5C8RA

Crystal structure of abba + udp-glc + di
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
287
structure length
278
Chain Sequence
GEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 278
sequence length 287
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c8rA00
1OQMB 2VD4A 4FRQA 4FQWA 2AE7A 4G3SA 1FXJA 2RIYA 1WT3A 3U2TA 4KNRA 1LZIA 3DUVA 4DE7A 1H5TB 2XWLA 2FYCB 3O3PA 3Q80A 2AECA 1JV3A 1H5SA 1H4CA 5CQPA 3U0XA 1G95A 4D0TA 2RJ7A 4J18A 1WT2A 4HO6A 3V8ZA 2BO7A 3CKOA 2AGDA 5I1FA 3EE5A 4MYBA 2WVMA 3OKRA 1YP3A 1G23A 4HG6A 1ZJ1A 5FTVA 1NWGB 1FWYA 1ZJ3A 3SXGA 4ECMA 5AJPA 2WE9A 4Y63A 1NF5B 2AM3A 4KRVA 4Y9XA 3SXEA 2X60A 1VGWA 3K8DA 1MC3A 4HO5A 4EEAA 1H3MA 3N9WA 4CVHA 4HO0A 3OH0A 2AH9A 1QGQA 2ZU9A 4ASYA 1GQCA 1FXOA 4B4MA 3ZGGA 4B5BA 1H4DA 2VFZA 2W0WA 4Y7TA 1W57A 3D8VA 2YQCA 2D0JA 5L6VA 2Y4JA 1FGGA 3I0HA 1GWVA 1S4NA 4B42A 3OAMA 1FRWA 1R7VA 2RJ4A 1G93A 4IRQA 1HJLA 4B2XA 1ZDFA 3KIAA 4CJBA 2Y6PA 1TZFA 3ST8A 2PGYA 4DECA 2P73A 1R82A 2XWMA 4UEGA 3OH3A 1SS9A 3D5NA 1ZI1A 1ZJPA 5C1HA 1H7LA 2QKXA 1VPAA 4AC3A 1KWSA 3CKNA 4FRHA 1G8OA 2D7RA 4NAKA 2FYBA 4KC1A 1JV1A 3SX8A 5FU0A 2PX7A 1VH1A 2XWNA 1ZCYA 3K8EA 1H7GA 4ASJA 2V0LA 2O1FA 2RITA 5CMHA 4MNDA 4KT7A 1FOAA 5FYEA 4P02A 1IIMA 3U2XA 1EZIA 2NXVA 4G3PA 2YQSA 3RMVA 3CU0A 4D11A 3I0KA 3SX5A 2MZBA 3OGZA 4Y62A 1XHBA 1FGXA 3U2WA 3Q7UA 1O0RA 1R7UA 1MP5A 3SX7A 3F1YA 5EJ1A 4AYLA 5CQNX 3I0GA 1VGUA 5C1LA 1FR9A 1R7YA 1ZJ2A 4YS8A 4EEMA 1ON6A 1R7TA 2AM5A 2VSIA 1WT0A 3ZLLA 2JCKA 1H5SD 3SXAA 5JQQA 2VS3A 3IOIA 3SXCA 1WT1A 2A8WA 2OI5A 1V83A 2OI7A 3T7NA 4G3QA 4IRPA 1QWJA 1G97A 2FYDB 5CMFX 1O23B 2RJ9A 1ZCVA 3I0LA 5C4DA 1VGZA 1V82A 2I5EA 5C49A 3FWWA 2RJ1A 1NHEB 4GBPA 2PGVA 2Z87A 1R80A 2CU2A 3IOJA 4Y6NA 4KC4A 3PKPA 3QVBA 3TQDA 4JISA 5C48A 2APCA 2YCMA 1I52A 1FO9A 1H5TA 1FO8A 1VGTA 1XZ6A 2Y4KA 2VS4A 5CMJA 1PZTA 1VZXA 5CMIA 3USQA 5EJZA 1ZI3A 3V0LA 3I0DA 3SX3A 3TZTA 1LZJA 1ZIZA 2JCJA 1LL0A 2QGIA 2RJ6A 2Y4LA 5FTSA 3I0EA 3U2VA 3V0PA 1YP2A 1OMZA 4EE4A 1ON8A 2ICXA 1H5SC 2ICYA 2UX8A 1ZI5A 5IDSA 5C3DA 1O7OA 4FRDA 2E8BA 4M28A 3I0FA 5CMGX 1HJJA 4BMAA 5IDTA 1H4EA 1HM8A 3I0JA 4KXOA 2A8UA 1WSZA 4EEOA 1G3LA 3E26A 4Y6UA 1ZDGA 2X5ZA 4KC2A 1VM8A 4Y7FA 3I0CA 1YROB 1NQIB 2OI6A 2XMEA 3USRA 5C47A 4ARWA 1ZHJA 1FZWA 4FRAA 4CJ8A 4EVWA 1V84A 1S4PA 4Y7UA 1IINA 4KPZA 4HO9A 4B3UA 4FCEA 4NANA 4B2WA 1OMXA 4CJCA 2PA4A 3CKJA 4NALA 3LW6A 4E1KA 2YQHA 4Y64A 3SXBA 2O1GA 3DJ4A 1MP3A 1O7QA 3BRKX 3PNNA 4EE5A 5CQOA 5DDVA 5C4EA 4JD0A 3DK5A 4AAWA 4FROA 1YP4A 3I0IX 1R7XA 2W0VA 3PKQA 3ZF8A 4HO3A 1R81A 3T7OA 2RJ0A 1VZUA 1ZI4A 2OEFA 1H7EA 2QH5A 1ZJ0A 1H5SB 1JVGA 4M2BA 4B4GA 1TW1A 4P00A 1LZ0A 2YQJA 1TVYA 3NGWA 1FR8A 3U0YA 4D48A 1QG8A 4DDZA 1H7QA 3CKQA 1G2VA 3JUKA 1H7FA 1H5RB 3ZLKA 3R2WA 2RJ5A 4K6RA 1G1LA 2VSHA 2YC5A 3V0QA 2WVLA 2O1HA 1ZCTA 2AESA 3JTJA 4FRMA 1JYLA 1PZYB 2X5SA 2BO6A 1GWWA 1LL2A 5DDTA 4FRLA 1LL3A 4NAIA 4R7PA 2GGOA 4FCUA 2ZU8A 3V0NA 1Z90A 5IFYA 1NMMB 1LZ7A 3IOHA 4D11C 3U2UA 2P6WA 4D0ZA 2FY7A 1HM0A 2DPWA 2RIZA 2I5KA 2FYAA 1H7TA 2V0KA 3RMWA 2V0HA 4EEGA 3ZGFA 5CQLX 2WGZA 2AM4A 4KPXA 5C1GA 3E25A 1H5RA 2VS5A 4HOCA 2Q4JA 5C8RA 1GX4A 1HM9A 1WVCA 3OH2A 4ZDQA 5J49A 2GGQA 5HS2A 5C38A 5AJOA 2WVKA 4KQLA 3HL3A 2JCOA 1MP4A 1TW5A 4BQHA 2OEGA 3SXDA 5FU8A 3V0MA 2FFVA 1EYRA 1VICA 4B4BA 5CQMX 2X65A 3T7MA 2E3DA 1QGSA 3Q4SA 1G9RA 3V0OA 1GX0A 2I7BA 4M2AA 1HV9A 4HO8A 4M4KA 3OC9A 1GQ9A 3V90A 2V0JA 1VZTA 3FOQA 5C4CA 5L6SA 3V91A 5EIYA 1JVDA 1ZCUA 4XWIA 2VXMA 1GA8A 1LVWA 3SPTA 2VXLA 4L41C 4G87A 5BXCA 4AYJA 2BO4A 4HCQA 5C3AA 2D7IA 1G0RA 4EE3A 3R3IA 1K4VA 2BO8A 3GUEA 4Y7GA 1NKHB 1JYKA 2Z86A 3V8YA 2FFUA 4KNXA 3POLA 2YC3A 1INIA 5AJNA 3JUJA 1FG5N 5FUHA 3RSBA 2RIXA 2P72A 4Y7VA 5C4BA 2Y7AA 3F1CA 4C2SA 1ZJOA 2RJ8A 2ZU7A 4FRPA 3CKVA 4HO2A 5C4FA 3BCVA 1VH3A 4HO4A 1S4OA 1W77A 2XMHA 2YESA 4LW3A 5C3BA 4FRBA 1INJA 1W55A 2Y4MA 2WAWA 2JCLA 4FREA 5FV9A 3D98A 3OH4A 4LW6A 1E5KA 3CGXA 5C36A 1H7HA 3OH1A 2WEEA 2V0IA
