5C9KA

Crystal structure of a highly fibrillogenic arg24gly mutant of the recombinant variable domain 6ajl2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
NFMLTQPHSVSESPGKTVTISCTGSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHVVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid lambda 6 light chain variable region PIP
publication title Mutating amyloidogenic lambda6 light chain AR back to germline 6aJL2
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 111
sequence length 111
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c9kA00
2VZTA 3K8LA 1ZS8B 3S5LA 3GMPA 4FQHA 3ALXA 3ALWA 1RZGA 1M71A 2BC4B 3GZKA 3WS6C 3ARDB 3VFGL 2X2YA 4KKAC 3L3HB 4LCYB 1J7VR 4XPAL 3DHJA 3O45B 1K3IA 1WITA 5FO7A 3VH8B 1PDKA 2O5XH 3GSWA 4PB0L 3CVIH 1Q8MA 4F9LC 4OLWH 4PP1C 2CLVB 4MAYC 3ULSA 3EYSH 3GSXA 4NN6C 2A73B 1A4KA 2MQ0A 2P5WA 3ZTJH 4NO0D 4XXCC 1DN0B 2H2PD 5LXGH 4Q2ZB 4U0QB 3PXJA 3FOLA 3LS5H 3F58L 4K2UL 4FFZL 4MQ7B 1CFSA 5IFAL 1LO4L 1KTDB 5SWZA 3A67L 2OX5A 3ARGA 1DL7H 4NUJB 5DRZA 2DWEA 1F4WL 4X9GA 1MFNA 4YE4H 4TSAH 4JPIA 1CDIA 2H1PL 5JORB 2RIKA 1OAKH 3MSPA 3LOWA 2VXSH 3STLB 4BZ1H 4E5XA 1MJUH 7FABH 3SDYL 5KVFL 3OXRA 2BFVH 4X4MA 5GZOC 2VDMH 1KPUB 1MWAB 3DVGA 1EEYB 3VMPA 2I9LB 3RUGB 3SDAA 1P84J 1QR1A 5E1HB 1QOKA 2F53E 3TCXA 4ZYKB 3X11A 5DLML 3P0YH 1DE4B 1MHEB 4OLYL 2A74B 1IAMA 1OQOA 2UWEE 4PRHD 5F71A 1P4IL 1X4ZA 3P73A 4LSDA 2VDNL 4TVPE 5D8JL 1EFXA 3UJTH 1BFVL 2IANA 4L8BB 1C12B 5K9KB 3TT1H 5IFJA 2DM3A 1S7UA 1KLUB 1B0GA 2V2WA 5JMOC 4YR6A 3REVA 1FLRL 5C6PB 1CICA 3U48A 1F3JA 1ACYH 5FV1L 4PJ7E 5K9QG 5ITBH 4NO2A 2X4OA 3AS0A 3AY4C 1D5XA 2HT3D 3MRFA 3CCHB 3M07A 4QRPA 3CFBB 4Y88A 4XP5H 5C6WH 5CWSA 3VFUA 4HUWA 1PZ5B 5IQ9A 5CD5C 4U6HB 4ELKA 2IFFH 3C8KA 5IBTH 4N0YL 3ZYOA 4WY7H 4P49A 5D5MB 5L2KD 1AGFA 3BGMB 3EO1B 2MOVA 1I9EA 1T80A 2EO1A 5BCAA 5ICXB 1NBYA 1UFUA 1TVHB 3SE9H 5AUMA 3ULUC 5ANME 1HILB 2FO1A 1WWBX 1XGQA 5DD5L 3PWVB 4AG4H 5FYJH 3T2NH 2BVUA 4K7PH 4WHYG 1HXYB 3BVNB 2X4TA 5IMLA 2Y07L 3DX6A 4E9LA 1EJ6A 3HPLA 4MNQE 5DQ9A 3W0WA 1XH3A 2VLMD 2BNQA 2XZQH 1U8JA 3VFSA 4Y4HB 3CD4A 2JTDA 4HGKC 3I3EA 4UUJB 5BO1L 1XGYL 5EU4A 2HT2C 2DQIH 4ZUUB 2VR4A 4NRXB 4OZFA 4OIIL 3B4NA 5HVWA 2FX8L 4TUJB 3PABA 4IS6B 3WS3A 3RL1B 5T1LA 3L3GB 2H26B 1KB5A 1MIEL 3MROB 4J12A 5I75C 5ID1B 4G8EB 3H9SB 4RSVA 5F6IB 1GGTA 3CAFA 2VL5B 4X8JA 1KPRB 2O61B 4JAMB 1T1YB 3P2TA 3QULB 4U1SA 2RAMA 4BQ8A 1KUMA 1I1AA 4YC2C 4XHQA 4Z76A 1YJDH 4FQJL 2XN9E 4HF5L 2GSGA 2XWJA 2M8XA 3TO4C 4I2XA 4GRLA 1QSEA 3DYMA 5HI5C 4YEEA 3GJFK 4QYOB 4IRJA 2ADJA 4LSQL 4PRBB 4UZGA 4E42A 5HYJD 4WEMB 4WW2F 3QDME 3BESR 2VE6B 4PRPE 1T2QL 1EEQA 2PXYC 3C5ZA 1FORL 1Y18B 4I77L 4W68A 4M1GL 1ZEAL 4EOWH 3DXAB 1I1YA 2E7HA 1P2CA 3EZJB 4AEIL 5KSBA 3TA3C 1RUKL 5DC9B 5F7DB 4TUOB 3DI3B 2C1OB 3CFDB 1AGCA 2BSED 3M17A 4AT6A 2HTKC 2P4AB 4FZEL 1I8MB 4WO4C 1MAML 2AK4D 3VRIB 3T0AA 3IKKA 4NRZB 1YDPB 4OFYD 5FM5O 3F62A 3SDYH 3VXME 3QDGD 4PJCB 4QKXB 4PJFE 4ELMB 4ODTH 4RZCA 4YPGB 3E3QE 2ESVD 1X5IA 2BSTA 5EN2B 4OGXL 5CHNA 2VJXA 4P2CG 4Z7WF 1DUYB 1HHGB 2X89A 4MZ3A 4F15C 1HHKB 3B9EA 3RVVD 2YRLA 2OR9L 3QT2A 2H8PB 3VDBA 1P5VA 1P4IH 4DKFH 5J13B 4X6DF 1HZHH 3O2WL 4R4BA 3ARBD 1U8LB 4U1NB 2EDWA 3HG1B 2KUTA 5I30L 4ONHB 3QDHA 1D5IL 4NQEA 4RGNE 3MGTA 4PYGA 4WI9A 4LASL 4EBQL 3V4PH 5C08D 4PV8B 5MERA 1AFVL 5EU6D 5HYSG 3D1MC 3FB5B 5BV7C 2NY4C 4BYHA 4MNHA 3PWPD 5F1KC 3O9WA 3BP7B 4AMKL 3V7MA 5E8DH 5FGBA 3RTQD 2IALA 4NC2B 3QIWD 1TVDA 4TN9A 1MRCH 2YUXA 1U6AH 3IF1B 2CIKB 3LQAH 2Z93A 5ITFA 4CNIA 2YEZB 3HNSH 4LCWA 3QISA 3WNOA 3DTXA 1H8SA 4ZFZB 1U8PB 4XVJL 3BZEB 1N5AB 4ZTPL 4XX1E 3PQYB 1JGLL 1UM6H 2OTUB 5INCA 3TBTA 2HVJB 4LPTA 2AGJH 5DJZB 4IRJC 1O0VA 3NZHL 4NKIH 1HK6A 4XT1C 1FE8L 2CIIB 1KGCE 1JI1A 2XRAH 3C5ZC 4JDZB 5I16B 1BWMA 3ZZ1A 3OJMB 3OG4B 2MKLC 1ZSDA 4G7VL 3AS1A 3SKMA 4KKBC 2X4RA 4NNXA 4X0KA 4UDUB 3C09B 5CCKL 1WBYB 3QB7C 4GH7B 4P5KA 2FX9H 3QRFM 1CD8A 4M1CD 2AXFA 3LZFL 2OCFD 2WQ8A 1NFDE 4MD4B 2EYTB 3N1PC 3PL6C 4HIJB 4MQXC 5I18H 3UPRA 4M6NH 4U1JB 2AJYL 5A3IC 3T77B 1EXUA 3FQUB 3RFZC 5DJDA 4UIMB 2GTZA 5JA8B 2VXVH 1QBBA 4P9ML 4MB3A 2NY3D 4Z5RA 4HH8A 4OT1L 5CJBA 4Z78B 1AQKH 3DROB 1NCDL 2EYSA 2ZNWA 4NT6A 4F7TA 1UWGH 5GS1B 4Q74A 3KXFA 4XC3H 1TNNA 1YNTA 4UQ3A 4R7NB 4Z77A 4V1DE 5D6CA 4N8CL 5HVFB 1NJ9B 4WNQB 5IJVB 4LSQH 4L4TE 4WCYH 2JIXB 2ITCB 1U92A 3P9LA 4PJGA 1NBVH 1ES0B 1GIGH 1G7HA 1MFAL 3KJ4B 3RWJB 4NSKB 3MLPA 3O9WC 3BIBX 1R5IB 1V7NL 5FGBC 3IAPA 4DN4H 2ORBL 5DD0L 3WDJA 5EU3B 4AEIH 3H2WA 3N0PB 2DTSA 4NBXB 3FFDA 1Z9LA 4JHWL 1T21B 3IKCA 4KQ4L 3HC3L 4K55A 1OAXL 2VISB 5HHME 2DMKA 2FBJL 4XBEL 3B43A 4I9WE 5DEGA 3U4BL 3JBG7 3IXAA 4P3WA 1I7RA 4NZJA 1FGNL 4X4YB 5IT2L 3MLXL 2WINB 3BH8A 3HFML 4K71C 4RBPK 3RNKA 1QR4A 1NCNA 2J8UB 5L2JB 1N5YL 1I3RB 1MY5A 3I02A 3FB6B 1A3LL 4NKDB 1J8HA 4GS7C 4QXUH 4YDVA 5MEPB 5IKCB 4KU1A 1LEIA 2IH1A 3UYPA 1HOCA 2YWZA 5DHYB 2DKSA 4OM0H 3CSGA 4Y5VB 5DYOB 3RVXC 5M95B 3VXRB 3P4OA 2VLKD 5HVHC 1WAAF 5F3BA 1CR9L 5JXAH 3I84A 4PLJC 5AAMA 5B8CA 1JHLH 2FX7L 3OXSA 2VN7A 2CRZA 1D5IH 1SY6L 2F74A 5KS9A 5IROC 4ZUWA 4X7SL 5EUOB 3LN5B 1YUHA 2Z4QB 4HKZA 2GCYB 3GNML 