5C8JA

A yidc-like protein in the archaeal plasma membrane
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
229
structure length
229
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFNFSSSSIHWVRQAPGKGLEWVASISPSYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGIWSYWYMVYPHDNYGMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody fragment, heavy chain
publication title A YidC-like Protein in the Archaeal Plasma Membrane.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 43
structure length 229
sequence length 229
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c8jA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c8jA01
1QYGH 3RDTD 1F4YL 1P5VA 2ZJSH 2AEPL 1IC1A 4KAQH 5B3JE 3G6JA 4KROB 1KC5H 4KRPB 4YEFA 5JHLL 2HH0L 4PRNB 3IDYB 4P49A 4KJQD 3KPMA 4U2ZA 3MV9A 3AXLA 3UYRH 5HBBA 4HC1H 4V2BA 5TDNA 1UXWB 4M3JA 4P2OB 3GSUA 3I2CH 5JOPD 5K9QI 4LPUA 2AS5M 1JPTL 2YMXH 1DBBL 4GRLC 5D1ZC 2YPLD 2IPTL 2LE9A 4NQVB 1JF5A 3T0EC 4X99B 1DSFL 2A73A 4UU9B 2XIDA 5D93C 1GIGH 3NIDF 1ZKAA 4G8FB 5IMOB 3FO1B 5E8NA 4ZUVA 5C08A 4PJ9B 3MOBL 2Q8AH 4HIHB 4U3CA 1BQHB 1QEWA 4WTZG 4NRZB 4BUGA 5INCB 4HULB 1BFOA 2B1HH 3C5SA 2CLVA 2X7LB 4GW5B 5D72L 5LGJB 3BOVA 2BOCA 3FB5A 1QSVA 1YC8A 4L4TB 3B9DA 5EOCL 4OF3A 5CEYA 1R5VA 3G04B 3PGCB 5D7IE 3C6LA 3LKSA 5I1AA 4XC3H 3IAPA 4JB9H 4NZDA 2RR3A 4MSWB 1M7IB 4KROC 4KRPC 4P2QD 2HFFB 4QHMB 1OTUC 1E28A 1KT2B 3GSNA 4OZGE 4ZUWB 5JHDE 1DR9A 1BBDH 4MJ6A 2J8UA 1JP5A 5CIPB 3RVWD 3PUCA 3TT1L 5IWLA 1XGUB 2Q6WA 1U95B 3UBXG 4BFIA 1B9ZA 4FOMA 4P2OC 1RUAH 1NGZB 1RZ8B 4M3KB 4GFTB 5IVOA 5TE7L 2JJSC 2AK4D 5E5RB 4QXTA 3S96A 3OX8B 4WNQB 3BEVB 5E7FA 4FQPA 1F11B 2OTUA 3ARED 1NEUA 5I19L 4ZYKB 1PZ5B 5F6IB 3S9DB 1QFPA 4ZDHA 1QPXA 3L5IA 1JL8A 2GAZA 4AEIL 4JREB 4AQOA 3TN0D 4XPHL 3D3VE 4JR9L 3MOQA 1A7RL 2BVUA 2VLKD 3LN5B 1K6QH 2R2EB 3VE0B 3O2WH 1Q94B 3QG6A 5HI5D 2HVJB 1R5IB 4G7VH 35C8H 1NJ9B 3JXAA 2D7TL 1PVHA 3DHJA 3EFDL 1MSPA 5T5NG 1XR9A 1ZA3B 5ICZA 3FB6B 1W0WB 3B8SA 5IHZB 1ZHBA 3OKKA 1CS6A 4AEHH 4GAJL 2JJTA 3GSQB 1JN6B 1F3JA 5C6TL 5I16B 3WIIL 3K4ZA 5GS0D 2NY6C 4GLRH 1UC6A 3NAAL 3OR7A 1X5GA 2ZCLL 3VRIB 4F37K 1DEEB 2BOBA 4JHWH 5E6YA 1RD6A 5DA4A 3SQOH 2A1WH 5F7NC 3RX8A 4TSCL 4M61A 4TQEL 2VJXA 5GGQH 1PFCA 4HF5H 1CF8L 3BE1H 1DANT 5L6YH 5FECB 4EBQH 3BN3B 1INEL 4XHJC 3UTSE 3BQUC 5F6IC 3U79A 4L8CB 5JW3H 1EHXA 3FN3A 4B41A 5IIEA 3BKYH 2ENYA 3NTCL 2Y72A 4JREC 1GGYA 4OCLC 4FQQA 1QSEE 5JOFB 5BVPL 1RY7B 2HTLD 3FAXA 4EOWL 3IVKB 3CSYA 3ZSSA 5E9DA 3V52L 4YAQA 1U6AL 2H26B 2QKIA 4WW2F 1T4KB 1WC7B 1EHLL 1S5IH 3QSKB 3UTPE 1J88A 2VISB 4MQXC 2LAAA 3QUZD 1I1CA 5CFHA 4XAKE 2B0SH 3CH1A 5M95B 1I4FA 4HJJH 3EFFB 3MGAA 5L2KA 5GRUL 1IZJA 4KJPC 5IB3B 4P46A 5BZDA 1BVLA 3QZWA 3QYCA 4X8JA 5DYOB 2PR4H 3W81A 3L5HA 3HUJF 3B9EA 4OLWL 1Q1JH 3HI5H 3IDJB 2FNBA 2RQ8A 4NQTA 3KPSA 3PWUB 5IG7B 5HYIA 1DQDH 1BM3H 3HRZA 1EUTA 2ESVA 1GRWA 3SY0A 2GJ6E 3ARFD 3HZVA 1NC2A 3SE8L 3RY6A 3QHTC 4XH2B 3EOYG 3EKCA 1AD0A 1QP1A 2AEPH 5JQ6L 5FA4B 1HN1A 1T5XA 1KIQB 4UOW0 5SWZD 1EEYB 1VACA 1ONQB 1U3HB 2YHGA 2DM3A 1MCPH 4R8WL 2DL9A 3ARVA 1MFAL 3E3QC 1OSPH 4L8DA 3RA7L 3NCYP 4Y4HC 1KSRA 1IGCL 2HRPL 1NDMA 3DVGB 5C0EB 5MEND 1JPTH 4C54A 3FHQA 2CGRL 3UYPA 2IPTH 4JFHE 1SJEA 5T33L 4HKJB 2X6MA 1CK0L 3QUXA 1FGNL 3OR6B 3P4MB 1Q38A 3GMQB 2PW2A 4WFFE 4Y19D 4FZEL 4NHCH 3RVUC 4N8VA 4I77L 5HY9B 3ORJA 1T0MB 3QDJE 3HB3D 2C1PA 2V7NA 4DKFL 1NAMB 4HUNB 1T1XB 4OCRH 5D72H 4U6HA 4FZ8H 3B8YA 5LAXA 2X4PA 4PS4L 1T6WA 4WO4B 4G9DA 2XYCA 4C56D 2ITCB 3MXVH 1A1OA 3IXTB 2CLRB 1OCWL 2DKSA 3TP4A 3VFUA 1QRNA 3KHQA 1XGYL 1IGFL 4ZTOH 2KQNA 3MRQA 1MHPH 5MEPA 3W0WA 1U3HC 4EUPA 3CSGA 4ZUSA 4U6YA 5DJYA 5C0AE 4NIKB 3ZZ1A 3JZ7A 5EUOF 4HPOH 5AWNL 3NCMA 5IBLD 3IS1X 2VOTA 5IVXF 2R0KH 1T3FA 1JNNH 1CGXA 4TN9A 4M1GH 1J9CT 5C0BB 4WEMB 5F88A 3RWDB 4DEPB 5I19H 3RWIB 2NY3D 5GRXG 1NAML 4Y16C 4Y5VB 5FYJH 5JXED 5F6HJ 3GIVB 4AEIH 2BVOA 1KPVA 4W4NA 4I3GA 4I0PD 3GB7A 5D70L 1CE6A 4L4VB 4PJ5E 4OM0L 3ZO0A 2V2XB 2CDGA 1KJVA 4ODVH 5BW7A 3C60A 3EBAA 3V9FA 3WS6A 3ZHKA 4D0BB 5GGTL 5HJ3B 1QOKA 3O2DA 5IFHH 5MERA 1TVHB 2D7TH 4WO4C 3F7YA 3PDDA 4QRTA 1JGDA 1OTTD 4QF1B 3WDJA 5EOQL 3G5YA 1QSFD 4J3SA 2XZZA 5TGBB 5FA3A 4GAJH 5I8KL 2YD7A 4FFZL 2KKQA 5DR5L 3NAAH 3DO7A 3P4OA 1AXTL 4DAGH 3MRCB 5FYKL 3WFEL 4RA3A 4PJDA 4UB0L 1CF8H 5F7DB 3QXDA 5DRWA 5JTWA 1R3HA 3DXAD 4JFZL 4PJ7E 4JKWA 3QDGD 3LPGA 2HA1A 4I18A 5B39A 2M26A 5L88H 1IGYA 2Q1EA 3FFCA 3C87A 1J0YA 4DEPC 4Z7QE 4UDUB 3VXOB 4QNPF 2X4TB 5HPOA 3PQYB 2ZOKA 3BEWA 1Q9KA 3O45B 1TZIA 3AS3A 5DF0A 1M7DB 5MP6H 1DBML 3OZ9H 3MTRA 2WUBL 4U4BA 5LG1A 4NQDE 4R26H 1YN7A 3D0VB 1FAIL 1JWUA 1QZ1A 1FYTA 4DQOL 3GSXB 3LD8B 1SQ2N 4HV8B 1S9YA 5KN5A 1ND0A 2I5YH 4JFFA 5LVEA 3QHFL 1QFOA 2XG5A 3O9WD 1BQHG 4ZS7H 1J5OL 1S78D 1BJMA 1YN6B 2GITA 4J6RH 2NY2C 4Y7MA 4WTWA 3MJ9A 1UT9A 1XGRA 2G75B 5DRZB 5A3IC 1VENA 5EU5A 1YEKL 3OB0K 3KPOB 4P57B 2VE6B 3MRLA 2B4CH 2V9QA 3HPLA 2VL5A 3LMJL 1RZ7H 3SE8H 3CX5J 1RVFL 3Q5YA 4WW2B 4ZSOB 4PGCA 5D6DC 5FO7A 1E6JL 4F3FB 3OV6A 2VXQH 4BFEA 1MVUB 2I9LA 4C4KT 4XHQA 4JN1L 1J1XH 4XCFH 1QLFA 3HC3H 3K2UL 4X6DF 1FO0A 1W72H 4JVWA 5D7LE 1YEFH 