5C9AC

Crystal structure of empty coxsackievirus a16 particle
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
242
structure length
242
Chain Sequence
GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRAHARAGYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIEQTANIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
molecule tags Virus
molecule keywords VP1
total genus 41
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2015-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c9aC00
1HRV1 1AYM3 1MQTA 2R072 4RR3B 5AC91 1CD3G 3DPRA 5CFCC 2HWC1 1F2NA 4CEYB 1ND2A 5BNPC 1FMD2 1VBA3 4CEWA 5C4WB 1VBE3 4CDXA 4QPGA 1AR83 1NY71 1FOD2 1NOVA 5C4WA 4CDWB 4GH4A 4SBVA 1QJU3 1POV1 5GKAC 3TN93 1RUJ1 1RUC2 3VBUB 1BMV2 2WZR2 1D4M3 1R1A1 1ND3A 1AR73 5C4WC 2MEV3 4Q4Y2 4NWWA 2BBVA 1PIV2 4N43C 5BNPB 5C8CB 1MQTC 2R063 5ABJC 5D8AC 1RUD2 4Y5Z0 1VBE2 5JZGB 1RHI1 1AR81 1M06G 1VBE1 1RUF1 2RM22 1HXS1 5J98B 3VBHA 4RQPA 1TME1 1OPOA 5D8AB 4GB31 1PO23 1PIV3 4CDUB 4WM7B 5D8AA 1FPN2 1NG0A 1AYN1 1CJDA 5A32A 1D4M2 1V9U2 1POV0 4WM7A 1QJY3 5K0UB 5L7OC 4QPIA 1Z7S2 2TBVA 1AL22 4JGZB 1QQP2 3J8F2 1RB8G 1RMU1 1A6CA 5L7OB 3JB4C 1RMU2 1PVC2 1RVF3 1C8NA 1FPN3 1HRV3 4Q4W1 1BBT2 1QJX3 1V9U3 3S6PA 3TN91 4FTSA 2RR13 2X5IA 1SMVA 1RUG1 1RUI2 1ASJ1 4RS5A 1VBC3 2XBO2 5CFCB 1VBC1 1DDLA 4N43A 1FMD1 1EV12 1R092 2PLV3 1HRI3 1EV11 4JGYC 1Z7S1 1OOPB 1ZBA3 4GMP1 1IHMA 3ZXAC 4CDXB 4PDWB 2HWD2 1RUH3 5A33A 4RR3A 4CDWA 4WM8A 4PDWA 1ND2B 1PGL1 1H8TB 4IV1C 1TMF2 3M8LA 1OHFA 3VBUC 4GH4B 3TN92 5DDJ2 1HRV2 4IV3A 1B35B 5CFDB 3CJIB 4Q4V1 4QPIC 4Q4V2 4GB33 5CFDA 1AR71 2GSYA 1ND3B 1NY72 1R093 2PLV1 1HRI2 2PLV2 1RHI3 2RS32 2Y26A 4YVSB 1PO22 2RMU1 4RQPC 1QJU1 4YVSC 1VRH1 3ZFEB 1MEC1 4IV1B 1ASJ3 1R083 1WCDJ 2BUKA 1NCRA 2R073 1RUC1 2RS53 3ZFFA 1V9U1 4CDQB 4CDUA 4GMP3 1AYM1 1VBD3 3NAPB 1B35C 4CDQA 2R071 5AC92 4Q4X2 1QQP1 3J8F1 4AEDB 1BEV2 1PVC3 4LLFA 1ND3C 3JB8A 2ZZQA 1EAH2 4JGZA 3VBSB 4N53B 5K0UA 2WZR3 2HWF2 4QPIB 1QQP3 3J8F3 3VBSA 1QJX1 1RUJ2 1AL0G 2MEV1 2VQ0A 5ACA3 1D4M1 3LOBA 1TME3 5AC93 2X5IB 1COV1 4Q4X3 4BCUA 5CFCA 1FMD3 1VBA2 3DPRC 1RUH2 3VDDA 4CEYC 1AR61 4CDXC 4CEWC 1VBD2 2HWB1 2RM23 3JBG3 4FTEA 3VBRC 1NA1C 3ZFEC 4PDWC 5FOJB 4RS5C 5A33B 4Q4W2 5ABJB 4JGYB 1NCQB 3VBFA 1MQTB 1OOPA 2RS12 4JGYA 1BBT1 4JGZC 2MEV2 4Q4Y3 3VBOA 5BNOC 2XBO1 4GB32 1K5MA 5JZGC 1RUI1 1TMF3 1K5MB 1RUG3 1B35A 1H8TA 5CFDC 1X33A 3CJIA 4RHV1 4WM7C 1ZBE3 4FTBA 1HX6A 1AYN3 1C8M2 1RUE2 5BNOB 5BNNB 1RVF2 1PO21 2RMU2 1VBD1 3VBUA 5BNNA 4Z92B 1FOD3 5C8CA 2RS52 4YVSA 1AR92 2QQPA 1AR91 1AUYA 1NCRC 1RUG2 5BNPA 1R082 1NCRB 1AYM2 3NAPC 3ZFFB 2RR12 1ZBA2 4Q4X1 1R091 1VBC2 5JZGA 1VBB2 2HWE3 1EV13 1HRI1 1X36A 4RQPB 1RMU3 3FBMA 4AEDA 2R062 3NAPA 1NA1B 1ZBE1 1RUE3 1PO12 1EAH3 1POV3 1VAKA 2RMU3 4CDWC 5C8CC 1RUI3 1TMF1 4YVWC 5C9AA 5BNNC 5DDJ1 4AEDC 4Q4Y1 2R042 5ACA2 1QJZA 1PIV1 1RUH1 5ACA1 2HWC3 1HQNA 1E57A 1AR62 1AR72 1ZBA1 5L7OA 2WLPA 1GFF2 5LK7B 2HWD3 1PO13 3VDDB 2XPJA 2RS31 1PVC1 1NCQC 1QJY1 2HWE2 4WM8C 2BFUS 2R061 2WWSA 4RS5B 1OOPC 1F8VA 1HXS2 1PO11 3VBRB 4Q4W3 1W39A 1FPN1 4CEYA 2WFF3 4CEWB 2WFF1 1BMV1 4QPGB 3VBRA 2WS93 4WM8B 1RUF3 1R1A3 1AYN2 3DPRB 4Q4V3 3JD73 3ZFGC 1NCQA 3VBFB 3CJIC 5FMOS 1VB4A 1C8M1 3VBOB 2HWC2 1AR93 1VB2A 1EAH1 3VBOC 5BNOA 1C8M3 1BEV1 2X5IC 1RUD1 1FOD1 4GH4C 1BBT3 1QJX2 4IV3B 1AR82 2FZ1A 1TME2 2HWF1 2HWF3 1RUF2 3VBSC 2ZAHA 1QJU2 5C9AC 1RUJ3 5K0UC 1HXS3 1COV2 1VBB3 2GH8A 2WZR1 4N53C 3JBG1 3ZFEA 2WFF2 4CDUC 4RR3C 4RHV2 3JBG2 4CDQC 1RUE1 2WS92 3JD72 5J96B 5FMOL 3VBHB 3JD71 2HWD1 4IV1A 4EJRA 1RVF1 1MEC2 4IV3C 5A32B 4GMP0 1RHI2 2BPA2 3VBHC 1RUD3 2ZTNA 5DDJ3 2RM21 1R081 2HWB3 2R041 3IDEA 4FSJA 2BFUL 1VRH3 4RHV3 1AR63 1ASJ2 1NA1A 4NWVA 5C9AB 1PGW2 4RFT0 3HAGA 1VBB1 2R043 4N53A 1AL23 1COV3 4YVWB 3VDDC 4QPGC 4YVWA 2WS91 1K5MC 1QJY2 2HWE1 1ZBE2 1Z7S3 1AL21 1H8TC 2HWB2 1BEV3 1RUC3 2RS51 1VRH2 2RS13 3VBFC 1MEC3 3ZFFC 1R1A2 4Y4YA 1PGL2 1ND2C 2RS33 2DF7A 2IZWA 2XBO3 3ZFGB 2RS11 2RR11 1VBA1 5ABJA 2FZ2A 4N43B 3ZFGA 1PGW1
chains in the Genus database with same CATH superfamily
1STMA 1W06A 3RG0A 5LRSA 5DUWA 4I0AA 4LE3A 5EHDA 3DPRA 5JI7A 1W2UA 3UJQA 1IS4A 5CFCC 1SLAA 4CCMA 2F17A 4SLIA 4LKFA 1H2NA 3SHRA 1W04A 1RXGA 4BE3A 4QPGA 2P2KA 4CDXA 1EUUA 1FOD2 5C4WA 4YARA 4CDWB 1AHSA 4GH4A 4SBVA 3HNYM 2BNMA 1YQ5A 2HBUA 4UI9L 1H2LA 4QU1A 1CX4A 2VZPA 4JVAA 5GKAC 3ZSMA 4GA9A 2VMFA 4H3WA 4FAGA 5IFTA 1G9AA 1RUC2 1X9PA 2RDRA 1LENA 3ZYIB 1BMV2 2K9ZA 5DAXA 2E7AA 1R1A1 3TBDA 4DY5A 1AR73 1ZREA 4CSWA 1A3KA 3D3AA 3T30A 2J7MA 3JU9A 1JBCA 3JZVA 3NWKA 3OOXA 4YW2A 3E97A 5IHRA 1H0BA 4CP0A 4OI0A 3LFIA 1FV2A 3T0AA 3ATGA 1W8NA 4IERA 4BQXA 4XFAA 4HBNA 4QX8A 1MQTC 2OUJA 3WDUA 1DYOA 2W08A 2VTFA 2RG4A 3AKQA 1WGPA 1SZBA 2JX9A 3GCXA 4XF3A 3BTYA 5D8AC 4YW7A 5EFUA 2XQRA 1RUD2 5FYVA 5FZ0A 4Z1VA 5FZGA 1ACCA 4IGOA 3ECQA 1RHI1 2X53S 1AR81 1OLRA 3E5XA 5EQUA 3RZHA 1KRIA 1YXWA 1RUF1 2RM22 4IDZA 1TME1 5F3EA 2Y6JA 1UPSA 3MV01 2YGLA 1NUKA 1UWWA 4I0BA 4XJ8A 5D8AB 3ZIWA 1PO23 4AR2A 1PIV3 1H6XA 1OFSA 1V6IA 3PTRB 2BU9A 3ZXDA 4WM7B 1FPN2 1JYCA 1NG0A 1CZTA 4RYDA 3CDZB 4EN0A 2SLIA 3KV4A 