5C9KA

Crystal structure of a highly fibrillogenic arg24gly mutant of the recombinant variable domain 6ajl2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
b'NFMLTQPHSVSESPGKTVTISCTGSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHVVFGGGTKLTVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid lambda 6 light chain variable region PIP
molecule tags Immune system
source organism Homo sapiens
publication title Mutating amyloidogenic lambda6 light chain AR back to germline 6aJL2
rcsb
total genus 24
structure length 111
sequence length 111
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c9kA00
4P5TB 4LU5L 5JPMB 2W60A 4V2BA 5ESVA 2PXYA 1MCLA 1HCFX 4GBXB 4G8FA 4TRPL 3BGFC 4I2XE 4WNQB 1A3LL 5JIPA 1HWGB 2EE3A 5HGDB 1KPRB 3L5XL 3HPLA 1WF5A 4OFIA 2VQ1B 2X1WL 4TQEL 4BZ2H 1E6JH 5DWUH 1J5OL 4G6JH 4ODUA 1MNUL 4X80L 3OXSA 1KN2L 4UNTA 2AEWA 4OZHB 4YDLB 1LP9E 1T1WB 1WBZA 3IS0X 4L3ED 1NMAL 3X12B 1FLRL 3GJEA 3HUJE 4RA0C 5B39B 3IDMA 1FAIH 4ZFFA 4JFFE 4RMTA 1ZHBA 2A74B 4WFED 3O45B 5FM4A 3HMXL 3TNMA 2H8PA 3C5ZB 1OT2A 2AV7B 2C3GA 3NAAH 4PP1D 2ZPKL 1UVQB 5T5FL 4NCC2 1D3CA 5HJ3A 5I1AA 3X11A 4MDJB 4XNUH 4WEBL 3QI9C 4MD0A 2P24A 1DL7H 4K9EL 1OM3H 5CZVL 4M8VA 4EJ1C 5CJ5A 4TUOB 4UV7L 4OCYH 4IHOB 4OGAC 4U3XA 1KIUA 1ED3B 4U3CA 1KEGL 5D6DA 3HI6H 2Y06L 4NZTH 4IMKA 2FHFA 4P9MH 2ZP0T 4UBDD 1XF4A 2NY1D 4PJIF 1H0DB 4CDHA 5ID0A 1SY6H 3UTSA 4FS0A 4PGCB 1YEIH 5GGUB 2V7NA 5BW7C 5I75C 4NYLB 4O2CA 2IALB 5J3HD 3WDJA 3WIFA 3GUTA 4CJ0A 2VLME 1D5IH 3V5KB 3QUYC 1QSEA 1NLBH 1N64H 5LGKA 3Q6FA 2VWEC 4S1SH 3NACL 2CDFB 1R5IB 4XMPL 4JZOA 1EMTL 2BRQA 5IIEB 3D0VB 1P2CA 3MRHB 3GBML 4J4PA 2N56A 4CU8A 4YXLL 4EI5C 1UM6H 3DSNA 4NPYA 3G5XB 4AEHL 3ZE0F 4JQXA 1SBBA 5ITFA 4EXKA 4HIEB 5JLZA 5EO0B 4R0LB 1XCTB 1WT5C 4XPHH 5I76A 2A9NL 4L4TD 3C09C 4M1DH 3WSQL 2YEZB 3MLYL 4MXWH 5HI4D 3QIWC 3MXWH 1CXFA 1XGPB 1QYGL 3RX7A 3O6FC 5EA0L 1F6AB 3QB7C 5FHBL 2Z31A 4Z8FH 1IGFH 1MSPA 5BW7A 3BESR 4W68A 5J1AB 4V1DA 1F00I 2XKSA 1WVZA 3F7YB 2IWGA 4W6YB 2EH7H 1A64A 4OLXH 1NCNA 4X4YB 1YEKH 1YEGL 2EDEA 2PTVA 1I7TA 3WIIH 3P0VH 3DV4A 3PWNA 1CLYH 4KC3B 3BKJL 4PRPD 5DSCA 5IVZA 2C3VB 3IJSB 4YDKH 4KKLC 4OKVB 4OI8A 1UWEL 5GISL 3Q3GB 