3U9UB 1AO7D 5ADPL 3RPKA 1CQYA 5JXAL 1RURH 1MFAH 5DJ8B 4DN4L 4WVRA 3NFSH 5GS2D 2YPVL 1I7RB 4X5WB 3MGTB 3TBSA 4KJQC 1C12B 3RIAF 3LD8C 4DFHA 1ZEAL 5JIHA 2YS4A 4YQXH 1QG3A 4IMLA 3IDIB 3THMH 1CFSB 5IV2B 4WU5A 3F7PC 2ORBL 2AK4B 1NCAL 5SWQB 1KCRH 3P77B 5FK9B 3QEUB 1F45A 3S3JA 3H9HB 2GCYB 4LPWA 5ERWA 1JV5B 3WKNA 1UG9A 1WIUA 3ARZA 3HMXA 3IU3B 4NJAL 4GBXA 3UTZA 4GG6F 3AREB 1FAKT 3TNMB 4S11A 4JDTH 4CDGC 3TT3L 4PGEB 4HEME 5SX4I 3IAQA 4DKFH 1T20B 1EO8H 5EZLB 3TN0B 3CCHA 2H6PA 3PWPA 1JHLL 1VPOH 4PLOB 5C0CA 1K5NA 1YEHL 4PR5B 4J3UA 3BHBB 5DJ2A 4R4NC 3FTGB 3BDXA 2VLKB 1K4DA 2BVQA 5GQBA 5DJ0B 5F7UA 4XP6H 2V2TA 4Y5YB 5DMKA 4NO2B 4LGRB 1UXSB 5I1EL 4MCZA 1E6OL 2FIKA 3VFTA 3VD4A 5DFTA 4M7KL 1RZGB 2D2OA 1YPZF 4JZNB 3DUSA 4O00A 1BD2E 4OBRA 3O6FA 4OFDA 3B9AA 5ECJE 1Q9LA 3MV8E 1C5CL 1ZK9A 5H94B 2AJ3A 1CFNB 3BKJH 4G9FE 1FL5A 4KMTL 1T89C 3RVWC 2CXKA 3FRPA 2F53A 1T22B 4DZ8B 3QNYA 1VHPA 3I6KA 1KEML 1QBML 4PRHD 2Y5TB 1MWAB 1FN4A 5EUOA 1I7UB 4HG4J 5L2JA 2QQQA 1H5BB 4LCWD 1PKQA 3VG0L 4AMKH 1TJHL 3KLDA 2CLZA 4Z7WB 2AV7A 3AREC 3WFHA 5IVXA 3CX2A 5TDOB 4S1SL 4YHLH 4U0QB 2OZ4H 5DZOA 2X70B 3H7BB 2VDRL 1HHHA 3SGJC 4JKPL 3TN0C 4PBWD 4YH6A 3V4UH 5GGTH 1DQJB 4ZO9A 5DHYA 5F89A 4ZNCD 3STBA 1NH6A 2FEDD 3O4LD 2Q76B 1IGML 2VIRB 4Y5YC 4MMZC 5HI5C 5FFLA 1WZLA 1OP5H 3SDAD 1NC4A 3HE7D 4GKZB 1UM4H 1OWRM 3CUPB 3GZKA 4HGMA 5GS0L 3MROB 5B38G 5ESAB 5F1NA 2CKBA 2KBGA 2R0ZH 3DX8A 3ULUF 1V8HA 1F02I 3X17A 5FYKH 3P0VL 1L7IH 3HNSL 2AXFA 2A38A 1MWAL 4XCYB 3MYZA 3IRZA 3PGDA 4OF5A 3WJLA 2CUMA 2IJ0C 5GS0C 3VXSA 4WI5A 1A3RL 3D18B 3VFOA 2VN7A 3ZDXE 4ODXB 5GGRB 4MLSA 1LEIA 4DGYH 2NY7L 5EU6E 2GYSA 3GJEA 4JJHA 3ZYJA 3SJVD 5K59F 1AXSA 1NLBH 1UJ3C 5DI8A 1BAFH 4LGPB 5D7JB 1H5BC 1MY7A 4JG1L 3MRHB 4P4KB 5B4MD 5KG9B 3HS0B 1DQLL 3VFRB 5SWZB 4LLWB 2V7HA 3NOIA 4XNUL 3U36A 1LP9F 4LL9A 2GEEA 2EDQA 2A6KA 2R29L 3RGVA 4MXWH 1L7TL 3FOLB 4FQ2L 1OAXH 1EFXA 2ZUQB 1KTLB 2ED7A 3CFKB 4YDIL 3BD3A 2DYPD 5MENB 4QCIA 3DO3A 2G5BA 2UUDK 3K1KC 5ENWB 3BP5A 1MFCL 1G6RB 1RUMH 4HIXL 4L29A 3HAEH 3QUZC 3RWEB 2VN4A 3IRPX 4LNRA 3MRMB 5LWYL 1JZ2A 1NANH 5HYSA 3GK8L 1NBYA 4YGVB 4EQ2A 4H1LB 4OZFB 1WEJL 2X05A 2F54D 5IOPB 3HZKA 2YD2A 2VMFA 4OCSL 1IARB 2FJGA 1RZFL 2WANA 5DHXB 4WTZA 3TPUA 4ZS6D 3C2AL 2HLAB 1FL3A 1E6JH 2EYSB 1WJ3A 2PTTB 1RJLA 5E03A 3NCCB 4UUJB 4C56B 4JN1H 3H9SE 4R96A 2C7UB 2APTA 3ARFC 4GXUN 3JTTA 4BQ9A 3K2UH 5D7JC 4D0DA 4UBDD 5F7YC 1RPQA 5F9OL 4YWGH 4Z0XB 3T65A 1RK0A 2YPVH 4M8QA 5I30L 2DTML 4NRXB 1G6RL 3EYSH 5TF0A 3VGAB 1T6VN 1BP3B 4OD1H 1DN2A 2QQLH 2HJLB 5FUOH 1TJIH 2R69L 4UT7L 3NVQA 4KDTA 1QBLH 4X6DA 2ZUQC 3O3AB 1MHEB 4N5EC 1A9BB 3UBXA 3BIKA 1MH5A 1HIML 1UVQB 4L3EE 4MNHB 4KMLB 4X6EA 2XKNA 4MJIE 5BV7B 5IR1B 5E8OB 3QJHB 1NCNA 1AR2A 4GRWF 3DUUA 5K9QG 4FFYH 2UVEA 1MJ7H 5DD3H 1NFDF 4P2YA 2AJYL 1SYSB 1P69B 1S7VA 4XXDA 3SPVB 3HFML 2X1WL 4RISH 1PD6A 1R3JA 1VKXB 4LCUB 3BWAB 3HB3C 5DS8A 4EXKA 5HVWA 1OW0A 1KGCE 2VDMH 4YE4L 4HC1A 5ETUB 1P7QD 2VZUA 4JFDE 3E6FA 2D9QB 4M7KH 3R8QA 5BVJB 3VXRE 4XPTH 4U1NB 5GGVH 1B6DA 5D5ME 3OG6B 2EDRA 3CNKA 3B9VA 4G3YL 1QSFB 3P2TA 1JMXA 3RWGA 3NPZB 1JYVA 4GG6B 5EG6C 4CDHA 1ZGLA 3GFUA 3QFJD 4QHKJ 3OL2A 4ONFH 5BV7L 3SDDA 2FJFB 3CMOL 3FO9B 4JFQB 1Q72H 3PHOB 3I9GL 3MZTA 3RNQB 2BVPA 4JAMA 5KSBE 4LSSL 1MJUL 4HWBH 3IT8D 5I8EA 2GTZB 5IBLC 2Z35A 3DXAB 4YFEA 1G7JA 3QDGB 4FQHB 3TYGL 3I02A 4CU7A 1RK1B 5BV7C 5D2LA 1KJ3L 3BAEL 5LCVH 2XQBL 3OHXB 2NY3C 2VWEE 4G6MH 3RJDA 5DQJA 3ARPA 1QLEL 2BSED 1FFNA 3OKMA 3L3GA 43C9A 1N3NB 1YPZB 3BJ91 4QHLA 5JXEC 1Y6KR 1PQZB 1F90L 4PRBA 4I0PC 2X4NB 4C4KO 3VWKD 5FUCC 2VH5H 3HMWH 4DKEH 2P4AB 4UTBL 4RNRA 2WINB 4LCYA 3T3MF 1S7TB 3FQRB 1SYVA 3KJ6H 2XPGB 1OLZA 4M48H 5FDWA 4X6BB 3QIWA 3HR5A 3CDCA 2ZUUA 3MA9L 1LNUA 1LO4L 1GZQB 1K8IB 4XPFL 5IK3B 1UWGL 1YY8B 3BO8A 3RGHA 3EJYD 1RHHA 5A2FA 1EIBA 1HOCB 1E4JA 4PTUB 4UV4L 4V2CB 4KDVA 4TSBH 4NQSB 4YDKL 3VRJA 2OMBA 2VR4A 12E8H 5DO2C 3L5XH 1JVKA 3TZVA 3R8BB 4I4WB 2IG2L 4Z7VF 4JG1H 1GGCH 4B50A 3OKEA 1DQLH 1D6VL 1S7XB 5M94B 5JHDD 3BZFB 3NN8B 3ZMRA 5GJTH 2CIKB 4U33A 1J05A 1OAKH 3KYMB 4D0CA 3ES6B 5HPMA 2R29H 1AO7B 4YDLB 1U8LA 2ICEB 3BH8B 4GSDL 4H26A 4KI5F 3UTTE 1JWSA 3DOSA 1CT8A 4PJHB 3OKLB 3CFCH 4LPCA 1A22B 1NDGB 1GL4B 3UJJL 1F3DJ 2XZCH 3AFLA 3PP4H 4G6FD 1G7MB 4AZ8A 4R3SB 3MRKA 5FYLE 5KSAA 4LPVA 1I1YA 2OJEB 1KTRL 2X44D 1WEJH 1SEBB 4NHUA 1T7WA 4JPIA 4WEBL 2IQ9H 4U1KB 1A6UH 3EAKA 1KENH 1YYMH 1QACA 4QRRE 3N85L 5C07D 4PJXF 1B88A 2EH8L 1LP9B 3ULVE 3ECBB 1AGDA 4NNYA 1JTPA 3U46B 4X8XA 4W4OC 3AVEA 3M8OL 2QSVA 4AK1A 4BFBD 4M5ZL 4YHIA 2H41A 4IRSD 2ZKHH 4UNTA 2VZVA 3UPRB 4CUCA 3ULUL 5ALCH 3EYFA 3CLEL 2PO6A 2LVCA 4P2RB 3OJDA 1WK0A 3MCKA 2Y06L 1EEZA 1FCCA 5EDXA 3AB0C 4OZIF 2NQCA 3RBSA 4CVXB 2DTMH 3Q6GL 4XGZA 2J8OA 3WN5A 1HK6A 1UB6A 3ZE1E 2WSKA 5F6HI 4YDLC 4M5YL 4TPRH 3ULUC 2R69H 4M6OL 5JO5B 4UT6H 3L7FA 1G1YA 1RU9H 1JPGB 1GH7A 1G7HB 5KOMC 5J4MA 1HIMH 2IF7A 3S8WA 1VESA 4JHZA 3UTSD 5E6IB 2HJKB 4Y2DD 3VGEA 1C16B 4PRHB 3EYVA 3NCFB 3BPOC 1BZ7B 4YHML 3DIFB 3RZWA 2Y07H 1KJ2H 1QSED 3KPRE 3M45A 4OAWA 2H8PA 1NFIA 1ZOXA 1O5DT 5JZ7D 1MCOH 4K3JL 5JDJA 4NKOB 1WAAE 3MLYL 4ELME 4OCMC 5E7BA 3B9KD 4GRLA 