5T54A 4UF0A 2VMEA 3PVBB 1QJY3 2GMPA 3D0JA 5E88A 1ZVFA 2WA4A 4KG0A 2TBVA 1W2NA 3ITQA 3LWCA 3J7LA 1EP0A 1PM4A 3FFQA 2D97A 4CTEA 3T2QA 1O91A 2E31A 1RB8G 1IG3A 4AI9A 1VMFA 5T3NA 2ZEXA 5F5CA 1A6CA 3IAPA 1US2A 3VV1A 1W28A 1RMU2 2RDQA 4IE0A 1PVC2 1XBFA 2AEYA 4C90A 4LA2A 2DU1A 4FTSA 4F3JA 2FMYA 3TRSB 4XBQA 2Q8OA 3RDIA 3U37A 4W6WA 2YZ4A 3X29B 1SMVA 1RUI2 3CJXA 2XKOA 4TLFA 2A7AA 3HQUA 3WCRA 4BYYA 4E4ZA 4F8AA 4XJ9A 4WVMB 1DDLA 2XR4A 2VCAA 4XPVA 3V56A 4FOQA 3SKVA 2ES3A 3H8XA 4GKXA 4I3GA 2GNMA 4HZFA 3N3HA 1GZWB 2VCCA 3CIHA 1C57A 2BDRA 4RGKA 1UPIA 1OBNA 3OJBA 2F6BA 3U11A 2VUJA 3OY8B 4XZUG 4Y1ZA 3SNMA 1OOPB 4I2OA 1IHMA 4NVPA 2ATFA 2R6QA 4CDXB 4PLOA 4JC1A 4PDWB 3DYOA 1BK1A 4FP3A 1HDKA 5A33A 1ZA7A 4RR3A 4AVSA 2OQ6A 2GC1A 2ZGTA 1W6MB 4CDWA 1PVXA 4WM8A 5IAXA 4E8DA 1ZZ7A 3WD5A 1UU6A 4R52A 4AQ6A 3S0MA 4XIKA 4XTMA 2G1MA 4DPNA 5FPXA 1LHWA 2LTNA 4PI0A 5C5UA 4MGYE 5LEKA 2ZBJA 1IGOA 3SCFA 4NPLA 4AZZA 1AJOA 3ZPYA 3BOPA 2VQUA 3BU7A 4LE4A 4QKFA 5JSRA 1W6NA 2WIIB 1B35B 4V2WA 5IVCA 3IMMA 3WSOA 1WD3A 2BNOA 2JDHA 1F5FA 3FHAA 1N3QA 4QPIC 3SH5A 1G6NA 2WLQA 2V4VA 5FZ6A 5A7NA 5CFDA 4A41A 2I07B 1OC1A 1ND3B 1NY72 3AKTA 3LSEA 4B4QA 1NQJA 3RZGA 4E4DX 4IEOA 4IE4A 4JHTA 5GZFA 2A5ZA 2XL7A 4JX0A 2PLV1 5FY8A 2Q4SA 2VOTA 1OF4A 1UU4A 5LA0A 2DFCA 2J1EA 1XPWA 4LA3A 4XFCA 4YLZA 2XJVA 5FZIA 5J36A 5IAVA 2Y26A 3FUQA 4LBQA 1GQPA 2GP5A 4NAMA 2RMU1 4OUEA 5JWPA 1LTEA 2IXKA 4UBGA 4W8JA 1SLLA 3PUIA 1QJU1 4RQPC 3VL9A 1XU1A 3ALQA 1VRH1 4GAZA 4MSVA 5DABA 4ZXKA 1ASJ3 2Y60A 1WCDJ 2R1BA 1ZYBA 2BUKA 3VD7A 4KGQA 3OPZA 1SHWB 4EN6B 2JKBA 3ENRA 2EICA 1CWPA 4HVOA 2YYOA 3RWKX 3K4DA 1NZCA 4GMP3 2VR4A 5EV7A 5FXVA 1OKOA 3AYEA 4ZS3A 4DIQA 2ZKNA 5FMBA 4CDQA 5FLJA 1PX4A 1O8SA 2TEPA 4Q4X2 2VZ1A 2VO5A 1O4ZA 1UNBA 1BEV2 4BQ5A 4UOJA 4LLFA 5EJ3A 3I2KA 4Y1UA 1Y4WA 1BHGA 2ZZQA 3VBSB 1CPMA 3VD3A 2ORXA 4PIXA 3AP5A 4EZ4A 4JQRA 4LR4A 1N1YA 2BW8A 1GNYA 2HEVF 1HB1A 1SEFA 2ET1A 4LULA 3UL2A 1Q3EA 4WVVA 4QXKA 5FQ0A 2WNUB 5LY1A 1HV0A 4HK9A 3RYKA 1ZNPA 1GOFA 2VQ0A 5FR3A 2RVAA 1ULGA 4MXVA 1VALA 2B39A 3AP9A 2Y0OA 3I2GA 5J7MA 1D4M1 1LOBA 1LKNA 2D40A 4YW3A 4IUGA 3THCA 4PIZA 4CXYA 3OPWA 3BUCA 4XQWA 5B4XA 4ATFA 4LO8A 4QGMA 2XJUA 5KHIA 4GZ9A 2ZABA 4ZY9A 5JLVA 3R0RA 2Y8KA 3RZKA 3CZJA 3CEWA 1IKQA 2UYBA 3ACGA 2VECA 2JICA 3VDDA 3ZX7A 5LY2A 2D5HA 4Q2FA 2HWB1 5IUQA 3DXUA 3TEXA 1YYNA 3JBG3 4FTEA 1Y7BA 2YB7A 3AX4A 2QDRA 4AHWA 3K48A 2W1WA 3I2IA 4JKMA 2CDOA 4PDWC 4MZUA 5JR7B 3ZYPA 1HV1A 3I2HA 4WBBA 3RZLA 4RS5C 1MR5A 5T5PA 2CGOA 4Q4W2 4XF0A 5ABJB 5FYUA 3WNXA 3ZDVA 3U10A 2OPWA 5A7WB 1MQTB 2XGXA 2RS12 1GWKA 1PZ8A 1WMEA 1VAMA 1BBT1 3CMGA 4JGZC 3RJ2X 2CWMA 3VBOA 4B7KA 5FZ4A 1OMIA 2W39A 2W46A 2Y6LA 3SXWA 1K5MA 1H4GA 4AVAA 4CUAA 4YZ1A 2VUAA 2OA2A 1SG3A 4OQ9A 1RUG3 3VD9A 1H8TA 3UKVA 2ZHNA 1X33A 1UD1A 1ZA4A 4PLMA 4RHV1 3F95A 3KF5A 4XACA 1FATA 4FTBA 4IEXA 1CIYA 1AYN3 4QX0A 3MICA 3GJAA 2WNOA 4FP2A 4K3UA 1RVF2 3B3QE 1JU3A 1CAXA 4OI4A 2RMU2 4PBPA 4QQHA 2VZVA 1VBD1 2ZX4A 3Q8BA 4IEQA 2I2SA 5JXJA 1O3RA 3HBZA 4Z92B 4PBOA 2AYHA 3CU7A 2RS52 5CBLA 2CHHA 3CNAA 3LPGA 4A44A 3U75A 4K9SA 2XXZA 5C3OA 5FMCA 2WO3A 1AR91 3GBWA 3HEIA 4HKOA 4QMAA 4YM0A 1F4AA 2D6OX 3BN6A 1SLTA 3B9CA 3KVAA 2EIDA 5IT6A 1NCRB 2D7FA 4Q8KA 4MGZE 2LW8A 3BOWA 1HB2A 3BPSA 3V64A 3AMHA 4XDPA 3ZIXA 4I0WB 2W92A 4ITCA 5JOZA 1VE0A 5FFOC 3KCYA 1YJLA 2HYXA 1OVSA 4Q4X1 4XFIA 4O65A 5LASA 1O3SA 3POFA 3ZMNA 1WBFA 4YW1A 2D43A 1V6NA 4A7YA 3AFKA 2HWE3 3CZUA 4MGTA 2CWSA 3ON7A 1JYVA 4JHZA 2H6BA 1UY1A 2JIGA 4U2AA 1JU4A 3N9MA 5K9YA 3OTFA 1WLWA 1NA1B 3LCPA 4AHZA 2FDGA 5D21A 1PO12 4XE9A 1UZ0A 5T5LA 1UY2A 1NLSA 3MIEA 3ETQA 1PK6C 3MPBA 2RMU3 1OA2A 3D8CA 4S2HA 1CZVA 4BK4A 1UYZA 4XZPA 1TMF1 2PFWA 5FY9A 2XHNA 4LORA 4G9SB 4XFFA 5BNNC 4AEDC 1JYXA 4Q4Y1 1KS4A 4FFGA 3L2YA 2P37A 2WR9A 3U78A 2Y0IA 4Y20B 4YM3A 1NLRA 3GZTB 4Y33A 4XCBA 1YNAA 3NMBA 1DG6A 2GDFA 4X8NA 1W2TA 2DTWA 3U07A 4BHPA 1AX0A 4CUGA 3OUHA 2JE7A 5ISLA 3BVCA 1GFF2 4BK5A 1DP0A 2X05A 2P5BA 5DMYA 2HWD3 3KGLA 2JG8C 3VDDB 4ISQA 3IMNA 3R6SA 3VKLA 4BISA 4COUA 3IKWA 1P8JA 5I93A 1S1AA 3HQRA 4CVUA 3WDWA 1NCQC 2HWE2 2BFUS 2J1AA 1H1IA 2WZEA 2R061 2EAAA 1AZDA 4OMDA 2IUWA 2NMOA 1H6YA 3WW4A 1HXS2 2JDMA 5DZFA 1AXKA 4I02A 1NLQA 1XQNA 1E5RA 4Q4W3 3WOGA 4CEYA 1DZTA 5FZLA 5FO8B 5T5JA 3VDAA 4CEWB 2BP6A 5E89A 3AKRA 3O1OA 1L7RA 2WNUC 3DPRB 4Q4V3 2EIBA 1BCXA 1NCQA 3ACHA 4FPEA 4BXSV 5FMOS 3IAQA 2FDFA 3PDQA 2WRAA 3KGZA 1QGLA 2C1FA 5CKQA 4P00B 3PUHA 3I3EA 3PHMA 4LUKA 1RUOA 1WCUA 5FYYA 3WUCA 1JS9A 1HN0A 1O4TA 1RJ8A 1W0OA 2Q5TA 4Q8LA 1O3QA 4DEQA 2WT0A 4P14A 4CCKA 2B9VA 3EXUA 1UOBA 1OLQA 5CAZA 2IXJA 4XBNA 1BEV1 3GXUA 1YFXA 2QQNA 5FY5A 4I30A 4MX3A 2VZUA 5T50A 4IETA 5F8PA 4IV3B 1TME2 1F35A 3UJOA 4FT8A 2ZEYA 3AKSA 5T55A 2PHRA 5FLIA 1HIXA 5JPMB 3USUA 2QQLA 1FAYA 1R64A 1W05A 4L97A 2WZPP 1CGPA 1K42A 1LCLA 1URXA 4OZXA 1W6OB 4Z2WA 2NN8A 2WZR1 2E33A 5LATA 3RMXA 3ZFEA 2O14A 4CDUC 1Z0HA 1LEMA 1PZ9A 3APBA 3JBG2 4LBLA 5BYNA 2V4AA 5FLHA 2JDKA 1WW5A 1RUE1 3ZYBA 2VW1A 1SPPA 5FMOL 3VBHB 1UW8A 3QBQA 2FQPA 1C5IA 3CHXA 4V2VA 3ACIA 4FPKA 2AEZA 4R9BA 3KS7A 2VMIA 5DAVA 5JXIA 4EJRA 3POYA 3VL8A 3CBNA 3MIHA 5AFEA 2XJPA 3H8OA 