1U3HB 4IDJH 3VFMA 1AIFA 4L5FL 4ZD3L 1ZEAL 4U1KA 2IPUK 5AUMA 1IKFH 2NNAA 4R4FH 5KVGH 4LCUB 3VXUA 3FO2A 3B2VH 3B3IB 1MAKA 5FHAL 1FC2D 1XF5A 5F6HJ 1DQLL 3NACH 5FKPA 1JPFA 4F8TA 1V7NL 4G8IB 3OKNA 3SKOA 3BUYA 5KTEL 3GSQA 2VISB 2A6KB 5IFHH 2J88L 2VQUA 4PJHE 2VABB 3MV8D 1WFOA 4PLOB 5SWZD 5BV7H 2VZSA 4Q9RH 1J8HA 3MROA 2H8PB 2YPLE 3SE4C 4XHJC 4FXKB 2BVYA 2V9RA 5B3JE 5T5NF 1JFQH 2HLAA 4L4TA 1MIEL 1ND0B 2R4RL 3VXNB 3RWCB 1CXKA 1NUNB 3VRIA 2DLHA 3FHAA 3DX7B 5F9AC 2ENYA 4M7KL 3KPMB 1X5GA 3Q1SH 2YC1B 1LD9B 2YK1L 3RWHA 4HX1B 1S7VB 3B5TA 2YUZA 4PR5B 3DMMD 5CMAB 4P5MB 3AMLA 5EFIA 3O9WB 4JQIH 4MD0B 2IAND 1M7IA 3PGDB 3L5IA 4PGBB 5D6CB 3HNVL 1WAAE 4RISL 1CE6B 1XIWC 2YUWA 2DWEB 1AC0A 1A6WL 2CKNA 3V0AC 4QHKI 1KBGL 3FOMA 4NHUA 3RJQB 3STBA 1VGKA 4U3HA 4JRXA 4HKBA 3QXVA 4KI5F 3LS4L 4K3JL 3IVKA 1CFBA 3BH9A 3BHBA 2XWJA 2FX8L 3VRJA 4JO2H 1DUYB 1G0YR 3CFJA 4NC1C 3KPRE 4M8QB 1A02N 3V4PL 1N5YL 4HHAA 1KELL 1KENH 4AT6B 1S8DB 3TBVA 4Y5YA 2XI9A 1XCQA 1T7WA 1B6DA 3WO3B 1AHWC 1KN2H 1YEEL 4OUOA 3DI2B 5GGTH 1QLEH 1T20A 3ZE1E 3EOYG 3ARXA 2VB5A 4N0YH 4YNYA 4PRBA 4ETQB 4KUCD 4HQQH 4YIQA 5J06A 25C8H 2YD5A 4HPYL 1Q72H 3GFUA 1E27B 2H2PC 4KMTH 1DQDL 2KKQA 5FA4B 3MA9L 4WW2A 5T1KD 1UCBL 5I8EA 5ITFB 3V5DA 4XAKD 5IW6B 1QFWI 4P5KA 4Y5VC 1ETZB 4ZS7H 1HIML 3GEWB 3VGDA 3UTPD 3C2AH 2C1OA 3MJ9L 1NBYA 5F8QC 2VLRA 1IJ9A 1VADA 5F71A 1ZT7B 4TSBH 1EPFA 2A0LD 4DTGH 1UM4L 1KFAL 3I2CH 2OJZH 4UI2A 4M4PA 4NC1E 2HTKC 4PJXF 1IQDB 1YYML 2NW3B 4GXUN 4MCYA 4P2RD 4XP5H 4X7TB 1EEQA 4ZO9A 1OGAD 4XTRD 5IVZB 4MDIB 2KBGA 1AE6H 5FK9B 1X5YA 4IRSA 3FB5A 4N0UE 2ZOKA 5IKCA 2FJFB 3HTLX 3HI5L 3QUZA 4PS4L 1XH3A 4S1QL 3ARWA 4R2GD 4LCYA 3O4LE 2EH7L 2Z4QA 3L3HA 5IBUG 4HXBH 5ESQA 1MRDH 3G9VA 3DHJA 3NCJL 1LVEA 3QIBB 4JHWH 4UB0H 5FKPB 3L3KB 3RVXD 1AGBA 2CK0L 1E4XH 4LEOB 5T3XD 4PRHE 2NNAB 2HRPL 2GY7B 1A2YB 3DO7A 2IQAB 4LVOC 3GK8H 4J3UA 4PJFA 3TO4A 4NQEE 4YEFA 5I2IA 3MUZ1 2EYTB 4G6KH 4G8IA 3ES6B 1RUPL 1J8HB 3TT3H 5IMLA 4LAQL 3OV6A 5D72L 4QXUL 4WU7A 5GS0H 3PP4L 3R8QA 3KR3H 2J6EL 2CUHA 4CVZB 3VXNA 4DVBB 4FZ8L 2MOVA 3MRRB 4Z7UB 5A2JH 2QJDA 5I66B 2H26A 1MFBH 2ZJSL 3RTQC 3EYVA 2NY3B 1B6UA 3E6HB 4R8WH 1DBJL 1MJ7L 1WTGT 4FFZH 1P9MC 3QIUB 3T08A 1GGIL 