chains in the Genus database with same CATH superfamily
1OQMB 2VD4A 4FRQA 4FQWA 2AE7A 4G3SA 1FXJA 2RIYA 1WT3A 3U2TA 4KNRA 1LZIA 3DUVA 4DE7A 1H5TB 2XWLA 2FYCB 3O3PA 3Q80A 2AECA 1JV3A 1H5SA 1H4CA 5CQPA 3U0XA 1G95A 4D0TA 2RJ7A 4J18A 1WT2A 4HO6A 3V8ZA 2BO7A 3CKOA 2AGDA 5I1FA 3EE5A 4MYBA 2WVMA 3OKRA 1YP3A 1G23A 4HG6A 1ZJ1A 5FTVA 1NWGB 1FWYA 1ZJ3A 3SXGA 4ECMA 5AJPA 2WE9A 4Y63A 1NF5B 2AM3A 4KRVA 4Y9XA 3SXEA 2X60A 1VGWA 3K8DA 1MC3A 4HO5A 4EEAA 1H3MA 3N9WA 4CVHA 4HO0A 3OH0A 2AH9A 1QGQA 2ZU9A 4ASYA 1GQCA 1FXOA 4B4MA 3ZGGA 4B5BA 1H4DA 2VFZA 2W0WA 5D92A 4Y7TA 1W57A 3D8VA 2YQCA 2D0JA 5L6VA 2Y4JA 1FGGA 3I0HA 1GWVA 1S4NA 4B42A 3OAMA 1FRWA 1R7VA 2RJ4A 1G93A 4IRQA 1HJLA 4B2XA 1ZDFA 3KIAA 4CJBA 2Y6PA 1TZFA 3ST8A 2PGYA 4DECA 2P73A 1R82A 2XWMA 4UEGA 3OH3A 1SS9A 3D5NA 1ZI1A 1ZJPA 5C1HA 1H7LA 2QKXA 1VPAA 4AC3A 1KWSA 3CKNA 4FRHA 1G8OA 2D7RA 4NAKA 2FYBA 4KC1A 1JV1A 3SX8A 5FU0A 4O6NA 2PX7A 1VH1A 2XWNA 1ZCYA 3K8EA 1H7GA 4ASJA 2V0LA 2O1FA 2RITA 5CMHA 4MNDA 4KT7A 1FOAA 5FYEA 4P02A 1IIMA 3U2XA 1EZIA 2NXVA 4G3PA 2YQSA 3RMVA 3CU0A 4D11A 3I0KA 3SX5A 2MZBA 3OGZA 4Y62A 1XHBA 1FGXA 3U2WA 3Q7UA 1O0RA 1R7UA 4MIXA 1MP5A 3SX7A 3F1YA 5EJ1A 4AYLA 5CQNX 3I0GA 1VGUA 5C1LA 1FR9A 1R7YA 1ZJ2A 4YS8A 4EEMA 1ON6A 1R7TA 2AM5A 2VSIA 1WT0A 3ZLLA 2JCKA 1H5SD 3SXAA 5JQQA 2VS3A 3IOIA 3SXCA 1WT1A 2A8WA 2OI5A 1V83A 2OI7A 3T7NA 4G3QA 4IRPA 1QWJA 1G97A 2FYDB 5CMFX 1O23B 2RJ9A 1ZCVA 3I0LA 5C4DA 1VGZA 1V82A 2I5EA 5C49A 3FWWA 2RJ1A 1NHEB 4GBPA 2PGVA 2Z87A 1R80A 2CU2A 3IOJA 4Y6NA 4KC4A 3PKPA 3QVBA 3TQDA 4JISA 5C48A 2APCA 2YCMA 1I52A 1FO9A 1H5TA 1FO8A 1VGTA 1XZ6A 2Y4KA 2VS4A 5CMJA 5D91A 1PZTA 1VZXA 5CMIA 3USQA 5EJZA 1ZI3A 3V0LA 3I0DA 3SX3A 3TZTA 2JCJA 1LZJA 1ZIZA 1LL0A 2J0AA 2QGIA 2Y4LA 2RJ6A 3I0EA 5FTSA 3U2VA 3V0PA 1YP2A 1OMZA 4EE4A 1ON8A 2ICXA 1H5SC 2ICYA 2UX8A 1ZI5A 5IDSA 5C3DA 1O7OA 4FRDA 2E8BA 4M28A 3I0FA 5CMGX 1HJJA 4BMAA 5IDTA 1H4EA 1HM8A 3I0JA 4KXOA 4O6MA 2A8UA 1WSZA 4EEOA 1G3LA 3E26A 4Y6UA 1ZDGA 2X5ZA 4KC2A 1VM8A 4Y7FA 3I0CA 1YROB 1NQIB 2OI6A 2XMEA 3USRA 5C47A 4ARWA 1ZHJA 1FZWA 4FRAA 4CJ8A 4EVWA 1V84A 1S4PA 4Y7UA 1IINA 4KPZA 4HO9A 4B3UA 4FCEA 4NANA 4B2WA 1OMXA 4CJCA 2PA4A 3CKJA 4NALA 3LW6A 4E1KA 2YQHA 4Y64A 3SXBA 2O1GA 3DJ4A 1MP3A 1O7QA 3BRKX 3PNNA 4EE5A 5CQOA 5DDVA 5C4EA 4JD0A 3DK5A 4AAWA 4FROA 1YP4A 4FIXA 3I0IX 1R7XA 2W0VA 3PKQA 3ZF8A 4HO3A 1R81A 3T7OA 2RJ0A 1VZUA 1ZI4A 2OEFA 1H7EA 2QH5A 1ZJ0A 1H5SB 1JVGA 4M2BA 4B4GA 1TW1A 4P00A 1LZ0A 2YQJA 1TVYA 3NGWA 1FR8A 3U0YA 4D48A 1QG8A 4DDZA 1H7QA 3CKQA 1G2VA 3JUKA 2C0NA 1H7FA 1H5RB 3ZLKA 3R2WA 2RJ5A 4FIYA 4K6RA 1G1LA 2VSHA 2YC5A 3V0QA 2WVLA 2O1HA 1ZCTA 2AESA 3JTJA 4FRMA 1JYLA 1PZYB 2X5SA 2BO6A 1GWWA 1LL2A 5DDTA 4FRLA 1LL3A 4NAIA 4R7PA 2GGOA 4FCUA 2ZU8A 3V0NA 1Z90A 5IFYA 1NMMB 1LZ7A 3IOHA 4D11C 3U2UA 2P6WA 4D0ZA 2FY7A 1HM0A 2DPWA 2RIZA 2I5KA 2FYAA 1H7TA 2V0KA 4Q7CA 3RMWA 2V0HA 4EEGA 3ZGFA 5CQLX 2WGZA 2AM4A 4KPXA 5C1GA 3E25A 1H5RA 2VS5A 4HOCA 2Q4JA 5C8RA 1GX4A 1HM9A 1WVCA 2J0BA 3OH2A 4ZDQA 5J49A 2GGQA 5HS2A 5C38A 5AJOA 2WVKA 4KQLA 3HL3A 2JCOA 1MP4A 1TW5A 4BQHA 2OEGA 3SXDA 5FU8A 3V0MA 2FFVA 1EYRA 1VICA 4B4BA 5CQMX 2X65A 3T7MA 