5D1ZA 3UTPD 5TPWH 4LU5L 4LSQH 2FD6H 1EMTH 4G43B 4XAKD 3LVEA 3HG1D 2OR9L 5D7IF 3ZTJG 1AR1D 5K9JH 2VYRE 1H15A 2WNGA 2YBRB 3CFBB 3O4LB 1FVEB 4YPGA 4U1HB 1UFUA 4G3YH 1FJ1B 4FXKA 4UILL 3SDAB 1HH6A 3HE7B 4FXGB 2NYYD 3VXMB 4OZGF 2FR4B 1EV2E 2FLRT 5FO9A 2ZSVB 3CDYA 1YEEH 4ZPTA 43CAA 4BA8A 4Q9QH 3GSWA 1D5BA 4E41A 3D25B 4GRWB 1U93B 1ACZA 5LQBH 3VXPB 3DX9B 4ZOEA 1NFDB 2Q8BH 1AJ7H 1MIEL 3K74B 5SWSA 2XTLA 4M4RA 1NGPL 1C08B 4K07A 4NOBA 1TPXB 2XQBH 1WBXB 5C09B 4NZRL 4PRNA 1UM6H 3NH7H 3SJVB 5F44A 2MHAB 1UA6H 2P5WA 1NGWB 3SGEH 3MLZH 3DVNB 1A6WH 3DX7B 2W0KA 4KKBD 5DEGB 1KFAH 1SY6L 1SBBA 1GGIH 1UCBL 1XF3A 2JJSA 4MNQA 3QUYA 3W82A 4JFHD 3LRGA 3BYYA 4K3DH 4TRPL 3RWFB 3KYAA 1X7QB 2DDQH 3SKUD 2MMXA 3SDCA 2E7BA 3PWVB 3MJ7A 4HS8L 4MDJA 4S1QH 5DJCA 2FEDC 4XVJL 3FQNA 3WS3A 4JO1H 5IMOA 4LSVL 3SDAC 4YXHH 3HE7C 4QXUL 3O3UN 2C5DC 1YNKH 2CO6B 2UWEB 5TQ2L 4OFIA 4QGYA 2EDKA 1X5YA 1XT5A 1ZHKB 5DD6B 4N0UA 3QULA 1ZLWH 2O5YH 5CJOH 1FZKA 2VQTA 1BZ9B 4OZHF 1JE6A 4FQ1L 1R5WA 4JJ5B 2GY5A 4C55A 1Q9OB 1TPXC 3LKRB 1M7IA 2OQJA 2OK0L 4QHMA 3S88H 2E8YA 3U4EB 5C0AD 1A6TA 5DUMH 3TA3D 5B4MC 2HLFD 2WBWB 4GSDH 4NSKA 1KTKE 3QQ4B 1MCFA 2HN7B 2VXUL 5A16B 3GO1L 3KPPA 3NPSB 4QYOB 1DQTA 4DVRH 2W9DL 4BH8B 5CSGA 2VDLH 2W1NA 3UYOD 3BQUA 1EGJH 3AU1B 4G6KL 5C0IA 1OWWA 5F21B 1BPVA 5EZOH 2HKFL 1X5HA 3C9NA 1N8ZB 4Z7VB 1A9EB 1JUFA 1U8OA 1CLOL 3RL2B 4EDXB 4NWUH 1HXMA 1CCZA 1JI2A 3BD5A 3QDHA 2XG4A 2VDNL 3WUWB 1X5JA 4DN3H 5CILL 1MFBH 2Z31A 5EIQA 3GSVB 3MRNB 5A2JH 4LCCB 4JZJC 2HG5B 3P73A 5AAWA 1S7SB 1R5IA 3M8OH 4ZUTA 1U92B 4C83A 3INUH 4M5ZH 4P5KB 2YWZA 3FB6A 4U7KA 4ZS6C 5GRYA 4CNIA 1LK3H 3SKNB 3NMEA 4WV1B 3ESVF 1P7QB 2ZG1A 3HC0B 1OGAD 1G9MH 3FL7A 2NTFB 1SJHA 5C8JB 4WUUA 2I07B 2J4WH 3L3IB 1CDCA 1U8KA 1Y6MR 1HWGB 1EVTC 2ADGB 4NN7B 4J4PD 3QUMB 1CDJA 4K71B 4ODWB 3V6ZA 5HYJA 3D85D 5ICYB 2DQFB 2D31B 2VDQH 2XN9D 5IB1A 3NPSC 2YD1A 5FGRA 4PJXB 1I8IA 3WE6A 3OPZH 2YEZB 3VU2A 4M00A 3FHAA 2QSCH 1ZGLM 2W0FA 1WWAX 4YXKL 2FLBT 2R4SH 1FGVL 4RWYL 5DT1H 3ILPB 1NL0L 1U58B 4MAUH 3SCMD 3GJFB 5CJQL 5T1LB 2DOCA 4Y4HA 1D9KB 4TULL 5IVZA 4PJBA 4HXAH 4LCCC 1EHNA 4LU5H 3SGKC 4XCNA 3EOBA 3MNWA 1ZTXL 4DZBA 1W72A 4K23L 1HZHL 4QHNB 5SX5K 3OGOE 5K93A 2NY0D 2QADB 4XZUB 4PJFF 5FGBC 4HW6A 2VLJE 4UI2A 2DLIA 4KI5C 1FLRL 5FF6A 5IB3A 2GUOA 5BRZE 1JPFA 1LO5A 3GGWA 2I27N 5I15L 3MRFA 4NUJA 1PEWA 3MRBB 4WV1C 4RGMB 1OAUH 1L0XA 4ETQB 5D2NA 4NC0B 2HWZH 5DEZA 3B3IB 1I9JL 2MCPH 3G6AA 4AM0A 1I8KA 4NN7C 5B38A 1CZ8H 3KYKH 4YC2C 3HE6B 4K71C 4G80B 5EWIL 3W9DA 3LIZL 4HGWA 4J3TA 3DTXB 3C5ZD 4RAUA 1ITCA 5DVLA 4IIQB 4YNYA 5T1DH 1UZ6F 3GI8H 1KIQA 1RULL 4OFVA 5D7IB 1BVZA 5D7LD 1IFHH 5IHUH 3TNNA 4OV5B 1A1MB 3QDMA 2I60L 4WFGE 2E7HA 4ZNEE 2E9BA 1XGPA 3H7LA 1T2QL 2JB5L 4OZGB 5JHDB 3FQXA 1D9KC 4G42B 1SY6H 5FO8B 2CMRL 4KHTL 1W2KT 5JDSA 2P5EE 4TRPH 2E3VA 1T5WB 1ZVHA 1RFDL 4NC1E 2PCPA 5IB5B 1B0GA 2NTSP 2QADC 2AJXL 3WLBA 2F58L 4XPAL 2DQIL 5IBTL 1N2RA 4Y16A 3QQ9D 4XTRD 4Z7UE 4MQ7A 1HSAA 2AK1L 4RGMC 2EDEA 5GXBB 3TEUA 3W39B 2P45B 2GQHA 3L9RA 1RV6X 4K3EL 4X7TB 4V1DE 5JNYA 3F58H 2DD8H 1TETH 3Q6FA 3QB7C 2RB8A 4PRDB 1NAMA 3D3VB 4JZOB 5HHPB 3HE6C 3D2UA 3PNWB 4N8CL 4PJ7F 3L3DA 4HS6A 2G9HA 4KUCD 4RIRB 1AI1L 4QRSA 2GHWB 1A7QL 1J1PH 2IPUK 3CXHK 1WZMA 4LVEA 5L0QB 4IIQC 1XGTB 2OZ4A 1ZGLP 1LDPH 5MEQB 4RX4A 2B39A 4RDQF 5GGTA 5ITBL 2J88L 4XC1L 4WUKL 4GMSL 5TQ0L 1FZMA 2VO5A 3V5KA 1AD9A 3MV8D 1HHIA 2IANA 4NQXB 3DURA 4OZHA 4XVSH 5E2WH 3GO1H 2UZIL 3GM8A 1DBKL 2F74B 2UV3A 4K9EH 4ETYA 3DBXB 1MJ8L 3UPCA 1FFQA 4FTVA 2CDFB 2FECI 2GKIA 1HHJA 2JKXA 2VZOA 4OCWH 1JYXA 1FFOB 4I9WD 4XBPB 4HUVA 1I9RL 1PG7H 2YC1B 3U1SH 4DCQA 5E2JA 2FWOB 1BF8A 5CILH 5MEOA 3RZCD 5CD3B 1QSEB 4YHZL 2H2SD 2YUVA 4FNLH 5D7SH 5DJXA 1FNEA 3HZMA 2ZP0T 2XXMB 4X98A 1S9KC 4QHKI 2W65A 1YDPB 1G7PB 5EFIA 1MAJA 5L0QC 3WFDH 4QTIL 4R90L 2GK0B 3V7AG 4S0SD 1ZAGA 1U8HA 4JPKH 4ZAKD 3QI9B 4NN5C 4W6YB 1XEDA 2HFEA 1CXHA 2W60B 4APQB 4Z9KB 4ODTL 4FXLA 1MAKA 2QQNL 3FCTB 4D9LL 1KELH 3C08L 1EZVX 4M62L 5FM5O 2APBA 2IBZX 4MJ5A 1NCBL 3HAEA 2X4SA 5CEXA 4QOKA 5D6DA 4CBPA 4YX2H 3JUZA 2GJ6B 3QXAA 2EC8A 5EIIA 1MCIA 2PNDA 3QEQE 3QT2A 3L3HA 4CU8A 3ETBF 2CUIA 3RDTA 4KK6D 2NW2B 1M7DA 1Q0XL 1NL0H 4QTHA 3DV6A 5DC9B 3VH8A 4LHUB 1MRCH 5TDPB 4PJ8D 3TIEB 5EN2B 3GMRA 4HXBH 4NT6B 4HIIB 1F6AB 4JFPA 4PJIA 3OJVC 4N9GB 5IF0B 1PY9A 1AFVH 1KLFA 1MCHA 1X5KA 4K23H 4D2NA 5JZ7C 3AY4C 5HI4D 1YYLL 1XH3A 1JCKA 4M7JL 4BQ6A 4U6XB 3NABL 1FLRH 4K7PL 4BYHA 3B9KC 2YPLA 4JDVB 2A77H 2BP3A 2VUYA 1I1FB 4HS3A 2JIXB 5IQ9A 4MCYA 1RUQH 1AR1C 4N9OB 3QI9C 4JRXD 5CEZH 4U1IB 3KYNA 4APQC 1I9JH 4M7ZC 2E7LC 3RUGE 1FBIL 4PV8A 3C6SB 3K8LA 3DV4B 3O8XB 5IUSA 3QDJB 3IDMB 1H3WM 2KUTA 3UEZA 1ZHLA 2DQDL 2R0WL 4HDIA 5DJ6A 1LO3L 3SKMB 5CINL 3H9SD 3EO1A 1REIA 2X4UB 5ACLA 1UH4A 3V0VA 3R06A 5K9KB 4PJFB 4KPHH 3GNMH 3MV9E 4UIMB 3U9UA 8FABB 2V5SA 2Y9RT 3X11A 4O2CB 5JW5B 1S5HA 3OG4B 1EHAA 3LEYH 3OB0H 1PW3A 1X3DA 3I50H 4P2QA 4X5WA 3P40A 2CMRH 5I73B 3V4VH 1T89A 2GSGA 1RFDH 2BVEA 4MX7A 1JZ3A 3IDIA 5J89A 2AJXH 2F58H 1CDBA 4XPAH 4RAVB 1LO0L 4F9PC 3OAZK 4L3ED 4HLJA 4MJID 5I76B 3QEUA 2WIIA 3WDIA 2GCYA 3WUWG 2AK1H 2R2BA 4CADA 2XFXB 