2P8LB 1LMKA 5CJ8A 4OZHA 2AK4E 4TOYL 1NC2B 4ELMB 4AIZA 2ZUTA 4ERSL 5D1QC 2CIKA 3WXVH 2VDLL 1RFDH 4EN3C 1JFQL 4GXVH 5E2WH 2CKBA 2EDDA 5HYQB 3WEXB 5H94B 3VGFA 4P5MA 4Q6IB 1OAUL 3BHBB 4XCFH 5FOBA 1E4KC 4BK4A 4P3WA 1MLCB 2Q76B 3RY6C 4AMKH 2B1HL 4L9LC 1I1FB 3AM8C 4FG6C 2BSTB 2F5AH 3GHBL 2XWJB 2LAAA 3QJHA 4NBZB 5B21A 2ERJB 4ELKB 3CXDL 4KDVA 1Q0YH 4LHUG 2VDOH 4Y5YB 4MLIA 2DQCL 4JRYB 5C0IA 1KIRB 3R4DA 4OJFH 4M00A 5DJXA 4M02A 1S78C 2HJLB 4WY7H 3QUKB 4YDLC 2DI8A 3VG9B 2HRLA 2XFXA 2VTFA 1QRND 1XGRB 3EYUH 4X6BB 3O8XB 5J89A 2R2CA 4P9HH 1BD2E 2DQHL 4MAYA 4CW1A 5LXGH 2W91A 1J7VR 1QZ1A 1EFXB 5DEGB 3PDDA 3U9PL 1XT5A 4WI6A 2LU7A 3S7GA 3P4MB 4H20H 2F74A 5IESH 4OAWB 4KY1H 4PJDB 5I8KL 3WIIL 4X9FA 4Y89A 3MLSL 3PG2A 3IDIB 3ARDD 3T1FA 4LLQB 4G6ML 4XAWL 1KIQA 3IAQA 5FFLA 1PG7W 4KHXL 5DD1L 5KVMC 4KV5E 3ME0A 1QQDA 2EE2A 4UV4H 1MAMH 1A6WH 1I9IH 3TIDB 1WWAX 3NN8A 3MC0A 1ZHNA 5HYJB 4O5LH 4F7EA 2P4AB 4I4WA 5T1MA 2OR9H 5KVEL 4IIQC 1XGUA 3TZVD 1PQZA 2OP4H 4J3XA 4Z7QF 2RGSA 1MCHA 5D9SB 5FUZL 1SJHA 1UZ8A 1CF8H 3DURB 3VA2C 1HQ4A 3H9HA 2R1WA 4E0RB 3LQAL 4RMVA 4ZS6D 3PWPD 4HGMA 2G5BB 3OR6B 4XNZC 2MMXA 3DSFL 4MX7A 1Q0XL 4X8JA 1MIEH 4UDUA 3DO3A 5ISZE 5E1HB 3DXAD 5C6TH 1ORSB 3K74B 1QSFB 1BQSA 1U3HA 4P9HC 5EIIB 2DJUA 3N85L 5LBSL 5ALBH 5MI0B 1YN7A 3HC4H 3VWJD 5IFAL 1F4XL 5B38A 2CRIA 3MRMB 2FL5B 5KSAA 2FIKA 3HS0A 5CZXC 5DFWH 4YHZL 3C87A 4ZAKA 2PYEE 3H9SD 5EOTA 4RGNC 3QHZL 4XP6L 3RA7H 4HUXB 5F96H 4LL9A 5ADPL 2GJ6B 3H42H 2VSCA 4YZFE 3BYYA 5HGHB 1K2DB 1Q8MA 1UA6H 4ZNEA 4K3JH 3HUJB 4APQB 4XNYL 3RL1B 2C1PB 1UGNA 2HJFA 3LZFL 3KAAA 3KXFE 4HJJH 3CSPA 1JZ4A 2D9CA 4U1SA 5AZEH 2R0KL 3DYOA 8FABB 4NFDA 4QO1A 3TP4A 5I1DB 1X5AA 3CZJA 1KCSL 4LNRB 2NY7H 2P8MA 3R06A 3BKCL 3P0GB 3BVNB 5ACZA 4JREC 5IHZB 4NO5B 4YX2L 3B4NA 1C12B 4Y2DD 2DI9A 1EEYA 2Z31D 4QHUA 3EYOB 3KPLA 3MGTA 5C0DA 2VLJE 3BP4B 4X80H 1M7IB 1ODAA 2GT9A 5FV1L 5IF0A 5GS0D 1JGVL 1IM3A 1ORQB 2YPVH 1XR8A 5HDLA 1AI1L 1XGRA 4X6BA 2H6PA 4C56B 1JF5A 2NY4C 2VOTA 2IFFL 5D2NE 5GS0C 2HG5B 5DJZB 2F19L 3VXRE 2FSEB 2KDGA 5C0JA 5DJXB 4ONGH 5CLTA 5CSZB 3Q2CA 4D9LH 4KK8D 1DN2A 1J8HE 3AB0B 2F8VA 3BN9C 1MJ7H 4FP8H 2W60B 4G8GD 4HUNB 4PB9H 4D0BB 2RIKA 4H1LB 4HWEH 4HS3B 4R8WL 