3H3UA 3RNSA 5A32B 2Z42A 3DUIA 3MEPA 1W03A 5FPAA 4Y24A 2WFPA 3V0BB 1LU2A 2VCMA 3UV9A 2CTVA 2OX0A 3MHZA 2HWB3 4AFMA 4FSJA 1DYPA 2BFUL 1BXHA 3NV1A 5GZCA 2IC1A 5I8SA 4D0QA 4MGKE 1PGW2 3FHQA 4HANA 4MYEA 2GC3A 4OHYA 2ERFA 2RDNA 1Q8VA 3ZXFA 3HAGA 2QNKA 3NQHA 4OULA 1AL23 3V0AB 4JDMA 3QD6A 4QPGC 2ZOEB 1U5ZA 1MS8A 4YVWA 3TEYA 2PAMA 2CY6A 2VBDA 2HWE1 4A45A 1K3IA 2W5FA 1YJKA 2ZMKA 5J48A 3FLRA 1AL21 1H8TC 2XKPA 4HXCA 2EAKA 1RUC3 3CQOA 2W2IA 3IDBB 3NV4A 4CCNA 4XVHA 1J59A 4AXOA 3T2PA 4LO7A 1UCXA 3VBFC 2XG3A 5F2SA 2A6WA 2QQWA 2CSGA 2KXLA 1S0DA 2AUYA 3ZFFC 1XSRA 4Y4YA 4COYA 1EUTA 2HYKA 3C2UA 2RV9A 2RJ2A 1YI7A 4EYUA 2JWPA 2XBO3 4X6RB 2UY9A 3ZSEA 2VNRA 2WINB 3I2OA 1FNZA 4XW3A 5GLZA 2WDBA 1WCSA 3GZEA 3KQRA 1UX7A 5F1RA 5LCWL 1OLMA 4QPYA 3VZKA 2FZ2A 1ZRDA 1HRV1 4YNIA 4DINB 5HV0A 1JXNA 2YHJA 3OBZA 3IZOA 5GLVA 4D69A 5EWSA 2J1RA 1EPWA 3PUAA 1F2NA 3JXSA 2H6CA 2IFWA 4JRAA 1FMD2 1VBA3 5C4WB 1PGSA 4HL0A 4KG8A 1UYXA 3DV8A 4DRVA 4D94A 3HOBA 5JUVA 4DXRA 1QJU3 4WVWA 4XBLA 4QKBA 2A73B 5E1RA 2JDZA 4QM9A 5FZ7A 1XXNA 2VTXJ 3WF0A 4FOYA 2IWGB 1X8MA 3W9AA 4QB1A 3VBUB 2R0HA 3RGBA 2WZR2 1D4M3 1EY2A 2VG9A 5C4WC 1WW4A 5DAPA 1G8WA 2GN7A 4Q4Y2 1XOYA 4FPCA 2Q0AA 4NWWA 3LA7A 4AQSA 1PHMA 2JDYA 4A3XA 2XDVA 3SISA 2D6LX 3M1HA 4J1WA 5JIAA 2R063 3DL3A 5LRRA 1QNYA 2ZGQA 1UIJA 5IW0A 4L0PA 1ULPA 2XWBB 5I8YA 1Y9GA 4FQZA 2A3XA 1VBE2 2WAAA 4YZ3A 5JZGB 3BU0A 4AE2A 4OVEA 2BWCA 2YMZA 3I97A 1DHKB 2Y33A 3LAGA 4HVRA 4QXHA 3IIAA 4PI2A 4Q0UA 3M3QA 4GD4A 2YPDA 3ZXKA 2D6PA 4O61A 2VOKA 2HH9A 3GZAA 4UF0B 4CPBD 5FO7B 2A70A 2J42A 2UWBA 1GKBA 3H42B 2DCKA 1HN1A 1CJDA 1LULA 1YHFA 3POJA 3J7HA 4NRPA 4YYOA 3ZN6A 1IPJA 1POV0 2NMNA 1LHUA 1HJFA 3NW4A 3B93A 1UOFA 5C3QA 1Z7S2 1WUVA 2YBKA 4KWJA 3ILRA 2W3JA 4P5YA 3V0AA 2WAOA 1AL22 4EWAA 4A6OA 5FP7A 3FN9A 4UW5A 5FY1A 1GICA 3OBRA 4AFAA 2KD7A 4LEJA 3S57A 1NE6A 1Y43B 2JB4A 2LROA 4KH9A 4BXFA 4BQ1A 5IATA 3KLSA 3JB4C 3JQXA 5FP3A 3MDPA 3JCIA 4CP9B 2PMWB 4OZOA 2WSVA 2YV8A 1GNHA 1RVF3 4NOTA 2H0BA 3K3NA 1BBT2 1QJX3 4R9DA 4DXSA 5A6ZA 2UYAA 3TN91 5KXEA 1B09A 1ZZ9A 4YM2A 3U1XA 1QOTA 4LBQD 2X5IA 2HBTA 1SFNA 1LB2A 3S7IA 5SV8A 2BJSA 1ASJ1 4EN7B 1VBC3 1FI2A 1QIQA 1YFWA 2XBO2 4NUBA 3EBRA 1FMD1 3GALA 2A1XA 1XNCA 2DBIA 3VD4A 2PLV3 1JYIA 1YQ6A 1W0NA 5F9TA 2QDNA 3O7OA 2VUCA 2OT7A 3P3NA 3R4DB 3ZXAC 3NJYA 2CV6A 2DVGA 4XETA 4MG2A 3CL1A 4UFMA 1QY4A 2E51A 1QXRA 3R05A 2QQVA 4IESA 4QHOA 5CADA 3OYWA 1C4RA 1ND2B 5F5QA 4CXXA 4KWKA 2PA7A 1KDMA 4DUWA 4YFZA 3RI9A 5BPXA 5DG2A 4A6SA 1W9YA 3VBUC 3W5NA 4GH4B 1H1AA 4H55A 5A3WA 4DO0A 1V00A 5A1LA 5BXXA 2SBAA 1YIPA 1RYYA 1BLZA 1TE1B 2QKDA 5CNAA 5KXCA 3JQWA 2ZHMA 3NJXA 4QAWA 4QHZA 1N1VA 2JD4A 4BB3A 1SBFA 3S30A 2RJKA 3THDA 3W20A 1YIFA 1AR71 4Y1VA 2G9FA 3NNJA 3C7EA 2VXJA 4A3ZA 2DURA 2Q8EA 1HRI2 2B8MA 4OHXA 4AW7A 2PLV2 1RHI3 3T4HB 3OGGA 5DAWA 3LA3A 3VUOA 4BZ4A 1MVEA 1J3PA 2C9AA 1REFA 1CAVB 4YVSC 1MEC1 3AVSA 1R083 2OPKA 5ANQA 4COZA 4JQTA 1A8MA 3GNEA 1NCRA 5A6YA 3BALA 3BTZA 2RS53 1SPPB 1I6XA 1QDOA 1U5YA 2O8QA 2ZX2A 5IVFA 3KQ4B 2ARBA 3I59B 3MIBA 4MH0E 3E1F1 4AI8A 3NAPB 3RVHA 1WKYA 1G86A 2UU8A 4Q0SA 4TXWA 2WSUA 1G9FA 1C3HA 4FQ4A 4CP1A 2W1QA 1UYPA 5A3UA 1R1ZA 3T2TA 1GP5A 1OUSA 4AEDB 3LFMA 3TWIA 1UZYA 4C0BA 2ADEA 1ND3C 1WA4A 5FQ0B 1EAH2 1FX5A 2VJXA 2WNUA 1XJAA 2WZR3 4QPIB 2ZPXA 2ETEA 4Q26A 1YWKA 1SQ4A 4XUNA 1QJX1 1OURA 2A3YA 2ZEZA 4MXWB 4CP9A 1RUJ2 2MEV1 4AEKA 4CA9A 4LBOA 4J1XA 3SITA 1TZOA 4AI3A 3VLBB 4HFSA 1TME3 2X5IB 4AHXA 5FZ8A 5CU1A 2VGDA 4BCUA 4YZ2A 1H9WA 5LZ6A 3BPZA 4UAPA 3I49A 4XIOA 1Q5OA 4YZ5A 3FFZA 1NT0A 1LHNA 2VE1A 2C4XA 1RGSA 3KSCA 4L2NA 3MF6A 1OT5A 1JMUB 1VP6A 4K1YA 1AR61 4P9XA 4CDXC 2WN2A 1JZ3A 4TWTA 2YROA 1VJ2A 2NP0A 1DQ4A 4DS0A 5FZEA 2BRTA 5A7QA 2BEOA 2GNDA 1BQPA 5FZHA 3ZSJA 5C5TA 5CKNA 5I0DA 3K46A 3IM0A 3ZSKA 2QVSB 3D0SA 2D5FA 2GAUA 4GWIA 1LOCA 5EXOA 3KV9A 4AGGA 5FKCA 1TNFA 1KS5A 1VLNA 4YW5A 1CIWA 1DGRA 1OOPA 3KF3A 5FIXA 2GMEA 2CYFA 4JGYA 5JMCA 4U36A 4MLOA 1IZ3A 5EJZB 3U4XA 4B29A 2ZJCA 1CONA 3WDTA 3O0WA 1SFYA 3GGLA 2ARAA 2ZX3A 1H8VA 5JZGC 1JOPA 2G4IA 2YBPA 2L9LA 2GNTA 1GYKA 2Y64A 2B9UA 3ME2A 4N90A 4YW4A 3MW4A 4G3YC 1IKPA 3N9NA 1N1TA 1HX6A 1YQCA 2W94A 3KHBA 5L73A 2DBNA 1CX1A 1IQDC 4IE7A 1I5ZA 3LB9A 4XUPA 4K7JA 3VBUA 5C3SA 1ZRIA 2PHUA 2KA3A 5BNNA 5IYYA 3OG2A 3L2HA 4Q27A 2ZGOA 4FXGB 1FOD3 1WCQA 3N9QA 2WN3A 5C8CA 4IEUA 4YVSA 5GJ6A 2DCYA 2DWRA 5FXWA 2Z2SB 3EJKA 2JB8A 1W8OA 4DUVA 4OHZA 2C6SA 1RUG2 3UKNA 5LW9A 2XLAA 1X82A 1R082 3K51A 4NIIA 2XJQA 5HCAA 1FXZA 2WNEA 3TNQA 4MADA 2VMGA 5H9SA 1W8TA 3HR9A 1ZBA2 4Y22A 3WCSA 2HJIA 1H9PA 1HLCA 4D6SA 1R091 3MPPG 4C8DA 3WW1A 5JZGA 3KHCA 4NHLA 3V65A 3HQXA 3DEMA 2ZMNA 1VAVA 4XAAA 3SCGA 1QH7A 3C7FA 4KGGA 1X36A 2D44A 4QX7A 1J83A 2V5DA 3FUOA 1ENQA 4AEDA 4N7IA 3E5UA 1V6JA 3KV5A 5FPUA 3FC0A 3RMYA 4CXWA 3MUY1 4FOWA 2ZEWA 3RZZA 5KHJA 3NRUA 4AVTA 2CGPA 1ZZ6A 1EAH3 2WJSA 2VVFA 4QGLA 3PVOA 1G9CA 2W95A 5FUPA 1RUI3 4YVWC 1CVNA 4W4ZA 1FV3A 5DDJ1 2PHFA 3WP3A 2J1UA 2IXIA 4JAAA 2KR2A 4RFRB 5FZAA 1ZRCA 1DZQA 3W58A 3TEZA 4EROA 1PIV1 2YU2A 5DZEA 1OH4A 2A6ZA 2JD9A 2WUHA 3N36A 1HQNA 3I8TA 1AR62 1GUIA 3IDAA 1O5LA 5KR7A 2P3KA 2X09A 2VZ3A 4M4PA 3AKPA 