1INQB 2FJGA 1NAML 5TQ2H 4QXGH 1ZHNB 4Y4FD 3O6MH 4L8SC 4G3YH 1BAFL 4HD9A 4M5YH 5DHVH 1ZWIB 2UWEF 3T0XA 4FFYH 4P23C 1S9YB 1OP9A 3BYTA 4D0CB 1OF2B 4RFOL 4D0BB 5EC1A 5GSRB 2OK0H 4EXKA 4OM1L 1CIUA 4ZXBB 3MRDA 3EDDA 4XVJH 1P4BL 2AEQL 5EULV 2LE9A 1G7JA 3MMEA 1I7UB 4M7ZC 5DEFA 3ROLB 2ZWLT 5D9SB 3D39D 3NZHH 1U3ZA 1IM9B 2ED8A 2EH8L 1KYOK 1HQ4B 1MPAL 1H3TA 3RKPA 3BHBB 5IV2A 1GGIH 3JV6A 2NY6B 5J6GA 3CC5B 1IC7L 4WI7A 4L8DA 5E6IB 1DQLL 2A77H 2KL6A 1QFWL 2OQJA 4BFIB 4DEPC 3WN5B 5I73C 4NNPL 4XTRD 2VO5A 4LSVL 4WI5A 1M7DA 2NR6C 3LZFH 5BOZG 5JIHA 2R29H 3RGVB 3RNQB 4WHTA 5C0DA 5JPMA 2DLFH 5H94A 4P2YA 1QEWA 3IETB 3BD3A 1E6JH 1BBDL 4UV7H 4ZS6D 4RX4D 1FC1A 5C3TA 4PJDE 5I8EB 1MF2L 4CU6A 4NFCA 1IC5H 1LEGA 3UTTE 5SWSE 4NO0A 4U6VL 3OKEA 3OKOA 1A64A 2Y36H 2JJSC 3U30B 5CZVH 5FYJU 5E4EB 2K7PA 4FZ8H 2R69H 3VRJB 5B4MD 1BIIA 4FN0A 5T5FL 1U95B 2YA2A 2CDGA 4FFWD 1V3MA 4P2QE 1N0LA 2XTJD 4ZOAA 3KDMB 3F65A 4XP6L 3U7YH 1XF3A 1JWMB 3VFMB 2BOCA 5AYUH 4ISVB 3QZWA 1R3JA 5DD0H 1NANH 4NNYB 1SEQH 1IBGH 1KN2L 3C6SA 4YBQD 1LD9A 2DN7A 5IBUG 1K4CA 5EPMA 2VWEC 3D69B 4R97B 3T3PE 5J0BA 4XCNB 3MV8D 4Q6IA 3TGXA 4MXWH 3QHFL 4G8IB 3NABL 3EGSB 1KEGH 4PY7B 5D7KE 5DD6B 1J9CT 4KROC 1XGRA 5F1NB 1BVKB 3HZKB 4Z7UA 1IM3A 1FFQA 5DVKA 5TF1H 4JZNB 3WFZA 4G6ML 2V7HB 2MQCA 4TNWK 4NQSB 2EEDA 3AMKA 3Q5OA 2DMCA 3RZCD 2CUMA 4WWID 4UOJA 1A3RL 4MD0A 2DD8H 3NCYS 5CEZE 2P8MA 5AG8A 1R0AH 4YHKH 4NDMA 3RDTD 3WFCH 1WCQA 3MC0A 1ULVA 2GYSA 2NLJA 2QL1A 1JGEA 2YBRB 3L3DB 4CBPA 2W9LA 5CJOH 3WFBH 3LVEA 2P45B 3RZWA 1MREH 2YKLL 3QQNA 3QDJD 1QG3A 2IBBA 4CAGA 5LVEA 4JKPL 3C60D 3DBXB 2JJVA 3D85D 4ZFOB 5L2KA 4OD3H 1CU4H 2Y06H 5DC4B 3EOTH 4DGVL 3BPNC 3B9AA 4G8FA 5H37H 1CD0A 4YH6A 2F54D 1K85A 3W39A 4OD2B 1DVFB 4RFNB 1FFPA 1NC2D 1NMCC 1AHWA 43C9A 4YHML 1JF1B 4FQ2H 1WT5A 5DO2D 4GW5A 1OARL 2E27H 2H2PC 3O4LD 2C4FU 5E7FA 2YWYA 4ZDHA 3VXTA 2I25N 4GBXD 1R5WB 3QFDB 2IJ0C 1IC4L 4X7CC 1HH9A 1EK3A 3OAZH 3IXTB 3DOSA 1KJMA 5SWQB 3O2DL 3QUZB 4U3HA 1UKSA 1YMMB 5K9OB 4J7RA 2KDGA 4RIRB 1UYWL 5A2KH 4APQD 4B7LA 3MCG1 5LCVL 5E00A 1OL0A 3TZVA 3MRLA 5GGRB 1A9BB 4QGTA 5D2NC 1DQLH 5JHDE 4D9RE 2VLRA 3PGCB 4ETQA 4QOKE 3GSRA 4Q9QH 3O6LH 5L7XL 4YBHA 3QUMH 4DTGH 4LSUH 4Q6IC 1FDLH 2AXHA 2ENSA 3A6OA 3VGEA 3QO0A 2DLIA 2X4PB 4CW1B 3B9KB 5CP7A 3QI9B 2OI9B 1RIVL 1YEIH 1JMXA 3UBXB 2FHBA 1JNHB 2PETA 4D0DB 3TBWA 2ZZUT 3KYAA 1V05A 4BK5A 4EI5A 1WTGT 4P2RE 4D94A 4UB0H 4HLZG 4HKJA 5GSVB 3MBED 4HW6A 1N3NB 2HT3C 2FWOA 3IFPB 4UOW1 2BMKB 2JELL 2AJVL 5D7JD 4LDLB 3CDFA 4UTBH 3IT8D 4UINH 3IJHA 1HWGB 4DKEH 1Z9MA 4JQXA 4U1KB 3KYMA 1NFDF 1MCPH 4K3DL 4KZEL 1DBJL 4JM2C 5DD3H 3ARQA 3KAAA 4UT6H 3LIZL 2AK4A 4FQPA 4IOSD 1XF5A 3ARFB 4PJ9B 4QGYA 1G6VK 4JFFD 1N0XL 3QDGA 3QXWA 4ODWA 1DSFH 32C2A 3Q1SL 4BSWB 1D9KB 4LRIA 3UTPE 1TJIH 5FA4A 4PGCB 2ESVA 2NMSA 5FUCC 4BH8B 4TSBL 5J6HA 1N6QL 3N85H 1GZQA 1VKXB 4ZAKB 5AZ2L 1WT5C 2R0WH 4IMLA 2DI7A 4XPFL 5A2LH 4JO2H 4J8RB 3FB7A 1GOFA 1WF5A 1X7QB 3QFJB 1HCVA 4ZOBA 4L3CB 3HZVA 2EKSA 3AC0A 4PJEB 4CADB 3ARBA 3KPMA 4P9HC 3OAYK 3HZYA 4LCCC 4M6MH 1JYWA 4XZUB 1EHXA 1UB5A 4BQ9A 3ET9F 3NFSL 4UT9L 3WE6B 3OR7B 5C7XH 3JUYA 3V4VL 1QQDB 5T3XH 4ZSOE 5C08A 1A3RH 2HJLA 1FZJA 5EU6A 3BT2H 3VJ6B 5D72L 1A1MB 1RURL 2GUOA 3BDXA 3EO9L 1WQVT 2H32H 2HYMA 3KPRB 3PWPA 3T08A 2FJFB 2KZWA 2NX5B 5C0GB 2DQJH 3RTQA 4JJ5B 3ZE2F 3QIWA 5BVJA 4LKXB 5A1AA 3KJ6H 5DHVA 5E94A 1WCBA 2HLFD 1LK2B 5GISH 4JFED 5TE7H 4IM8A 1F00I 4KI5E 5C0CE 1A7PL 2JCCB 4FHBD 1BEYL 4GMSH 4HCRL 1D6VH 1YNKH 4WJ5A 2D9CA 1ZHLB 3FONA 1DDHB 1F45A 3KPLB 5KTEL 2IAMB 3H9HA 3NPSB 1YN6B 3CH1B 3VMOA 1DBBL 2W0LA 3HI1B 3MNVB 1S5HA 1MCQA 5ACLA 1S7QB 3E6HA 2EDHA 3OX8A 5D70H 5I17B 3Q3GB 1G9MC 1IAKB 4FNLL 5CIPA 5CEYB 3EFDH 5GGSB 3MYJB 4JDVB 4CU7A 3PDDA 1MCRA 4UAOB 4NGHH 2YXFA 3ARDD 4XC1L 1CI5A 5D1ZC 3O6FA 3S9DB 3DVNA 5I1HL 1ITBB 2CO6B 3IU4L 1VENA 1DUZA 4UIKL 1JTOA 3BP4A 2QSCL 1RZ7H 5CEXB 4M48H 1RIHH 2QHRL 3RY5A 3F6IA 1GZPA 1BM3H 3ZSTA 5HHPA 2G9HA 1BOGA 4KHXH 5ICZB 4DVRH 1ZGLP 3AAZB 2Y23A 5CJQH 2V7NB 3MRQB 3RVVC 1MQKH 3SBWA 3P0VL 4X6CB 4OLZH 4M7LT 2YPLB 5DJAB 2OM5A 4CVZB 3Q6FA 4RISH 4S2SA 2X7LB 4KDTA 2YC1A 4POUB 3DGGB 1NEUA 2B2XH 4WDIA 4XVSH 4RNRB 4WTZA 3K4ZA 3R1GL 5DMGD 3K1KC 1H3WM 4OB5H 1EMTL 4WHCA 1MWAL 4F7EA 1IFHH 1VFOA 2WUCH 3THMH 2DQUH 4DVBB 4YDJB 4QHLA 1AO7E 5C07E 3S3JA 1KYOJ 4W81A 5IMMA 3CVHB 2OZ4L 1EEZA 1Q38A 1C5BH 3TNNA 3QEQB 2W0FB 2BNRB 1J1XH 4OLEA 3RTQC 3OKDA 4P57A 3QIWC 4IIQC 4PGEB 4EXPX 1FPTL 3KWWB 4XMKH 5FM8A 3O0RL 5TJWK 5KSAA 5DK2B 4JZJA 5FYKL 1SYVB 1UQSA 3VXQA 1K6QL 4WI2A 4LVHC 3LKNB 1TXKA 4M6OL 4ERSL 3MXWH 4X80H 3QEUA 2W9DL 4RDQG 4BSVA 1HSAA 1IKFL 3QRGL 4G5ZL 4UV4L 3WNPA 2NY2B 4E41B 1E4XL 1GPOL 3EYUL 4YHOL 4XNUL 2P1YA 2EH7L 3SGDI 4NQTA 5GRWA 5LAXA 1X5FA 3F5WB 5SX5H 1DQQA 2YN5A 5IHBA 4GG6E 5FECB 1TETH 3SQBA 4GAJH 4Y4KA 1AXTL 4N0UE 2MMXA 3LKPB 4OV5B 2VLKA 4PJHA 1UA6L 4QRTB 4LVOB 5MENE 1JUFB 3ILQD 3VMNA 3LEXB 1CFQA 5D7IA 5ESQB 3ESUF 1ORQB 3O3DA 1BJ1H 3KGRA 4UT9H 2XQYK 3WIIH 4LIQE 3MQIA 5DRXB 3V4VH 1QNZL 4FQLH 5IM7B 4PREA 2Q76B 3BZDA 1CL7H 5FYLL 3UP1A 3JSSA 1SQ2N 2NY3C 4M9PA 5FCSH 4DCQA 5FYLD 3D3VB 4A2MA 2MWCA 