5B3JF 3DXAE 1JHTB 1WCQA 2IPKA 5IW1A 4M62H 3MA7B 4PJEE 5D7JC 2BY0A 1JNLL 2NLJB 2OK0L 3E1F1 4RMSA 2FBJH 4WHTA 4KTEL 3WKML 1SEQH 2CGRL 3MOAL 5DMJB 3R0MA 4MHHG 3ECBB 4BFGA 3H9SE 3HAEB 1S7WB 1AR1C 5D7JD 2JJVA 2Q20A 2G9HA 3RY6A 4OCWL 4XP4H 1HHGA 5T3XE 1LEIB 3CFKB 3V52L 4F3FB 5JHDD 1TJGH 1IT9H 1F2QA 1CG9A 1LGVA 3BW9B 4LSPH 1TVHA 5FYKH 1NCBH 4JRYD 4Z9KB 3VFPA 2H9GA 3OR6A 1KENL 4U1HA 4G6AC 4QTHB 4YGAB 5EU6D 5JNYA 4YHOL 1IC7L 5DYOA 4WV1C 4X8JB 5C09A 1I9EA 3T2OA 1MFAL 5T1DH 4JDTH 1X5ZA 2ZG2A 3KPNA 3QRFM 3ZKQD 4HPOL 3MV7A 1I1YB 3G5ZA 5IB5B 3TIEB 5EUOF 3NA9L 3HS0B 4TULL 3PJSB 4WHDA 4KAQL 3VFNB 1GOHA 2R4SH 2HFEA 1BD2B 1WFNA 5C09E 3AU1A 5DRWB 1WJ3A 3CFEB 1X6NA 1KB5A 5DHYB 4WW1A 3DO7B 1R0AL 1ZGLP 3K2UL 4KJWC 1IAOA 1KCLA 4PJAA 4XMKL 1S7QB 1U8QB 4H5SB 3VFTA 1N59A 1X5XA 4KI5D 1BJ1J 3WUZA 1YPZF 4U6VL 3RWDA 3WJLC 4XNXH 1OTSC 1TZGH 4X7SL 2ICWI 1FL5A 1QSEE 5K93A 2AXJA 1I8MA 2WBJD 2BP3A 2GUOA 4M6NH 3IDJA 1EAPA 3I84A 5CIPA 4N9OB 5DDHB 4MA8H 1FYTB 1J0KA 1KF9B 2IADB 4WEBH 1MHHB 3TPUB 4K2UL 3OKMB 5FEBA 3OAZH 4ONFH 2P8MB 2OP4L 4NKDB 2L4OA 4OFVA 4LRIA 3ESUF 5GXBB 1EO8L 3MX0A 4HV8A 4K9EC 4GBXD 3L3OA 2ZSVB 4YUEL 2XZAL 4QHMA 3UYRL 2GT9B 4WO4C 4KVNH 5IF0B 4P99A 1UWGL 3REVB 4LRIC 3A6CL 4NQVB 5DJ8A 4PJ5A 4GQ9H 4OLWH 1KJ3H 3IDGA 4PLKD 5C8JA 5C0DB 2X2YA 5D7LD 1NMAH 2YPLA 1Z2KA 3HRZB 4HIJB 3B6SA 4JN2B 4LFHG 2PXYD 2VWEE 1KCUH 2O5XH 3EOBA 5JQ6H 4JM2B 2ZCLL 2HYMA 1LO0L 1P6AB 2APWA 1UH4A 2APXA 5ERWB 4NO3A 2OI9C 1RAMA 3FRUA 5ID1A 1J12A 3VFOB 2QKIB 4Z7NF 4H25B 3ILPA 3ZDZF 4ALAL 2R1YA 3KNBB 1IM9D 4HJ0D 1KV3A 4M7KH 4WFEE 2A6DB 5EU4A 2WBWB 1N5AA 5IOPA 1F5WA 2VDQL 3QEHA 4PY8I 5FIEA 3UJJH 3MBXL 2WBJB 2GSIA 3VFUB 4U6VH 5L2KA 2VXVH 3OJVC 1RULH 3HAEA 4M1DL 5GRJL 1TZHB 3NFPB 1QFWL 2JJSC 3QO1B 5DUPH 5BCAA 5FUCC 2LTQC 4WHTB 1A7QH 1LK3H 2YKLL 4URTB 1R5WB 3K4DA 4UILH 1FN4B 4ZPVA 5AG9A 4I9WE 3EFDH 3CDYA 3FCTA 4Y19B 1ZA6B 1S9KC 1I7ZB 4NKQB 3VCLB 4HIHB 3G08A 2F5BH 2WWMD 4GBXA 3QHTC 4XP9L 4HJGA 3VFVA 1W8NA 1BGXL 3BWUC 5EWIH 1IEHA 1Z9LA 1UWEH 1A3RL 2PYEA 5ECJE 5A40E 2XACC 5LGJA 4JY5L 5D7IF 2K9UA 3D3VE 1SYSB 2AXFA 1QBLH 4IDJL 4J1UA 4ZOCA 1B4RA 4PJ7F 5BVPL 5HYJA 4F7EB 2H2SC 4PR5A 4DKEL 4B7IA 2BNUB 4Z0BL 5SWZE 4PJGB 3O8XC 