5F7EL 2DQUH 3MNVA 1M71B 2ATPB 5L8KB 1I9IL 5F1IA 4HWBA 4OBSA 1T20A 3SGJA 1IGIL 4F7CB 2CJUH 1XIWA 5ILTH 4PJ5B 4HUWA 4KRLB 3O8XC 5DQ9B 2W0PA 4MHHG 1HHGB 1KGCD 3ZDXF 1A2YB 5CSZA 4MJ2A 4CAGA 1R24B 2JB6B 2XZAL 4JFDD 5KSUB 1QR1B 3U0PA 1Z0NA 2Z9TA 3VXRD 1P6AB 3BKCL 3H42L 1VFAB 4Z77A 4XMKH 3STZB 3JV0A 4N1CA 4BZ1L 1CIUA 4WUKH 2J8UE 1S9VA 5A2LH 4KZEH 3SEPA 2P44B 1WCBA 4LAQL 5CWSB 4FQXD 2VXTL 2DQHL 4HKXA 5CBAA 2V9RA 3AM8C 5I73C 3TA3C 2VUOA 3MBED 2RGSA 4OGXL 3L1OH 1S8DA 1EEQA 3PXJA 1QBAA 3IJSA 3GSOA 2H32H 1IAII 4PJ7B 2L7UA 1UJ3A 3ZTNL 4HIEA 1JIBA 2YK1H 1X44A 4EQ3A 3UZVB 4JY6A 5HHXH 5T3ZE 3QPQD 5HI3D 2VLRD 1QO3A 1CDYA 1Q8MA 2UYLB 1NMBL 3GMPA 4NQDB 1KPUA 2GJZB 4BUHA 4EDWL 2F5AL 4MZ2A 3BKML 2AI0H 4PYHA 2BNUA 4ZFOB 1TJGH 4HFUH 1JNJA 4R90H 3QUZA 3W5MA 5ITFB 3GHEH 5HHQB 1AIFA 1RIVH 2R39A 1K2DB 1XCTB 1B0RA 2D3VA 3GMOA 4H0GA 4D9LH 2Y5EA 1G7IA 4L8BB 1CVSC 5FKPA 2AJZB 3KXFD 3OGCA 1NCBH 5C0JB 1OAYL 3Q1SH 4JM2D 4J4PC 5E4IA 4Y5XB 2YA0A 3ARFA 3PDOB 2Q86B 3BP4A 1FDLH 5B22A 5DJZA 1Q0XH 2J6EL 1DANU 4JHAL 4OM1H 5E0QA 3MRHA 1S9XA 1CGTA 3VXQB 3IGAB 5SWZA 2O61A 4ZFOL 4OI8A 1HYSD 1FZOB 1NGYB 5D7LB 5C2UB 5E9DE 2AGJL 1OSZA 4LLDB 4ELKB 3QEHA 3QIUD 1HQRA 1DN0A 4UDTB 4OIIL 4BH7B 3LKNB 4JVUA 2GY7B 5LGHH 4HJGA 3SCMC 3QRGH 4RFEB 3QNXA 3VWJD 1KN2H 3QIBB 3WHXA 4M7JH 3X3GL 5DA0B 5TE4H 3MLXL 4K7PH 5MENA 4NO5A 5L2KE 4FP8L 1OT2A 2DB8A 1RUPH 1UWXH 1YNLH 5IGXL 1TXKA 5DVKA 5FYLD 2NY0C 5D5MF 2DQGL 1DVFD 1KEGH 2OX5A 4JRYD 4O2FA 3S5LB 4EIGB 2IGFL 5DK0B 4F37F 1Z9SA 2R9HD 4M6NL 4HBCH 4Y19A 4HX1A 1CL7L 1JFQL 4I0KA 5D1XD 2FH8A 2ESVE 3N1GC 3Q3GA 2PW1B 4O02H 4U3HA 2HFGH 3TBWA 1I3UA 3RPIB 2R0WH 2UUDH 2PTTA 1VSCA 5KBNC 1MUJB 4Y5XC 1KJ2A 2ZG3A 4C56A 2BK8A 3QDAA 5EU4A 2F5BH 3VGBA 1RZJL 3BPNB 2DQTH 2VDPH 4KH2A 1QFWI 3MOAL 3VGDA 4XNMA 3F62A 1FRGH 5JIPA 5IJKC 1BD2B 4WI4A 3BT2H 3VFMA 1E4XI 4JY4A 1AQDB 4ZD3L 1RZJC 5DDHA 2FECL 3MV8B 4LSPL 2WK2A 2GW5A 4L5FL 4M6MH 3SO5A 2FB4H 3LRSB 4G9FB 3R1GL 4W6XB 4CU6A 5EC1A 4M1DH 4X5XB 3PWNB 4E42B 5GSVA 1T04A 1OLLA 2B2XL 5F7EH 1T1ZA 1GVIA 2R0LL 4XPGH 3CGTA 5CS7A 2Z4QA 3KPRD 5JXEA 3QQ9C 4XTRC 2IBZY 1IGIH 2I25N 1LE5B 1SYSA 2ZCHL 4I0PA 3T77B 3NIDE 4FQIH 3SPVA 4WEUD 4NUGL 4KY1L 2DLFL 3AROA 5DRXA 4HKZA 1UCTA 2DLHA 3TO4D 2WV3A 4FQLH 5CGTA 3MYJB 3O6KL 3RZCB 4R7DA 1JJUA 4HPYH 3CVHH 3SGDI 1QRNE 2KZ1B 1IEBB 3W5NA 3KVQA 5JW4Q 3K8KA 1KCLA 1L9MA 1EJOL 5C0BE 1KPRB 3W0WE 3BPNC 2NNAA 4U1SA 3TCXA 1QSFA 3V5DA 1GGUA 5L9DH 4DUWA 1U3YA 3RTQB 1X5XA 2G2RA 4LAQH 2OSLB 1I75A 4Q7DA 3H3KA 4JO3H 1EDQA 1N7ML 2EIDA 4L4VE 2FJFA 4LKXB 5C2BL 1IILE 4ZQKB 3AC0A 3MV7A 4QXGL 4ZOBA 4OGXH 4Q6IB 4NCC2 5IW1B 1M7XA 3DLQR 4OCYH 3MRJA 2GTZA 4NP4H 5E8DL 3DXAA 3ZTNH 3QDGA 5IM7A 4MAYB 4FQCL 3P4NB 5T3XE 2CXGA 1I1AD 3DRQA 2IQAA 1NGXB 3BDYH 5EU6B 1MRDL 1A6ZA 5J9PA 4JPVL 1QPPA 1J8HA 3EGSA 4HWZB 2YUZA 5KAQG 4PRID 1DUZA 4LNVA 1W8OA 1AKJD 3I6GB 3VGGA 3VFGL 3ULVF 4XT1C 1PEZA 4X6FA 2VXVH 3RZCC 2R2HA 2APWA 2GT9A 5F3BB 1I3GL 1RZIB 1YEGL 3RRQA 5C9JB 5IMLA 4YHPB 2H2SC 4KKCD 1ORSB 3NACH 3KS0J 3ZT5A 1PX3A 1VADB 1MCCA 2DS4A 3B83A 3WSQL 2VAAA 1CGYA 2QL1A 3PABA 4TUKH 4UAOC 3DWTA 3O9WA 3Q5OA 4NRYA 3LN9A 3BESR 5FAAA 1ZANH 1CLZH 5EULV 2F19H 2OTWB 2XA3A 1N5YH 1HWHB 1IAOA 1U8MB 3GKWL 4PJDE 4QY8B 1RAMA 1BOGB 4GW1B 5DC0A 3V79C 3IDNA 1EGJA 5C6PB 3BUYB 2DIJA 4ODHL 4P3DA 3BVNA 3P9MA 4G6JL 4B7IA 4QRPA 4Q6IC 3ARBD 1MLBB 2YRPA 3MR9A 1W0VA 3GMMA 1L0QA 3UZEA 1YECL 1CFTA 4IOIB 1RIHH 4MAYC 2ICWB 2A9MH 2FX9L 4X9BA 4F7EA 2ATKB 3H9SB 2R1WB 5I2IA 3VW3H 2VC2L 3ZYZA 4F7PB 1R3IL 3KYMA 1FYTE 2V2WB 4PB0L 4KK6C 4OIIH 3GBNH 1WAAF 4GXVL 3FO0H 2OBGA 4PJ8C 1MCDA 3OJ2C 1KG0B 2WUCL 4PJAF 3VI4F 3TC9A 3QCTL 3OKLA 4BK4A 3F6LA 2AXGB 2ED8A 1SJVA 4IRZL 3ARGA 4HZLA 5HI4C 1KCKA 3TBYA 2WAHA 2HKHH 4U1GB 4L3EB 2DI8A 4MJIB 2CDEB 2AEQH 3QEGH 1GYAA 1ZLVH 3RKDD 2XA8L 4R4FH 5DGRA 3JWDL 4C57C 1JNHA 5I17A 5LJYH 1AGEA 1CL7H 3L6FA 3WXWH 1F5WA 4FMFA 4KDWA 1MQKL 4KQ4H 1OM3H 4MXQD 2MOVA 1U42A 3TJEH 4PG9A 3W9EA 4XNXH 3U46A 1C5BL 3RP1A 3HUJE 3RFZC 2GFBB 3JWDC 4M7LL 1HE7A 3TVMD 4OIBA 4P5TB 5FM8A 1RZJH 2R15A 3HPJA 4KJYB 4U1LB 3W2DL 4JFDB 4G8GD 1E27B 3HZYA 3VXRB 4D9QE 5AYUH 3T8XB 5IMMB 3OAYH 4CVXA 5D5MB 1A5FL 5EUKB 4Q9CA 4ZD3H 1IAIL 4LSPH 2FYYA 2OL3H 4IOFC 3I6LD 1VFMA 2WBJA 3NCBB 4FQXB 5CKAA 1G7HA 4PJGA 5KJRH 2BFVH 4S1RH 4JO4L 2R23B 3ALXA 2XT1B 3H0TB 3MACL 5F1SA 5KSBB 3GRWH 3KPTA 1BQLH 2CO7B 4CMMB 5J3HD 2QQKH 3KDMB 3RNKA 2R0LH 5JPMB 3ZKQD 3L3JB 2N1KA 4U1GC 3UPAA 1QNZH 2KDGA 5DUBA 4LCWA 1IGJB 1MVFA 5HYEA 5D71H 3VFNB 2ZCHH 4UOW1 3PWPE 5C0CE 1H8SA 5E5MA 4I2XA 1D5MB 4XNYH 3KPLB 4DK3A 4XVTL 3O11B 2JJVA 2BXYA 1BWMA 1BGXH 3X12A 3EYQD 4FG6D 4LLMA 4X7FC 1T21A 3MJ8B 1FC2D 3QH3B 3PDGA 4UV7H 4PRAA 2VLJD 4LSUL 2GTWB 1N4XL 3TO2A 3O4LA 4NOFA 2NMSA 5EPMA 1M05A 1SY6A 4XNQA 1NCCL 4XCEA 3SDAA 4WI7A 1HILB 3ZKSD 2FATH 1U2CA 2VDOH 5K9OB 1DBAL 5E08H 2BSSB 1U93A 4I48A 1HH9A 1U8IB 1T80A 1IC4H 3DYMA 2F53E 2JELL 4FQXC 1OPGH 4NQCB 4LLQB 1IGTB 1IL1A 2HFTA 4FQCH 5EUOE 1BFVH 4JM2B 5I1JH 1UKTA 1BEYL 1PKQE 4Y4FB 5F9AC 4GUPA 2E6JA 4GRMB 4WHDA 4LEOB 4AL8H 3MCLH 2CIIA 4KGJA 2MQ0A 5IVXE 5ESVA 3EDEA 5HYFA 2EIZB 4GT7A 4WFGD 3SDXA 3ZKXC 