1TTGA 4Y4FA 3SBWC 4LLWB 1NAMA 3VGAC 4LNVA 2PYEE 5FIEA 3DLQR 15C8L 1BFOA 1D5ZA 2NY0B 3LS4L 1KJ2B 4Y4HD 4U6YB 3A6BL 2N7BA 4XBGB 5EOCL 3DX8B 5EZLA 1MHHB 4J3XA 4J4PC 3D39A 1MVUA 4WTWA 3MJ9H 1U91B 1W0WB 2CLZB 4NC0B 2HKFH 4X9BA 4ODBD 3SKJL 3VW3H 2XTLA 4PJIA 4JN1L 5F1SA 5DJXB 3GGWA 3H9SD 5IFHL 3BEWB 1YEHH 3L95B 1G7IB 5I66A 1I4FB 3P30L 3SDDB 3L9RB 3C2AL 4JZJC 3STBA 5CINL 3VE0A 1I9RL 2HN7A 3U7AA 4HX1B 4LSTL 3C8HA 2EDKA 3B6SB 4JFDE 2VDQL 3IDJA 5MI0B 1UJTA 1FJ1B 3QPQD 4X9IA 2EDJA 3L3KA 5EOTB 1WBXA 3MRJB 2BNUA 3MNZB 3UC0L 4LLQA 2V17L 2EDQA 3IFOA 1UVQB 5CMAA 5E2TH 2PCPB 1Y6MR 1IQDA 2B1AH 3STZA 5C0JA 1F58H 3DXAD 1GAFL 3NCCB 1F4XH 2N4IA 3BISA 5JUEH 3FJTA 4C83A 4Y5YC 5HYFA 3DO7B 4BM7A 5IJKC 3SE4C 1KB9K 4EZMA 5GGVY 2GSIA 4P46B 5DRWB 4AH2A 1IGYA 3PWLB 1A7NL 4YO0A 4CDHA 3CFCH 3BD4A 4NN7B 4OCRL 2FL5A 4HZAA 1ZT1A 1WTLA 3MLYH 1FNSH 4PBWD 1U3HB 1DFBL 1FZKA 3VFRB 1U0QA 1WC7B 4MGXA 3KVQA 5KVDL 1TJHH 3GSVA 5E03A 5DQDL 4JY5L 3T0EC 4Y4FC 5ID0A 5FGRA 3O81A 4Z18A 2DLEA 2DAVA 3R06B 4KJPD 5IVZA 1JYNA 3U4EB 3PHOB 4W4OA 4DUWA 3DSFH 2F53B 1K4DB 2FLRT 5FYKH 1T4KA 3IDGB 2X4QB 4U1HA 3MRRA 3SE8H 3HG1D 3FN9A 4TVPH 2B0SH 2WBJB 4JZOB 1P1ZA 1MFEL 3ORJA 4PD4K 3O11A 4J6RH 3CK0H 4RAVA 3RU8H 3AREB 4JY4B 3QEHA 3BDBA 1MEXL 5HI3C 3P4MA 3RZCA 3HA0A 1NDMA 2BCKA 4XVTL 1YC7A 4PRNA 1Q9WA 1CFVH 4I18B 4PJ7B 5EO1A 5L0QC 4XTRC 3HRZA 3RDTA 4YHPA 2WMPA 2BSSA 5EBWB 2XZCL 1RJZA 1I85A 5IB4A 1EHNA 1QNZH 4L29B 1IGCL 3QDJA 4NO3A 4RA3A 3JV0A 1AXSB 2ZNXA 3PP3K 3C60A 3UTQA 1WIOA 2VAAA 1XIWB 2EIZA 1B0RB 3D85A 3U7WH 1A6UH 1A14L 4D8PB 4PJEF 4ZS6C 3VU2A 4NJ9H 5GGSY 1KF9B 3WIHH 5I1AB 3JTSA 4P4KC 1J05B 3X14B 3O3EA 2F54A 3MODH 4GKZB 1NC2A 1QTYT 4TRPL 3DX9A 4ZQKB 1OD7A 1MUJB 4U4BA 3O4LA 1JNLL 1UEYA 4GBXA 1QFWI 4R8WL 4FMKA 3TIDA 5B4MC 3ZMRA 1Q72L 5GRVK 4MJIA 1MCDA 3EYFA 2L7UA 1A2YB 4HK3J 4FFWC 5J4MA 1BHGA 4DK3A 1OT1A 1UZ8B 2P5EA 4OZGB 1T5WB 2H3NA 2XTJC 4MNQB 5F96H 4LPYA 3QCVH 5LG1A 1MHPL 3O2DA 3VG0H 4JO4L 4K3EL 3BZ4A 2EYRB 3IS0X 3EJZD 3ZYJA 4QTIL 4APQA 1I1FB 2FEEL 2X1WL 3VH8G 1OOAA 2RFXB 4K3GA 3MPCA 3I9GL 4QF1A 1A1OA 5MHSE 5FO9B 4M02A 2ED7A 4G7YL 2YRPA 1OT2A 3QUYB 3P4NA 1Z2KA 1Z3GL 4YBQC 3L5JA 2AEWA 3FQNB 3P30H 4N1EA 3S4SB 1GSMA 1D6EB 1FG2B 3ZTJG 4E0RA 2ICEA 1S3KH 3MRMA 4LSTH 2AQ2A 5C8JB 2B8OT 2M2DA 1IL1B 1KIQA 3KPQB 3UTSE 3CFEB 2PF6A 1CF8L 4Z7WA 2V5RA 4OI9A 2JIXD 1S7WB 1OGTA 5D93C 4YHZH 3UC0H 1AD9A 2V17H 4OQTH 1Q1JH 1NEZB 4N9OB 4X6DA 3MOAH 2R2BB 4WUKL 3RZCC 3DMMA 3MUHL 4QHKJ 5IHUH 3MUJA 3NAAH 5EU5B 3IDIA 1QRNA 2A6KA 4NZUL 1CXHA 1T7VA 3MBEA 4GAYB 3ULUE 1NGPL 3BZFB 4PJ8A 3RDTC 1AKJD 3VI4E 4ZO8A 2G5BB 5DURB 1YQVH 2P5WE 1B4JL 1RZKH 5D7JA 5AYQA 2CDEA 3EOBA 3TNMA 1U8OB 4UOW0 4RFEA 5E8NB 3F7PC 1ONQB 4LBEB 1MY7A 1YNLH 2R0LH 1KXTB 3C60C 4R7DA 5SWZE 4DGYL 4HLJA 2V2TA 1N64H 2GW5A 3WKML 1S9KC 1N2RB 1FAIL 1HHIB 2E9IA 4JFFA 4ZUTB 3QUXB 3BO8A 4NHUB 4K7FB 4KKCD 1XR9B 1A3QA 4X4ME 4R96B 1JPSL 1UWEL 3WV0A 1JV5B 3VXRD 3CNKA 5ETUA 3UJJL 5CJ8A 2YK1L 4JGUA 4GBXC 1QVOA 3MA7B 5T5NF 4AIZB 4IRSB 4GRWE 3BJ91 1VGEL 5A40E 4F7MB 2IANE 2CD0A 4UQ2B 4APQC 1A7OL 2XXMB 1Q9LA 4YDIL 1C16A 2C7UB 4KUZH 3MGAA 1QKZH 1F2XK 4KK9C 3V0VA 4C56B 3JV5A 1A1NA 4PR5A 3FOMA 3TYGL 1VPOH 1N59A 4G8GB 1YYLH 1QBLH 4ZXBD 5IB2A 5DF0A 4KDWA 3DNKA 4WW1A 1FYTB 3QA3A 4QRPE 2XZCH 3K3QA 1G7QB 4PBXA 3GM8A 5KVEL 3L3JB 1I9JL 3DETD 4FQQB 3IAGC 1KT2B 1LNUA 4WU7B 5DFTA 1IM9D 5DJ0B 3C5JA 1SVCP 2PXYB 1A6AB 5IUSA 1C8PA 1X44A 5FCUL 3CIQA 2WIMA 1ETZA 2NY6D 2A6DB 3QPXL 5ERWB 3OR6A 4GG6F 4HCRA 4GKSA 4LLVB 2Q8BH 4J3SA 3MBEC 5E6ID 5TDNB 2ICES 4HIXL 1NPUA 2QQNL 3SJVB 3MTRA 4KV5E 1KCSL 2BOBA 2Y1VA 4JG0L 5D7JC 4WO4B 1U93A 1QHPA 1JPGB 2ICCA 4D2NA 4QHMA 3EW3B 4ZD3H 1ZS8A 1FFRA 1PEWA 2BVEA 1Q72H 3RGVD 2PW2B 4FTVB 5DJYB 2BC4A 5EU7C 3ARDA 4Z8FL 3T4YA 4DZ8B 3WXWH 3B2VL 4MMXC 3BH9B 3W0WE 5CSZB 3L3HA 1PYWB 2BNQE 4K3EH 4LCYA 3O45A 2EE6A 2AABL 2JJWA 5DUMH 1BP3B 5ICYB 2R8SL 4PV9B 4TOYH 2CLVA 1AIFB 1T1WB 2A73A 3OAUL 1IEAB 3RWHB 2D03H 1F4YH 1DN0A 5DUPL 3OV6A 5TQ0L 1V3JA 35C8L 1NFKA 2B20A 4L5FH 4MQ7A 1M7XA 1QSFB 4OGYL 3WIFB 1U8HB 3FQWB 5LBSH 1W72B 4JRYB 1A8JH 1DBAL 4RA0C 2P8LA 4JKLA 1EAPA 4O2EB 2ZUTA 1XCTA 5JO5B 3T1FB 1QBMH 2NZIA 3AXLA 4G6KL 2O93L 3STLA 4A2LA 1JWSB 4PGJA 3D0LA 3KPOB 4DFHA 4I2XE 4ZTOL 1WAAA 1CCZA 1KPUA 1MWAA 1QSEE 2DTML 5FHBH 1FZMB 4RAUB 4B7IA 3O3BB 2MKWA 3QJFB 2I9LA 2JJTA 3AB0C 3RUGA 3IDNB 5DVLA 2I27N 1PFCA 4UILL 2VZ3A 4ZYKA 1SHMA 1FIEA 1XMWA 1T03L 1DE4A 3U36B 1KBGH 1FZOB 2A74A 1HQRB 1YY9D 2XQBH 4ZNEA 3KLAB 4WV1B 2AJ3B 5F88B 2WW8A 2HLFC 4KDVA 2UZIH 5FUZH 1KLUA 1JK8B 4F58H 4UT7L 1IAIH 1NCUA 3WKMH 1MH5B 3FRPG 4Q9RH 2UWEA 5JOFA 3HMWH 4MVBC 4XB7A 4HKBB 1H0DB 2PW1A 5L8JB 5TDOA 3SO5A 3FQRB 2QKIB 5CGTA 4S1RH 2VKXA 5BZDB 2VXTH 4JHAL 3KR3H 5J06A 3TV3H 5EBLB 1NCAL 1NCWL 3CCHA 1MJJB 1NCBH 3CFBA 1HDMB 4G80B 4WRLA 3GJFH 5ISZB 5D2LB 1X6LA 3P11H 1OY3B 3QQ3B 4ZFOL 4U6HA 2NTFB 1KN4H 4FRWA 1KB9J 4MA1B 2YZ8A 2LFGA 3CFJB 5D5MA 4MDIB 1AD0A 2X70B 1EHLH 5JXED 5ICXA 1HINL 1TVHA 2FRGP 4NQEE 1S5IL 1NUFA 1OSZB 1DVFD 3G5YB 2G60H 3JWOL 1FL6B 4NP4L 2K9UA 4K8RH 5T1DH 5CUSH 4WI4A 2ZCHL 3GSQB 3PWVA 2Z8WC 2ARWA 4GAGH 