2WLPA 1PZ7A 4HKLA 1DYKA 2Z4FA 3I3BA 4YG6A 4XF4A 1WMFA 2JG9C 2ORZA 3DN7A 2RS31 4Y3OA 5FJHA 1LAJA 5C7GA 1UAIA 1QJY1 1VMHA 4WM8C 3ZYHA 4NJ4A 3W21A 3ZLIA 5A70A 2WWSA 3EB7A 4XILA 1F8VA 5HCBA 2VMCA 4F7ZA 4IW3A 2P3JA 4JZRA 3OF1A 3RS6A 1ENSA 4TSVA 4IEVA 2AC1A 4Z8BA 3WDXA 2WFF3 1J1LA 1FT9A 2NPIA 4DQAA 2XQXA 2WFF1 2BYVE 1I9RA 2XVKA 4QPGB 5CYYA 4LPLA 3KB5A 1RUF3 3AMQA 3OCPA 3ZFGC 2J22A 4LT5A 2B42B 1W8UA 2LALA 4A4AA 1PMHX 2ZCWA 3I3QA 4R8HA 1UMIA 1GP4A 1GZCA 2B5HA 2C5DA 1CJPA 3M3IA 2YDEA 5GZEA 1OA4A 1W9FA 2HWC2 2XWJB 3OB8A 3WNMA 1VB2A 5HV4A 5JVVA 3VBOC 2YFZA 4ZZ8A 3IPVA 3FBYA 1DGLA 3KD4A 3TNPB 4D3WA 2X5IC 3D82A 1D4VB 2F4LA 3CO2A 4K1ZA 4IGQA 4Y1XA 1DCSA 4HMZA 4KU8A 5JOWA 5JXHA 3N7KA 1UY0A 2OYZA 3ZO0B 1W9TA 3R4SA 2NM1A 1FYUA 4M0HA 4XJAA 2WA3A 2F4PA 1QJU2 1D7PM 2QUOA 1DGWA 4E27A 4I09A 4KI5M 5C9AC 4D7TA 3F2ZA 5K0UC 3O5SA 1COV2 1VBB3 1DIWA 4UFKA 1ENRA 2W0XA 3MFAA 3S5QA 3VDBA 1T6BX 1GOGA 4IEZA 3AXDA 4GWNA 4RR3C 4LUMA 4RHV2 3VZOA 4CZSA 3BKZA 1CESA 1PX3A 4XJUA 4PCRA 4CDQC 3I3MA 1RJ7A 2WS92 3HN1A 3JD72 5J96B 5IVYA 1NX9A 1O7FA 4TZDA 2ILMA 2WO2A 1A34A 3DCQA 3ZYGA 4GULA 3B94A 4M0NA 2WBKA 2XUEA 3GBGA 5HBAA 4DY3A 3HVDA 4NO4A 4J6GA 3ZXLA 3ST7A 5FZOA 1LODA 3LSDA 4HSLA 4EQVA 1MS0A 4L99A 5KHHA 2BPA2 3NKGA 2VPVA 4QKNA 4OI1A 1GLHA 4AGVA 2OS2A 1RUD3 2DUPA 4N8MA 4W65A 2D98A 2ZTNA 5DDJ3 1RL3A 3IDEA 1DLLA 1H30A 3N7JA 3R4UA 4DNYA 1BVP1 1UO9A 1VRH3 1WWYA 3OEBA 1ASJ2 2VZQA 2ID4A 4QWNA 5TSWA 2D3PA 4D6RA 4DXZA 5GZGA 5KC6A 5EIYB 1D2QA 3J26N 4CPBA 4AHYA 1X8EA 2DVAA 1SCSA 3AZVA 2OZJA 3BGAA 4YVWB 1COV3 3VDDC 3WP4A 3AM2A 3K4ZA 4AK3A 3E6CC 1XYNA 3CLPA 4LO5B 1J3RA 1K5MC 1KJLA 1QJY2 2HEYF 3M3CA 3HBKA 3UYJA 3E5QA 1Z7S3 5JMOA 3S5AA 1TQ5A 3I54A 2HWB2 4IQPA 4HG6B 4XJWA 1MVQA 1XE7A 1DQ1A 4P9YA 3WW3A 3ZVXA 4OUSA 2RS13 1QU0A 4Y5SA 4YGEA 2A6YA 2QBXA 1REDA 1CPNA 5IK8A 4AAXA 5FYBA 4FPJA 1R1A2 4XQ4A 1PGL2 1ND2C 3H1WA 1JYNA 2CNAA 2V09A 2VOXA 1WBLA 2IZWA 3WNOA 4BMEA 3KMHA 3NL1A 2C9KA 2DYCA 1PM7A 2KM2A 2RR11 1QF3A 2RS11 5EYXA 1VBA1 2ZZJA 4WZCA 4LLOA 3O0VA 4MO3M 3ZFGA 4LO6B 2E7QA 5FXXA 4XDOA 4BIFA 3OGRA 3QH7A 4BWOA 5AC91 3GZUC 1W6MA 1MZ6A 2OUHA 2PYTA 2HWC1 1Q8QA 2WWUA 3RYPA 1FNYA 2IFRA 4M3CF 4CEWA 1O6UA 1VBE3 1MS5A 3I2DA 1J1TA 1AR83 1UQXA 4OHVA 4HOOA 4PF5A 4QDRA 1V6OA 4A7KA 1IS3A 3FL7A 4XURA 4QX5A 5F32A 5FYHA 3IT8A 1VRBA 3FX3A 3OYWB 3IPVB 3RWNA 1RXFA 1WD4A 1POV1 4AI2A 1CAUB 3WG1A 1CQ9A 2YG0A 4ZU4A 3LEGA 2VBBA 4NR1A 2FDIA 4HN0A 3PVNA 4FXKB 1ND3A 4OI2A 2XJTA 3OBAA 5FZMA 3HNBM 4FPGA 1Z78A 2I74A 2MEV3 1DGRN 1S2EA 4ZXEA 1RITA 1PIV2 1OLME 2HEWF 3PVEA 3LF7A 3NJVA 4YFWA 3ZR6A 2W68A 3WQ1A 3URFA 5E8AA 4M01A 2E63A 1C1FA 4XMAA 2A6XA 2EIEA 5CIRA 1W9SA 1NZIA 2AENA 4Y5Z0 1F4HA 5GLWA 2DUQA 3SEEA 1DFQA 3WQ7A 2XB6C 5A7OA 3U4SA 1M06G 2VZTA 1VBE1 3RRDA 1LU1A 5FZ1A 5C6CA 1CAWB 2HLEA 4TLGA 5J98B 2VC9A 3QLQA 4RQPA 3HN3A 1OPOA 4W50A 1UZVA 1S0IA 3EYPA 4GB31 3WUDA 3ZN6B 4DB5A 3O1RA 1JN2P 3HT2A 2GNBA 4XDQA 4CDUB 5D8AA 1AYN1 1UKRA 1RINA 5FBJA 4HPKB 4ZU7A 4O7XA 4D8MA 5A32A 5A3MA 1V9U2 2QJVA 3HJRA 4CE8A 4P5HA 4WM7A 1O4YA 4YG0A 5K0UB 1XE8A 4LKDA 4JDOA 5A7SA 5K4LA 2WNVA 5A3TA 1MS1A 5I0UA 4AFBA 1YQ2A 5JCTA 4PQQA 2FDJA 5LWBA 2YY1A 2R16A 1QOOA 4KU7A 3POGA 3RYRA 3MLLA 3HD8B 4PIYA 2DFBA 3PL0A 2XLFA 4B4RA 1ZZBA 1O8PA 1ZM1A 2YC4A 4Q0VA 5A1FA 1KGYA 1PK6A 1Q8SA 4FPFA 1FPN3 4K21A 1HRV3 1HB4A 2VXRA 3S6PA 4AFDA 5KHGA 3WDYA 3J9SA 1OKQA 1UMZA 2JDUA 3G7DA 3AK0A 4NIAA 1JHNA 1SLCA 3PMEA 4K20A 5GLUA 1HQWA 4NE9A 4RS5A 3A7QA 4UFIA 5FZ3A 1VBC1 2YBSA 3PU3A 4EN8B 5A6XA 5CEHA 3ETPA 2XHKA 1EV12 3WZ1A 1WCKA 3A21A 1S0CA 4WZFA 3NVCA 2IXCA 4N9IA 4JGYC 2EF6A 5JOYA 4LK6A 1ZBA3 5LEJA 4GMP1 4NHKA 3LDBA 4XUTA 3LDRA 2X29A 5APAA 3MLKA 1POQA 3ELNA 5H9PA 3WP6A 3BTXA 1QHDA 2GN3A 2W47A 3T1MA 3ZKYA 1RC6A 5FPVA 3OUIA 4BQ2A 1WLDA 3ZM8A 1X7NA 2ZXQA 5FYZA 1V6MA 3SH3A 5A3LA 1HQLA 1UIKA 1TMF2 5F3IA 3M8LA 5GALA 4E4HA 2YU1A 1MACA 4NRQA 3TOJA 1MS4A 1HRV2 4RSUA 1ZRFA 4ZHNA 1KITA 5LA9A 5CFDB 3LEIA 3WV6A 1N1SA 4Q4V1 3VKMA 2WC2A 5FK7A 4O9EA 4BOWA 3SKJE 3W5MA 4LO4B 4TTGA 4CUBA 1F5JA 5I91A 3POWA 2GSYA 2P3IA 4XHXA 4K8FA 5EJ1B 2TUNA 3RJRA 2IVJA 1R093 4R4XA 3MIFA 2FCVA 2BNNA 5CVRA 5L19A 4C1XA 4YVSB 1PO22 5HXMA 1W8FA 4B4PA 3AMPA 5K7PA 3ZFEB 3FZ3A 1QH6A 3WW2A 5A6QA 2FDKA 2R073 2QE3A 5IVJA 4ASMB 2OKXA 1LHOA 1V9U1 2AACA 4FI9A 4AWDA 2VM9A 4Y22B 2VQTA 1KXGA 4CDQB 1DQ0A 3N9LA 4CDUA 1GWLA 4CU9A 3EQEA 1AYM1 1KDKA 2VZSA 5IJRA 3GYDA 3WY6A 1ODMA 2UWCA 1WMDA 3PJYA 5AC92 4XJZA 2DV9A 1LHVA 5FYSA 4YSFA 1U5XA 3H50A 2BOJA 4GJYA 1OUXA 1J3QA 4BU2A 5F3GA 3JB8A 2D6MA 4JGZA 4XC9A 2V72A 3FMGA 3H0OA 4EZHA 4MXWA 2E7TA 2EXIA 5FZDA 5FYMA 3VN4A 2D6NA 2HWF2 5FOBB 2ET7A 3HIFA 1CR7A 1QQP3 2Z69A 3J8F3 3VBSA 4IXLA 4IL7A 3LE0A 5GLTA 1W2OA 3POIA 4GWMA 3ZXGA 4NHYA 1AL0G 1IOAA 3A4UA 1QMJA 5ACA3 3FWEA 4HETA 2K46A 3KVBA 2Z79A 3H1YA 1W6QA 3LOBA 5F2WA 4XXAA 2BOIA 2BQPA 2CDPA 4QT6A 1OQ1A 3E6DA 1G7YA 1HW5A 2ZGNA 4Q4X3 1BJQA 1UX6A 1W3XA 3IWZA 5FCCA 1YEWA 3NV2A 4GALA 2DDUA 3OGJA 3VDCA 2OZ6A 1RUH2 2VVEA 3EO6A 1T2XA 3I2FA 4CEYC 3UGHA 1MPXA 3LEMA 1SDWA 5LBCA 1JHJA 1T6GC 2AGSA 2G9ZA 1VBD2 1OSGA 3EMRA 3MIGA 2BWAA 2TNFA 4PF1A 4WVMA 2PAEA 