2JLLA 3QPQC 2VWEC 1A21A 1CTOA 2UZXB 2E7CA 2YN5A 1FIEA 4HHAA 2XKSA 3A67L 3V6OA 1I3GH 5HDOA 3AGVA 3CPLB 2AEWA 2AQ3A 2EXYD 4ALAH 1N6VA 3S5LG 3VCLA 3L5WA 4G8EB 5CCKL 2YA2A 3UTTB 1MHCB 1SMAA 1UWEL 3H8NA 4K7FB 5I1KL 2DYPA 5I1GH 3PWJA 1MI5A 3NFPB 1V3LA 4Z0BH 4WIQA 5FKAA 2NX5E 3D1MC 1IM9D 5L7XH 5I1DB 1H8OA 1P53A 2O5XH 1YNTB 1MEXH 3O2VL 3LZFH 4JZJA 3VXSE 2AV1A 4ODHH 4OD3H 2ZSWA 1I8MA 2F54A 1P4BL 5D1XB 1DQQA 1QFWL 4QRRB 4PGBB 4U0RB 2FJHA 3T2PA 4WWKD 4H5SB 4IDJL 4KK9D 1OP3H 3VXNA 4MD0B 1U3JA 2YSSA 4JM2C 1I1RA 2R1XB 2HMID 2FX9H 2XQYG 1YEIL 4NQUA 3S4SB 1ZT1A 1E4XL 3T3PF 2BY0A 1FSKB 1A02N 3T2QA 2X40A 3MLRL 2RCSL 4JFXA 4CJ0A 3G08B 2ZUSA 1UYWH 4TTDD 5F96L 4KTYA 3RX5A 1HYSC 3HI1B 5KVGL 3MRRA 3M17B 4LQFH 2NR6D 4QYOA 4YK4B 5C71A 2H9GB 4JQIH 5FYLL 1DE4A 5CGYD 5BZWA 3VRLF 1VGEH 3VMPA 3BISA 1TZGL 2HP4A 4OLXL 3G5VB 4L8SA 5KVDH 3T1FB 2VITB 1FNLA 4Z78A 3MUGA 1F4XH 5I75B 4YR6A 1KLGB 4NNPL 4A6YH 3SE4C 1A9EA 1AQKL 4PRPD 1S7WA 2GI7A 1DDHB 3F7VB 4KK8D 1XGQA 1JK8B 1D3CA 1L6XA 5ID0B 1Q9WA 1CIDA 1DVFC 4UOJA 1NAKH 4YLQT 1ZS8B 2FHBA 1HEZB 4PB9L 3KPRB 2NZ9D 3MRNA 5D1QB 4I5BA 5GGSA 4JLRB 2PYEE 4LCCA 3LQMA 2A6DA 2JCCA 4MA7L 4Z8FL 1C5BH 4FQJH 5DEFA 2R9HC 1C1EL 2EE6A 4XBGB 4AIZB 5D1XC 3IKCB 1D5ZA 4JFOA 2J7LA 3VFPA 5FGBA 4ELMB 4HLZG 4U0RC 5AUMA 4GQ9L 1RIUH 4HQQH 2BRQA 3JV6B 3QFDB 4PJAB 5J12B 5DSCB 5DURD 3OBAA 4IRJA 4MB5A 1O7VA 4XWGL 5FUZL 5IEHB 3DHMA 2FZ3B 5F9DC 1OAZL 1FSKC 4RQQB 4X7EC 4H88H 3KGRA 3C8KB 3MLSH 4BZYA 3CXHJ 1A6VL 3CLFL 1OP5K 4OUUB 3L95B 25C8L 4X6DE 1KN4H 3NA4A 3B4NA 3BDBA 3QFJA 4YGAB 3T2OA 1OGTB 1X4XA 4YK4C 1Y18A 2XWJB 4GKSB 4MA3A 3RX7A 1FH5L 2PXYD 4RAHA 5JORB 4JHBA 4M1CD 4AENB 5I0DA 4DW2L 1V7NL 1WZKA 4WDIA 2PTUA 3T0ED 5EIVA 1Y0LA 5I75C 5CAYB 3E8UL 2E27H 3FT4B 5HYQB 1U91B 1FG2B 2YR3A 5ISZB 1CVRA 1ZA6A 1W8NA 2ADJB 4W70A 4ZO6A 4YXLH 3N50A 4LVOB 3OAUH 4MDIA 2DWDB 2E6QA 1FE8L 2ZUWA 2LVEA 5D1QC 4M9PA 3MA7A 1AKJB 2I9TB 1ZT7B 3KLAA 1HKLH 1T1WA 3LV3B 4WHCA 4HAGA 2NW3B 4JKKA 4KQ3L 3VWKA 1NGQL 4LSUH 1MAML 1DQML 3BGMA 1UH2A 5J12C 4E0RB 3EYOB 2Y6SD 2DM7A 5HGDA 2GSIA 2X4QB 2B5IB 3O3EB 5DTFA 5DHVH 5BXFB 5D8JL 4I3RL 1VEPA 2D7NA 3QO1B 5CP7A 4M43L 4LLVA 5C0FA 3PWLB 3JWOH 3T4YB 4RMTA 5SX5H 4G80A 5CHNB 2ADIA 4Y1AB 5HDLA 3K2MC 4X6CA 5EA0H 1T7XA 2YKLH 1QVOA 5IB2A 3SOBL 3BH9A 3BI9X 3E2HB 5HGHB 5D2LE 4DUXA 1JHTA 1H3PL 2R4RL 4XWOC 1WQVT 1P4IL 3JV4A 4LLUA 1KJMB 3O3DA 5JW4M 1A1NB 2X10A 3L3KA 4R6UA 4MD5B 5DVMA 3MUJA 1FORH 4PJ9D 4U3XA 2A2QT 1ACYH 1XF2A 2MNUA 1KIUA 3O3BB 2XOTA 4Y89A 4PJEA 4RMQA 3EYUL 3OXRA 1GSMA 4UQ2A 2YD8A 3RIFK 2VZTA 4JVPA 4TOYH 3DGGA 4PUBL 2DMCA 2X1QA 1YUHB 4KKCC 4R2GB 2OXHA 2B20A 4H25A 2IMMA 1TTUA 5EO9B 4NZTL 4NKMB 4WGVB 3O2VH 2IFGA 1MHHB 3REVA 2V6HA 5LKNA 4U7MA 3FQUB 5GSRA 2AJSH 3IETB 3NGBB 3SE9H 4MA8L 3I84A 4H8WH 4WCYL 1A7OH 1YEDB 5C07A 3QG7L 4LKCB 3O4OB 4Z7OE 4MQTB 2RIKA 3KPNB 1CWVA 3ARBC 5EBMA 3KNBB 1WIPA 1JZ6A 1JWMA 4IRSA 4HIJB 3M1BA 4XHJD 3TVMB 4BQ8A 1WV7T 3T08A 4J2XA 4ISVA 3P0YH 3ZHLA 3UO1L 5DJAB 2VLLB 1GHFH 3PV6A 2BERA 5F96H 4U6VL 2XWBA 1DL7L 4OGYL 1GXEA 2R8SL 3AS1A 3K46A 1FFPB 3BRGC 3V6FB 2P8PB 5I6XC 4MQXD 2IAMA 5KSVA 1LD9A 1G7LB 1KB5B 2QHRH 3MRIB 4KTEH 4R2GC 5GGVY 3UTSA 3LS4L 4BSWB 3NCEB 4HUMB 4Y2DA 5JUEL 3E1F1 1C5DB 1OD7A 5HHVH 3RUGF 4WENB 4PB9H 4XX1E 3V0WH 4Z8FH 3RKDC 3WIFB 4NBXB 4P9HL 3CDFA 3NGBC 1OAQH 4OT1L 1CICB 4MXQC 4J7RA 1IBGH 1YDPA 1UGNA 3B9KA 3O4OC 1VGKB 2IALB 3G6JF 3SKOB 2IH3A 1K4CB 1D6EB 2O5ZL 1EFQA 4XRCB 3HG1A 3CFEB 1UEYA 2JTDA 4P9HC 1TIUA 3MLTA 3TVMC 4KHXH 2VXSH 4RWHA 5E2UL 5BRZB 4GQPH 2XNAA 1SBSL 3QO0A 1FZJA 4NDMB 3L7EB 1QLRA 3CLFH 1TQCB 4KTDH 3RWHB 1CR9L 3HLAA 3WD5L 3U0TB 5H35A 2XWTB 2AVGA 1HCFX 3TV3L 3RVXC 4HH8A 4RFOL 1FH5H 2JE8A 3QA3B 3ZE2E 1EBPA 1DUYB 1KB9K 2PETA 3MJ6A 3X13A 1BVKA 2NY4D 4LRNH 4NQEA 5GZND 5DQDH 3V7MA 3RVVD 1CD1B 1HI6A 4E5XB 4GMTL 4NM4L 3DSNA 5JIIA 5KTEH 1F4WL 2Z93A 4K94H 2FO4B 1CE1H 5E9DD 5T5FL 2OI9B 4I3SH 4Y8DC 1HKFA 3ARUA 4LARL 3GBML 3G5ZA 5GJSL 2VQ1B 1KBGL 2IADB 3TM6A 4EI6B 1LE9A 4N9GA 3EHBD 1RMFL 1GPOH 3FT2A 4GRWE 1NGQH 1IC7L 2VABA 1LILA 1MAMH 5F3HA 3VFWB 5L2KD 1NFDE 2P5EB 1OY3B 3PL6A 4TNWF 4U6XA 5KW9L 1T2JA 3EYQC 4QRUB 4QRQB 3VDAA 4FG6C 4ZPVA 3VD5A 4NKDA 4ZFGH 5KZCD 1GZPA 1TQBC 2FL5B 4OLZL 5T1MA 4YUEH 4EN3B 5D8JH 4CJ1A 2YUXA 4EVNA 2J8UF 4Z7UB 4M43H 3O6LL 5ALBL 3QCVH 3DVIA 2B1AL 4E41E 1QKZH 5GPRA 3WL9B 1TQCC 2ESVD 1IM9B 4ONOA 2X9WA 4JFEA 3QXUA 4V1DB 4D8PB 3S4SG 2FSEA 1I3RB 5SWSE 4RRPA 1U8QB 5ADOL 1GGBL 4GG8B 1INQB 1ZVSB 2RFXB 3KJ4C 3GSRB 3JTSB 1NBZB 1OTSD 1NMCB 4TVPH 3VXUA 4P4RA 1XF4B 2IPKA 5EORH 2IWGA 2P5WE 3MRPB 1EO5A 5TE6L 5JW5A 3EOTL 3CVHA 3W11D 4NO3A 4RGOL 2OI9C 1IQDB 2DJUA 5C0AA 4LVNB 1VFBA 3ARDB 2VRAA 1F8TL 4MNQE 3TA3A 3JVGA 3B5TA 3GMNB 1JHKL 3EYUH 4PV9B 4ZXBB 3IFNL 3FO2B 5EO0A 4XBEL 5E8EB 2ZPKL 3QUXD 4EJ1C 1IAMA 1UM5L 4WO4D 5CSBA 1JZ4A 4KVCH 1MOEA 4NC1C 2UVFA 2EXYC 2M1KA 2VDKH 3L5JA 1RJYA 5FHAH 1QFUH 1HINL 1IM3A 4EN3C 1NBVL 4X0KA 5TFSH 3U4BH 1OB1A 2A74B 4YBLB 1N59A 3D39A 1A3LL 1WBYB 1XCQA 3MMEA 4PP2B 1IMHC 3IFOB 4MA8H 5FYJE 1QQDB 5DQ9A 2IMNA 4N0UE 5LBSH 3OAZH 1KTDB 2RAMA 3NFNA 2ERJB 4DGIH 3DI2B 1QRND 4N0RA 3IFPA 