4OKDA 3HB3D 1HXYA 1A6PA 1HKLL 4XCYB 4IRZL 3BKMH 4JPKH 3OMZA 3OKKB 1KACB 1IZKA 3O3AB 2ZJSH 5KVEH 1I9JH 2IPUG 3QUZD 5ENWB 3SE3C 5FYKU 1YMMD 4Y4HA 1XZ0B 4LCWE 4OD1L 4UUJA 5DMGC 3DV4B 3INUL 5C0EB 3WUZA 4LVEA 1RIUH 4PD4J 4ZUUA 3RVUD 2RCSH 4NRXA 1G84A 4HHAA 3MLTB 4Q0XL 3K81A 3QPXH 2IH3B 3ZL4L 4LCUB 4TUJA 2QQNH 2Y72A 3RL1A 1CVRA 3L3GA 2H26A 5IK3B 1FVCA 5IBLD 3MROA 1E27A 4EN3C 1X5KA 3JV4B 3H9SA 2VL5A 1U8MB 1KPRA 3PDOA 4XMLL 3VWJB 2O61A 1T1YA 3IJYB 4LOUD 3B9KD 3QULA 3V6ZB 1ZA6B 3QI9D 3HI6L 1NGXB 3VD9A 4YUEL 4Z8FH 2AEIT 3ARVA 1ZLWK 4IOIB 4YDKH 1I9IL 1KFAH 2P24B 1T5XB 3QIBB 1HYSC 5ADPL 4KVCH 4DOHB 3B5GA 4OTXL 4PRBA 3K2MC 5FXCH 4HXAL 4ODVL 4YZFE 3K46A 3SKNB 3I6KB 5TFSL 2VE6A 2D31B 2XN9A 2DYPA 4MA8H 2Z91A 5F1OB 1Y18A 1FCCA 2L0DA 4QY8B 3QSKB 3DXAA 1C5DA 4OZ4A 3BAEH 4MDJA 5DSCB 3HR5B 1OLLA 1EDQA 5T33H 2DQDH 5F7DA 2HH0L 1UCBL 3UTTB 3CFDA 1S7RB 3ILQC 4I3SH 3TJEL 1WIPA 5ALCH 1I8MA 1QFWM 5HPOA 3ARFD 4PJ9D 2LAGB 1KPVA 1TPXB 5I2IB 3IU3B 4PGBB 1MI5B 4PJCA 5E1AA 3FT3A 1KIPB 2DTMH 4ELMA 4YPGA 4HPYL 1SEBB 2R56H 4R9HA 4P4RA 4P23B 1IEBA 5HGGS 4ZAKD 1MCEA 4PJGE 5EN2A 4NWUH 3VWKC 1DUYA 1HHGA 4P2OB 1JF5A 1E4XI 4WUUB 5EZIL 2H8PA 4X83A 1U42A 3QFJD 4JJHA 1SJHA 1G1CA 4RMQA 4PJAF 1U8LA 4OV6F 4Y4HC 3PHQB 3HG1A 1IC1A 4ONHA 1ZVSA 5D4QA 1K3ZA 1RSFA 2DWDB 3EHBD 2ARJB 2MCPH 1FN4B 2GY5A 3MA9L 1JE6A 4PV8A 4U7MA 3LKQB 5E9DB 1DBKH 1JPTL 3BDYH 2PYFB 5IB5A 5I73B 4XGZA 1CDBA 3ULUF 4PJ5B 3KPRD 3BP5B 3BP7A 3VI4F 2J88L 2NX5D 1MCHA 3DRQB 1J8HE 5F6IC 3MUGA 3DIFB 2DBLL 3MREB 4BA8A 5CEZH 3IF1A 2CIKA 3SDXB 2YD4A 1N4XL 2YEZA 2HLAB 5L9DH 1UADC 3MJ8B 1KJ3L 4ZFZA 4JM4H 1OQXA 3BZEA 1N5AA 1ZANL 4X4ZA 4LAJH 4EQ3A 3QPQC 2HVJA 5DJZA 5DMJB 3CLFL 5K59E 1OAUH 1XAUA 3G6JB 3MCLH 2IAMD 1UGNA 2CIIA 3KPNB 5IMOB 1E0OB 5KS9E 4ZO6A 4JDZA 4X6EB 3MLZL 1UEMA 4O58H 1RU9H 1MIML 4UDUA 1GYAA 4HK0B 2HWZH 5IHZB 3ARWA 1QD0A 2H9GB 4X4XB 5D71H 2HAZA 1J5OL 2K1MA 3GSNB 2XG5A 3HI5L 4RBPH 4EQ2A 4O2CB 4M3KB 5HYSB 3DV6B 2DKMA 3TT3H 5JOPE 1RZFH 2UY6A 4MD4A 2Q7YB 2VWEE 3UO1L 1EV2E 2EYTA 5GS2D 5CLTA 4HIJA 2EDBA 3MX0A 3EDJA 5TDPA 3PWUB 4U1JA 2QHLA 1DQDH 2BX5A 4O02L 2UYLB 3RWCB 1ZK9A 2BVTA 3AS2A 3T77A 2ZCLL 3ZO0A 4Z7OE 1CXFA 2UUDK 1X4YA 4ESKA 1J87A 4FABH 2DM2A 4Z78A 1ZTXH 5KSUB 3DROA 4KJPC 2R0KL 4GXUN 3W2DH 3GUTB 1QUNA 1YEJH 5J13C 4NBZB 1K2DB 4LU5H 3M8OH 4LLMB 4M93B 1JWUA 3LH2L 4LQFH 2ITDB 2YPLD 5C1MB 5GS1A 1AI1L 4HFUH 4ETYA 1RUPL 5IESL 1JGVH 1Q0YH 1NCCL 1CXLA 4R7NA 3QXDB 1TZGL 2UVFA 3JWDH 3BUYA 2OL3L 4QTHB 5C0AB 5ADPH 1NJ9A 1OPGL 4WNQA 3OJDB 5IJVA 3CVHL 2JIXA 2ITCA 5CILH 1P7KA 3V4UL 4PUBL 4NC1C 1BQLH 1FO0B 5IR1B 2GFBB 1ES0A 2QQKH 5ESVB 2PN5A 3BPCB 3ZKXB 3QEGH 1I7TB 4NSKA 3UPAA 4KV5F 4R6UA 3QEQD 5EO9A 1R5IA 2BNRD 1SVZA 4ODXA 3CSYB 4EDXB 5EU3A 2X9XA 1NGYA 2HH0H 1UCBH 1AKJA 3CDCA 4C54A 1SJEB 4ONGL 1FL5B 2VISA 1F90L 3RY4A 4G6JL 1T04B 5HDBE 4PY8J 4X4YA 3CUPB 2VQTA 5FHAH 4IDJL 4M4RA 4XNZB 5BRZB 3REWB 4PB9L 2J8UA 5L2JA 1DJSA 2MFNA 1BFTA 4E41D 1I3RA 2NY2D 4OZHB 3X12B 4NIKB 4TUKH 1T7XA 1QA9B 2ED9A 5F9JB 3IDYB 1SYSA 3C09C 1F6LL 4LGPB 5DHYA 3FZUD 4HIHB 2X10A 4UU9A 4Y5VA 3VXRA 2DICA 5D2NE 2AEPL 5EIIB 5C0BB 3D9AL 5TF0A 3NPZB 5CS7A 2GK2A 3VXPB 5KW9L 5LWYH 4PRHE 3DYPA 4NKOB 1LDPH 5C0NC 2J6EL 3O2VL 5HGDB 1W8OA 4I4WB 4U6XA 3MA9H 5IVXB 3GJFA 5EUOA 1NLBL 4KTDL 1DQJB 1TLKA 5DQJB 3QWRD 3W9DB 2Z4QA 4M4PA 4Z7UE 2DJ4A 2GCYA 3C08L 3QNXB 1INQA 3D3VD 4X9FA 4YNYB 1ZHNA 2J8HA 5DUBB 2VDLH 1RMFL 4Q7DA 3WHXB 4O4YL 5JW3H 1ZWIA 4KAQH 5I0ZA 3BN3B 4LF3A 4GUPB 4D0CA 5GS1C 1OF2A 4D0BA 5GSRA 5F9AC 3SKUD 2NY0D 1FGVH 4ZXBA 2OTWA 4XPGL 1UM4H 4LSRH 1WEJL 4JKMA 1MRFH 1I7UA 3ROLA 3KHQA 2ICWB 2VDRH 3LKSB 4ZNCD 3IDMB 5IW6B 1OM3L 3GK8H 3BSZL 1AJ7L 3BHBA 3KJ4C 4NFBA 3D5OF 4G9FB 3TBVA 2BVOB 5JPNB 3D25B 5L2KE 4X5XB 1PX3A 2FEEI 1JHTB 3IAQA 1DEDA 1CIDA 3EFFA 2DI8A 4R0LA 3WN5A 3UCRA 4M7KH 5HHXL 3CMGA 3F7VA 5JDJA 2WBKA 2MQ3A 1C1EL 3RGVA 3TVMB 1TCRB 5ACMA 3RNQA 4MQSB 2X05A 3U1SH 2YSSB 4XCFL 3TYFB 2YPKB 3UBXG 2VLME 3IETA 1OAZL 4XHJD 4O5LL 2ADFL 1KCUH 5EWIH 3IVKB 4HUNB 1RZ8B 3LQZA 2EIDA 5DRNA 5J12B 5C0IB 3KYKH 4DQOH 2VYRE 5DVOA 4LDEB 5INDB 1RJYB 4G9DA 5I8EA 2X4NB 3MRPB 4Y5VC 5A2IH 2CMRL 2VH5H 1BZQK 1KCVL 3V5HB 5F9DC 4D9QD 5HTSA 1KG0B 3BRFA 4LCCB 4RGOH 4B0MM 1S7SA 1NH6A 2VLRE 4KJWD 2IWGA 3L5IA 1SBBA 4LDOB 4YAQB 1I8IA 3JVGC 1A6TB 3QQ9D 4P46D 1U95A 5JTWA 3CSBA 2OL3H 5EA0H 4PTUB 4IHOB 4J3WA 2CKBB 3WSQH 1KV3A 2ZOKB 3KDMA 4M61B 2QADB 1XGUB 5EDXA 5J11B 4HWBL 2VABB 1U3HD 5DFVD 3GMQA 4P3CL 4ISVA 5J1TC 4JG1L 1X5YA 4S1QL 4S1SL 4FQIL 2V5SA 4D9LH 4NNYA 1NBQA 1YECH 3BYYA 3EYOA 5GIRB 1M7IB 3V0AC 3Q48A 3RGHA 5HYIA 3BPOB 2F53D 4ONGH 5DS8B 1CGSH 5JQHC 3D69A 3ARUA 4ZXBC 1NL0L 3GMNB 4G6JH 1XF2B 4XCNA 1RULL 1CG9B 2OBGA 4G8IA 3EGSA 5DFWH 5D1QB 5GRXG 4M62L 3CXDL 4NKQB 1FNLA 5DD6A 2V5MA 1IJ9A 5I1CH 2HT4C 4R90L 1BVKA 4PB9H 3HZKA 2FDBP 4CU8A 5M7QA 4JZNA 3ARED 1CZ8L 2JB5L 1CYGA 3DX7B 3FRUA 4N0FB 1OW0A 2AK4E 2NY6C 4NQSA 2XZAH 4MA7L 4A6YB 4WEBL 3BE1H 3HNVL 1DZBA 3QDGE 1RUQH 5E6IC 3O41A 2ESVE 3RI5K 1LDSA 1T7YA 3H7BB 1BQHA 5D1ZB 1GRWA 5GZND 3HHRB 3S37H 3FHAA 3VFOB 5KSVA 1R3IH 2Q7NA 3RGVC 2IMMA 3L3DA 3GMRB 3BIKA 