2E3DA 1QGSA 3Q4SA 1G9RA 3V0OA 1GX0A 2I7BA 2VK9A 4M2AA 1HV9A 4HO8A 4M4KA 3OC9A 1GQ9A 3V90A 2V0JA 1VZTA 3FOQA 5C4CA 5L6SA 3V91A 5EIYA 1JVDA 1ZCUA 4XWIA 2VXMA 1GA8A 1LVWA 3SPTA 2VXLA 4L41C 4G87A 5BXCA 4AYJA 2BO4A 4HCQA 5C3AA 2D7IA 1G0RA 4EE3A 3R3IA 1K4VA 2BO8A 3GUEA 4Y7GA 1NKHB 1JYKA 2Z86A 3V8YA 2FFUA 4KNXA 3POLA 2YC3A 1INIA 5AJNA 3JUJA 1FG5N 5FUHA 3RSBA 2RIXA 2P72A 4Y7VA 5C4BA 2Y7AA 3F1CA 4C2SA 1ZJOA 2RJ8A 2ZU7A 4FRPA 3CKVA 4HO2A 5C4FA 3BCVA 1VH3A 4HO4A 1S4OA 1W77A 2XMHA 2YESA 4LW3A 5C3BA 4FRBA 1INJA 1W55A 2Y4MA 2WAWA 2JCLA 4FREA 5FV9A 3D98A 3OH4A 4LW6A 1E5KA 3CGXA 5C36A 1H7HA 3OH1A 2WEEA 2V0IA
chains in the Genus database with same CATH topology
1OQMB 2VD4A 4FRQA 4FQWA 2AE7A 4G3SA 1FXJA 2RIYA 1WT3A 3U2TA 4KNRA 1LZIA 3DUVA 4DE7A 1H5TB 2XWLA 2FYCB 3O3PA 3Q80A 2AECA 1JV3A 1H5SA 1H4CA 5CQPA 3U0XA 1G95A 4D0TA 2RJ7A 4J18A 1WT2A 4HO6A 3V8ZA 2BO7A 3CKOA 2AGDA 5I1FA 3EE5A 4MYBA 2WVMA 3OKRA 1YP3A 1G23A 4HG6A 1ZJ1A 5FTVA 1NWGB 1FWYA 1ZJ3A 3SXGA 4ECMA 5AJPA 2WE9A 4Y63A 1NF5B 2AM3A 4KRVA 4Y9XA 3SXEA 2X60A 1VGWA 3K8DA 1MC3A 4HO5A 4EEAA 1H3MA 3N9WA 4CVHA 4HO0A 3OH0A 2AH9A 1QGQA 2ZU9A 4ASYA 1GQCA 1FXOA 4B4MA 3ZGGA 4B5BA 1H4DA 2VFZA 2W0WA 5D92A 4Y7TA 1W57A 3D8VA 2YQCA 2D0JA 5L6VA 2Y4JA 1FGGA 3I0HA 1GWVA 1S4NA 4B42A 3OAMA 1FRWA 1R7VA 2RJ4A 1G93A 4IRQA 1HJLA 4B2XA 1ZDFA 3KIAA 4CJBA 2Y6PA 1TZFA 3ST8A 2PGYA 4DECA 2P73A 1R82A 2XWMA 4UEGA 3OH3A 1SS9A 3D5NA 1ZI1A 1ZJPA 5C1HA 1H7LA 2QKXA 1VPAA 4AC3A 1KWSA 3CKNA 4FRHA 1G8OA 2D7RA 4NAKA 2FYBA 4KC1A 1JV1A 3SX8A 5FU0A 4O6NA 2PX7A 1VH1A 2XWNA 1ZCYA 3K8EA 1H7GA 4ASJA 2V0LA 2O1FA 2RITA 5CMHA 4MNDA 4KT7A 1FOAA 5FYEA 4P02A 1IIMA 3U2XA 1EZIA 2NXVA 4G3PA 2YQSA 3RMVA 3CU0A 4D11A 3I0KA 3SX5A 2MZBA 3OGZA 4Y62A 1XHBA 1FGXA 3U2WA 3Q7UA 1O0RA 1R7UA 4MIXA 1MP5A 3SX7A 3F1YA 5EJ1A 4AYLA 5CQNX 3I0GA 1VGUA 5C1LA 1FR9A 1R7YA 1ZJ2A 4YS8A 4EEMA 1ON6A 1R7TA 2AM5A 2VSIA 1WT0A 3ZLLA 2JCKA 1H5SD 3SXAA 5JQQA 2VS3A 3IOIA 3SXCA 1WT1A 2A8WA 2OI5A 1V83A 2OI7A 3T7NA 4G3QA 4IRPA 1QWJA 1G97A 2FYDB 5CMFX 1O23B 2RJ9A 1ZCVA 3I0LA 5C4DA 1VGZA 1V82A 2I5EA 5C49A 3FWWA 2RJ1A 1NHEB 4GBPA 2PGVA 2Z87A 1R80A 2CU2A 3IOJA 4Y6NA 4KC4A 3PKPA 3QVBA 3TQDA 4JISA 5C48A 2APCA 2YCMA 1I52A 1FO9A 1H5TA 1FO8A 1VGTA 1XZ6A 2Y4KA 2VS4A 5CMJA 5D91A 1PZTA 1VZXA 5CMIA 3USQA 5EJZA 1ZI3A 3V0LA 3I0DA 3SX3A 3TZTA 2JCJA 1LZJA 1ZIZA 1LL0A 2J0AA 2QGIA 2Y4LA 2RJ6A 3I0EA 5FTSA 3U2VA 3V0PA 1YP2A 1OMZA 4EE4A 1ON8A 2ICXA 1H5SC 2ICYA 2UX8A 1ZI5A 5IDSA 5C3DA 1O7OA 4FRDA 2E8BA 4M28A 3I0FA 5CMGX 1HJJA 4BMAA 5IDTA 1H4EA 1HM8A 3I0JA 4KXOA 4O6MA 2A8UA 1WSZA 4EEOA 1G3LA 3E26A 4Y6UA 1ZDGA 2X5ZA 4KC2A 1VM8A 4Y7FA 3I0CA 1YROB 1NQIB 2OI6A 2XMEA 3USRA 5C47A 4ARWA 1ZHJA 1FZWA 4FRAA 4CJ8A 4EVWA 1V84A 1S4PA 4Y7UA 1IINA 4KPZA 4HO9A 4B3UA 4FCEA 4NANA 4B2WA 1OMXA 4CJCA 2PA4A 3CKJA 4NALA 3LW6A 4E1KA 2YQHA 4Y64A 3SXBA 2O1GA 3DJ4A 1MP3A 1O7QA 3BRKX 3PNNA 4EE5A 5CQOA 5DDVA 5C4EA 4JD0A 3DK5A 4AAWA 4FROA 1YP4A 4FIXA 3I0IX 1R7XA 2W0VA 3PKQA 3ZF8A 4HO3A 1R81A 3T7OA 2RJ0A 1VZUA 1ZI4A 2OEFA 1H7EA 2QH5A 1ZJ0A 1H5SB 1JVGA 4M2BA 4B4GA 1TW1A 4P00A 1LZ0A 2YQJA 1TVYA 3NGWA 1FR8A 3U0YA 4D48A 1QG8A 4DDZA 1H7QA 3CKQA 1G2VA 3JUKA 2C0NA 1H7FA 1H5RB 3ZLKA 3R2WA 2RJ5A 4FIYA 4K6RA 1G1LA 2VSHA 2YC5A 3V0QA 2WVLA 2O1HA 1ZCTA 2AESA 3JTJA 4FRMA 1JYLA 1PZYB 2X5SA 2BO6A 1GWWA 1LL2A 5DDTA 4FRLA 1LL3A 4NAIA 4R7PA 2GGOA 4FCUA 2ZU8A 3V0NA 1Z90A 5IFYA 1NMMB 1LZ7A 3IOHA 4D11C 3U2UA 2P6WA 4D0ZA 2FY7A 1HM0A 2DPWA 2RIZA 2I5KA 2FYAA 1H7TA 2V0KA 4Q7CA 3RMWA 2V0HA 4EEGA 3ZGFA 5CQLX 2WGZA 2AM4A 