2FBOJ 2JB6A 4UTAH 1JGEA 4LSTL 4N0YL 5C0BD 3W0WD 1I7ZB 3SKJH 4AH2A 4S2SB 4KK9C 4TUOB 3NIFF 2HMIC 3C5JB 5ID1A 2JJUA 3NCYS 4R7NB 2G60H 4PD4K 1OGAA 1KIRB 1G1CA 4L4VD 5IEKB 1CU4H 3LY6A 4LVNC 3ARDC 1U8PA 2YPKA 1GOHA 4J4PA 4TTDC 4ZXBC 5HHNA 3BGFB 3D85A 4U1MA 2XN9A 1ADQL 4XP9L 1P7KA 4N0FB 4OZ4B 1OARL 3MLUL 2BHUA 1QA9A 1U8NB 4IHOA 3IB4A 1TFHA 1TVBA 5C7XH 2MKWA 2VZ3A 5CGYC 1CTNA 3N9GH 3CXDL 5JUEH 3QEQB 3QP3A 4Z76B 4UQ3A 4YBLC 4J12A 3T2NH 1CDHA 4OLYH 5DD1H 4P9HH 2D7OA 2EDFA 2VL4A 4KK8C 4BELD 1HCVA 3SCMA 2BY3A 1KCVH 3CU7A 5KS9A 5T1KD 3RL1B 3LQAH 2X4OB 4XNZB 4JN2A 2NZ9C 2ERJC 4ZFOA 5IKCA 4M8VA 4QHUB 3P9LA 1MIMH 3UX9B 1WITA 3ET9F 3MNZB 3D69B 1FVCB 4PJXE 2CUHA 3WEXB 3TYFB 1J8KA 1S7RA 2EDXA 3DX6A 2A6JA 3JWNC 5MI0C 5E2UH 3DROA 3S36H 4WUUE 4M7LT 2EKSA 3KHOA 1AGBA 3MRGA 2DBLH 3PQYD 3RWCB 5C86A 1A0QL 1EAPB 1ES0B 1XF5A 4GAGH 1ZWIB 5B8CB 5CD5D 5EOTA 4PG2A 5HYJE 1CD9B 3DRTB 3RUGB 1AGFA 5ACZB 1J86A 1MJJB 2NY5L 1PBYA 4K3HA 4NKIH 2ITDA 4OCNC 5IB4A 3N06B 4OZIE 2Q20A 2MCG1 1JRHI 4Z7NF 2Z92A 3AAZA 3OXSB 3HCVA 5HGGS 4JFYB 3TIDA 3BGFC 3FT3B 1HHKA 3PDOA 1IKFH 2Q86A 3C5ZA 3RHWK 5ESQA 5GS1C 1YZZA 3HNTL 3V5HA 2P24A 2FX8H 2PXYC 2NY5C 2BC4A 2BJMH 4M1CC 3MODL 3V0AC 2BNRA 1FYTD 1ZMYA 4JG0L 3KPMB 3MV9B 3AXLB 1ZLWK 4P9MH 4PJBE 5TDNB 4LHJB 5AZ2H 3EDDA 3VFVA 4O4YH 4Q6YA 3GSUB 1DP0A 5CMAA 1FV1A 2IH1B 5AYQA 3ARWA 4R4ND 2X4RA 5KW9H 3MV01 1QRKA 4XNZC 4U31A 1NUNB 3U6RA 4URTB 2LU7A 1NMAL 1SM3L 1G0XA 1F42A 3EOAA 1FNSH 2A73B 3NCJL 1DFBH 2D4DA 2OL3A 4BKLA 6CGTA 1PLGL 2HVKA 5D2NE 1CFBA 4ODUA 1EXUA 5E8NB 2Y6SC 4JANA 4ZUVB 1E4WH 5B8CC 3GRWA 3HC4H 5HGBA 1RHFA 4F58H 3KAAA 1BFOB 3C5SB 5EZIH 2CLVB 3IDYC 1EPFA 2HT2D 2BOCB 3FB5B 4HUXB 4AY0A 4IOSD 1JPST 2EE2A 4DK6A 3TLRA 1SJXA 5CEYB 1R5VB 1O0VA 1KLUA 2EH7H 3C6LB 5EBLA 3LKSB 5I1AB 1T0NA 5E2TL 3MXWL 3QDME 3TH4T 1TNMA 4D9QD 1C7SA 2HT4D 1E28B 3GSNB 4RGOH 2K9UA 4MJ6B 1FNGA 2J8UB 1F8TH 4Y4KA 5AG8A 4L1HA 1IEHA 2Q6WB 5KVEH 3MV8A 4LEXL 4LSRL 1B4JL 1JHKH 4G6AD 4BFIB 3IFNH 4PJ9C 4XBEH 4ZOCA 4CVZA 3U9PL 4QXTB 3S96B 1HNFA 2QR0A 3P11H 1NCDL 2OTUB 1NBVH 2A6IA 4KUZH 1Z9OA 5E99L 3TBVB 4X9IA 4P23A 2GAZB 2H3NA 2EXWD 3QQ3B 5C0CD 4PJDF 1BX2A 3EIFA 2QEJA 3MREA 3L3OA 2VZSA 1YY9D 4G8IA 5D6CA 1MY5A 4X4YA 1BREA 4XMPH 1G7QA 4XP4L 4F2MA 3IDUA 4Y88A 5C0DB 1HXYA 4N0YH 1ZLSL 5JLZA 4UIKL 1XR9B 3IFLH 3QCUH 5E2VL 5ICZB 3C6LC 1ZHBB 3OKKB 1YMMA 4RMWA 2PKDA 4Z18A 1NCWH 5I8CA 2IANE 2IFFL 4Z95H 4ZAKA 3F12A 4OZHE 1FIGL 1F3JB 4YDJA 3V8OA 4Q2ZA 4Z5RA 3KR3H 3UTQA 5GISL 2BOBB 1YJDL 4YHKH 2DQCL 3FMGL 4M61B 3PXHA 2EDNA 3RU8H 1I8LA 1T03L 5FYKE 1ADQH 5T3ZL 2LQRA 1D5IL 4FFVD 5J6GA 1CLYL 1AC6A 1TCRB 1YJDC 4GKNA 2NY4B 4W68A 1EUUA 4KGLA 5IIEB 1MF2L 5JQHC 4FQQB 4HCRH 2C4FT 2ZWLT 1ZT4A 2L0DA 3CSYB 4PJ8A 5E9DB 3UJIL 4YAQB 3G6DH 3BFOA 1CG9A 2C4XA 4ERSL 1NKOA 4WI3A 3K0WA 3WLWD 4IS6A 1YQVH 3BZ4A 1NC4D 3ISWA 3CH1B 3TCLA 2ZZUT 1I4FB 1ETZA 4LBEB 5L2KB 1U3ZA 4P46B 4MD4A 5BZDB 1BVLB 3QZWB 2NX5D 4N1HB 5KZCB 1F4YH 5D7JD 4R97B 3U0WL 2CRYA 4P4KD 4JRXA 5JHLH 2HH0H 3VXSD 4DUVA 3FN0L 3KPSB 3BUYA 4YHOL 4ZTPL 4QOKE 3HRZB 4A6YA 2ESVB 3SY0B 3MGOA 2AJVL 5F9WB 3A6CL 3HZVB 1NC2B 3IF1A 4N5ED 1AD0B 3JSSA 2ICWA 1DBBH 3KYOA 3WFCL 1T5XB 4JE4B 2MWCA 2ATKA 4GKOA 1VACB 4XI5D 4JQXC 2NY4C 2E9JA 4L3CA 2HTKD 1DSFH 1MCEA 3FRUA 5GZNC 2YD3A 2QJDA 2X89D 3RVVC 1NEZA 4PJIE 5FB8A 5KVMC 5C0RL 2LV4A 5GRZA 4YHYB 4NCC1 2W9EL 4ONHA 4L8DB 4ONGL 5DRNA 3MOBH 1N6QL 1HQ4A 4PGJA 1NDMB 2DI9A 1PGRB 1TDQA 1Y6NR 2YPLE 3EHBC 1NMAH 1SJEB 5EO1A 5J0BA 3N1QC 2WP3T 1S7UA 2OR7A 1ORQA 5AZEL 3QUXB 1PLGH 2DBJA 4P5MA 4K7PX 5EOCH 4N8PA 3FB7A 4P46C 1GJIA 4PJFE 4R97C 2PW2B 1JI1A 4N8VB 4JY5L 4LDOB 2H1PL 2C1PB 2PYED 2V7NB 4U6HB 5E94A 5HTSA 5LAXB 1DLFL 2X4PB 3Q5TA 3TT1H 2RJMA 4NN6B 3U2SA 1MCNA 4G9DB 2J3SA 1A1OB 3IJHA 4YFLI 4MXVE 2XZQL 3RY6C 5TE7H 3VFUB 5JR1L 1QRNB 5E1AA 1CYGA 3IXAA 3ROLA 3MRQB 32C2A 2CRIA 1OTSC 2WWKT 3W0WB 2M8XA 4EUPB 1UZ6E 2FX7L 1MLCA 4ZUSB 4U6YB 5DJYB 1MNUL 4J8RA 3LS5L 4LSRH 4YHYC 2DICA 4XPHH 3ROOA 3REWA 2OJZL 3W11C 1U8JA 4W81A 4WU7A 4JR9H 5DHVA 5HD8D 1A7RH 3LEXA 3MBEA 4NFBA 1T3FB 4JO2L 5J1AA 5I1LA 5KSBA 4PLJC 5F88B 3MLWL 3QUXC 2Z91A 4LF3A 5CIPH 1WTGT 3EFDH 3HI6L 3GIZL 4XP1L 2BVOB 1KPVB 2MPAL 4YJZL 3GB7B 2AP2A 1UENA 4KU1A 5B3NA 1CE6B 2DQJL 2Y7QA 4F33A 2CDGB 2NCMA 1KJVB 1M6OA 3IDGA 2VLRA 3KPLA 3BSZL 1UQSA 3IJYA 4UMGA 2GIYA 1IC5L 3C60B 4U1JA 5C6TH 3KWWA 4XP4H 3WIIH 4MWFA 4U05A 4YFLF 2ZCLH 5MERB 2P8MA 4NN6C 3F7YB 3VXTA 4TSCH 5T1KB 4QRTB 4TQEH 1FQ9C 1JGDB 4TSAL 4O51A 5DO2D 4YHNA 4MNGA 1QD0A 3G5YB 4K3GA 1T0PB 1WFOA 4PTTB 5IMKA 3DUHA 4ZFZB 1INEH 2EYRA 1FIGH 3A0OA 3WXVL 2DQEL 5DD5L 1JRHL 5CP3H 2YN3A 5MHSE 4HMCA 5I0ZA 1NCTA 3P4OB 1YJDH 3LPFA 4Y5VC 2DQCH 3FMGH 3NTCH 3IU4L 3RWJA 5DJDA 4PJDB 4DTGL 5T3XL 3QXDB 5DRWB 1PX4A 1L4IA 1R3HB 5BVPH 3KXFA 4EOWH 4XP5L 4I18B 3V52H 5B39B 3UBXI 2BXZA 3CFJA 5TF1L 1U6AH 1IGYB 3FFCB 1EHLH 3ELAT 3CMGA 4KMQA 4IMKC 4LEOA 4XXCC 5IJVA 5IFJB 2ZOKB 1Q9KB 1PZUB 3O2DL 1TZIB 3U30B 5GRUH 2J2ZA 4J3VA 1R3LB 1MFEL 1YN7B 1JWUB 1FYTB 1J11A 4OSUL 5BW7C 4MVBC 3C60C 3QIUA 1IT9L 4OLWH 4Q9RL 4O2EA 1S9YB 1KNOA 5KN5B 2VB5A 1ND0B 5ICXA 1H3XA 5CUSL 4JFFB 5C0NC 