4M7JL 4NRYB 4HKXB 4LMQI 1JL8A 5A16B 4YXKH 4JDTL 3OKNA 5A43C 3DJ9A 4IJ3B 4QLRA 3SKOA 1CT8B 4OZIB 5B39B 2XG4A 1J1OH 3O2VH 3OB0K 4H0HB 4KPHH 3QCUL 2ZUVA 3DBXA 4F3FB 1P4LA 1VACB 1XIWD 2A9NH 3R8QA 1KC5H 4MX7B 1QZ1A 4ZFOA 3OZ9L 5IBUB 3WL9B 2ICWJ 1G0DA 4PJGF 3S36X 5JXEA 5EG6C 3TCLB 2PTVA 3FMGL 3PP4L 2Y5TA 1L0YA 4H8WL 4M43L 5FF6B 4OD2A 4Y19B 3I75B 5C08E 1JF1A 5EU6E 1G7PA 2XY1A 4GQ9H 3V8CA 3U30C 3HE6B 3PWPE 4P3DB 1R5WA 3SCMC 3LV3A 4MNQD 3QUZA 3UTOA 1MRDL 1CDYA 5BZWB 5FK9A 5K9OA 2WWMD 2ZOLB 1NAKH 4EI6B 1YEFL 4XP9L 5GGRA 5I8OH 1ZA3A 1A9BA 4NKMA 1VEMA 4M6AA 3QUYD 1LE9A 1CLYH 3PGCA 5CP3H 1JGUH 4R97C 1VFBA 1RJLB 2I60L 3G6JF 4Y2OA 2O5ZH 4K9EH 2A6IB 2X4PA 4CW1A 3B9KA 3MRHB 1E4WL 3QI9A 1I7ZB 3QO1B 2V9RA 2IPKB 4DW2H 5IW1B 4KQ3L 1EFQA 3UBXA 4JFZH 3WO3B 1JNHA 1KXVC 3U6RB 2VITB 4XBPB 2WSKA 3F12B 1OW0C 3DUUB 5E24E 5KS9F 2DQTH 2NY1B 4HXBH 5E5MB 5B3JE 2QQLL 4FP8L 5L6YL 2NXZB 1F6FB 1NCTA 4FQXA 1AGDB 5A2FA 1Q94B 2DQEL 3MO1B 3G04B 5GSVA 4XXDB 3CLEH 4K07A 1FIGL 1S7XB 1P7QB 3IFPA 5DURD 2BMKA 4LK4A 2O5YH 3ILPA 3K2UL 1U8QB 4JB9L 5DMIH 4U1KA 5E2VH 1G6RH 4Z6AT 4LRNL 1OSPH 5L8LB 2R0ZL 2CJUL 3RRQA 2GJJA 2VMFA 1YYMH 3BKCH 4XPHL 1INEL 4OCWH 1AE6H 3ARFA 4Z7OF 3VFPA 4ONOA 4M7LH 5JXEC 2BVYA 1NGWA 3DGCR 3UZVB 1T0MB 3HNTL 3H0TB 4BH8A 3MRIB 1DVFC 4RFNC 4OJFL 5E2WL 2QQQA 5BS0B 3UX9B 4AEHL 1OGAB 5GS0H 3WLBB 3JWOC 4EUPH 4HDIB 3G5ZB 3QXAB 3DURA 3HB3C 3HC0B 4J8RA 4LHUB 2QSTA 4IRSD 4XNXH 3NTCH 2C3VB 3QFJA 4V2CB 2J8OA 1TJGL 4PJEA 4BUHA 3QUZC 4CADA 2P43B 4LVNB 3WE6A 3OR7A 1V7ML 2CDFB 2DF3A 3RVUC 3V5DA 1QQDA 3HNVH 4XP4H 4C56D 1YEEL 3MRCB 2BHYA 3VJ6A 2F8VA 4ODUB 3ISWA 5IBLC 3S34H 3NA9H 1FV1B 1EGJH 3KPRA 4ALAL 2FJFA 2NX5A 4G8GD 5C0GA 3JTTB 3H3PL 4JJ5A 3WHE1 3V52H 1EJOL 3NGBB 1FYTD 4LOUC 1V3KA 5TE6H 2DM7A 2OI9C 4I48B 3WUWB 5J9PB 4F7PB 1CGXA 4HT1L 2WQRA 1UH4A 3QCUH 5HD8D 2VLKE 2Q87A 3GIVA 1HI6B 4PJHE 1PKQB 3U83A 1R3LA 2KKQA 2PXYD 1FC2D 1FVDB 3BD5A 3MLWH 5C6TH 2JCCA 5D7IE 4BQ6A 1DDHA 3MV7B 4XNMB 2IAMA 3CH1A 3BW9B 1MSPA 3SJVD 3UPCA 3HI1A 2XA3A 1JZ2A 1YEGH 5F8RC 1SBSL 1S7QA 2HTKD 1JHKL 2F5AH 3N9GL 4WO4D 5FV2A 5IVXF 4CMMB 3RAJH 5I1JL 3Q3GA 3OKMB 4HH9B 2VIRA 5GGSA 3V6OA 3MYJA 3U0WL 2OXHA 4JDVA 1WZ1L 4FTVD 2D2OA 3HCVA 4HFWB 4NZDA 1KXQE 3BUTA 2G75B 2FZ3B 5DZLA 2NYYD 3ARFC 4PJ9C 3UBXI 1Q0XL 2KH2B 2XKUA 3T0EB 4ZS7L 1YEFH 5JDSB 3HS0B 4Z7UF 1T0NB 1D9KC 3P3YA 5CEXA 1OLZA 2I26N 3D39E 4JO1H 3GBLA 1FNGB 4ZAKC 2IQ9H 2A6JB 3KPSB 2D7PA 2ATPB 5ICZA 3AAZA 4Z7VF 2AJUL 4O9HH 3MRQA 2YD3A 4PJIE 1A5FH 1W72L 1QSFD 2AV7B 3WFHB 2ID5A 3GHEL 3IS1X 4WFHD 2ZG3A 2YPLA 5DJAA 5KOMC 1NGQH 5DR5H 4JRYD 2X7LA 4PG9B 1ZT7B 3S8WA 2ZKHL 5D96B 2ATKA 2V5YA 3PF2A 1VADB 4Z95H 2PR4L 4PFEA 4RNRA 3BKYL 1ZGLA 4JM2F 5FFLA 3EHBC 2IC2A 2YRZA 3L7FB 1NLDL 4FP8H 4HQQL 2OL3A 5DWUH 1GGUA 4FQHB 1VGKA 4J3TA 1LP9B 3CVHA 5L0QB 1FIGH 4OCLC 2R4RL 4CN4A 5LGJB 4HUXB 4KZDL 2HMID 2HRPH 3QEQA 3UEZA 2W0FA 2BNRA 3ETBF 4QRRB 3S35L 1LE5B 4M1DL 4XCCH 1TVBA 4YHYB 5GRVL 3KWWA 3ULUH 3TN0A 3NCJL 5C07A 5SV3A 3S88L 1KTLB 2VLLB 5DK2A 1CDJA 1A4KB 1SYVA 3DVIA 1ORSB 3VG9B 1J18A 4WI8A 5I1EH 43CAB 4G6AD 4UNTA 3WXVH 12E8L 4P4KB 2EC9U 2BY3A 4KKBD 5ADOH 4P5TC 4MAUH 1CFSB 3EZ8A 1HWHB 2IAMC 3NPSC 4OLXL 5E2WH 4LARL 2XTJE 2DWEB 3S37X 3U82B 2C9AA 4JPIB 3F5WA 1J1PL 2Z35B 5JR1H 5FECA 2AJXL 5E2UH 2BRRH 5E8PB 1C5CH 1YEKL 2IG2L 4BZ2L 3LKPA 4HZLB 5F89A 4OV5A 1GJIA 3QCTH 3DVGB 3SGKA 1DLHA 4J3UA 5ISZD 2Y6SD 4QRTA 3C9NB 3SDAB 1JUFA 2L4OA 3ARSA 2BY2A 3LEXA 1FNHA 1ORQA 2EDEA 4GRWH 5EORH 1RJCA 4QRUB 3MV8E 5DRXA 3ZHKA 3C5SB 3P73B 5IM7A 5KVGH 2Q76A 2VZUA 3QQ4A 2J6EA 3QWRA 1RZJL 5IFJB 2R2EB 4FXGB 3D3VA 4JRWA 3CMOH 4LLWA 4YR6B 1CICB 1WUNT 1FH5L 4EIZC 4Y5XA 3K0WA 4NOFA 3GHBL 5MEOB 1J0YA 5D93B 2X4OB 4LHQB 4U6YA 2Q6WB 1PLGH 3DX8A 3X3FH 1CQYA 2QR0B 1FFOB 1B6DA 2C3HA 5E08L 1U91A 1W0WA 4C55A 2CLZA 4JRXA 3QDJE 1FVEB 5IQ9B 4YFDB 4YEFA 2VDKH 5I19L 4MJ4A 1UM5H 3O8XA 3BEWA 1AGFB 1EBAA 4ODSH 1G7IA 3VWJD 1IGFL 3FO0H 1UWXK 2F54E 3S4SG 3L9RA 5AUMB 5F7EL 4ZPTA 4JANB 1ZV5A 4KHTL 4HX1A 3O4LE 5I1LB 5CP3A 1GC1L 3QIBD 5GHWL 3A6CH 3IDXL 3VI3E 4BKLB 1A6WH 2F5BL 1FJ1A 2AS5M 2V2XB 4ZS7H 3WFDL 2F58H 1HE7A 2Q1EA 2P48B 1F97A 1OAYL 5EOTA 3MRJA 4R4FL 2P5EE 2NY2C 1HSBB 3MNZA 1RUML 3MBXL 4X5LA 3FO1B 2WNGA 5DQ9B 1GGBH 3W0WB 1NEZG 1U8JB 4TULH 2PCPA 1T3FA 1JTTA 1PSKL 2B1HH 4LP4A 2DQGH 4JR9L 4JFHD 1EEUA 4IDLA 3RBSA 3ARXA 4OZFB 5CD3A 5IIEA 3SGKC 3UTTD 1JTPA 1E4JA 4YGVB 1D7FA 4H1LH 5BV7H 4LVOC 4Q9BA 3PP3H 1KB5H 3J8F7 1S78D 1FFNB 1JIBA 3KYNA 5DRWA 3PWLA 25C8L 4L3EB 2XT1B 1HNFA 1MI5D 4X8JB 4Y8AA 4JVUA 4TPRH 2D7TH 4JE4B 4Z7WE 4P23D 2ZCKL 2VR5A 3VFRA 1WC7A 3I6GB 4OCSH 4Z76B 4HWBA 5IB1B 4YGAB 2HJKB 4P2OD 5DZNA 5HXMA 3D2UB 3S35H 3WCYA 4WUUD 4GRLB 3X3GL 1LO5A 5T3ZL 5HVGB 3U4EA 4RRPA 4N9GA 1M05A 2ADJB 3PHOA 5IGXL 1QRNE 2I24N 5T3ZD 5AZEL 1K4DA 1LO3L 3IDGA 2NY0C 4NJAH 5GRYA 3E2HB 1PVHA 4XPBH 4OLVL 2IQAB 1MJ7L 4JZOA 2Z31B 3MR9B 5GQBA 5F7HA 3MLUH 3HN3A 5KSBB 1F42A 5DMKB 2I07A 4NZRL 5KN5B 5LGHH 5E9DD 2GT9B 4NO5A 1AGCB 2R9HD 3M17B 4LARH 4S10A 1ZLSL 4JY4A 3NFNB 3W81A 4PJ5D 3HAEB 2AJXH 4JFFE 2NW3B 1CDUA 4DN3L 4YWGL 4I18A 1CK0L 3SDDC 1X5AA 4FXKB 