2DVBA 5I0TA 3J4UH 3VHPA 5FRAA 3ZFEC 4ZKTB 5FOJB 3C7OA 4ATEA 1QWRA 5J3UA 2JECA 2FBEA 4CRQA 3LA2A 3VD5A 4JGYB 3UT0A 2R32A 1WA6X 2Z5WA 1S0EA 3PUQA 3VBFA 2IXLA 4DRRA 2DCTA 2J1VA 4TN7A 4L8QA 3FLPA 3POBA 3RQ0A 1VR3A 2PHWA 1NAEA 1OPMA 4Q4Y3 3VZMA 2XBO1 4GB32 2GU9A 5DUVA 2GH2A 1TMF3 2XUMA 1KEXA 2YFUA 2WT2A 2P3YA 1NE4A 2CAVA 5CFDC 2VCBA 5IFPA 3H9AA 1LGCA 4IGPA 2XONA 4ORFA 1XYOA 1ZBE3 3A22A 1LNSA 4AQTA 3AYAA 4M00A 1C8M2 5BNOB 5F6KA 5BNNB 4B7EA 1PO21 5DPNA 1IS5A 2VTXA 4FFIA 1NKGA 2DCZA 2P34A 3LDKA 3QOPA 5DG1A 5A7PA 1JW6A 1I5PA 3NNFA 4XF1A 1AUYA 2FDHA 2A75A 3Q8FA 2WQ8A 4YWAA 4LJHA 1OVPA 4HN1A 1W6PB 1AYM2 3NAPC 5G04L 4CCDA 4LBQB 4LITA 3VKNA 1LOFC 5JDBA 5F7UA 3D5OA 5FZFA 5ERLA 2ARXA 5EZWA 3KT7A 1UXXX 1YUDA 1VBC2 1Y9QA 3H7JA 3PIJA 2XH6A 1VBB2 1LOEA 2BV4A 2C26A 3DKQA 3WNKA 2JG9A 1YO8A 2ZMLA 1EV13 1HRI1 2QCSB 3O1UA 2ZGPA 1RMU3 4J25A 5FZOB 4JDNA 2R062 3NAPA 2NQYA 2QFEA 1OXCA 2Y6FA 3MF9A 4CCOA 1ZBE1 4IE6A 2ZACA 1RUE3 1JZ4A 4RA0A 1YCIA 1POV3 3QCWA 5B2GB 1VAKA 1E5IA 2XVLA 4CDWC 5KBFA 5C8CC 1VMJA 1JOBA 2RHPA 2GP3A 4JV4A 3T3YA 3VHNA 4RGAA 4AGRA 1XRUA 2JXAA 4AI1A 5FKBA 1S55A 3SC7X 2R042 4E8CA 5FWJA 4LBMA 5ACA2 5JI9A 4QB6A 4FPYA 1RUH1 3O14A 2HWC3 1E57A 3BIWE 1JODA 3BIEA 5LK7B 5LBBA 4ARXA 2DU0A 2VAUA 1XB9A 1PO13 3PUSA 2PHTA 5BNQA 2W9XA 2WWJA 1L3JA 2BGPA 2PAKA 4X6QB 2ZGSA 3WF4A 1PVC1 2MHFA 3T0BA 1ST8A 5IVVA 1UY4A 2LM3A 2OQ7A 5FZKA 4RS5B 1D0HA 3HT1A 3MW3A 4CCJA 1WLTA 4MHUA 1EYBA 3ZYJB 1AF9A 1PO11 1US3A 5DN2A 2VY0A 1IS6A 1X50A 2Y34A 1OD5A 4ET7A 5FPZA 3N35A 5JSPA 3B01A 1W8HA 1UZZA 3TYJA 2WS93 3VBRA 1BMV1 3P1IA 4YZ4A 4NRMA 5JOXA 5BUVA 2BVVA 3EHKA 3USSA 4B3NA 3MBWA 5L7OC 5FP9A 3CJIC 5A7WA 2ZGMA 1OQDA 3WNLA 1C8M1 5A1AA 1H2KA 4LHNA 5EPAA 4Q1PA 4QXBA 1C5HA 3VBOB 4XF9A 1AR93 5BNOA 1Q43A 3OPTA 4L9BA 2RJLA 1C8M3 1WW7A 3HMYA 3MI8A 1U0AA 2ZGLA 4AFCA 1NQDA 1RUD1 1AR82 2D6KA 3SH4A 2HWF1 2R30A 1RUF2 4IEWA 3T09A 2ZAHA 4NAOA 4XTPA 4CYDA 3BI3A 5FZBA 4BMBA 4AQ2A 1RUJ3 1HXS3 5H9QA 2N7GA 2GH8A 1N3PA 4CCEA 3C7GA 1JYWA 1AX1A 1MZ5A 2I45A 3AFGA 3KT4A 4B1MA 4D6QA 5FP4A 5HI0A 3DXTA 3LIHA 3D6EA 1DZRA 4R9CA 1CAVA 1XNKA 3BCWA 3JD71 2HWD1 2PTMA 4GQ7A 2JG9B 4KBBA 1LRHA 5CKMA 1NXMA 2XMLA 1Y3TA 1VIWB 3KWVA 3A23A 4LKSA 4UFJA 3OSDA 4Y26A 1CAWA 2Q8CA 4MGSA 1NXD1 4IV3C 3L9JT 3PJQA 3V0BA 4XEZA 3FE5A 4JKLA 2JE8A 5FYIA 3AJYA 4ISRA 4XUQA 4BDVB 2VNOA 3WINE 1Y9MA 4TYSA 2GMMA 4D7SA 1R081 2R041 4M4RA 5FWEA 4RHV3 5T5OA 2UWAA 3H7YA 1NA1A 4NWVA 5C9AB 4INDA 1Q8PA 2VL4A 3M7AA 1DLCA 3I3DA 4H7LA 3VB9A 4BIOA 1IPKA 4XMIA 4UFLA 1KD7A 1ALYA 4RFT0 3AB0A 1SLBA 2R49A 1XNAA 2E53A 2R043 5HXVA 2PELA 4QHBA 2ZHKA 4ARYA 3FLTA 2R1DA 3U14A 1L7LA 2QZ3A 2P4EA 4IEPA 2WZ8A 2NLRA 1WZXA 4UW6A 1S4CA 2PHDA 4QX2A 3Q9OA 3O1TA 2VVDA 5F5AA 2JKXA 3A0KA 4OLLA 2D3SA 1H1MA 4C1WA 4JCKA 4YPJA 5FY4A 4I01A 3NJZA 1BEV3 2RS51 4P9IA 2EXHA 1CN1A 1TVGA 1GWMA 4AOCA 3CF6E 4LHLA 3OGSA 1UYYA 1PNGA 2PQSA 2VOWA 2O1QA 2EA7A 3MW2A 3D4KA 3B5LB 4AF9A 1MEC3 1J84A 2XOMA 3NSTA 3C8XA 4UXAA 2RS33 1N3OA 3H1MA 3K75B 1C28A 1QJEA 2QQUA 3LOIA 3T4VA 1GQGA 4CU6A 4N43B 3N4MA 3PNAA 1UKGA 3PIGA 4OFGA 2ZHLA 4AVCA 5FO9B 1PGW1 1GR3A 1AYM3 1MQTA 1YFUA 1NYWA 2R072 4RR3B 4ZZ5A 1CD3G 5JIUA 4QQOA 3UNPA 1E5HA 1YQ8A 3IDCB 3J7MA 3QACA 1XNTA 4CEYB 5KXDA 1ND2A 5BNPC 5C3PA 4NIHA 2Y6HA 4L11A 4QGNA 2DCJA 5AVAA 5LA2A 5LK5A 4QPWA 4W6YA 1NY71 2Q30A 1NOVA 4AL9A 1S0JA 3RZMA 3M2MA 5CG9A 3BB6A 3N9PA 4G4FA 2VZRA 1EPZA 3DGTA 3WF3A 1KFXL 3ORJA 5LB6A 3TN93 1IQAA 1CAXB 1RUJ1 5E16A 4AI0A 1U5IA 2PHLA 2JE9A 2WQZC 3H3ZA 4HLTA 1GOHA 1TG7A 2ARCA 5ANNA 4CU7A 3C3VA 4BLJA 4MHRA 3UK9A 3KZ4C 1SDDB 2OW4A 5G05L 2BBVA 2ZS6B 5J1XA 2WNVC 4N43C 5BNPB 1H2MA 2D3RA 4KWLA 5FDBA 1GNZA 2BERA 5C8CB 5HCHA 5FYTA 2FHRA 4FO9A 5F5IA 1ULEA 3UESA 1YC61 5ABJC 3DF0A 5IVEA 2O8OA 5I0SA 3M4FA 4NIGA 5IK7A 1ULFA 5JPNB 4CP2A 2CAUA 4PHZA 1TNRA 3ZR5A 3GCWA 3N7MA 1C1LA 3LZZA 1HXS1 1QKQA 2E6VA 3VBHA 4NHMA 1D2SA 5FPLA 2JG8A 3H3LA 3NNGA 2Y6KA 4CUCA 3MUZ1 4HPKA 1OI6A 5A80A 2RE9A 3MIDA 1UZWA 2K2SA 1JUIA 1JOJA 1D4M2 1UL9A 2E32A 2VNVA 4YM1A 4KNCA 2WABA 5FZCA 1WW6A 3K77A 3AVRA 3MO4A 4QPIA 4XABA 4C91A 5JSOA 1QXPA 2ENRA 4P9LA 4ZU5A 3THTA 4JTOA 4LOSA 3TB0A 4P9WA 3LGRA 3OBTA 3OGVA 2DVFA 3OD4A 1WLCA 4JGZB 1W2AX 2WQ4A 5EP9A 3ZXEA 1UOGA 4LNVA 3IBMA 2QQIA 1QQP2 3J8F2 2VZOA 3OEAA 5C70A 1RMU1 1PK6B 3I4IA 3AYDA 3WHUA 5L7OB 3CKHA 1AJKA 3VGIA 4BLIA 1GU3A 2QQOA 3ZN4A 5J37A 3UGFA 2AH2A 5A3NA 1YRZA 2FCUA 1C8NA 3IB3A 1KJRA 4HVQA 2VMDA 4JTNA 1F31A 2XVGA 4Q4W1 4E2QA 3WDVA 1V9U3 5FAXA 3MFCA 4S2DA 2RR13 1W99A 1RUG1 2PQQA 3AZXA 2W87A 3SMHA 1V70A 4YGDA 4IE5A 3WQBA 4R9AA 4P9GA 5CFCB 1REEA 1ULCA 2A3WA 4QDQA 4QU2A 2E9QA 4LQRA 2YPJA 1G9BA 4N43A 4OMCA 5CB7A 3OD0A 4Z82A 2EIGA 3AP7A 1R092 3B02A 4ASKA 1TEIA 3WVJA 1HRI3 1EV11 2R0FA 1Z7S1 2VOVA 3DECA 3M3OA 4XHBA 3INAA 4NHXA 4AAPA 5F37A 5DAQA 5FV3A 2HWD2 1RUH3 1BK0A 4MGIE 2W1SA 3GJBA 1ULDA 3T08A 3LPFA 3SEPA 3T0DA 2OXBA 4PDWA 5L9RA 2QQMA 2R7EB 4N9HA 2BTVC 4FCAA 3WF1A 1PGL1 4O9GA 3DYMA 5L9BA 5B4NA 1QXJA 1Q56A 1H8TB 4DEVA 4IV1C 1GQHA 5F39A 4D7YA 5HCFA 1OHFA 4PT6A 4MGQA 4QKDA 3TN92 1S0BA 5DDJ2 3OUJA 4IV3A 1ONAA 4M3CB 4QQLA 4XCAA 1JZ2A 1CZSA 