 4PRAA 4GKSB 3TN0A 3IVKB 3C60A 3FQTB 3B9KA 3AROA 1AGFA 4XAKE 4GXVL 2YD4A 3LSOA 4LRNL 4X6EA 5IEHB 1OAXL 2XNAB 4P3DA 4LBEA 1SJXA 1T04A 2OMBA 3SGKC 4C4KT 2AABH 3O2VL 4B7LA 5I6XB 1F4HA 1BZ9A 4IOFD 3NABL 1G1CA 4DGYL 1NCWL 1WBXA 3L6FA 3WN5A 5AAMA 5BJTB 5I71B 5SWZE 3JWDL 1RURH 5HY9B 5H35B 3VWJA 8FABB 2JCCE 4J7RA 1EHXA 3U48A 3V52L 2WWKT 5ICXB 5IHBA 3DECA 1MQ8A 4M1CD 3I75A 5TJWK 3RGVC 4U0RC 5DEFB 5HYSB 4HZAA 4BZ2L 3VMOA 3ARVA 3AREC 1VGKB 1RZIB 2Z35A 4U2YA 4HKXB 4OGZA 3E3QE 5IW1A 1B4JH 4FFWC 5MERB 3H8NA 3UTSA 1FL3A 3K0WA 4L4VE 5EBWB 1MIML 2N7BA 5E00B 1NEUA 1YECL 4KHTL 3EOAA 5D70H 3GKWH 1BJ8A 1UEYA 5DJXB 3AU1A 4PJFE 4BH8A 5BMFH 1I1FA 1I9RL 1I3RA 3OB8A 1LWRA 4HLZH 5K59E 3G6JB 1NLDH 3B9EA 3KPRA 4JFDA 3C8KB 2JJSA 4HX1B 4X83A 4JFOA 4BZYA 5M95B 4XPGL 4HBCL 1F6AB 1YJDH 2X1XR 4EUPH 4RX4A 1EO7A 3G6JF 2B20A 1FBIH 1QBBA 1O7SA 3WIFA 4HQQH 3SDCA 2EDOA 1IT9H 5IFHH 5B38B 4CUCA 3VRIB 2Q8AL 1YMMD 2AEPH 1JIBA 1TJIL 1MCPL 2VDOH 2C3GA 2ZSVB 5EUOB 1YMHB 5GS2D 4N0CD 2O26U 3QUMA 5C09E 2R0WH 3TWCH 3QZWA 3FT3B 3FO0H 1RZJC 5EUOF 5H94A 1PKQA 4D9QE 4UAOC 4YJZL 1J7VR 1WZLA 4Y4FB 4W6WB 5D72H 3WIIL 4Y4FD 4QF1A 5CP3H 4JY4A 4RDQF 1BD2E 1R0AL 1ZHBA 2G75A 1JZ7A 3EKCA 3VW3H 2VLJE 1MWAB 5EO0A 2VN7A 4JFYB 4O9HH 3VH8G 3GIVB 2CJUH 3HI1B 3FO1A 3PE9A 1CR9L 4OZIF 3WKMH 2Y1VA 1I85A 1JMZA 4NKMB 4XI5C 2V2XB 5T1KB 1UWEL 3OAUH