4KPXA 5C1GA 3E25A 1H5RA 2VS5A 4HOCA 2Q4JA 5C8RA 1GX4A 1HM9A 1WVCA 2J0BA 3OH2A 4ZDQA 5J49A 2GGQA 5HS2A 5C38A 5AJOA 2WVKA 4KQLA 3HL3A 2JCOA 1MP4A 1TW5A 4BQHA 2OEGA 3SXDA 5FU8A 3V0MA 2FFVA 1EYRA 1VICA 4B4BA 5CQMX 2X65A 3T7MA 2E3DA 1QGSA 3Q4SA 1G9RA 3V0OA 1GX0A 2I7BA 2VK9A 4M2AA 1HV9A 4HO8A 4M4KA 3OC9A 1GQ9A 3V90A 2V0JA 1VZTA 3FOQA 5C4CA 5L6SA 3V91A 5EIYA 1JVDA 1ZCUA 4XWIA 2VXMA 1GA8A 1LVWA 3SPTA 2VXLA 4L41C 4G87A 5BXCA 4AYJA 2BO4A 4HCQA 5C3AA 2D7IA 1G0RA 4EE3A 3R3IA 1K4VA 2BO8A 3GUEA 4Y7GA 1NKHB 1JYKA 2Z86A 3V8YA 2FFUA 4KNXA 3POLA 2YC3A 1INIA 5AJNA 3JUJA 1FG5N 5FUHA 3RSBA 2RIXA 2P72A 4Y7VA 5C4BA 2Y7AA 3F1CA 4C2SA 1ZJOA 2RJ8A 2ZU7A 4FRPA 3CKVA 4HO2A 5C4FA 3BCVA 1VH3A 4HO4A 1S4OA 1W77A 2XMHA 2YESA 4LW3A 5C3BA 4FRBA 1INJA 1W55A 2Y4MA 2WAWA 2JCLA 4FREA 5FV9A 3D98A 3OH4A 4LW6A 1E5KA 3CGXA 5C36A 1H7HA 3OH1A 2WEEA 2V0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQM B;  2VD4 A;  4FRQ A;  4FQW A;  2AE7 A;  4G3S A;  1FXJ A;  2RIY A;  1WT3 A;  3U2T A;  4KNR A;  1LZI A;  3DUV A;  4DE7 A;  1H5T B;  2XWL A;  2FYC B;  3O3P A;  3Q80 A;  2AEC A;  1JV3 A;  1H5S A;  1H4C A;  5CQP A;  3U0X A;  1G95 A;  4D0T A;  2RJ7 A;  4J18 A;  1WT2 A;  4HO6 A;  3V8Z A;  2BO7 A;  3CKO A;  2AGD A;  5I1F A;  3EE5 A;  4MYB A;  2WVM A;  3OKR A;  1YP3 A;  1G23 A;  4HG6 A;  1ZJ1 A;  5FTV A;  1NWG B;  1FWY A;  1ZJ3 A;  3SXG A;  4ECM A;  5AJP A;  2WE9 A;  4Y63 A;  1NF5 B;  2AM3 A;  4KRV A;  4Y9X A;  3SXE A;  2X60 A;  1VGW A;  3K8D A;  1MC3 A;  4HO5 A;  4EEA A;  1H3M A;  3N9W A;  4CVH A;  4HO0 A;  3OH0 A;  2AH9 A;  1QGQ A;  2ZU9 A;  4ASY A;  1GQC A;  1FXO A;  4B4M A;  3ZGG A;  4B5B A;  1H4D A;  2VFZ A;  2W0W A;  4Y7T A;  1W57 A;  3D8V A;  2YQC A;  2D0J A;  5L6V A;  2Y4J A;  1FGG A;  3I0H A;  1GWV A;  1S4N A;  4B42 A;  3OAM A;  1FRW A;  1R7V A;  2RJ4 A;  1G93 A;  4IRQ A;  1HJL A;  4B2X A;  1ZDF A;  3KIA A;  4CJB A;  2Y6P A;  1TZF A;  3ST8 A;  2PGY A;  4DEC A;  2P73 A;  1R82 A;  2XWM A;  4UEG A;  3OH3 A;  1SS9 A;  3D5N A;  1ZI1 A;  1ZJP A;  5C1H A;  1H7L A;  2QKX A;  1VPA A;  4AC3 A;  1KWS A;  3CKN A;  4FRH A;  1G8O A;  2D7R A;  4NAK A;  2FYB A;  4KC1 A;  1JV1 A;  3SX8 A;  5FU0 A;  2PX7 A;  1VH1 A;  2XWN A;  1ZCY A;  3K8E A;  1H7G A;  4ASJ A;  2V0L A;  2O1F A;  2RIT A;  5CMH A;  4MND A;  4KT7 A;  1FOA A;  5FYE A;  4P02 A;  1IIM A;  3U2X A;  1EZI A;  2NXV A;  4G3P A;  2YQS A;  3RMV A;  3CU0 A;  4D11 A;  3I0K A;  3SX5 A;  2MZB A;  3OGZ A;  4Y62 A;  1XHB A;  1FGX A;  3U2W A;  3Q7U A;  1O0R A;  1R7U A;  1MP5 A;  3SX7 A;  3F1Y A;  5EJ1 A;  4AYL A;  5CQN X;  3I0G A;  1VGU A;  5C1L A;  1FR9 A;  1R7Y A;  1ZJ2 A;  4YS8 A;  4EEM A;  1ON6 A;  1R7T A;  2AM5 A;  2VSI A;  1WT0 A;  3ZLL A;  2JCK A;  1H5S D;  3SXA A;  5JQQ A;  2VS3 A;  3IOI A;  3SXC A;  1WT1 A;  2A8W A;  2OI5 A;  1V83 A;  2OI7 A;  3T7N A;  4G3Q A;  4IRP A;  1QWJ A;  1G97 A;  2FYD B;  5CMF X;  1O23 B;  2RJ9 A;  1ZCV A;  3I0L A;  5C4D A;  1VGZ A;  1V82 A;  2I5E A;  5C49 A;  3FWW A;  2RJ1 A;  1NHE B;  4GBP A;  2PGV A;  2Z87 A;  1R80 A;  2CU2 A;  3IOJ A;  4Y6N A;  4KC4 A;  3PKP A;  3QVB A;  3TQD A;  4JIS A;  5C48 A;  2APC A;  2YCM A;  1I52 A;  1FO9 A;  1H5T A;  1FO8 A;  1VGT A;  1XZ6 A;  2Y4K A;  2VS4 A;  5CMJ A;  1PZT A;  1VZX A;  5CMI A;  3USQ A;  5EJZ A;  1ZI3 A;  3V0L A;  3I0D A;  3SX3 A;  3TZT A;  1LZJ A;  1ZIZ A;  2JCJ A;  1LL0 A;  2QGI A;  2RJ6 A;  2Y4L A;  5FTS A;  3I0E A;  3U2V A;  3V0P A;  1YP2 A;  1OMZ A;  4EE4 A;  1ON8 A;  2ICX A;  1H5S C;  2ICY A;  2UX8 A;  1ZI5 A;  