5D9SA 1N6UA 2EEDA 2FCBA 4N1EA 1SBSL 3NIFF 3W81A 4NP4L 1V5JA 3P3YA 4I18C 1HH6B 4IOIB 1T21A 3KYAA 4PJXE 4MAUH 3E3QE 1XIWB 3O45A 4PJAB 2R0LH 4YWGL 3CFCL 3BRFA 1MHEB 3MRNA 3ORJA 4OTXH 2UZIH 5DEFB 1SJVA 5JOFB 2I60H 3BUTA 2EDYA 3U7YH 1RZIA 4HT1L 3ZT6A 4LASH 4PJ7E 5FGCB 4D9RE 3ZKMD 1F45A 1EJ6A 4X0KB 1PYWA 4NN5C 5TH2A 1EAPB 4PJEB 4KKBC 5LGHL 1WUNT 2R39A 3KPTA 4LOUC 4KDTA 3FHQA 2A77H 3GMPB 3I6KA 4OD1L 1KLGA 4XVJL 3VGEA 1TQBB 5I17B 1JYWA 4KZEH 3ZE2F 1ITCA 2BOCB 3UTZA 5C09D 2HT3D 2NZIA 2PW2A 1J1PH 4ZNEE 1OAZH 4XPFH 2VLRD 5T33H 1UEYA 5KS9A 2K3TA 1CDYA 4YHMH 2AS5M 2X41A 2Q8AL 1RHHB 2X7LB 1WLHA 3EOBB 8FABA 1K4CB 5AYUL 1IEBA 2J3SA 4NUGH 2CKBH 3QUZD 3OXRA 2MSPA 4JLRA 4UIMB 2VXSL 3BXNA 1FO0L 4O2EB 5K9QI 4M62L 5EUOA 3H0TA 3ZE2E 4FQLL 3FZUD 4IOFD 5MEPB 3HLAB 1OL0A 4JN1L 2UVFA 2DJ4A 3F65A 2CLZB 4G7YH 4GRLC 2UWEF 3AS2A 3QAZB 4RGNB 3QPQC 1GPOH 5HDBF 3FRUB 4GKSA 4ODSL 3O3DB 4NC2B 1S9WA 4WRLA 1NBVL 3NIGE 3REWB 5IG7A 5JUEL 1H3XA 4PJAF 5F88A 5I1KL 3GMLA 2C4FT 3T2PA 4JRXD 4OLUH 2I26N 3ELAT 5K9OA 5JR1L 2BVOB 4U2ZA 5KAQG 5EBMB 4WENB 1I7UB 3TN0B 4MNGA 4Y19A 2DS4A 2X89A 1F4AA 4FFVD 4Y16C 3S6CA 5FYJL 5DGQA 1YNLH 4PRDA 1XR9B 4UT9L 2YOCA 4WU7B 5FO7A 4KROB 2GJJA 1MRCL 4P46B 4NDMA 2LU3A 2NLJA 1G1CA 3OAUL 2NY6D 4QHLA 4HUVB 1JMZA 2VQTA 4B0MM 5DVKA 4UT6H 3B9KA 5HVFB 1F11B 5DJ6B 4MJ2A 4OFKA 4R90L 4K7PY 4OD3L 2X1XR 1NGYB 1ZA3A 2BNUA 2P5EE 2G9HB 4PREB 1QTYT 1NUGA 1HXMB 3K2UH 2RFXB 3QWOB 4OCNC 3UPRA 3BYTA 5GGRA 4D9LL 3QXDA 3DVFA 1KXVC 1LO5B 3FTGB 4QTHA 4K3HA 3RVUD 1U95B 3SDYH 4X7EC 1V8HA 1R24A 4HH9B 4Q6IC 5ISZB 4LNVA 3CXHK 3QDGE 2D7PA 4MA8L 4IEFB 4PLKC 3MR9A 3KHOA 1VEMA 1V7ML 1MCBA 5D7JA 4R3SB 4TTGA 1UXSB 2ICWA 4NCC1 5M95B 2EC9U 4LKCA 1RZKL 3AXLA 5HY9B 1VKXA 1B0GB 2A38A 3IDMB 4ZFFB 5D5MA 4PBVC 1NUFA 3DV6B 2QSTA 2A73A 1IQWL 1VACA 3QWRD 3MLTA 4M7JH 1CFTA 1KIPB 2J2ZA 4Y5YC 2VAJA 1ZVSB 1JPST 3FOMB 4NHUB 1UVQA 2DRUA 2R2BB 1WC7B 3ISWA 1VFUA 4KXZI 4G6AD 5MHSD 1KCUL 3RGVC 3VXMB 2XKNB 2QQLL 5DTFB 3UC0H 1JPSH 3NFNA 2F74B 3PNWB 1S8DA 3EOTH 1FH5H 4YR6B 3BT2L 4I77L 2Q6WA 5DMYA 4AEHH 2QQNH 4LP4A 4N0FB 5KS9B 5BZWA 5CIPB 1RUPH 4L29B 3TM6A 1GC1L 2OQJA 4F33B 5E2VH 5K59F 3MLPA 4GQPH 1AO7E 5DXWA 4NP4H 3O2DA 1SYVB 