3VWJA 5AAMA 1MCKA 1MHCA 3FAWA 1P1ZA 3U7AA 4R4BA 1E0OB 3NFPA 3O41A 2GITB 3VD7A 1IAKA 3OKDA 5JQ6H 1KXVC 1DVFA 4NO0A 1YNTA 2E7MA 1KYOK 4JRYA 1J12A 4F9LC 3V95A 1XGRB 3U82B 4ZTPH 4R8WH 4O9HL 2Q7YA 3EO0A 3OWEA 5D1XA 3ULUD 2N7AA 3ALWA 3MRLB 4FFWC 1UADC 2E9IA 5CD5C 1G9EA 1S7QA 3HPLB 1H0DA 3RA7H 5JA9A 5HGAA 1IGCH 2HRPH 4JPWL 1YMHA 4PGCB 5FO7B 3FQTA 1I85A 3HUJB 2CGRH 1FNHA 3HR6A 4PGDA 3AMKA 2I9LB 3QJFA 4OF8A 1CGSL 4LVHB 2WM0A 3FN9A 5T33H 1QLFB 2JK5B 1JGUL 3TBTA 1FO0B 1WT5C 1CK0H 1FGNH 4LIQL 5I9QB 3CFDA 5INDA 3WDHA 3O6ML 1FVDA 1QTYT 3TBSB 4FZEH 4NYLA 3BZEA 3ZDZF 4I77H 2APFA 5GS3A 1RJZA 5H2BA 4E9LA 4IMLB 1JGLL 1J0ZA 1MRFL 3MJ9L 1LWRA 4WU5B 4PS4H 2VLME 3PHQA 3WNMA 4RZCA 5DGQA 5J6HA 3OKNA 1KLGA 5T5NF 1H9VA 5ERWB 1OCWH 3UTZB 4GBXB 4WW2C 4OKDA 1XGYH 4NNXA 1IGFH 4R9HA 4AG4L 4P2RD 1DLHA 4F80A 5JPNA 1I9EA 2DIBA 3CCHB 4LASL 3PWPB 2V5YA 1F58L 5C0CB 2A9NL 4P59L 3F5WA 4CW1A 1FO0L 1K4DB 2BVQB 3TO4A 5AWNH 4Q9BA 1P4LA 1MFDL 5IBUB 2V2TB 5DMKB 1A6AA 3CK0L 1VERA 4NBZB 5D2LF 2HT2C 5DSCA 4MCZB 2FIKB 4KKLC 1P2CA 3VFTB 3LKPA 5SV3A 3S34L 1N64L 5E6ID 1V3JA 3DUSB 3H3PL 1NAMH 3O6FB 4FHBD 5IQ7L 5I9QC 1EVUA 1Q9LB 5IROA 5DMIL 4WHTA 2HT4C 2OJZH 4EI5A 2AJ3B 5D70H 3HN3A 1FL5B 4OM0H 2P7TA 1WZ1L 4CVUA 3HMXL 1IKNA 1ZHNB 2F53B 4G6AC 3QNYB 2APVA 3I6KB 4GLRI 2RBLA 3G5XA 4P99A 2ZUTA 2FGWL 1FN4B 7FABL 3NZ8A 5EUOB 5L2JB 1N5AA 1PKQB 4I13B 3GIZH 4WGWB 4PREA 5E8PB 1I1AA 1HSBA 2QSTA 1YC7A 2CLZB 4GBXC 2AV7B 5EOQH 3BD4A 2DQJH 3WFHB 5IVXB 3VXMD 5I8KH 5FUCE 4RSVA 4FFZH 3BSZH 1KOAA 5C0GA 5FIEA 1HHHB 3GDBA 1A7BA 4PRIA 3QR2A 2EXWC 5DR5H 1K8DA 5BO1L 5DHYB 1BBJA 5F89B 4PJCA 2H2PC 1GAFL 1XR8A 3BP6A 1AXTH 4CN6A 1YY9C 3WFEH 4Z7OF 3OF6A 4UB0H 3LHPL 4X9FA 1A4JA 3CC5A 3EDKA 15C8L 4JFZH 5AD0A 2P49B 1NC4B 1AP2A 2V9TA 4XAWL 3FQWA 5BXFA 1IJ9A 3A6BL 2DQEH 2XY2A 5F1NB 2CKBB 5DD5H 5C09D 1T83C 1V3KA 4XCCL 4ORGA 2NX5B 5D7KE 3U7YL 2BMKA 3IU4H 2WP3O 3MV7E 1UWXK 1DBMH 2AXFB 2WUBH 5CHNA 4DTGH 3PGDB 4OIAA 1CN4A 1FAIH 4HFWA 3VXSB 2Q3ZA 4JDZA 5CBEA 4Q0XL 4DQOH 4NJ9L 3VFOB 2HT3C 3ARBA 1LEIB 3GJEB 1AY1L 1PAMA 3LN4A 3QHFH 1AXSB 5DI8B 1J8HE 2C3XA 4F7TA 5BOPA 2GJJA 4FFVC 4CL7A 4WTXA 1H3GA 2FBJL 1J5OH 3U48A 2N4IA 3U36B 1KB9J 4LDEB 2PYFA 3KLSA 4MNQD 3ZYOA 3T4AA 2A6KB 3RGVB 1LVEA 4N0CC 4F7MA 3BXNA 3JUYA 3PE9A 2WWKO 2CKBL 1EFXB 1YEKH 3M07A 2C26A 5IT2L 4GW4A 3QRFM 3MO1A 4QCIB 2G5BB 3WLWC 4PPTA 3BP5B 4N8VG 5GIRB 3LMJH 4LRIA 2AXJA 4L29B 5ELIA 3VG9B 1RVFH 2BSTA 4LNRB 4ZODA 3FONA 4PBXA 5HYSB 1AE6L 1NBYB 1XMWA 5ADPH 4GXUM 3IETA 3HZKB 4QRPE 5JXAH 4A2MA 4I0CC 3S3PA 4P4KC 4DN4H 2FJGB 5HHOA 2IEPA 2QTEA 2PYEB 3ZE2F 1CFQB 1FL3B 2WQ8A 4XMLL 2XI9A 4OLVL 1H8NA 4EUPG 1RJLB 2WWMD 1ZEAH 3BP7A 4HUKB 4R96B 1OP9A 5F70A 3JTTB 4LSDA 3TVMA 2EZ0D 4Z6AT 4UT9L 1PSKL 5DVNA 4D0DB 4HKBA 4LIQH 3X14A 2ORBH 1NCAH 3T65B 1RK0B 4G8GA 4M8QB 1G9NL 4XI5C 4HG4K 4NJAH 2HTKC 3PIQA 3E6HA 1LEKA 3N1PC 3TT3H 3VD9A 3GMLA 1Z0MA 3D0LB 4X4XA 3U7WL 4X6DB 5DMJB 1JHLH 2VR9A 1YEHH 5IFAL 5BQ7A 1BZQK 1G9NC 2LFGA 3BIKB 1MH5B 2F15A 4X6EB 2XKNB 1KULA 3MRIA 4KI5D 4JKLA 5E00A 4LLAA 3KG5A 5I1EH 4DOHE 1E6OH 5EBWA 4AG4H 1NUGA 4D3CL 1BJ1H 3DUUB 3FZUC 3S3SA 4GAYA 5F7LB 2Z31D 2A83A 1AGCA 1P9MC 5EB9A 1S7VB 1KCUL 4XXDB 5DK2A 1UKSA 3KLHD 3ARSA 1R3JB 4O5LL 3QNZA 1C5CH 5DS8B 3RJQB 1LO2L 2IALA 4BJLA 4KMTH 3T0XA 3VGAC 1BIHA 3S34H 4MMXC 3CFEA 1WWCA 5FGCE 2UY6A 5HHME 2VLJA 5FOBA 1KEMH 3QUKA 1QBMH 4JCLA 4WY7L 2APXA 3RWGB 2IC2A 5E4EB 3VG0H 1TJHH 4K8RL 5B39G 1ZGLB 5T1LD 4S1SH 3SDDB 1D9KD 2DRUA 4PJGE 4L1DA 3WKML 2VDRH 1A4KA 4TTGA 2BVPB 4JAMB 4JKPH 4KDTC 1I7TA 5I8EB 3TWCL 5I18L 2Z35B 2E5EA 5HD8C 3GM0A 2QADD 3PP3K 1G7JB 3TF7C 1A7PL 1BFTA 1QYGL 3I02B 4PD4J 5JW4R 1IGMH 2ZJSL 1CD1A 2PTVA 5D2LB 2AQ1A 4KAQL 3QXTA 1S3KL 4HK0A 1KC5L 5EU3A 5DQJB 1FFNB 3OKMB 3FFDA 3SE3A 5HDBE 3L3GB 4OD2A 43C9B 3UYRL 5GS0H 4HC1L 2IADA 4PRBB 1MREL 5HDQL 3HE6D 3P0VH 1BLNB 4RNRB 3HNSH 2CR3A 1MWAH 2YZ1A 2YMXL 1OW0C 4LCYB 5J1SC 1SYVB 4WW1B 4IBLT 5FDWB 1A3RH 1ZSDA 4NQCE 2EIBA 1LGVA 3QIWB 1GGTA 1LNUB 5I66A 2NY7H 2NZIA 4ORZC 3V7AE 4XCCH 2LAGB 5AG9A 3BO8B 1OD9A 4NWTL 1WWWX 2OTPA 1RHHB 2Q8AL 3WHE0 1IM9A 3RI5K 1WVZA 3NBNA 3DMMD 1KXTB 4B5EA 2B1HL 2YD4A 4XNUH 3VRJB 4U6TA 1ZLVK 1R3KA 2EYTA 4TNVK 5FGSA 3GSRA 4OQ1A 2XRAL 1L7TH 4FQ2H 4X9GA 3S98A 3TZVB 4WWKA 1S9WA 2D9CA 5EZJA 4YDIH 3ZTJH 2ZOLA 4XC3L 3SDXE 2BSRB 1RQ5A 3OKEB 4JB9L 1MFCH 3RBGA 4HIXH 3GI9L 1J05B 5LWYH 4D0CB 3BPCA 1BBDL 2DLGA 4DGVL 3V6OE 5HPMB 1U41A 4YDVB 3GK8H 1JF1A 4DVBA 2B8OT 2D0HA 1U8LB 2WLZA 5FEBA 3LKOA 4CKVX 5D9SA 1RUAL 3D3VD 4H26B 5SV4A 1SVZA 1UACL 3FO2A 4PY7B 1V5JA 2CRZA 1JWSB 1CT8B 3OAYK 4NPYA 4OCSH 2OYPA 1RZFH 1MI5E 3Q48A 3C2AH 3V4PL 2Q3AA 4TUJA 3MRKB 3PJSA 5KSAB 1D7FA 1VFUA 1UB5A 4ZUUA 1I1YB 4NHUB 3QWOA 1ADQA 3MX0A 4PRPA 1ED3B 5IBUG 2F54E 5F9OH 4L9LA 1MELA 1NSNL 3B2VL 4OFPA 1AGDB 4NNYB 4Y0GA 5I30H 2BNQA 1G6RH 2BCKA 4GS7B 4G7VL 4YHIB 3BZDA 4HCRA 5DFWH 4KKAD 4HZAA 4UT7H 2P42B 3TZVC 1UJTA 3OKOA 3EYFB 4H1LH 4OZFH 1AHWB 4X7CC 3UXFA 3BWUC 4IDLA 3WCYA 3WBDA 3PHSA 3OJDB 4AEHL 4J1UB 3MCKB 1D5XA 2P43B 2KQMA 2XQYK 1EEZB 4MJ4A 4PJBF 3LB6D 4HK3J 3FRPG 3WN5B 1KIPA 1UB6B 1CXKA 4JHWL 3SQOL 2A1WL 