1JI6A 1QJFA 3CJIB 5I8TA 4QM8A 3LD8A 5FBZA 4URAA 1GMMA 1W6NB 3J7NA 4Q4V2 1XNDA 4GB33 5KHKA 1E5SA 1O5UA 2Q1FA 2EVXA 4BQ3A 4LBKA 4ZS2A 3VHRA 3KCCA 3WG3A 4DZGA 4NIDA 3P3PA 3PTYA 3SQOA 1PNFA 3WEZA 2J1SA 2WO1A 4HT1T 3VZNA 4Q1RA 3WLUA 2RS32 1XYPA 2E26A 1SBEA 4FPHA 4UT5A 1AXZA 3MGUA 1LECA 4LBJA 3LKJA 2ZAAA 4IV1B 1OA3A 2J1TA 2GZWA 5E6HA 2XL9A 2XJSA 2YGMA 2JDPA 2LS6A 1RUC1 1DQ5A 3WG2A 3ZFFA 4DUXA 3KCXA 1UU5A 2W52A 3O12A 4QX3A 4DXTA 1MS9A 3O1MA 1IPSA 3THPA 1VBD3 2DVDA 4EWDA 5K8SA 3MLJA 3KT1A 3LQCA 1B35C 3I59A 3PLQA 2W1UA 4CU8A 4OHWA 2R071 2CGNA 5KC5A 2P17A 3ZXJA 4KQ7A 2RDSA 4UBHA 1QQP1 3J8F1 1LGNA 2BZDA 3GM8A 4MOAA 5F6LB 2QQJA 2Q1ZB 1PVC3 4NPMA 2ZKLA 3U0ZA 1W8WA 1OF3A 4QQPA 4N53B 4RL7A 4B1LA 2B45X 4IEYA 2MPFA 5K0UA 2WKKA 3HWJA 5HPOA 5KXBA 3KV6A 4WVZA 3ILFA 4DMIA 5L9VA 3FJSA 4KL1A 4E9KA 1UF2C 2VNGA 4A2UA 4FAHA 1W6QB 4ONUA 4LMFA 3Q8AA 3WG4A 4H2AA 2V73A 4BA6A 5JR2A 3DYPA 1HJGA 4OCTA 2VU9A 5AC93 1K45A 1LJ7A 2IVIB 1JZ6A 1COV1 1OFNA 1YI9A 3I2JA 4XFGA 3O1PA 2B7YA 3AL5A 1ZZCA 4BJ0A 5IK5A 1J58A 1ZX5A 2BBAA 2AZ5A 3POEA 5CFCA 1FMD3 1VBA2 2DUOA 3DPRC 3I7DA 3Q8CA 4CCCA 4R4ZA 5F3CA 2EXKA 4LTAA 2P1BA 4HKWA 3AP4A 1GZWA 4LBNA 3W59A 4CEWC 1GV9A 1UXZA 2VULA 2RM23 4BPZA 2ZX1A 4P02B 4XYXA 3OY8A 3VBRC 3WF2A 3AZWA 1QDCA 3PU8A 3VZJA 3AYCA 1H4HA 1NA1C 2YUEA 4K6BA 1N47A 4RD7A 3SCHA 4GJZA 3FHIB 2BGOA 5JAXA 5A33B 1Q8OA 1XU2A 1LOFA 4K40A 3B69A 1IG0A 1NCQB 2P6HA 1JUHA 2YXSA 4X8PA 4AG4A 1SCRA 4H14A 3C7HA 4XAEA 1SFPA 1M4WA 3VKOA 2MEV2 3MYXA 1AXYA 5BNOC 4GIQA 4HSJA 2CU5A 3GBFA 5DXDA 3K2OA 1DBNA 4A7ZA 1SBDA 5H9RA 1RUI1 2PHXA 3AL6A 4AYUA 4GXLA 4Z2AA 2FMDA 1K5MB 1B35A 2NZ9A 4YGBA 3S7EA 4P08A 5DQ0A 3CJIA 1UOJA 2HKXA 3ACFA 4UYBA 4WM7C 1V6LA 5EYYA 2Y38A 3M3EA 4Q5OA 4QXCA 3WXPA 1CAUA 1RUE2 3WNNA 3KM5A 4EV0A 5CISA 3K4AA 3VHOA 1JYTA 3USUB 4YW6A 4FBFA 4E4SA 4S2FA 1W6OA 5C8WA 3RZJA 3ACLA 4ZONA 5DUXA 3WT3A 1OD3A 5CA6A 4H7MA 4Y4RA 4E2SA 2PN5A 5FXZA 3JUUA 1AR92 1K5JA 1BZWA 3WR0A 3WHTA 2QQPA 1DF0A 3H8UA 4AEJA 4OUMA 5CG8A 1NCRC 1S2KA 4HONA 5CZKA 5BNPA 3VKFC 4AVVA 4B8EA 2FD8A 3ES1A 3LIGA 4RN5A 1W90A 4YG3A 3ASIA 3BTAA 2VMHA 1QOSA 1GZ9A 1UMHA 2RR12 3AMMA 3PMSA 3ZFFB 2V5YA 4LK7A 2P6CA 1MZFA 1LGBA 3ZN5A 2B46X 4QD2A 4FOVA 5AFBA 1XNBA 4COWA 5FZ9A 4N7UA 3O0XA 5AVPA 1SACA 2VD7A 2WO7A 4M3CE 2VH9A 4RQPB 2JEMA 3AZYA 4AEMA 1JTZX 3FBMA 4GKYA 1LESA 2LUWA 1XSQA 2MNGA 4MV2A 2GC2A 4Q29A 1LOGA 2IXHA 2XLGA 3GDBA 4EWEA 3ZSLA 4NMIA 5D1IA 2OIIA 4LKEA 4ES8A 4BH9A 3HPNA 4UW4A 3T2OA 5JXGA 1ODNA 2AREA 1WMXA 4UWDA 5A3OA 5FMDA 1GANA 5GM0A 2DTYA 1GP6A 4Q0PA 5C9AA 1JZ8A 4BQWA 3M70A 1VPHA 4NPRA 1DQ2A 1JH5A 3ZYFA 2H0VA 4DFSA 2W91A 3BYWA 2JJ6A 3AMNA 4RGGA 4XOGA 1QJZA 5C33A 4Y5TA 5ACA1 2GALA 2ZGRA 2A71A 3RPQA 5LBEA 3ES4A 1KQRA 1AR72 1ZBA1 3GHNA 2PXJA 5L7OA 4OQ8A 2EALA 5FREA 4MUVA 4ES9A 1KFUL 4LIUA 5A3PA 5M0TA 4MVTA 5KWRA 4K8RB 5SV5A 4HK8A 4UW3A 5BV6A 2XPJA 1AX2A 2JENA 5FYCA 3TAYA 1ZZ8A 3SLIA 1D0GA 2C24A 2YC2A 3MZHA 1BYHA 2ADDA 3IIIA 4YGCA 3TEWA 3ZDSA 5I0RA 4FPLA 4QX1A 4XXPA 1MZEA 1S2BA 3ABZA 4NN0A 5T52A 2WYSA 4XFBA 3O1SA 1OOPC 4URTA 3AZZA 1G9DA 3N9OA 1A78A 3AJZA 3VBRB 1W39A 3GHMA 4QDSA 1FPN1 1HB3A 1I3HA 3WP5A 2AR6A 1LR5A 4YRDA 2C0ZA 3G6JB 4WM8B 5IWFA 5D2AA 5DUUA 1R1A3 1AYN2 4BQYA 3JD73 4JRLA 3VBFB 1XE0A 2Q1MA 1I1EA 4S2GA 2Q8DA 1HKDA 4I3PA 1VB4A 5FP8A 4P9JA 5GZDA 1S0FA 3AC0A 4EE2A 3NV3A 3ROUA 2JDAA 2QZ2A 4OYUA 2OVUA 3O1VA 1W3VA 1EAH1 1O3TA 4QQ2A 3WX5A 3MV11 1RUNA 4XUOA 1SLIA 2X8KA 2X10A 1UN1A 4WV8A 1FOD1 2FCTA 1BBT3 1QJX2 2G19A 4GH4C 2QQKA 1ZRRA 3WQ0A 2VW0A 1GBGA 2FZ1A 3POSA 3RSJA 5FJKA 2JDNA 1LOAA 4M3CA 2HWF3 3VBSC 1ULOA 1W0PA 1RIRA 2LRPA 3NNMA 3AXEA 5FY7A 4FPOB 3AP6A 2D93A 4KBZA 4FFFA 3ZYRA 4KMQA 4N53C 2XJRA 3HNMA 3ILNA 1OQEA 3JBG1 4PJYA 4JKKA 2WFF2 3NKTA 2ZGUA 1DU3D 4Q0QA 4COVA 1F15A 1BKZA 3ZOIA 1RTVA 2B4KA 1YLLA 2G9GA 3Q8EA 3VZLA 3RFRA 5FPBA 2QTWB 5L36A 4V1PA 3PURA 5IK4A 5IVBA 3QH6A 1W6PA 3NO8A 2WL1A 5C3RA 4IV1A 2ZX0A 3B00A 1GSLA 2A6VA 2EXJA 2NYYA 4A42A 1RVF1 2K0GA 1MEC2 4BQ4A 5FUIA 4E2GA 3B7MA 4GMP0 2JG8B 4XFHA 1LEDA 1RHI2 3H8RA 4LHKA 3VBHC 1V0AA 5BY5A 1W9WA 3E6BA 4KWUA 2RM21 3LEKA 4FVVA 3T1LA 3B9IA 3UGGA 2CL2A 5FUNA 1W8ZA 1A8DA 2GC0A 1YFYA 1AR63 2WNVB 3P6BA 3A0NA 1K12A 1QNWA 3ZMOA 1L7QA 3ZPOA 1O59A 1DQ6A 3N7LA 4DOUA 4LHSA 2VBPA 1JZ7A 5LA1A 2O0OA 2VUDA 3P5BA 4GWJA 4LIVA 4PQ9A 4Y20A 3ZKUA 4F83A 1MS3A 1VBB1 4PLNA 4ASLA 4META 1UY3A 1DGWX 2ZA9A 4N53A 4QB2A 4UFHA 4Z07A 3RI8A 5J09A 2Y6GA 2UURA 4AVBA 2YC0A 5C71A 1GZTA 3WNPA 2WS91 1F9KA 1APNA 1ZBE2 2BVBA 2WT1A 3UETA 1BVVA 1XC6A 1ENXA 2JIJA 1S0GA 1JZ5A 2BGCA 2WYFA 3NNLA 1VRH2 1X9TA 4C0HA 3BODA 4EN9B 4L92A 5FY0A 2VW2A 3IN9A 5DZGA 3K3OA 4LXLA 3DKWA 2UY8A 1U12A 5LBFA 5FK8A 4W6XA 4BM8A 4XQDA 3GF6A 1AVBA 2DF7A 4CCLA 4FFHA 3ZFGB 4LOTA 4Y1YA 2ZGKA 4ZPIA 1PMJX 4NROA 1OH3A 1PMIA 5FTTC 1V6KA 3UKTA 5ABJA 2VQAA 1QEXA
chains in the Genus database with same CATH topology