3M1BB 3FT4A 3RA7H 4JFOA 5J7CC 3D48R 2CK0L 5EBWA 1DANT 1JRHL 5MI0C 2VDOH 4HC1L 4PJXB 3SOBL 4MNGB 4F9LA 4HS3A 4Y89A 2Y9RT 4XWGL 4GXVH 4KK6D 4L29A 5HYEA 5EZJB 1AXSA 4XHJC 1XIWA 5CBEB 1TIUA 4HBCH 1B0RA 4XXCA 3QXUA 5LKNA 4D8PA 4DAGL 5IEHB 5I1KH 5I1AA 1UACH 2FB4L 1YPZB 1J05A 3X14A 3LAFA 4GKZA 3S36L 3GSNL 3CX5K 2P7TB 4RMWA 2CGRL 4RGMC 1MUJA 3SQOL 4F33B 1CFNB 4KJWC 3B83A 3HMXH 1IGIH 4MNHB 4MJ5B 3QQ9C 1MFCH 4P46C 1OCWL 5EH1A 2A9ML 1A2YA 1WV7T 1UZ8A 3MXVL 4NN7C 1JMZA 1R3HB 4M5ZL 4M9OA 2Z93B 3AB0B 3RJDA 4PP2B 5ITFB 2EYRA 3V7AE 1U3HC 1VEPA 5DFVC 3QG7L 1I1FA 2PTTB 4LPXA 3ZT5A 5HGHB 5FO9A 5I1DB 4ZUVB 1JFQL 1EERB 1XFPA 4Z0BH 1J12A 3FQNA 5DK0B 4KMQA 3S4SA 4QRSB 1FG2A 1SM3L 5GJSH 4KHTH 3IFLL 3CXHK 2W0KA 4KY1L 5C8JA 4XRCB 2I9TB 1EO7A 2WBJC 3IJSB 3CDYA 5FGCB 4D3CH 4WHYH 5H2BB 1ZSDB 3NIFE 2F5BH 2X4RB 3KPQA 4FQCL 3CFEA 1SJVA 1L7TH 4S11A 5F21B 5C0AD 5C9JB 3TBYB 4ODHL 1FO0L 1S7WA 2HFGH 3AY4A 3AREC 1ITCA 5I15H 2YD5A 4QHKI 1NEZA 1M6OA 1KOAA 2R2BA 3KNBB 1G7MA 3GB7B 3U9PH 4JO3L 1PSKH 4PJAA 5EU5A 1DLFL 4I18C 2JF1A 4XVUD 3TWCH 4GAYA 5D6DC 1KCKA 3BZFA 1CWVA 1KELL 2G5BA 5GZNC 2YD8A 1ZE3C 5DA0B 5E8NA 1ONQA 4LBEA 1Y6KR 4X6FA 1MCOL 25C8H 2L7JA 5IW3A 5BRZD 3DRTA 4HG4K 1XIWC 1J86A 1VFAB 4YXLH 3F7YB 3GI8H 4KMTH 3KXFB 2VXQL 1N2RA 1HHIA 5DDHB 2XA8L 3LN4A 4K7FA 4Z77B 2DBJA 4TYUA 1MHCB 5K33A 3X3GH 4OCYL 4R96A 1WAAE 1QFHA 2YXMA 3Q6GH 4PJIF 4OFKA 4H8WC 4K94H 3RUGE 1U92B 2CR3A 3P9LB 5C0BD 4EJ1C 1AP2A 2J4WL 3MA7A 4HJJL 1G7HB 1NMAL 5E99H 1AR2A 4AIZA 3LHPH 4IRSA 5ILTH 2AJZB 4ZNEE 1UXWB 1VB9A 2HJFB 4F7MA 1PJ9A 2APWA 1BD2B 2WWMC 5BVPL 2XPGB 2WV3A 5GGUB 1Y6NR 1JZ4A 5FYKE 4G42B 4U1LB 3RIAK 4EN3B 4JQVA 1I7RB 3FB8A 5IB3B 4C56A 3QUYC 5I6XB 3BH8B 1A7QL 2IPUK 3C6LB 3H42L 4QHUB 1F2QA 4OUOA 1V3LA 1RV6X 2B4CL 1H3PH 2XI9A 4G8GA 3I02B 4EDWL 3CZFB 2N7AA 3TO4A 1J8HB 5EBMA 3FFCB 1FYTA 1DCLA 3WHE0 5F9OH 1G7QA 5H35B 5HHVH 3MUZ1 4XWGH 4OF8A 1D3CA 2WWKT 5J1AB 4FQQA 5JHLL 1KT2A 1CLOL 4WU7A 5E8EB 1XGPB 3IFNH 3I2CL 5KAQG 1DEEA 4N8PA 3L1OL 2PXYA 3LKOA 4CRPA 3RWDB 1A6AA 1LMKA 1VESA 2YUWA 4HEPG 4G9FD 1U2CA 2DIBA 5D5ME 2GK0A 5B8CB 5ERWA 4FQ1H 5D7LB 3TA3A 5TDNA 3MFFB 1X6NA 3T3MF 2CXKA 4JM2D 4PRIB 1WK0A 3ZYZA 5EC2B 4WO4A 5F7LB 3UTZB 2FBOJ 5FYLE 4HKZB 4TSCH 1BWWA 1UXSA 1P6FA 1NKRA 2FJGB 3BPLB 1OCWH 3TVMD 4NQDB 3IB4A 2PW2A 4FTVA 5DJYA 1RAMA 5GJTL 5LQBL 2BY0A 4J2XA 3BH9A 2AK1L 5CSZA 1PYWA 5KBNC 1T66D 4K23L 3HLAB 1PG7L 2OJZH 3VWKB 3QUXC 4RDQF 3G5VA 5K9JH 3MRDB 3E0GA 2Q20A 4ZFGH 2FSEB 4PV9A 2BDNL 1KEMH 1AIFA 1T1WA 4C4KT 1IGMH 3E3QC 3HE7B 3O6KL 3IYLW 4P9HL 2ZUQB 1R5VB 4HGMA 1U36A 5GRJL 3LMJH 5SX4I 1KSRA 4IRSC 5KJRH 2LTQC 1QSFA 5JW5A 1W0VB 5B21A 3WIFA 3H9SE 3PUCA 1U8HA 1D5MB 2CKBL 1W72A 4JQIH 4L8DB 3CU7A 4JRYA 3KPPB 2OQJB 4O2EA 4AENA 1MLBB 4H1LA 4N1HB 4XMPL 1OAQL 4AJ0A 4F37K 2QADD 3VD7A 1FNEB 3T1FA 1JWSA 2XACC 2WIIB 1NUDA 1BGXL 4JQVC 1M7DB 2HP4A 4GJTB 1L7IH 4RGNC 3MJ6A 1FZMA 4RAUA 3O3BA 4I5BA 4WHTB 2H2SC 3QJFA 5JPMB 2P46B 4WGVB 2CH8A 3VFGH 3HC4L 1QEWB 3NACL 1HHJB 5E8OA 4IMKC 4NHCL 3VGHA 3GBML 5C2BL 1Q9OA 4XPAH 1FZOA 1OD9A 4JGJA 3UYRL 3CFKA 3FO2B 4HJGB 3BFOA 4YJZL 3DXAE 1RY7B 3KLAA 3ZSSA 4AIXA 4PB0H 5F1IB 2AJ3A 5D1QD 5F88A 3VI3F 3FQTB 1MCOH 1JYVA 3U0TB 2R1WA 2CLRA 1LEGB 5HD8C 5B3NA 3OKEB 3OKOB 3LCYA 4A6YL 1G9ML 3HUJB 1MH5A 3VCLB 3OPZL 3R0NA 4KFZC 1WZKA 5E0QA 5ALBL 1ZGLM 3F58H 4K2UH 3UJIL 4FFZH 5IFAH 1H0DA 1S9WA 1LO4H 4PJCE 1WWAX 3A67H 2D7NA 2QKIA 3FQRA 3R8BB 3GMOB 4ELME 1F4WH 1MFBL 5DD1L 5BZDA 3ZTNL 2MPAL 1CLZL 4GLRH 5D1ZD 3VFNB 1JPST 1MJJA 1XF3B 2H1PH 1E28B 1NMAH 4WU5B 1HDMA 2XV6B 1EX0A 5KVFH 1QO3B 3PL6A 1INDL 1U58A 1YC8A 4KRMB 5I8KL 5FB8B 4G80A 5ISZA 5D2LA 1BZ9A 5FKAB 3QQ3A 5I0DA 2NTFA 4OCXL 4Q9CA 2NYYC 1LD9B 1PAMA 4IBLT 5BVPH 5DLMH 1OB1A 3T1WA 1K4CB 3HG1E 4NWTL 2M1KA 4DK6A 2X70A 2R1XB 4OLYH 4S1DD 1RFDL 4Q6YA 5D8JH 2VDNH 5DI8B 5CBAB 1BFVH 3G5YA 4Y19D 4JVPA 1XGRB 4NC1E 3GSQA 1IM3B 4OSUL 3S3SA 3HE6D 1FLRH 2XKNB 4PG2A 4XCYA 2VZ1A 3E8UL 5I76A 4NQCB 1ERNA 1OTUD 2Q3AA 3TIEB 5F70A 2O26U 2P8MB 4PJBB 4XCEB 4DGIL 3HMXA 3DV4A 4U2ZA 4NM8L 2OJEA 2XOTA 3MLTA 2IH3A 4LCUA 2E6JA 3MACL 4PJXF 3WKNA 4NZTL 1QLFB 2VQ1A 2HMIC 3MRBB 3GKWL 4MHHG 3JV4A 4N0YH 1U8MA 5F3HB 3QWQB 3EOAB 4WV1C 3IJYA 3MUY1 3V6ZA 1ZA6A 2WK2A 5I1GL 1NGXA 5EOCJ 1A02N 5AWNL 1GL4B 3UYOD 3QIBA 4G6AC 5DD5H 2NY1D 4AM0A 4ZDHB 4CVXA 2YMXL 3EJJX 2VXUL 2X1PA 2NXZD 4NUGL 2Y07H 3OJVC 1KJMB 3SKNA 3I6KA 5KZCB 1O5DT 4PYHA 2D31A 1ZLVH 1U8KB 3VFTB 1P7QD 2DQCL 1LEKB 4HUUB 3NN8A 1U8IB 1EVUA 5BO1H 5HY9B 3S7GA 1XGYH 3CX5J 2LVCA 3TZVB 4OIIH 1UZ6E 4WEUD 5DC0A 2Y6SC 5IROA 1S7RA 2FX8H 2IMNA 5MEQB 2W07A 3KYOB 3OG6B 1CQKA 4XMPH 4MA1C 2VLRB 2J7LA 1MIEH 3GSUA 4JREC 5I2IA 2E7BA 3ULVL 1EUTA 3IU3A 4L8SA 1MI5A 2AI0L 2DS4A 4R4NC 4LCIL 4MCZA 3ULVD 4V2BA 2Y25A 3EYVB 2CXGA 3CU1A 1G7LA 4P23A 5BS0D 1OGAD 4KRPB 4JKKA 1RZJC 4FQJH 4NHCH 4C57C 4P2OA 4HF5H 2ZSWB 3NFPB 4LHUD 5F6HJ 1JPFB 1W8NA 4PG2C 4JLRA 1ZMYA 4EI5B 1S7TB 3MOBL 4J4PD 4JGMA 3NIFF 3OHXB 4OBSA 3CXHJ 4B53A 5DVMA 1T2QH 3PHQA 4GRMA 2UUDH 1FORH 4I77H 4M1GH 1ZEAH 4LEXL 1G9MH 4HPOL 2OYPA 4UTAL 1TMCB 4MJ6B 3ZT7A 1FN4A 4UDTB 5EUKB 1RUKH 2W9EL 