5IDS A;  5C3D A;  1O7O A;  4FRD A;  2E8B A;  4M28 A;  3I0F A;  5CMG X;  1HJJ A;  4BMA A;  5IDT A;  1H4E A;  1HM8 A;  3I0J A;  4KXO A;  2A8U A;  1WSZ A;  4EEO A;  1G3L A;  3E26 A;  4Y6U A;  1ZDG A;  2X5Z A;  4KC2 A;  1VM8 A;  4Y7F A;  3I0C A;  1YRO B;  1NQI B;  2OI6 A;  2XME A;  3USR A;  5C47 A;  4ARW A;  1ZHJ A;  1FZW A;  4FRA A;  4CJ8 A;  4EVW A;  1V84 A;  1S4P A;  4Y7U A;  1IIN A;  4KPZ A;  4HO9 A;  4B3U A;  4FCE A;  4NAN A;  4B2W A;  1OMX A;  4CJC A;  2PA4 A;  3CKJ A;  4NAL A;  3LW6 A;  4E1K A;  2YQH A;  4Y64 A;  3SXB A;  2O1G A;  3DJ4 A;  1MP3 A;  1O7Q A;  3BRK X;  3PNN A;  4EE5 A;  5CQO A;  5DDV A;  5C4E A;  4JD0 A;  3DK5 A;  4AAW A;  4FRO A;  1YP4 A;  3I0I X;  1R7X A;  2W0V A;  3PKQ A;  3ZF8 A;  4HO3 A;  1R81 A;  3T7O A;  2RJ0 A;  1VZU A;  1ZI4 A;  2OEF A;  1H7E A;  2QH5 A;  1ZJ0 A;  1H5S B;  1JVG A;  4M2B A;  4B4G A;  1TW1 A;  4P00 A;  1LZ0 A;  2YQJ A;  1TVY A;  3NGW A;  1FR8 A;  3U0Y A;  4D48 A;  1QG8 A;  4DDZ A;  1H7Q A;  3CKQ A;  1G2V A;  3JUK A;  1H7F A;  1H5R B;  3ZLK A;  3R2W A;  2RJ5 A;  4K6R A;  1G1L A;  2VSH A;  2YC5 A;  3V0Q A;  2WVL A;  2O1H A;  1ZCT A;  2AES A;  3JTJ A;  4FRM A;  1JYL A;  1PZY B;  2X5S A;  2BO6 A;  1GWW A;  1LL2 A;  5DDT A;  4FRL A;  1LL3 A;  4NAI A;  4R7P A;  2GGO A;  4FCU A;  2ZU8 A;  3V0N A;  1Z90 A;  5IFY A;  1NMM B;  1LZ7 A;  3IOH A;  4D11 C;  3U2U A;  2P6W A;  4D0Z A;  2FY7 A;  1HM0 A;  2DPW A;  2RIZ A;  2I5K A;  2FYA A;  1H7T A;  2V0K A;  3RMW A;  2V0H A;  4EEG A;  3ZGF A;  5CQL X;  2WGZ A;  2AM4 A;  4KPX A;  5C1G A;  3E25 A;  1H5R A;  2VS5 A;  4HOC A;  2Q4J A;  5C8R A;  1GX4 A;  1HM9 A;  1WVC A;  3OH2 A;  4ZDQ A;  5J49 A;  2GGQ A;  5HS2 A;  5C38 A;  5AJO A;  2WVK A;  4KQL A;  3HL3 A;  2JCO A;  1MP4 A;  1TW5 A;  4BQH A;  2OEG A;  3SXD A;  5FU8 A;  3V0M A;  2FFV A;  1EYR A;  1VIC A;  4B4B A;  5CQM X;  2X65 A;  3T7M A;  2E3D A;  1QGS A;  3Q4S A;  1G9R A;  3V0O A;  1GX0 A;  2I7B A;  4M2A A;  1HV9 A;  4HO8 A;  4M4K A;  3OC9 A;  1GQ9 A;  3V90 A;  2V0J A;  1VZT A;  3FOQ A;  5C4C A;  5L6S A;  3V91 A;  5EIY A;  1JVD A;  1ZCU A;  4XWI A;  2VXM A;  1GA8 A;  1LVW A;  3SPT A;  2VXL A;  4L41 C;  4G87 A;  5BXC A;  4AYJ A;  2BO4 A;  4HCQ A;  5C3A A;  2D7I A;  1G0R A;  4EE3 A;  3R3I A;  1K4V A;  2BO8 A;  3GUE A;  4Y7G A;  1NKH B;  1JYK A;  2Z86 A;  3V8Y A;  2FFU A;  4KNX A;  3POL A;  2YC3 A;  1INI A;  5AJN A;  3JUJ A;  1FG5 N;  5FUH A;  3RSB A;  2RIX A;  2P72 A;  4Y7V A;  5C4B A;  2Y7A A;  3F1C A;  4C2S A;  1ZJO A;  2RJ8 A;  2ZU7 A;  4FRP A;  3CKV A;  4HO2 A;  5C4F A;  3BCV A;  1VH3 A;  4HO4 A;  1S4O A;  1W77 A;  2XMH A;  2YES A;  4LW3 A;  5C3B A;  4FRB A;  1INJ A;  1W55 A;  2Y4M A;  2WAW A;  2JCL A;  4FRE A;  5FV9 A;  3D98 A;  3OH4 A;  4LW6 A;  1E5K A;  3CGX A;  5C36 A;  1H7H A;  3OH1 A;  2WEE A;  2V0I A; 
#chains in the Genus database with same CATH topology
 1OQM B;  2VD4 A;  4FRQ A;  4FQW A;  2AE7 A;  4G3S A;  1FXJ A;  2RIY A;  1WT3 A;  3U2T A;  4KNR A;  1LZI A;  3DUV A;  4DE7 A;  1H5T B;  2XWL A;  2FYC B;  3O3P A;  3Q80 A;  2AEC A;  1JV3 A;  1H5S A;  1H4C A;  5CQP A;  3U0X A;  1G95 A;  4D0T A;  2RJ7 A;  4J18 A;  1WT2 A;  4HO6 A;  3V8Z A;  2BO7 A;  3CKO A;  2AGD A;  5I1F A;  3EE5 A;  4MYB A;  2WVM A;  3OKR A;  1YP3 A;  1G23 A;  4HG6 A;  1ZJ1 A;  5FTV A;  1NWG B;  1FWY A;  1ZJ3 A;  3SXG A;  4ECM A;  5AJP A;  2WE9 A;  4Y63 A;  1NF5 B;  2AM3 A;  4KRV A;  4Y9X A;  3SXE A;  2X60 A;  1VGW A;  3K8D A;  1MC3 A;  4HO5 A;  4EEA A;  1H3M A;  3N9W A;  4CVH A;  4HO0 