3RG0A 5LRSA 5DUWA 4I0AA 4LE3A 3DPRA 5JI7A 1W2UA 3UJQA 1IS4A 5CFCC 1SLAA 4SLIA 3SHRA 1H2NA 4BE3A 4QPGA 2P2KA 4CDXA 1FOD2 5C4WA 4YARA 4CDWB 1AHSA 4GH4A 4SBVA 2BNMA 1H2LA 1CX4A 4JVAA 5GKAC 3ZSMA 4GA9A 4H3WA 4FAGA 1G9AA 1RUC2 1LENA 3ZYIB 1BMV2 2K9ZA 2E7AA 1R1A1 3TBDA 4DY5A 1AR73 1ZREA 1A3KA 3JU9A 1JBCA 3JZVA 3NWKA 4YW2A 3E97A 1H0BA 4CP0A 4OI0A 1FV2A 3ATGA 4IERA 4XFAA 4HBNA 1MQTC 2OUJA 3WDUA 2W08A 3AKQA 1WGPA 2JX9A 4XF3A 5D8AC 5EFUA 1RUD2 4Z1VA 3ECQA 1RHI1 2X53S 1AR81 1OLRA 3E5XA 1KRIA 1YXWA 1RUF1 2RM22 1TME1 1UPSA 2YGLA 4I0BA 4XJ8A 5D8AB 3ZIWA 1PO23 1PIV3 1OFSA 1V6IA 3ZXDA 4WM7B 1FPN2 1JYCA 1NG0A 4EN0A 2SLIA 5T54A 3PVBB 1QJY3 2GMPA 3D0JA 5E88A 1ZVFA 2WA4A 4KG0A 2TBVA 3LWCA 1EP0A 3FFQA 2D97A 4CTEA 1O91A 1RB8G 5T3NA 1A6CA 3VV1A 1RMU2 1PVC2 4C90A 4LA2A 2DU1A 4FTSA 4F3JA 2FMYA 3TRSB 4XBQA 2Q8OA 3RDIA 4W6WA 2YZ4A 3X29B 1SMVA 1RUI2 3CJXA 2XKOA 4TLFA 2A7AA 3WCRA 4BYYA 4E4ZA 4F8AA 4XJ9A 4WVMB 1DDLA 4XPVA 3V56A 4FOQA 2ES3A 4GKXA 4I3GA 2GNMA 4HZFA 3N3HA 1GZWB 1C57A 1UPIA 3OJBA 2F6BA 3U11A 2VUJA 3OY8B 4Y1ZA 3SNMA 1OOPB 4I2OA 1IHMA 4NVPA 2ATFA 2R6QA 4CDXB 4PLOA 4JC1A 4PDWB 1BK1A 4FP3A 1HDKA 5A33A 4RR3A 4AVSA 2GC1A 2ZGTA 1W6MB 4CDWA 1PVXA 4WM8A 1ZZ7A 3WD5A 1UU6A 4R52A 4AQ6A 3S0MA 4XIKA 4XTMA 4DPNA 5FPXA 1LHWA 2LTNA 4MGYE 5LEKA 2ZBJA 1IGOA 3SCFA 1AJOA 3ZPYA 3BOPA 3BU7A 4LE4A 5JSRA 1W6NA 2WIIB 1B35B 1WD3A 2BNOA 1F5FA 4QPIC 1N3QA 3SH5A 1G6NA 2WLQA 5CFDA 2I07B 3AKTA 1ND3B 1NY72 3LSEA 4B4QA 1NQJA 4E4DX 4IEOA 5GZFA 2A5ZA 2XL7A 2PLV1 2Q4SA 1UU4A 2DFCA 4LA3A 4YLZA 4XFCA 2XJVA 5J36A 2Y26A 3FUQA 4LBQA 5JWPA 2RMU1 1LTEA 2IXKA 4UBGA 3VL9A 1SLLA 4RQPC 1QJU1 1XU1A 3ALQA 1VRH1 4ZXKA 4MSVA 1ASJ3 1WCDJ 2R1BA 1ZYBA 2BUKA 4KGQA 3OPZA 4EN6B 2JKBA 3ENRA 4HVOA 2YYOA 1NZCA 4GMP3 5EV7A 3AYEA 2ZKNA 4CDQA 5FLJA 2TEPA 4Q4X2 1O4ZA 1BEV2 4LLFA 5EJ3A 4Y1UA 2ZZQA 3VBSB 1CPMA 4PIXA 3AP5A 4JQRA 4LR4A 1N1YA 2BW8A 3UL2A 1SEFA 2HEVF 5FQ0A 2ET1A 4LULA 1Q3EA 4WVVA 4QXKA 2WNUB 1HV0A 4HK9A 3RYKA 1ZNPA 2VQ0A 1ULGA 4MXVA 1VALA 2B39A 3AP9A 2Y0OA 5J7MA 1LOBA 1D4M1 1LKNA 2D40A 4YW3A 4PIZA 4XQWA 4ATFA 4LO8A 4QGMA 2XJUA 5KHIA 2ZABA 5JLVA 3R0RA 3CEWA 1IKQA 2UYBA 3VDDA 2VECA 2JICA 3ZX7A 2D5HA 4Q2FA 2HWB1 5IUQA 1YYNA 3JBG3 4FTEA 1Y7BA 3AX4A 2QDRA 4AHWA 3K48A 4PDWC 5JR7B 4MZUA 3ZYPA 1HV1A 4WBBA 4RS5C 1MR5A 5T5PA 2CGOA 4Q4W2 4XF0A 5ABJB 3WNXA 3U10A 1MQTB 2XGXA 2RS12 1PZ8A 1WMEA 1VAMA 1BBT1 4JGZC 3RJ2X 2CWMA 3VBOA 4B7KA 1OMIA 2W39A 3SXWA 1K5MA 1H4GA 4AVAA 4YZ1A 2VUAA 2OA2A 1RUG3 1H8TA 3UKVA 2ZHNA 1X33A 1UD1A 1ZA4A 4PLMA 4RHV1 1FATA 4FTBA 4IEXA 1AYN3 3MICA 4FP2A 4K3UA 1RVF2 3B3QE 4PBPA 1CAXA 4OI4A 2RMU2 4QQHA 1VBD1 2ZX4A 4IEQA 1O3RA 2I2SA 3HBZA 4Z92B 4PBOA 2AYHA 3CU7A 2RS52 5CBLA 3CNAA 4K9SA 1AR91 3GBWA 4HKOA 4QMAA 4YM0A 2D6OX 1SLTA 3B9CA 5IT6A 1NCRB 2D7FA 4Q8KA 4MGZE 3BOWA 3V64A 3AMHA 3ZIXA 4I0WB 4ITCA 5JOZA 5FFOC 3KCYA 1YJLA 4Q4X1 4XFIA 1O3SA 3ZMNA 1WBFA 4YW1A 2D43A 1V6NA 4A7YA 3AFKA 2HWE3 2CWSA 2H6BA 4U2AA 5K9YA 3OTFA 1WLWA 1NA1B 3LCPA 4AHZA 1PO12 4XE9A 5T5LA 1NLSA 3MIEA 3ETQA 1PK6C 3MPBA 2RMU3 1OA2A 3D8CA 4S2HA 4XZPA 1TMF1 2PFWA 4G9SB 4XFFA 5BNNC 4AEDC 4Q4Y1 1KS4A 3L2YA 2P37A 4YM3A 2Y0IA 4Y20B 1NLRA 3GZTB 1YNAA 1DG6A 2GDFA 4X8NA 3U07A 2DTWA 4BHPA 1AX0A 2JE7A 1GFF2 2HWD3 3KGLA 2JG8C 3VDDB 4ISQA 3IMNA 3R6SA 3VKLA 4COUA 3IKWA 5I93A 1S1AA 3WDWA 1NCQC 2HWE2 2BFUS 1H1IA 2R061 2EAAA 1AZDA 2NMOA 3WW4A 1HXS2 5DZFA 1AXKA 4I02A 1XQNA 4Q4W3 3WOGA 4CEYA 1DZTA 5FO8B 5T5JA 4CEWB 5E89A 3AKRA 2WNUC 3DPRB 4Q4V3 1BCXA 1NCQA 4FPEA 5FMOS 3KGZA 1QGLA 2C1FA 3PHMA 4LUKA 1RUOA 3WUCA 1O4TA 1RJ8A 1W0OA 4Q8LA 1O3QA 2Q5TA 2WT0A 4P14A 3EXUA 5CAZA 1OLQA 2IXJA 4XBNA 1BEV1 1YFXA 4I30A 4MX3A 5T50A 4IETA 4IV3B 1TME2 3UJOA 4FT8A 5T55A 3AKSA 2PHRA 5FLIA 1HIXA 5JPMB 3USUA 1FAYA 4L97A 2WZPP 1CGPA 1LCLA 1URXA 4OZXA 1W6OB 4Z2WA 2NN8A 2WZR1 3RMXA 3ZFEA 4CDUC 1Z0HA 1LEMA 1PZ9A 3APBA 3JBG2 4LBLA 5BYNA 5FLHA 1WW5A 1RUE1 2VW1A 5FMOL 3VBHB 1UW8A 3QBQA 2FQPA 1C5IA 4FPKA 4R9BA 3KS7A 2VMIA 4EJRA 3POYA 3VL8A 5AFEA 3MIHA 2XJPA 3H3UA 3RNSA 5A32B 2Z42A 3DUIA 3MEPA 4Y24A 2WFPA 3V0BB 1LU2A 3UV9A 2CTVA 2HWB3 4AFMA 4FSJA 1DYPA 1BXHA 2BFUL 3NV1A 5GZCA 2IC1A 5I8SA 4MGKE 1PGW2 4HANA 4MYEA 2GC3A 4OHYA 2ERFA 1Q8VA 3ZXFA 3HAGA 2QNKA 4OULA 1AL23 3V0AB 4JDMA 3QD6A 4QPGC 2ZOEB 1U5ZA 1MS8A 4YVWA 2PAMA 2CY6A 2HWE1 1YJKA 2ZMKA 5J48A 3FLRA 2XKPA 1AL21 1H8TC 2EAKA 1RUC3 3IDBB 3NV4A 1J59A 4AXOA 3VBFC 4LO7A 1UCXA 2XG3A 2A6WA 2KXLA 1S0DA 2AUYA 3ZFFC 4COYA 4Y4YA 3C2UA 2HYKA 1YI7A 2XBO3 4X6RB 2UY9A 3ZSEA 2VNRA 2WINB 1FNZA 4XW3A 5GLZA 1WCSA 5F1RA 3KQRA 2FZ2A 3VZKA 4QPYA 1ZRDA 1HRV1 4YNIA 4DINB 1JXNA 2YHJA 5GLVA 4D69A 5EWSA 1EPWA 1F2NA 2H6CA 2IFWA 4JRAA 1FMD2 1VBA3 5C4WB 1PGSA 4HL0A 4KG8A 3DV8A 4DRVA 4D94A 1QJU3 4WVWA 4XBLA 2A73B 5E1RA 2JDZA 4QM9A 1XXNA 4FOYA 2IWGB 1X8MA 3W9AA 3VBUB 2R0HA 2WZR2 1D4M3 1EY2A 2VG9A 5C4WC 1WW4A 1G8WA 2GN7A 4Q4Y2 4FPCA 2Q0AA 4NWWA 3LA7A 4AQSA 1PHMA 4A3XA 3SISA 2D6LX 3M1HA 4J1WA 5JIAA 3DL3A 2R063 5LRRA 1QNYA 2ZGQA 1UIJA 2XWBB 5I8YA 4FQZA 2A3XA 1VBE2 4YZ3A 5JZGB 4AE2A 4OVEA 2BWCA 2YMZA 1DHKB 3LAGA 4HVRA 3IIAA 4Q0UA 3M3QA 3ZXKA 2D6PA 2VOKA 3GZAA 5FO7B 2A70A 2UWBA 1GKBA 2DCKA 1CJDA 1LULA 1YHFA 3ZN6A 4YYOA 1IPJA 1POV0 2NMNA 1LHUA 3NW4A 3B93A 1Z7S2 1WUVA 4KWJA 3ILRA 3V0AA 1AL22 4EWAA 4UW5A 1GICA 3OBRA 4AFAA 4LEJA 1NE6A 1Y43B 4KH9A 4BQ1A 3KLSA 3JB4C 3JQXA 3MDPA 3JCIA 2WSVA 2YV8A 