3MJGX 4LLAA 5C0BB 2XA8H 1IE5A 4KJWD 2VAAA 3D85A 2EDKA 3I85A 3TJEL 3AFLA 4JZJC 2BNRA 4LDOB 1R3JA 1RZFH 5FA3B 4D9RD 4JZOB 5MEQA 1PDKA 3N1PC 3RWFA 3D1MC 3FN0H 3RHWF 3LEYH 4V1DD 1IGIL 1W2KT 4P5TC 3NMEA 4BZYA 4NNYB 4OCXH 4OGZA 4YC2C 1D5MB 3B9AA 4MNGB 3VJ6A 4EDXB 1UH2A 5GSRB 5FO8B 1U8KB 3GMLB 2E6JA 4ODSH 2X42A 3MLVL 4JANB 2GSGA 5C92A 3F12A 4LPWA 4MVBD 4PJXA 4MVBC 2JF1A 5IKCB 3TN0A 1FVCB 2AP2A 5C71A 5IHUH 4LHUA 3WFBH 2A1WH 3FQNB 5ITBH 4A6YL 5FKAB 4HUVA 1T83A 2JJTC 3SGKC 2ZWLT 3W9EA 4ZUVA 5B4MC 5L2KB 1AJ7H 2HT3C 4HUWB 4OI7A 2G75B 3KR3L 4X7DC 1GGTA 3TA3D 1CR9L 4NKOA 1FGNL 1K2DA 5KOMC 1GOFA 4EI5D 4LAJH 3GNMH 2NTFA 4YPJA 5A1AA 1H5BB 2RFXA 3QWOA 32C2A 3ULUH 3I02A 2DTSA 1I3GH 1DL7L 3TO4B 3UTSD 4I48A 3S35H 4JM2C 5FUCE 1E6JL 2WW8A 5DK2A 4LCIH 4NSKB 4HGWB 4OLZL 3UZQA 1CK0L 5EA0H 4NQXB 2IGFH 5FCUH 4MA3B 2WIMA 1Y6NR 1MWAA 4F7MB 3OKKB 3ARFB 4Z77B 3TC9A 5C6TL 1QBML 1F6LL 4KJQC 3KPRA 5DRZA 4W4OC 2A73B 1VACB 4XCNA 2J4WL 1QEWB 3HE6D 4NQCB 3GJFA 1DVFA 5DD6A 3AXLB 1MCOL 1T0MA 1NCTA 2R2HA 3O6KL 2Z8WC 3RWIB 4QGTA 3ARQA 2BHYA 4JFFB 3RIFF 4UILL 4GW1A 3RAJL 1CDHA 4H26A 4LSQH 5KG9A 1KLFA 4UQ2B 5IB4A 1X5FA 2YZ1A 1MHEA 2OXHA 2NY5H 4XCYA 1H0DA 3P11H 3GDBA 3LDBC 4WWKC 2GFBB 4NZTL 3B9KC 4JPVL 3VRLE 4X6CE 3AB0C 4L29A 1S7XB 1F3JB 2BJMH 1P5VA 3CMGA 4NGHL 1CDGA 1NSNL 3C09B 3RGHA 4CMMA 1TENA 4K8RD 3MZTA 2VLJD 3U1SL 1MCCA 4QY8B 4RGND 2UZYB 5D2LA 2XWTA 3O8XA 1E4KA 4ZFOL 1U8HA 2CH8A 5JLZB 3H3KA 4XBPA 4OFYA 3QNZB 2BNQA 1B88A 3C60B 5E94B 5T5FH 3L1OH 1HWHB 2ID5A 3PABB 1YPZE 3WBDA 2Y36H 3SPVB 1LHZA 1EZVX 1TVHB 1T20B 4ZD3H 4OIIL 3P4OA 3BZEA 1QNZL 2HWZL 3O0RL 4L3EA 3QIBD 3UTSE 1HILB 4HEPG 5CP7A 3I6GA 4PGEB 5IT2H 3VXPB 1I85A 5EO1B 4B53A 3ROLB 4JFDB 2JB5L 3IFLL 4FQCH 5DQJB 1QA9B 3T0ED 2VERN 5CAYB 4HXBL 2MCPH 3QDJA 2XTJC 3TT1L 3KXFA 5KN5B 3KLSA 1AD9A 1VADB 1NANI 3FAWA 3SE3C 4M3JA 3QFJB 3HUJF 3P73B 4HWUA 2NYYD 4TSCL 3HB3C 4MQXC 2DN7A 1N5YH 4MGXA 1GZPA 3WFDL 2UY6A 2Y5TA 4MCZA 3WIHL 4R7NA 1WK0A 3QULB 1AFVL 3Q6GH 2H3NA 4OGXH 3RL2A 3H9HB 1CWVA 1IC5L 2HFFB 5HSFA 2R1WB 5KZCD 4DAGH 3V4VL 4GQ9L 4OLWL 3MO1B 4Y2DB 4BQ8A 2KUTA 1AXIB 2XKUA 1IGTA 2OL3A 5KSBB 2CLVB 2FRGP 3QUZB 4LCCB 3QQNA 3QG7L 1NCDL 3X13B 3AS1A 2O5ZH 