A;  3OH0 A;  2AH9 A;  1QGQ A;  2ZU9 A;  4ASY A;  1GQC A;  1FXO A;  4B4M A;  3ZGG A;  4B5B A;  1H4D A;  2VFZ A;  2W0W A;  5D92 A;  4Y7T A;  1W57 A;  3D8V A;  2YQC A;  2D0J A;  5L6V A;  2Y4J A;  1FGG A;  3I0H A;  1GWV A;  1S4N A;  4B42 A;  3OAM A;  1FRW A;  1R7V A;  2RJ4 A;  1G93 A;  4IRQ A;  1HJL A;  4B2X A;  1ZDF A;  3KIA A;  4CJB A;  2Y6P A;  1TZF A;  3ST8 A;  2PGY A;  4DEC A;  2P73 A;  1R82 A;  2XWM A;  4UEG A;  3OH3 A;  1SS9 A;  3D5N A;  1ZI1 A;  1ZJP A;  5C1H A;  1H7L A;  2QKX A;  1VPA A;  4AC3 A;  1KWS A;  3CKN A;  4FRH A;  1G8O A;  2D7R A;  4NAK A;  2FYB A;  4KC1 A;  1JV1 A;  3SX8 A;  5FU0 A;  4O6N A;  2PX7 A;  1VH1 A;  2XWN A;  1ZCY A;  3K8E A;  1H7G A;  4ASJ A;  2V0L A;  2O1F A;  2RIT A;  5CMH A;  4MND A;  4KT7 A;  1FOA A;  5FYE A;  4P02 A;  1IIM A;  3U2X A;  1EZI A;  2NXV A;  4G3P A;  2YQS A;  3RMV A;  3CU0 A;  4D11 A;  3I0K A;  3SX5 A;  2MZB A;  3OGZ A;  4Y62 A;  1XHB A;  1FGX A;  3U2W A;  3Q7U A;  1O0R A;  1R7U A;  4MIX A;  1MP5 A;  3SX7 A;  3F1Y A;  5EJ1 A;  4AYL A;  5CQN X;  3I0G A;  1VGU A;  5C1L A;  1FR9 A;  1R7Y A;  1ZJ2 A;  4YS8 A;  4EEM A;  1ON6 A;  1R7T A;  2AM5 A;  2VSI A;  1WT0 A;  3ZLL A;  2JCK A;  1H5S D;  3SXA A;  5JQQ A;  2VS3 A;  3IOI A;  3SXC A;  1WT1 A;  2A8W A;  2OI5 A;  1V83 A;  2OI7 A;  3T7N A;  4G3Q A;  4IRP A;  1QWJ A;  1G97 A;  2FYD B;  5CMF X;  1O23 B;  2RJ9 A;  1ZCV A;  3I0L A;  5C4D A;  1VGZ A;  1V82 A;  2I5E A;  5C49 A;  3FWW A;  2RJ1 A;  1NHE B;  4GBP A;  2PGV A;  2Z87 A;  1R80 A;  2CU2 A;  3IOJ A;  4Y6N A;  4KC4 A;  3PKP A;  3QVB A;  3TQD A;  4JIS A;  5C48 A;  2APC A;  2YCM A;  1I52 A;  1FO9 A;  1H5T A;  1FO8 A;  1VGT A;  1XZ6 A;  2Y4K A;  2VS4 A;  5CMJ A;  5D91 A;  1PZT A;  1VZX A;  5CMI A;  3USQ A;  5EJZ A;  1ZI3 A;  3V0L A;  3I0D A;  3SX3 A;  3TZT A;  2JCJ A;  1LZJ A;  1ZIZ A;  1LL0 A;  2J0A A;  2QGI A;  2Y4L A;  2RJ6 A;  3I0E A;  5FTS A;  3U2V A;  3V0P A;  1YP2 A;  1OMZ A;  4EE4 A;  1ON8 A;  2ICX A;  1H5S C;  2ICY A;  2UX8 A;  1ZI5 A;  5IDS A;  5C3D A;  1O7O A;  4FRD A;  2E8B A;  4M28 A;  3I0F A;  5CMG X;  1HJJ A;  4BMA A;  5IDT A;  1H4E A;  1HM8 A;  3I0J A;  4KXO A;  4O6M A;  2A8U A;  1WSZ A;  4EEO A;  1G3L A;  3E26 A;  4Y6U A;  1ZDG A;  2X5Z A;  4KC2 A;  1VM8 A;  4Y7F A;  3I0C A;  1YRO B;  1NQI B;  2OI6 A;  2XME A;  3USR A;  5C47 A;  4ARW A;  1ZHJ A;  1FZW A;  4FRA A;  4CJ8 A;  4EVW A;  1V84 A;  1S4P A;  4Y7U A;  1IIN A;  4KPZ A;  4HO9 A;  4B3U A;  4FCE A;  4NAN A;  4B2W A;  1OMX A;  4CJC A;  2PA4 A;  3CKJ A;  4NAL A;  3LW6 A;  4E1K A;  2YQH A;  4Y64 A;  3SXB A;  2O1G A;  3DJ4 A;  1MP3 A;  1O7Q A;  3BRK X;  3PNN A;  4EE5 A;  5CQO A;  5DDV A;  5C4E A;  4JD0 A;  3DK5 A;  4AAW A;  4FRO A;  1YP4 A;  4FIX A;  3I0I X;  1R7X A;  2W0V A;  3PKQ A;  3ZF8 A;  4HO3 A;  1R81 A;  3T7O A;  2RJ0 A;  1VZU A;  1ZI4 A;  2OEF A;  1H7E A;  2QH5 A;  1ZJ0 A;  1H5S B;  1JVG A;  4M2B A;  4B4G A;  1TW1 A;  4P00 A;  1LZ0 A;  2YQJ A;  1TVY A;  3NGW A;  1FR8 A;  3U0Y A;  4D48 A;  1QG8 A;  4DDZ A;  1H7Q A;  3CKQ A;  1G2V A;  3JUK A;  2C0N A;  1H7F A;  1H5R B;  3ZLK A;  3R2W A;  2RJ5 A;  4FIY A;  4K6R A;  1G1L A;  2VSH A;  2YC5 A;  3V0Q A;  2WVL A;  2O1H A;  1ZCT A;  2AES A;  3JTJ A;  4FRM A;  1JYL A;  1PZY B;  2X5S A;  2BO6 A;  1GWW A;  1LL2 A;  5DDT A;  4FRL A;  1LL3 A;  4NAI A;  4R7P A;  2GGO A;  4FCU A;  2ZU8 A;  3V0N A;  1Z90 A;  5IFY A;  1NMM B;  1LZ7 A;  3IOH A;  4D11 C;  3U2U A;  2P6W A;  4D0Z A;  2FY7 A;  1HM0 A;  2DPW A;  2RIZ A;  2I5K A;  2FYA A;  1H7T