1GNHA 1RVF3 4NOTA 2H0BA 1BBT2 1QJX3 4R9DA 5KXEA 2UYAA 3TN91 1B09A 1ZZ9A 4YM2A 1QOTA 4LBQD 2X5IA 1SFNA 1LB2A 3S7IA 5SV8A 1ASJ1 4EN7B 1VBC3 1FI2A 1YFWA 2XBO2 3EBRA 1FMD1 3GALA 1XNCA 2PLV3 1JYIA 5F9TA 2QDNA 3O7OA 3P3NA 3R4DB 3ZXAC 2CV6A 2DVGA 4XETA 3CL1A 1QY4A 2E51A 1QXRA 3R05A 4IESA 5CADA 3OYWA 1C4RA 1ND2B 5F5QA 4KWKA 2PA7A 1KDMA 4YFZA 3RI9A 5BPXA 5DG2A 3VBUC 4GH4B 1H1AA 4H55A 1V00A 5BXXA 2SBAA 1YIPA 5CNAA 1TE1B 2QKDA 5KXCA 3JQWA 2ZHMA 1N1VA 2JD4A 1SBFA 3S30A 2RJKA 1YIFA 1AR71 4Y1VA 2G9FA 2DURA 1HRI2 2B8MA 4OHXA 4AW7A 2PLV2 1RHI3 3OGGA 3LA3A 3VUOA 4BZ4A 1MVEA 1J3PA 2C9AA 1REFA 1CAVB 4YVSC 1MEC1 1R083 2OPKA 4COZA 1A8MA 3GNEA 1NCRA 3BALA 2RS53 1I6XA 1QDOA 1U5YA 2O8QA 2ZX2A 2ARBA 3I59B 3MIBA 4MH0E 4AI8A 3NAPB 1G86A 2UU8A 4Q0SA 2WSUA 1G9FA 1C3HA 4FQ4A 4CP1A 1R1ZA 3T2TA 4AEDB 3TWIA 1UZYA 4C0BA 1ND3C 1WA4A 5FQ0B 1EAH2 1FX5A 2WNUA 2WZR3 4QPIB 2ZPXA 2ETEA 4Q26A 1YWKA 1SQ4A 1QJX1 4MXWB 2A3YA 1RUJ2 2MEV1 4AEKA 4LBOA 4J1XA 3SITA 4AI3A 3VLBB 4HFSA 1TME3 2X5IB 4AHXA 5CU1A 2VGDA 4BCUA 4YZ2A 1H9WA 3BPZA 4XIOA 1Q5OA 4YZ5A 3FFZA 3KSCA 1LHNA 1RGSA 4L2NA 3MF6A 1VP6A 4K1YA 1AR61 4P9XA 4CDXC 2NP0A 4TWTA 2YROA 1VJ2A 1DQ4A 4DS0A 2BEOA 2GNDA 1BQPA 3ZSJA 3IM0A 3ZSKA 2QVSB 3D0SA 2D5FA 2GAUA 1LOCA 5EXOA 4AGGA 1TNFA 1KS5A 1VLNA 4YW5A 1CIWA 1DGRA 1OOPA 2GMEA 2CYFA 4JGYA 5JMCA 4U36A 4MLOA 1IZ3A 3U4XA 4B29A 2ZJCA 1CONA 3WDTA 3O0WA 1SFYA 2ZX3A 5JZGC 1H8VA 2G4IA 2GNTA 1GYKA 2B9UA 3ME2A 4N90A 4YW4A 3MW4A 4G3YC 1IKPA 1N1TA 1HX6A 5L73A 1I5ZA 3LB9A 4K7JA 3VBUA 2PHUA 2KA3A 5BNNA 3L2HA 4Q27A 2ZGOA 4FXGB 1FOD3 5C8CA 4IEUA 4YVSA 5GJ6A 2DCYA 2DWRA 2Z2SB 3EJKA 4OHZA 1RUG2 3UKNA 2XLAA 1X82A 1R082 3K51A 2XJQA 5HCAA 1FXZA 2WNEA 3TNQA 2VMGA 5H9SA 3HR9A 1ZBA2 4Y22A 3WCSA 2HJIA 1H9PA 1HLCA 1R091 3MPPG 5JZGA 3WW1A 4NHLA 3V65A 3HQXA 2ZMNA 1VAVA 3SCGA 1QH7A 4KGGA 1X36A 2D44A 3FUOA 1ENQA 4AEDA 4N7IA 3E5UA 1V6JA 3FC0A 3RMYA 4FOWA 3RZZA 5KHJA 4AVTA 2CGPA 1ZZ6A 1EAH3 2WJSA 2VVFA 4QGLA 3PVOA 1G9CA 1RUI3 4YVWC 1CVNA 1FV3A 5DDJ1 2PHFA 3WP3A 2IXIA 4JAAA 1ZRCA 1DZQA 3W58A 4EROA 1PIV1 5DZEA 2A6ZA 3N36A 1HQNA 3I8TA 1AR62 1O5LA 2P3KA 3AKPA 2WLPA 1PZ7A 4HKLA 1DYKA 4YG6A 4XF4A 1WMFA 2JG9C 3DN7A 2RS31 1UAIA 1QJY1 4WM8C 2WWSA 4XILA 1F8VA 5HCBA 4F7ZA 2P3JA 3OF1A 3RS6A 1ENSA 4TSVA 4IEVA 4Z8BA 3WDXA 2WFF3 1J1LA 1FT9A 2NPIA 4DQAA 2WFF1 2BYVE 1I9RA 2XVKA 4QPGB 3KB5A 1RUF3 3AMQA 3OCPA 3ZFGC 4LT5A 2B42B 2LALA 2ZCWA 4R8HA 2B5HA 1GZCA 2C5DA 1CJPA 3M3IA 2YDEA 5GZEA 1OA4A 2HWC2 2XWJB 1VB2A 5JVVA 3VBOC 3IPVA 3FBYA 1DGLA 3KD4A 3TNPB 4D3WA 3D82A 2X5IC 1D4VB 3CO2A 4K1ZA 4Y1XA 4HMZA 4KU8A 5JOWA 3N7KA 2OYZA 3ZO0B 3R4SA 2NM1A 1FYUA 4M0HA 4XJAA 2WA3A 2F4PA 1QJU2 2QUOA 4E27A 1DGWA 5C9AC 4I09A 4D7TA 5K0UC 3O5SA 1COV2 1VBB3 1DIWA 1ENRA 2W0XA 3MFAA 4IEZA 3AXDA 4GWNA 4RR3C 4LUMA 4RHV2 3VZOA 4CZSA 1CESA 4XJUA 4PCRA 4CDQC 1RJ7A 2WS92 3HN1A 3JD72 5J96B 1O7FA 4TZDA 2ILMA 3ZYGA 4GULA 3B94A 4M0NA 5HBAA 3GBGA 4DY3A 3ZXLA 4NO4A 4J6GA 3ST7A 1LODA 3LSDA 4HSLA 1MS0A 4L99A 5KHHA 2BPA2 3NKGA 2VPVA 4OI1A 1GLHA 4AGVA 4W65A 1RUD3 2DUPA 2D98A 2ZTNA 5DDJ3 1RL3A 3IDEA 1DLLA 1H30A 3N7JA 3R4UA 4DNYA 1BVP1 1VRH3 3ZVXA 1ASJ2 5TSWA 4DXZA 2D3PA 5GZGA 5KC6A 1D2QA 3J26N 4AHYA 1X8EA 2DVAA 1SCSA 3AZVA 2OZJA 4YVWB 1COV3 3VDDC 3WP4A 3AM2A 4AK3A 3E6CC 1XYNA 3CLPA 4LO5B 1J3RA 1K5MC 1KJLA 1QJY2 2HEYF 3M3CA 3E5QA 1Z7S3 1TQ5A 3I54A 2HWB2 4IQPA 4XJWA 3WW3A 1MVQA 1XE7A 1DQ1A 4P9YA 4OUSA 2RS13 1QU0A 4YGEA 2A6YA 1REDA 1CPNA 5IK8A 4FPJA 1R1A2 4XQ4A 1PGL2 1ND2C 3H1WA 2VOXA 2CNAA 2V09A 1WBLA 2IZWA 4BMEA 3KMHA 3NL1A 5EYXA 2DYCA 1PM7A 2KM2A 2RR11 1QF3A 2RS11 1VBA1 2ZZJA 4WZCA 4LLOA 3O0VA 3ZFGA 4LO6B 2E7QA 5AC91 4BWOA 4BIFA 3QH7A 3GZUC 1W6MA 1MZ6A 2OUHA 2PYTA 2HWC1 1Q8QA 3RYPA 1FNYA 2IFRA 4M3CF 4CEWA 1VBE3 1MS5A 3I2DA 1J1TA 1AR83 4OHVA 4PF5A 1V6OA 4A7KA 1IS3A 4QX5A 3IT8A 3FX3A 3OYWB 3IPVB 3RWNA 1WD4A 1POV1 4AI2A 1CAUB 3WG1A 1CQ9A 4ZU4A 4NR1A 4HN0A 3PVNA 4FXKB 1ND3A 4OI2A 2XJTA 4FPGA 1Z78A 2I74A 2MEV3 1DGRN 1RITA 1PIV2 2HEWF 3PVEA 4YFWA 2W68A 3WQ1A 3URFA 5E8AA 4M01A 2E63A 1C1FA 4XMAA 2A6XA 5CIRA 2AENA 4Y5Z0 5GLWA 2DUQA 3WQ7A 1DFQA 2XB6C 1M06G 1VBE1 3RRDA 1LU1A 5C6CA 1CAWB 5J98B 3QLQA 4RQPA 1OPOA 4GB31 1S0IA 3WUDA 3ZN6B 4DB5A 1JN2P 3HT2A 2GNBA 4XDQA 4CDUB 5D8AA 1AYN1 1UKRA 1RINA 4HPKB 4ZU7A 5A3MA 5A32A 1V9U2 2QJVA 4P5HA 4WM7A 1O4YA 4YG0A 5K0UB 1XE8A 4JDOA 2WNVA 1MS1A 5I0UA 4AFBA 5JCTA 2YY1A 2R16A 1QOOA 4KU7A 3RYRA 3MLLA 3HD8B 4PIYA 2DFBA 2XLFA 4B4RA 1ZZBA 1ZM1A 4Q0VA 1PK6A 4FPFA 1Q8SA 1FPN3 4K21A 1HRV3 2VXRA 3S6PA 4AFDA 5KHGA 3WDYA 3J9SA 1OKQA 1UMZA 3G7DA 3AK0A 1JHNA 1SLCA 3PMEA 4K20A 5GLUA 1HQWA 4RS5A 1VBC1 4EN8B 2XHKA 1EV12 3WZ1A 1WCKA 1S0CA 4WZFA 3NVCA 2IXCA 4N9IA 4JGYC 2EF6A 5JOYA 1ZBA3 5LEJA 4GMP1 4NHKA 2X29A 3MLKA 3ELNA 5H9PA 3WP6A 1QHDA 2GN3A 3T1MA 1RC6A 1WLDA 1X7NA 1V6MA 3SH3A 5A3LA 1HQLA 1UIKA 1TMF2 3M8LA 5GALA 1MACA 3TOJA 1MS4A 1HRV2 4RSUA 1ZRFA 1KITA 5CFDB 3WV6A 1N1SA 4Q4V1 3VKMA 2WC2A 4BOWA 4O9EA 4LO4B 1F5JA 5I91A 3POWA 2GSYA 2P3IA 4XHXA 4K8FA 2TUNA 3RJRA 1R093 4R4XA 3MIFA 2BNNA 5CVRA 5L19A 4C1XA 4YVSB 1PO22 4B4PA 3AMPA 5K7PA 3ZFEB 3FZ3A 1QH6A 3WW2A 2R073 2QE3A</