2W0FA 5FYKD 3ULVD 5IV2B 5EO9B 2WUBL 3CPLB 3WUWA 5F7DB 2MKWA 5TDOA 4QHNB 5BRZA 5KSAB 3SGDH 5E70A 3RTQD 3TV3L 4HPOH 3H7BB 4GRWE 4L8BA 1W0VB 1F11A 4OCMC 4BKLB 3CFDA 3QQ9C 3AREB 3BRDA 3UJJL 2EYTA 4HV8B 1EVTC 4WUUD 1A7OL 2EDJA 3NBNA 2R2HB 2WAHA 4NWTL 1CK0H 2DLFL 3NIGF 5CMAA 5I1IL 4PJHB 1K3ZA 3G6AA 3NIDE 4NRXA 4PJAE 4XCNB 1MJUL 2NCMA 3DVIA 3RQ3A 3D69B 3O11A 1ZLWK 3JSSA 4LLVB 3T65A 1AHWB 3IAPA 3MUHL 4NQDE 2DWEA 2HT4D 3U30B 1T0MB 1FC1A 5CUSH 3T0VA 1CLOH 1A4KB 2B1AH 3QPXL 1TZGL 3P9MA 4GRWF 1KUMA 4JJ5B 1RU9L 3WNOA 1G7JA 4M48L 3GI9L 4OT1H 4PY7B 4UQ2A 1AO7A 2WWMC 4OIAA 5BXFA 5BJTA 3SCMB 3IJHA 3MOBH 3F58L 1GHFL 4OJFL 5HY9A 3QUML 4JGMA 4JM4H 4HMEA 4X99A 4K23L 4JHZA 5D5MB 2X4RB 2F58L 3WHE0 1C16A 5FOBB 5F7LB 1A7RL 3CH8A 4AEFA 1ZVSA 4JFXB 1ADQL 4HK3J 4R4ND 1MI5B 1TZIB 4ENEC 1NAML 4XGZA 4KAQH 5JO5A 4OZFH 5C7XH 3ULUC 2EDRA 4KKCD 2HTKD 5TPWL 2VE6B 1LE9A 4U6YA 3WL9A 2Y72A 1K3IA 2HT2D 3C08H 1AR1D 1BJMA 1IC1A 4U1JB 1ZGLA 4TVPL 2G5RA 4XZUB 3P4OB 3BZEB 4U49A 4YDIH 1J10A 3ULVF 2E27H 1BHGA 4OB5H 2IGFL 2IH3B 2PO6B 4XNQB 4L3EE 5KW9L 1I9JL 5K9KA 5EBWA 3FQRA 1U0QA 5E7BA 3QISA 1P7QB 5JW3H 1MCOH 5F1IB 4K3DH 4JCLA 2FIRT 4DN3H 3K2MC 1XF1A 2OTPA 3LKSB 2A77L 5EZOH 3CVIL 4BH8A 1P4BL 3IRZA 3UXFA 1T22B 3D9AH 3FT2A 2HWZH 4G9DB 4OZIF 3UDWC 1X5KA 1KXTB 5ACMA 1BFVH 5AWNH 3U0WL 1G9ML 1E28A 1JYNA 3RWFB 5IQ7H 5LKNA 5FYLH 1YNTA 4ZS6C 1U8MA 3D2UA 1D7FA 4LVHC 2CSPA 4Y16A 1H9VA 3NH7L 3PE9A 3B83A 1MAJA 4HDIA 4EDXA 2DQTH 3RVWD 2GJ6D 1B2WL 4WO4A 4KHXH 4LLWB 1HN1A 1YEJH 4NWUH 2A6JB 3SOBH 1WEJH 2Z31C 5L7XL 2P5EA 5JOFA 1KB5H 4DGVH 4JY4B 3JV4A 2X6MA 4CL7A 2Z91A 4MHHI 2EC9T 3WUWB 2DAVA 4NQEA 4N8PA 4JHAL 5H37H 4MNQE 5D1ZB 3DUSB 3ARFD 5FM8A 3PGCA 3O4LB 4NN5B 3QUXD 4JY5H 3BWAB 3MV11 3QEQB 2DF3A 1ZHLB 3MCLH 5GRUL 1CBVH 4OB5L 2QHRL 3NFSH 1WBXA 2J6EA 5BRZB 3OL2A 1KBGH 1MQKL 3UYOD 3DBXA 4XCEB 4YHNA 4LQ1A 3PL6A 3G6AB 2X4TA 4L9LB 1T03L 3OKYA 1S5HA 3BZ4B 5HI5D 3INUH 1TCRB 4X6DB 4HF5L 2OR9L 4BFIA 5KVEH 4QXGH 3OXRB 3WFHA 3WEXA 2CKBL 4QCIB 1OSZB 1OD7A 4Q97A 3H0TB 3EOTL 2HFGL 2BERA 4K94C 3MRBA 1G7MA 1LDPL 1UYWL 3MREB 5EZIH 2Q7YB 3OKOA 5DMGD 1D6EA 4JFHE 2UY7A 2V9TA 4CVXA 4ELME 4I0PB 1OSPL 4WUUE 4YH6A 1OARH 1EERB 4EIZC 1KB9J 5EIQA 