A;  2V0K A;  4Q7C A;  3RMW A;  2V0H A;  4EEG A;  3ZGF A;  5CQL X;  2WGZ A;  2AM4 A;  4KPX A;  5C1G A;  3E25 A;  1H5R A;  2VS5 A;  4HOC A;  2Q4J A;  5C8R A;  1GX4 A;  1HM9 A;  1WVC A;  2J0B A;  3OH2 A;  4ZDQ A;  5J49 A;  2GGQ A;  5HS2 A;  5C38 A;  5AJO A;  2WVK A;  4KQL A;  3HL3 A;  2JCO A;  1MP4 A;  1TW5 A;  4BQH A;  2OEG A;  3SXD A;  5FU8 A;  3V0M A;  2FFV A;  1EYR A;  1VIC A;  4B4B A;  5CQM X;  2X65 A;  3T7M A;  2E3D A;  1QGS A;  3Q4S A;  1G9R A;  3V0O A;  1GX0 A;  2I7B A;  2VK9 A;  4M2A A;  1HV9 A;  4HO8 A;  4M4K A;  3OC9 A;  1GQ9 A;  3V90 A;  2V0J A;  1VZT A;  3FOQ A;  5C4C A;  5L6S A;  3V91 A;  5EIY A;  1JVD A;  1ZCU A;  4XWI A;  2VXM A;  1GA8 A;  1LVW A;  3SPT A;  2VXL A;  4L41 C;  4G87 A;  5BXC A;  4AYJ A;  2BO4 A;  4HCQ A;  5C3A A;  2D7I A;  1G0R A;  4EE3 A;  3R3I A;  1K4V A;  2BO8 A;  3GUE A;  4Y7G A;  1NKH B;  1JYK A;  2Z86 A;  3V8Y A;  2FFU A;  4KNX A;  3POL A;  2YC3 A;  1INI A;  5AJN A;  3JUJ A;  1FG5 N;  5FUH A;  3RSB A;  2RIX A;  2P72 A;  4Y7V A;  5C4B A;  2Y7A A;  3F1C A;  4C2S A;  1ZJO A;  2RJ8 A;  2ZU7 A;  4FRP A;  3CKV A;  4HO2 A;  5C4F A;  3BCV A;  1VH3 A;  4HO4 A;  1S4O A;  1W77 A;  2XMH A;  2YES A;  4LW3 A;  5C3B A;  4FRB A;  1INJ A;  1W55 A;  2Y4M A;  2WAW A;  2JCL A;  4FRE A;  5FV9 A;  3D98 A;  3OH4 A;  4LW6 A;  1E5K A;  3CGX A;  5C36 A;  1H7H A;  3OH1 A;  2WEE A;  2V0I A; 
#chains in the Genus database with same CATH homology
 1OQM B;  2VD4 A;  4FRQ A;  4FQW A;  2AE7 A;  4G3S A;  1FXJ A;  2RIY A;  1WT3 A;  3U2T A;  4KNR A;  1LZI A;  3DUV A;  4DE7 A;  1H5T B;  2XWL A;  2FYC B;  3O3P A;  3Q80 A;  2AEC A;  1JV3 A;  1H5S A;  1H4C A;  5CQP A;  3U0X A;  1G95 A;  4D0T A;  2RJ7 A;  4J18 A;  1WT2 A;  4HO6 A;  3V8Z A;  2BO7 A;  3CKO A;  2AGD A;  5I1F A;  3EE5 A;  4MYB A;  2WVM A;  3OKR A;  1YP3 A;  1G23 A;  4HG6 A;  1ZJ1 A;  5FTV A;  1NWG B;  1FWY A;  1ZJ3 A;  3SXG A;  4ECM A;  5AJP A;  2WE9 A;  4Y63 A;  1NF5 B;  2AM3 A;  4KRV A;  4Y9X A;  3SXE A;  2X60 A;  1VGW A;  3K8D A;  1MC3 A;  4HO5 A;  4EEA A;  1H3M A;  3N9W A;  4CVH A;  4HO0 A;  3OH0 A;  2AH9 A;  1QGQ A;  2ZU9 A;  4ASY A;  1GQC A;  1FXO A;  4B4M A;  3ZGG A;  4B5B A;  1H4D A;  2VFZ A;  2W0W A;  5D92 A;  4Y7T A;  1W57 A;  3D8V A;  2YQC A;  2D0J A;  5L6V A;  2Y4J A;  1FGG A;  3I0H A;  1GWV A;  1S4N A;  4B42 A;  3OAM A;  1FRW A;  1R7V A;  2RJ4 A;  1G93 A;  4IRQ A;  1HJL A;  4B2X A;  1ZDF A;  3KIA A;  4CJB A;  2Y6P A;  1TZF A;  3ST8 A;  2PGY A;  4DEC A;  2P73 A;  1R82 A;  2XWM A;  4UEG A;  3OH3 A;  1SS9 A;  3D5N A;  1ZI1 A;  1ZJP A;  5C1H A;  1H7L A;  2QKX A;  1VPA A;  4AC3 A;  1KWS A;  3CKN A;  4FRH A;  1G8O A;  2D7R A;  4NAK A;  2FYB A;  4KC1 A;  1JV1 A;  3SX8 A;  5FU0 A;  4O6N A;  2PX7 A;  1VH1 A;  2XWN A;  1ZCY A;  3K8E A;  1H7G A;  4ASJ A;  2V0L A;  2O1F A;  2RIT A;  5CMH A;  4MND A;  4KT7 A;  1FOA A;  5FYE A;  4P02 A;  1IIM A;  3U2X A;  1EZI A;  2NXV A;  4G3P A;  2YQS A;  3RMV A;  3CU0 A;  4D11 A;  3I0K A;  3SX5 A;  2MZB A;  3OGZ A;  4Y62 A;  1XHB A;  1FGX A;  3U2W A;  3Q7U A;  1O0R A;  1R7U A;  4MIX A;  1MP5 A;  3SX7 A;  3F1Y A;  5EJ1 A;  4AYL A;  5CQN X;  3I0G A;  1VGU A;  5C1L A;  1FR9 A;  1R7Y A;  1ZJ2 A;  4YS8 A;  4EEM A;  1ON6 A;  1R7T A;  2AM5 A;  2VSI A;  1WT0 A;  3ZLL A;  2JCK A;  1H5S D;  3SXA A;  5JQQ A;  2VS3 A;  3IOI A;  3SXC A;  1WT1 A;  2A8W A;  2OI5 A;  1V83 A;  2OI7 A;  3T7N A;  4G3Q A;  4IRP A;  1QWJ A;  1G97 A;  2FYD B;  5CMF X;  1O23 B;  2RJ9 A;  1ZCV A;  3I0L A;  5C4D A;  1VGZ A;  1V82 A;  