2P46B 3L7FB 2AJYH 5GGQL 2V5RA 4HF5L 5F1OB 4KRNA 3BE1L 3HFMH 5FV2A 4AT6A 2QLVB 5GS1A 4EBQL 3GUTA 1RUKL 2PXYA 1BMGA 4YE4H 4PJAE 3VI4E 3EYVB 4GJTB 5KSAC 3T0EA 1FC1A 5JW3L 3S37L 3OQ3B 3QI9D 3MFFA 4OAWB 2H8PB 1NFIB 3IKKA 4APQD 2JCCE 3RY5A 1KCUH 3ARTA 2LABA 5TH2A 3Q0HA 4QT5B 3B6SA 3K80A 1UEMA 2Z8WC 2Z8SA 2D03L 5D1ZB 4QHUA 5BV7H 4GS7C 3CMOH 1QHOA 3CDGA 5D93B 2B0SL 3I9GH 4KV5F 1H15B 2GJ6D 4LSSH 4HJJL 1LEGA 1MJUH 3ABZA 3I3DA 5HVHB 1AHWC 3K8MA 4FXKB 4HUUA 1HH6B 3TYGH 3DETD 5FO9B 1KJ3H 4ZPTB 4DJMA 3BAEH 5E6IC 43CAB 3GSWB 5ISZE 4LHUD 4E41B 3WN5C 1Q1JL 3HI5L 1P84K 3QFJE 5ACZA 1QLEH 4QOKD 2BVYA 1R6VA 5CEZE 1K3IA 1DQDL 1TENA 1BM3L 1UXWA 1F2QA 1F90H 1KACB 3TWCH 5I18H 4P2OA 1M4KA 4N1EA 5SWSB 4UTBH 2EDDA 1S3KH 2DIAA 4NQVA 2JIXD 3MA9H 4X99A 4H1LG 4OZFG 3OB8A 4UU9A 3U4AA 1MCPL 2P5WB 1LO4H 4G8FA 1MREH 1OP3K 4XPFH 1UWGH 3SDYL 1RZKL 5HDQH 3FO1A 4MS8C 3K4DA 1OSPL 4XPBL 4WFFD 4PJ9A 4R0LB 3UCRA 4HIHA 3DYOA 1BQHA 1XF3B 2IH1A 3O8XD 2DJSA 4NRZA 4MNQB 3S35L 3QDJD 3QUYB 5INCA 4HD9A 4Y1AE 5HYSG 4UV4H 4U7SA 4HEPG 2X1PA 2X7LA 4GW5A 3SDCB 4YDKH 5LGJA 3MJ7B 1RZKC 4MDJB 4L4TA 5DJCB 3FQNB 3WS3B 2ICES 3H9YA 4NCDA 5HVHC 3PGCA 3G04A 5CKGA 2IG2H 4NWTH 4NHCL 1D6VH 4MSWA 1U36A 5FXCH 4X6CE 2HFFA 4ZUWA 1KT2A 3J8F7 4OCRL 1LMKA 1NANI 2ZUVA 4FZ8L 4HUXA 5CIPA 4LP4A 4PY8J 2XRAH 5D4QA 1XGUA 4N0UB 3QULB 1OVZA 1U95A 3MXVL 1K3ZA 1FZKB 1NGZA 1RZ8A 3NA9L 1R5WB 5DC4B 4ZTOL 1PDKA 2OQJB 5SX4H 3UJJH 1MHPL 1QUNA 4PP1D 3GI9H 3OX8A 4WNQA 3BEVA 1F11A 1A6TB 2X09A 4DGVH 4ZYKA 1PZ5A 2NY6B 4CRPA 4PJEE 2KL6A 3PV7A 1PYWB 4HPOL 4GH7B 4NSKB 4WEBH 1UACH 4R0LC 4PJ5D 5B21A 2DWEB 3KPPB 3QUYC 3LN5A 3N85H 3H3BC 1CXIA 2R2EA 4HBQA 2R0KL 2EH8H 3VE0A 1JNNL 5CP3A 4M1GL 1Q94A 3SDCC 3V4PH 2HVJA 1MCLA 3ZHDA 3BQUB 5C0IB 1C8PA 1NJ9A 3OTTA 1J87A 5FYJL 3TBVA 3C9NB 1JUFB 1U8OB 3QQ3A 3ULUH 1ZA3A 1XIWD 3CLEH 1W0WA 5GS2H 5IHZA 1HXMB 1NSNH 3GSQA 3O81A 4ODVL 5GRVL 2Z31B 3B2VH 1JN6A 2Y06H 2OS7A 5C07E 3P73B 3Q6GH 4OUOA 2EDLA 5I16A 4NC2B 5IFHL 4ZUTB 4C83B 4WFEE 5C0DA 4M5YH 3VRIA 1DEEA 5ANME 4KJWC 4M6OH 4OCXL 4PLKD 3MPCA 1N26A 4CNIB 1NPUA 2WWMC 4MA1B 5FECA 4F15B 5FHBL 2MQCA 2WIMA 1SJHB 2EZ0C 2EIEA 4PJIF 4WUUB 5MHSD 3DARA 1U8KB 1KV3A 4GAFB 4L8CA 4YHMH 4DAGL 2WW8A 1X4ZA 3T3PE 3V6ZB 5HYJB 4XVUD 3RIFF 4NQDD 5JOFA 5IB1B 4ESKA 4RCAA 4K3JH 3WE6B 3IVKA 1I8IB 1T1YB 3MLYH 1FG9C 4G5ZL 2H26A 5L88L 4M4PA 4OZIB 1RUKH 1T4KA 1WC7A 4JRWA 1P7HL 2F8VA 1TCRA 2W0FB 4JQXA 2VISA 1ITBB 2OR9H 2AQ2A 3S37H 4KZDL 1JTOA 2EDJA 3EFFA 3VRLE 5MP6L 3OZ9L 3QUML 2R1YB 1BIIB 3CVIL 4R26L 4UILH 4Y4HB 5DYOA 4ZMAT 5LGKA 5IVZB 2Z31C 4PJBB 4Q97A 2D03H 4XCNB 3EOBB 3MNWB 3IDJA 4DZBB 1W72B 2I5YL 4MXVF 3KLHC 5F7HA 3PWUA 5IG7A 3HG1E 3X3FL 3UC0L 3OJMB 4LBEA 1MIEH 5FF6B 1X5IA 4ZS7L 2GUOB 1JPFB 1LO5B 3GGWB 5F72S 3MRFB 4NUJB 4XH2A 4MA1C 3ULSB 1NGPH 4F15C 4J6RL 5D2NB 4ENED 5FA4A 3R4DA 4NZRH 1EEYA 1ONQA 3S36X 3G6AB 3R0MA 4AM0B 1U3HA 1I8KB 5B38B 3EUUA 3W9DB 4HGWB 4AQ1B 3C8DA 2B4CL 4RAUB 3DMMB 2A0LD 4DKDC 1K85A 2R56L 3BW9B 1RZ7L 3NIGE 3QIBD 5H37H 1UCBH 3DVGA 4YNYB 4NQEE 5C0EA 2VXQL 2N56A 1J1XL 4HKJA 1WTLA 4AYFA 4XCFL 4GRWH 3TNNB 5ACMA 3HC3L 1W72L 3QDMB 4HS8H 2B4CC 1YEFL 4XVJH 1OQOA 3OR6A 1RURL 1XGPB 3SDYH 1RZKH 4LSVH 3NFSL 3P4MA 4XPBH 3FQXB 4QXUH 3GMQA 5A43C 3S35H 3JBG7 5JDSB 5HY9A 5DUPL 1T0MA 4YQXL 5TQ2H 2PCPB 1B0GB 1T1XA 2X1XR 3THML 1WICA 2VLMD 3WLBB 4OF0A 1N2RB 4Y16B 4WO4A 1KCRL 4MQ7B 2ITCA 1HSAB 4FA8A 3IXTA 2CLRA 4XX1G 3UTOA 4FQ1H 1LQSR 4KRMB 3L9RB 4JDTL 4JFEE 5D2NC 2OK0H 5JNYB 3Q6FB 1BD2D 4G7YL 3CIQA 1EO8L 1VPOL 3D2UB 2VR5A 3VD3A 3L3DB 4HS6B 2G9HB 4QRSB 3DMMC 4XP6L 4G9FD 3VXUE 3NA9H 3EDJA 2VXUH 2DKMA 4L3AA 1KYOJ 2YOCA 4Z7WF 2W9DH 2ARWA 5C0BA 1OT1A 1QR4A 3QXWA 3RWDA 3RWIA 1SMOA 4G6KH 1FZMB 3V5KB 1AD9B 4Y5VA 1HHIB 2HKFH 2IANB 3GIVA 3DURB 4OZHB 4YEEA 5E24E 1CLOH 3K7UA 5D96B 3BKJL 3LSOB 4L4VA 1JZ7A 2V2XA 2VDNH 1B2WL 4NFCA 3QWQB 4D0BA 5HJ3A 4IMKA 1VFOA 4XXCA 4FTVB 3BN9D 1TVHA 5H37G 1HHJB 3BIBX 3QWRA 4AMKL 3H2WA 4LHQB 4QF1A 3D39E 4HUVB 5BS0E 1C7TA 5TGBA 4YHLL 3RTQD 4DCQB 2OZ4L 5MEOB 1PKOA 4X7SL 3V4UL 3LRHA 4OTXL 3MUY1 4LFHG 2AERT 5DJXB 3MRCA 1FNEB 3HZMB 5T1KA 4X98B 3UZQA 4A2LA 4OCXH 4QLRA 2W65B 5F7DA 5EFIB 5HVGB 4PTTA 1TVDA 3QQNA 4PYGA 4MAYD 1UM4L 1U8HB 1WUNT 1U2HA 2NY2B 5FHBH 4ZFZA 5EC2B 1X6NA 4KKAC 5EU6D 3SN6N 2HFEB 1OGAE 4FABL 2E6PA 2R0ZL 4F9LA 5D7KD 4UDUA 4W6WB 4YXKH 3VXOA 2W92A 4BK5A 2X4TA 1FGVH 3PQYA 3MV7D 3O45A 4RWYH 1WFNA 1J0HA 1L7IL 4MB3A 4MJ5B 5D96C 3ARYA 3HAEB 3LB6C 5CJQH 2KH2B 3D0VA 2X4SB 2XN9E 4TULH 5CEXB 4G5ZH 4QOKB 4H0HB 3GSXA 3QXAB 5EIIB 3N0PB 4DGYL 1ZTXH 4HV8A 1NCUA 1HZHH 5KANI 1J8HD 3L3HB 1NLBL 5IFJA 2K3TA 3RDTB 1BAFL 1CD8A 1WT5A 4KZDH 3VMOA 3QUMH 4QTHB 1R3LA 3CVIH 3DV6B 3VH8B 5I15H 5HSFA 1YN6A 3GMRB 5I74B 5KS9E 2BHZA 4JFPB 4PJIB 3I75B 4MXWL 4BSVB 4JGUA 1OAXL 2G75A 5DRZA 4HWEL 1XH3B 3X3FH 3UC0H 3K81A 3KPOA 3SGEI 5EWIH 3LIZH 4P57A 4I1NB 2VE6A 2YPLB 1RUML 4HS3B 4IM8A 4MCYB 4WW2A 5IQ9B 4ZSOA 3GJFH 4F3FA 3IYLW 1MVUA 1RULH 4M02A 3G6JE 3KYNB 4PV8B 3DETC 4QRPD 2I60H 3V2AR 4M6AA 3HKFA 5DJ8A 3P3YA 1T2QH 4IOFD 2JB5H 2R56H 1I7RA 1ZHLB 3MGTA 3EW3B 4LQ1A 2Y4SA 3VI3F 1C12A 4HDIB 5DJ6B 4KHTH