5J3HD 3KYMB 5E9DA 2XWBB 2NY5L 2PYFA 2J8UE 2BP3A 2JK5B 3B8YA 4FZEH 4PJ5A 3NCBB 5DD1H 3VDCA 3ZE2E 1S8DA 3BP5A 1MAMH 3ZTNH 1XF5B 3DRQA 2NY7L 2I5YL 3DIFA 3VWJC 3GMLB 1CE1L 1J0ZA 3MREA 4ODWB 4JFXA 2HLAA 5J6HB 3QJHB 5D7SL 3VXRE 5I8CA 1PD6A 3QIBC 5C0RL 5K9QI 4OGXH 3GI9L 1H5BB 1GC1C 3ZHDA 1S7VB 2Z8VC 3FB7B 4HC1A 3ZE0E 4HG4J 2OR9H 3MV7D 3G6JA 4JFYA 2EZ0D 2RB8A 4MJ2A 3HZVB 4MD5A 2EKSB 5IMOA 1KULA 3O2WH 5EUOE 3V5KA 1JJUA 2A83A 2OP4L 1NKOA 3DPBA 2JJSA 3LEVL 1NC4B 3RUGF 2J5LB 2BVPA 1JNJA 5I30H 4HK0A 1ED3B 1T6WA 3LRSB 4X4XA 3WNMA 4LASH 3SGDH 4EBQH 3GSNA 1K8IB 3TFKD 1FZJB 4O2CA 1AFVH 3MNWB 5HYSA 2GUOB 4N90D 4K7PX 1AY1L 1S78C 2SEBB 3TBSB 4ZFFA 2R4SL 4K7PY 2Q7YA 4HEME 4P48A 4UBDD 4AMKH 5I74B 1TPXC 3T0ED 2XICA 4LNRA 4LMQE 4OUUB 2ERJB 3PWUA 4MSWB 3RWCA 2UYLA 1CE6B 3MACH 1QFPA 5DHVB 5E94B 2G2RB 3KPSD 2VDPL 3BWAB 4I8DA 3WEXA 5C09B 3AS3A 4P2OC 1QPXA 4HUVA 4ZTPH 3VGFA 2X4UA 4AQ1B 1QFUL 1JGLH 2VNCA 1ADQL 5GGQL 1K2DA 1T1ZA 3EUUA 4R26L 5GPRA 4WJ5B 3BKJL 4LLMA 2ITDA 1P5UA 3L3IA 1NSNL 1FE8H 2HG5B 1HYRC 3H9HB 4KJQD 3ZDYF 5EOQL 2EDOA 1S5HB 3L3OB 5E6YA 3OX8B 3ZKSD 1QSVA 5HI3D 4QTHA 5C0AA 4G7VH 5CIPH 2YMXH 1B2WL 3OJDA 5D5MF 5CCKH 5T5NG 2R9HC 1FO0A 5IR1A 5ESVA 1I7TA 4LPWA 3CX2A 3O6FB 3P9MA 3MV11 1XEDA 3DVNB 5JLZB 4QRRD 4DZBB 3CSYA 1DTUA 5HGBA 2EE9A 2WBWB 4KKLC 3QNYB 3V6BR 1Z6JT 1Y0LA 3K8KA 2AJYH 1SJEA 3RY6C 1FL5A 1F3DH 4Q58C 4GG8B 2LQRA 5IEKA 4O2FB 2FATL 2HVKA 3EO0B 3MV9B 4PY8I 4P9MH 1T22B 1T04A 1OP5H 5BW7C 2QTEA 4OT1H 3QYCA 4P4KD 4LLAA 4KK6C 1KIRB 1NCDH 1JI2A 1G9NL 4HJ0D 2APTA 4K3JL 2IF7A 1E6OL 4WI3A 4PRAB 4OZHA 5TE4L 2A0LD 4AL8L 3Q6FB 4S2SB 3AM8C 3L6FB 4RWYL 1QA9A 2EEBA 6FABL 3SCMB 2FD6L 4N8CH 1CXEA 1EBPA 4HIHA 2JKXA 4HLZH 3TEUA 3O3UN 2HTLC 3G9VA 5C0BA 5EIIA 3SDAD 5BXFA 1MFAH 4HMEA 3T0BA 1KCRL 2VZVA 1V7NH 4P57B 4NKOA 2ORBH 3OB8A 5B39G 1JRHI 5IVXA 5D2NA 4JHWH 5KSAB 5DQJA 3MLVL 3W9DA 1PY4A 4KQ4H 3HC3H 3K8MA 1OAXH 3QNXA 2DLHA 2FBJH 4GKOA 4XBEH 4Z7QE 1YEDB 3U4BH 5JQ6L 3FCTB 1QYGL 2J12B 4YNYA 3N1FC 1GOHA 4PRHA 5DUBA 1FGNH 4G6FB 1N8ZA 4HULB 3I85A 1CICD 5IT2H 4RMTA 2CRYA 3MLXH 3HFMH 4MXVF 4M93C 3QEUB 5F9WB 4BSVB 2X09A 1MCIA 4PS4L 1N5YH 3K7UA 1BOYA 3PV7A 3MLSL 1A3LH 4F57L 4ZO9A 1R3KB 5IF0B 3VFVA 3JWDC 1XT5A 5BJTA 2DB8A 4Y4KB 5DMYA 4Z7VA 5IMKB 2NTSP 3LKSA 3IDMA 5IW6A 4PJCF 3ZKXC 4PJHB 5F7YC 2BY1A 3H9ZA 4ELMF 2OP4H 1CR9H 4G9FA 4JHBA 2DJSA 5JPNA 4X5XA 5BQ7B 2C3WA 4HGWA 2FX7H 4MHHI 3MJ7A 4XVUC 1JHTA 1GHFL 1DP0A 1SY6H 2VQUA 3GIZL 1H3XA 4JM2A 4X7SH 4KC3B 3TH4T 2R4SH 3GNMH 4Z7NE 2E7LC 1NAMH 2CRMA 2Q3ZA 3TVMA 3TJHD 3PGFL 4QRQB 3QHZL 2YSSA 4XNZC 1BAFH 2YPKA 2EC9T 4L8CB 5IOPB 2VL4A 1YY8B 3W0WD 3IVKA 4MCYA 4RFOH 2CPCA 3QDAA 5GGTL 2E9JA 1BFOB 1MAJA 1YMME 3QIUB 4BZYA 2VDPH 4U1IA 4OM1H 3GBNL 5INDA 1RJYA 3IDYC 1P4BH 5EZLB 2AEQH 2X4NA 3MRPA 1MVUB 3N50A 3V5HA 1NSNH 1KG0A 2EH8H 5SV4A 3U46B 3OB0H 4LCCA 3VFWA 1MPAH 1FSKB 4YAQA 1N7ML 3H9YA 4IHOA 4L3ED 1IC7H 1XF1A 4KK9D 1EO8L 1QFWH 2ZOKA 3PHSA 3VE0B 5CKAA 4NNPH 5SX5K 3R0MA 4LSVH 2FYYA 1WFOA 3QUMB 3D2UD 1AC6A 2WUBL 1H15B 1RUAL 4GRLD 5GRUL 3QXVA 2Q8AL 1M7IA 3L3KB 3O4OC 1M4KA 3I3BA 3RIAF 2DQHL 2LU7A 4MWFB 5DS8A 5F93C 3W82A 2B4CC 1BBDH 3GMNA 3IFOB 4LHUG 3FN0L 1XF2A 4NN5B 4U31A 3VXOA 1IQDB 3STZB 4GLRI 2Z31D 5D1QA 1BVZA 5HYJA 2R2HB 1MF2H 1E4KC 4U6VH 5I9QB 3QBTB 3LDBB 3DX7A 4N0FA 5TPWL 3BRDA 4KI5C 5I1IL 4H88L 3PIQA 1LK3L 3RWEB 4A6YA 4GMTL 3VGDA 1M1SA 5T5FH 1IGYB 4YO0B 2FL5B 3H7BA 1UZ6F 5D1ZA 3MJGX 1HIML 1CN4A 1FZKB 4XP6H 4LAQL 4OFYA 3JZ7A 5T1MB 1MVFA 1WSST 3TVMC 4OGZA 1KCRH 3H3KA 3LD8C 5A16A 1L4IA 4HKXA 4QNPF 4YXHL 3QFJE 3WUWG 5IVZB 2Z9TA 5E4IA 1A6VL 1KN2H 4JFQA 4PJEE 3RVWD 1T66C 4F3FA 1RQ5A 1VACA 2ICWI 4F80A 5J12C 4U1HB 3WL9A 3MRRB 3P77A 3VXSB 4CVUA 1XF4A 2H6PA 3QHFH 5MP6L 3NABH 3QR2A 1A0QL 5FF6A 4U1MA 4Y19A 5IQ7L 3I75A 3GEWB 3SY0B 2RHEA 1ZT4B 4PS4H 2A1WL 3QEHB 4G6MH 3KPRE 5B38G 1NBZB 2NX5E 4F57H 3G08B 5JW4N 4Y8DC 3UAJD 4HAFA 4R3SB 4OGAD 5F7WC 5L88L 3SGEI 2QADC 2AJSL 5FM4A 5BZWA 5K93A 5J11C 3HRZB 4LQ1A 2E8ZA 1GOGA 2UY7A 2ZOLA 4FXLA 4EI6A 2H32B 2J8UF 2BSSB 2P42B 3AROA 4NM4L 1AGBB 2JCCE 3ALPA 4DKDC 1F13A 3B5TA 4IIQA 4KTEL 1UC6A 3G6DL 4GAFB 2V9QA 3HRPA 2YKLH 3GIZH 3QWOB 3BPOC 4YDLB 4JKPH 2EIZB 2DDQL 5T1KB 4L9DA 1BREA 4YX2L 4Q97A 4DGVH 5D1QC 3T0VA 4MVBD 3PGFH 3MRHA 3QHZH 4P5TB 3BGFB 3V6OE 2IPKA 4Y1AB 5HDQL 3ZE0F 4YHMH 4XBPA 1OARH 3F12A 2W0PA 5E5MA 1BBJB 5EUOF 4J1UB 3GBNH 1B4RA 1NBVL 4WW2B 4NQXB 1IC4H 1I8LA 2YN3A 3S5LG 1T20B 4HWZA 4MJIB 3EYFB 1AGDA 1Q94A 3MO1A 2GJ6B 2P5EB 3O2DH 4XXDA 1OP3H 2H3NB 2VZSA 2CR6A 1CD1B 3BZ4B 1UYWH 3Q2CA 2O5XL 1U8QA 4JKWA 5LCVH 2DM4A 3CVIL 3VGGA 4OLWL 1A1OB 2EDYA 4IJ3C 4KXZI 3WFEL 3EYSL 3LB6D 3P4NB 2OSLB 2YPLE 4HS6A 5C0FB 4BFGA 2P47B 4KK8D 2ICEB 1I3VA 5LXGL 3KXFD 2FR4A 2EXYD 5L7XH 3LS5L 4S1DC 1PY9A 4LLUB 1RUAH 1T0MA 3H0TA 1KIQB 3MRIA 1DL7L 3U4AA 4PPTA 5BS0A 1RIVH 1OGAA 3WLBA 4YE4L 4TSAL 4YFLI 4CGTA 1MQ8A 3G5ZA 3QXAA 3HC0A 4U3CA 3HE6C 3BRGC 4XAKD 1OAKL 4RAHA 2VXSL 4LHUA 3VRLE 4X6DB 4BZ1L 3QEQE 1MJUL 7FABL 2BNRE 2BFVL 2C3VA 3BMWA 3DMMB 2VDML 4J4PA 1OTUC 1QRNB 5TH2A 1JCKA 1BD2D 1C7TA 4PJ8B 3I6LD 1KJVB 3P0YL 3OBAA 1OWRM 2ZG1A 