2I5E A;  5C49 A;  3FWW A;  2RJ1 A;  1NHE B;  4GBP A;  2PGV A;  2Z87 A;  1R80 A;  2CU2 A;  3IOJ A;  4Y6N A;  4KC4 A;  3PKP A;  3QVB A;  3TQD A;  4JIS A;  5C48 A;  2APC A;  2YCM A;  1I52 A;  1FO9 A;  1H5T A;  1FO8 A;  1VGT A;  1XZ6 A;  2Y4K A;  2VS4 A;  5CMJ A;  5D91 A;  1PZT A;  1VZX A;  5CMI A;  3USQ A;  5EJZ A;  1ZI3 A;  3V0L A;  3I0D A;  3SX3 A;  3TZT A;  2JCJ A;  1LZJ A;  1ZIZ A;  1LL0 A;  2J0A A;  2QGI A;  2Y4L A;  2RJ6 A;  3I0E A;  5FTS A;  3U2V A;  3V0P A;  1YP2 A;  1OMZ A;  4EE4 A;  1ON8 A;  2ICX A;  1H5S C;  2ICY A;  2UX8 A;  1ZI5 A;  5IDS A;  5C3D A;  1O7O A;  4FRD A;  2E8B A;  4M28 A;  3I0F A;  5CMG X;  1HJJ A;  4BMA A;  5IDT A;  1H4E A;  1HM8 A;  3I0J A;  4KXO A;  4O6M A;  2A8U A;  1WSZ A;  4EEO A;  1G3L A;  3E26 A;  4Y6U A;  1ZDG A;  2X5Z A;  4KC2 A;  1VM8 A;  4Y7F A;  3I0C A;  1YRO B;  1NQI B;  2OI6 A;  2XME A;  3USR A;  5C47 A;  4ARW A;  1ZHJ A;  1FZW A;  4FRA A;  4CJ8 A;  4EVW A;  1V84 A;  1S4P A;  4Y7U A;  1IIN A;  4KPZ A;  4HO9 A;  4B3U A;  4FCE A;  4NAN A;  4B2W A;  1OMX A;  4CJC A;  2PA4 A;  3CKJ A;  4NAL A;  3LW6 A;  4E1K A;  2YQH A;  4Y64 A;  3SXB A;  2O1G A;  3DJ4 A;  1MP3 A;  1O7Q A;  3BRK X;  3PNN A;  4EE5 A;  5CQO A;  5DDV A;  5C4E A;  4JD0 A;  3DK5 A;  4AAW A;  4FRO A;  1YP4 A;  4FIX A;  3I0I X;  1R7X A;  2W0V A;  3PKQ A;  3ZF8 A;  4HO3 A;  1R81 A;  3T7O A;  2RJ0 A;  1VZU A;  1ZI4 A;  2OEF A;  1H7E A;  2QH5 A;  1ZJ0 A;  1H5S B;  1JVG A;  4M2B A;  4B4G A;  1TW1 A;  4P00 A;  1LZ0 A;  2YQJ A;  1TVY A;  3NGW A;  1FR8 A;  3U0Y A;  4D48 A;  1QG8 A;  4DDZ A;  1H7Q A;  3CKQ A;  1G2V A;  3JUK A;  2C0N A;  1H7F A;  1H5R B;  3ZLK A;  3R2W A;  2RJ5 A;  4FIY A;  4K6R A;  1G1L A;  2VSH A;  2YC5 A;  3V0Q A;  2WVL A;  2O1H A;  1ZCT A;  2AES A;  3JTJ A;  4FRM A;  1JYL A;  1PZY B;  2X5S A;  2BO6 A;  1GWW A;  1LL2 A;  5DDT A;  4FRL A;  1LL3 A;  4NAI A;  4R7P A;  2GGO A;  4FCU A;  2ZU8 A;  3V0N A;  1Z90 A;  5IFY A;  1NMM B;  1LZ7 A;  3IOH A;  4D11 C;  3U2U A;  2P6W A;  4D0Z A;  2FY7 A;  1HM0 A;  2DPW A;  2RIZ A;  2I5K A;  2FYA A;  1H7T A;  2V0K A;  4Q7C A;  3RMW A;  2V0H A;  4EEG A;  3ZGF A;  5CQL X;  2WGZ A;  2AM4 A;  4KPX A;  5C1G A;  3E25 A;  1H5R A;  2VS5 A;  4HOC A;  2Q4J A;  5C8R A;  1GX4 A;  1HM9 A;  1WVC A;  2J0B A;  3OH2 A;  4ZDQ A;  5J49 A;  2GGQ A;  5HS2 A;  5C38 A;  5AJO A;  2WVK A;  4KQL A;  3HL3 A;  2JCO A;  1MP4 A;  1TW5 A;  4BQH A;  2OEG A;  3SXD A;  5FU8 A;  3V0M A;  2FFV A;  1EYR A;  1VIC A;  4B4B A;  5CQM X;  2X65 A;  3T7M A;  2E3D A;  1QGS A;  3Q4S A;  1G9R A;  3V0O A;  1GX0 A;  2I7B A;  2VK9 A;  4M2A A;  1HV9 A;  4HO8 A;  4M4K A;  3OC9 A;  1GQ9 A;  3V90 A;  2V0J A;  1VZT A;  3FOQ A;  5C4C A;  5L6S A;  3V91 A;  5EIY A;  1JVD A;  1ZCU A;  4XWI A;  2VXM A;  1GA8 A;  1LVW A;  3SPT A;  2VXL A;  4L41 C;  4G87 A;  5BXC A;  4AYJ A;  2BO4 A;  4HCQ A;  5C3A A;  2D7I A;  1G0R A;  4EE3 A;  3R3I A;  1K4V A;  2BO8 A;  3GUE A;  4Y7G A;  1NKH B;  1JYK A;  2Z86 A;  3V8Y A;  2FFU A;  4KNX A;  3POL A;  2YC3 A;  1INI A;  5AJN A;  3JUJ A;  1FG5 N;  5FUH A;  3RSB A;  2RIX A;  2P72 A;  4Y7V A;  5C4B A;  2Y7A A;  3F1C A;  4C2S A;  1ZJO A;  2RJ8 A;  2ZU7 A;  4FRP A;  3CKV A;  4HO2 A;  5C4F A;  3BCV A;  1VH3 A;  4HO4 A;  1S4O A;  1W77 A;  2XMH A;  2YES A;  4LW3 A;  5C3B A;  4FRB A;  1INJ A;  1W55 A;  2Y4M A;  2WAW A;  2JCL A;  4FRE A;  5FV9 A;  3D98 A;  3OH4 A;  4LW6 A;  1E5K A;  3CGX A;  5C36 A;  1H7H A;  3OH1 A;  2WEE A;  2V0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...