4L4VB 2PO6B 5I1IH 2JELH 5GXBB 2CDFA 2AJVH 4EN3D 3RWGB 1AGEB 4P5MB 4GMTH 3LSOB 1CLCA 3MRCA 3UJTL 4K3DH 4KZEH 3C6LD 3TT1L 1DBJH 4R7DB 1FV1A 3ZDZE 4E41E 2VLJB 1YQ2A 2PUQT 3LIZH 5HGAB 2V2TB 3JTTA 2Y7QB 3OKLB 4X7DC 2EDDA 1HYSD 1J8HD 1N0XH 3FFCD 1ACYL 1T2JA 3Q1SH 4YXHH 4I48A 3WUWA 5ITBL 4F7PA 5J9PA 4TSBH 1FNAA 4X98B 1N6QH 4Z9KB 5AZ2H 2FGZA 1PKQA 2EE3A 2NY1C 2LVEA 5HHOB 4XPFH 1TZHB 1IVLA 2AQ3A 3TPUA 4TQEL 4XP5L 1I8LC 2NXZC 2BHZA 3EOYG 4EEEA 3MV7A 2BXYA 5D7LD 4XNMA 3L5WB 2CRIA 4Y5YA 3BW9A 2D0FA 1T83C 3QHTC 4U6TA 1F5WA 3PWNB 2XY2A 4PRID 5IJKA 2IFFL 3SE4A 5IBTL 4CMMA 3D0VB 1H3UA 3NFSH 3D3VE 3S96B 3OKMA 4HH9A 1MCNA 3SE9L 4NQVB 4NQDD 3V0VB 5FKPB 1SY6A 1A1NB 4HFWA 4Z0XB 4L9LC 2G75A 2FZ3A 5D72H 1RURH 2ADIB 1LWRA 3EO9H 2AJSH 5JNYA 1HH6B 1N59B 5JOPD 5FYJL 2BERA 3VWKD 3T2NL 3T0EA 2YUVA 4K7PL 5JDSA 3HS0A 4Z7QF 1R6VA 5FYJD 4W6XB 3ULVC 3FQXB 2AXGB 3G6DH 3HE7D 2XZQL 3BMVA 1LNUB 3KPSA 4JRXE 2ATPA 3VXUB 2YZ1A 4RMSA 3KLSA 4GKNB 4W6WB 2DDQH 4I3GA 1A7PH 2DQIL 4YX2H 1BEYH 1WBZB 2AV7A 2EDLA 4OZFG 1A6ZB 4HCRH 3JUZA 3WYRA 4O51B 3OR6B 4KMLB 1ZHBB 2KQNA 3P0GB 4GKSB 4H25A 5KTEH 1X5LA 4PG9A 1ZT7A 4LVNC 4WFGD 4YHIB 5E7BA 1DBBH 1ZLUH 1VADA 5HJ3A 3GSOB 3L7FA 4FNLH 5J3HC 2DKUA 1LP9A 1TTUA 3T4YB 4GW1B 2C4XA 2NY5C 5LGJA 4HUXA 4XC1H 1YJDL 2HFTA 4QRRA 3B9DA 1LE5A 5I1HH 2Z8RA 3NGBC 2OMBA 3IU4H 2LU4A 4Z7NF 4UIKH 1AR1C 1KTLA 2VLLA 3WFEH 2QSCH 2QHRH 3TP4A 4D9QE 2VTFA 1ORSA 4HIIB 2R23A 4EOWL 3WD5L 1WFTA 1JN6B 3N1QC 4RX4A 43CAA 1QLEL 4P4KA 3BI9X 3P0VH 5AD0B 2EZ0C 4M00A 1BMGA 2VOTA 4RGMB 1FP5A 1UWXH 2P8LB 1EAPB 1BX2B 2X5PA 3HAEG 3ME0A 1XCTB 3HR6A 2Z35A 3AXLB 1KLGB 1MCWM 3R1GH 3LRGA 3D0LB 1EMTH 1MWAH 5E8PA 4U7KA 2IPTL 4HZLA 3TFKC 4ODTL 2BK8A 1TZIB 1Z0MA 3C9NA 2ZSVA 1IQWL 1EPFA 1C08A 3D18B 2OZ4H 4UBDC 5EO0B 4QRUA 1YN7A 3C5SA 4DKFL 1FPTH 1AQDB 2W60B 3MGOB 3LPFA 1HZHL 3O0RH 4KUCD 2R2EA 5IWLC 3MFGB 4FXGA 2X41A 1K6QH 3MV8A 3NMEA 5JMRA 2UWEB 2H41A 5JOFB 4M6OH 4ERSH 1ZAGA 4NQCD 4FOMA 3V4PL 5IG7B 2W9DH 5MEOA 2PW1B 1T7WA 4KJQC 8CGTA 4QHNB 1BPVA 3QUKB 5TDOB 1IKFH 3FT2A 1BJ1J 3QRGH 4G5ZH 4UV4H 5KG9B 1E4XH 5D96C 3U9UA 1GPOH 5HI4C 3EYUH 4YHOH 4XNUH 2EH7H 1ZVHA 2Q6WA 3B3IB 2YS4A 5E8DL 4M8QB 4WENB 4TQEH 2A2QT 2QR0A 1CXIA 1CXKA 1FFOA 4HBQA 1MRCL 1AXTH 1U6AL 3LQAL 3N1GC 1FVEA 1HHHA 3HNSL 4U0RB 1UA6H 1J10A 2NXYB 1MLCB 1K5NB 1FBIL 1UM6L 1RI8A 3PQYD 4HV8A 4YHYC 1AD0B 2AGJL 5AAWA 2HFFA 4NKIL 5F7UA 3UMTA 3GMMB 1WZMA 4JANA 4LSSL 2XRAL 4KJYA 5FYLH 5HDLA 3VG9C 5I1LA 3U2SB 1PKOA 4BKLA 1RK0A 2V2XA 1IGJB 4HJ0C 2BJML 5ANMB 1G9NC 3ARGC 4OZGE 2GQHA 1HSBA 5KZCD 3FO1A 3ROOB 2FX9L 4BELD 1MCJA 2A0LC 3AU1B 5IVOA 15C8H 1PQZA 4OAWA 3LS4H 5GGTA 3A6BH 5EOCH 2XXCB 3TZVD 5I18L 1UB6B 3WJLA 4HHAB 4M6NL 1X3DA 2EC8A 5DVNA 1GVIA 5C0ND 3FAXA 3K4AA 4YGVA 5FDYA 3SDAC 3LPWA 2VXVL 3E6FA 3SKJH 4OFIA 2B39A 2VLRD 1FVCB 4ZOEA 1E27B 1FFNA 4XNQB 1AQKL 3V8OA 4JN1H 4L3EA 5IFHH 2R1YA 3PDOB 2JCCF 1KENL 4LHJB 4DWHA 1UWGL 3QNZB 3C2AH 5CINH 1I9RH 4XC3L 1A47A 4KRPD 5C92A 3I6GA 3TF7C 3SEPA 5IB1A 2HJKA 2VDQH 3D2UA 3DUSA 1CICC 2WP3T 1CFTB 2XFXA 4EI5D 1QFOA 2W65A 4PJAE 4WCYL 4URTB 1Z5LB 3PE9A 3UROR 1GIGL 3EYQD 4WFFD 2XN9B 1NGZA 2DYPB 2Z91B 3WD5H 2IQAA 5C3LD 3RPIB 3KPTA 3PGDB 3DUHA 1B3JA 3QG6B 4HAGA 3MRKA 2Z31A 1QLEH 4DN4L 3MR9A 1C5DB 1GAFH 4OZ4B 1BF2A 5F7MC 4MDJB 5DMKA 3QDMB 5KN5A 2GT9A 1TQCC 4PRPB 5CGYC 2GKIA 4TNWF 3NFNA 5DHXB 3HAEA 1F6AB 2E9BA 2NW3A 4QXTB 2FNBA 1KPVB 1A7NH 2IBZX 1XCQA 1KIUA 2IBZY 5E1AB 2IPTH 3FT3B 2IADA 1LGVA 4OCRH 2COQA 4FXKA 5EFIB 2CSPA 3M1BA 4X6CF 1IQWH 4P4RB 1IEBB 1DFBH 2NNAB 5KVDH 3T0WA 3TJHC 4PJXA 4QXUL 4JY5H 5DQDH 2Z92B 1KTRL 3VXMB 4MNGA 4PJFB 2FJHA 5EZJA 4OM0L 1SJHB 5CBEA 3FO9B 4XPTL 5IEHA 5JXAL 3S98A 1YPZA 1GXEA 1NC4D 4KGLA 1JHLL 3GJEA 4N68A 4BUGA 1ZVSB 2LTQB 3PJSB 5DJ6A 4EVNB 3VRLF 1MFEH 2AERT 3WJLC 3WLWD 2P7TA 1JNNL 4C56E 5EIVA 4F33A 1CFNA 3S3PA 5IB5B 4XGZB 3T8XA 3FN3A 1MEXH 4MJ5A 4G8GE 5TQ2L 2FIRT 2MNUA 4QXGL 1F11B 2C3XA 3O6ML 4XVTH 4H26B 4G3YL 1FYTE 3MUGB 4M5YL 4RGNB 1JGDA 2NZ9C 1R3HA 4FFYL 4PP2A 2NW2A 2OK0L 1I1AC 1UENA 5EBGA 4J23A 3DSNA 1B88A 1ZVYA 2PTTA 4JPWL 4XNYL 5C09D 5IHLB 3ZDZF 3WDHA 5H8DA 4I3RL 2FIKA 5HGHA 1FBIH 2C1PA 4GRLC 5I1DA 3OKYA 4QT5A 4ZUVA 3PDGA 5DK0A 1IGCH 4JFEA 4QRSA 2HT4D 4HIEA 3SJVE 4LSSH 3E2HC 2APFA 5F97E 5JA9A 4XRCA 2I9TA 4X6BB 1A14H 1GGIL 2CUIA 3IJSA 4JVWA 5H2BA 2Z31C 4DFIA 5C9JA 3TBYA 2BJMH 4ONFL 2A77L 4FTVE 4TRPH 1HKFA 3CH8A 4LP5A 5C9KA 1JNLH 2BHUA 3KNBA 3ECBA 3O6FD 3RX8A 4R8WH 3GB7A 2R29L 2FH6A 1L6XA 2EDRA 2DLFL 5JW4M 4I1NB 5TDPB 1MHPH 1K8DB 1CTOA 1E6JL 4JO4H 3AFLA 3MV9D 4QTIH 4UV7L 3VH8A 1NFDB 1TQBB 4GT7A 1CGUA 3I9GH 1QSFE 1IC5L 4G7YH 4WFHE 3RVWC 1VFAA 1Z3GH 1JWUB 1KENH 3F7YA 4JRYE 2Y36L 4QCIB 1X9QA 4Q2ZA 5DDHA 5CZVL 4FZ8L 2R69L 4X9HA 5HYQB 1MHCA 3DI2B 2E8YA 3SCMD 2ADGB 3BUYB 5J57B 1KTDA 2FHCA 1UJ3B 3PWJB 4NUJA 4NPYB 4TTGA 1CF8H 5TGBB 1P7KB 3SE3A 1CTNA 3U7YL 1AH1A 3RX7A 3JXAA 5JORA 3HPJB 3I50L 5AYUL 4V1DB 4WUKH 3QZWG 5EO9B 3UAJC 4GOSA 1QHOA 2AJZA 4ODXB 4OGAC 1UXWA 4LKCB 1EEYA 3LRHA 4L4TB 2HJFA 1SEQL 4NZUH 1IBGL 1BD2A 1I8KB 1NGYB 1NGPH 5CZKA 1AKJB 5KSAD 2XPGA 4KI1A 1B4JH 5GGUA 2OZ4A 1B6UA