4TUJA 1IM9B 2HH0H 3WUWG 2D3VA 1OW0C 4KK5D 4U6HA 4GOSA 4ZUUA 3VXTA 4NKIL 3MNZA 4HIJA 4JN2A 4P2QA 5IB4B 3QUXB 1DQLH 3QFDB 1XGYL 3D25B 1IMHC 5C0AB 5BS0E 4NO2A 1KCSH 4XZUA 1G7LA 4DZ8B 5T3XH 2R0ZH 2ADFL 4E5XA 3RVVD 2IH3A 1JGUH 3GMQB 2PO6A 3RI5K 2VR4A 1YC8A 1NC4B 3QPQD 3FQRB 3QI9B 3LEXA 4RBPK 5H2BA 3ILPB 5JHDB 1P4IL 1OP3K 2XY1A 2R15A 5DUBB 5SV4A 4L8SC 4JG0L 3MV7D 3QWRA 3OPZL 4ZSOE 3BPCB 2HN7B 5GGSA 3UBXG 1I8IA 1KTDA 3DNKA 2PN5A 4NWTH 2W0LA 1QQDB 1ACYL 1FNEB 4PREA 1B90A 3R0NA 3CK0L 1ERNA 3P4NA 3TIDA 2F54A 4BM7A 1YPZA 3EO1B 2YD3A 4HS3A 4F80A 3S3SA 5EU3B 4QYOB 3JWNC 3RVXC 4RFNC 4WFFD 2Z9TA 1OB1A 3FB6A 4R4BB 1I8LA 2BOBA 1BBJA 4NZUH 5I16B 3IRPX 4X4XA 3DURA 2VLJA 2GAZB 4WWKB 5FF6A 2HVKB 3LIZL 3P77A 4M1CD 5I30H 5BZDB 4XI5C 2PYFA 1H3TA 2AEPH 1CFSA 1K6QH 3I3DA 5E5MB 2VUYA 1M7DB 2EXWD 4C83A 4ZSOA 3SDXE 5HDOA 2FR4A 2QLVB 1W72L 5GGVH 1ZS8B 1FGVL 3JUZA 5JORA 2H9GB 1MI5E 4Q2ZB 3QI9D 3O3AB 1A1MA 4JPIA 3ZKXB 2BVPB 5DYOB 3QULA 3LKPB 1C5BH 4GRMB 1JP5A 1T7XA 5BS0A 5EOQH 4PTUA 4OF7A 2VXUH 1B0RB 3ZKND 1U93B 3B5GA 3NFNB 1GH7A 5HI3D 2YMXL 3FQXA 1M4KA 1H3UA 2NY4D 3EKCA 5TJWK 4B41A 4Z78B 5EO9A 1FDLH 2JB5H 1PD6A 3IFLH 2APFA 3MTRA 4PJ8A 1IILE 3EYFB 5TH2B 5K33A 5HHQB 1OSZA 2X4TB 4ODVH 5JZ7C 3MYZA 1A0QL 4UDTB 3MGOB 1TCRA 2RHEA 4X6DA 3SE4A 4FQHA 4OKDA 3TH3T 3PHSA 2VLLB 3HR5B 5IB1B 3LHPH 2X4UA 1MWAH 1HZHL 3ZKSD 1G7MB 4WFGE 5ICXB 4EUPH 2DKUA 4LVNB 1I8MB 5MEQB 3EDFA 5HYSG 4MAYD 1FNAA 5TE4H 4Y0GA 4B5EA 4LIQE 2EKSB 4RIRB 2R0WH 4ZOAA 4NRYA 2EKJA 5JW4R 4X6CA 2DTMH 1AGEA 5GSRA 3C2AL 4RX4D 1FFPA 5TE7L 2XZCL 3GMQA 3HNTH 3OG6B 3EJJX 5C2UB 3RZCA 5TGBA 2GSGB 1AKJA 3I9GH 3O3EB 1CBVL 4P2YA 3V7AG 4PJ7A 5FGBC 5T5NG 4HJ0C 1J0ZA 1JF6A 1KPUA 5DUBA 1AI1H 2V2WB 1Y18B 1HINL 3GMNA 5CHNA 4PJEF 2MQ3A 5DHXB 4E9LA 3ARRA 3F7QA 4JRWA 1NC4A 4BJLA 2RAMA 3ZE0E 1GC1C 4XH2B 1WWBX 2LVEA 5BRZE 1JHTA 4MDJA 4OIBA 3MODL 2XA8L 3X14B 2P5ED 3GSOB 1RJLB 5MP6H 5GRYA 4J3WA 4JEGB 3HZKB 6CGTA 3BPCA 4TVPD 2DQTL 4PUBH 4U1JA 1I7UA 1FNLA 2ESVB 4K3GA 1FORL 4LARL 5EU4B 4WFHE 5CEZE 1MUJB 1JMXA 2QADC 2AV1A 4W4OA 5E03A 2N4IA 1JZ3A 2Z92B 2WBJA 2GSIB 2ZKHH 3VFUA 3QDGD 3SY0B 4LCIL 4UTAH 1MWAB 1RK0B 1C08A 1CICD 3C5ZD 1PX4A 4L1DA 3GSUB 1S7RA 1CZ8H 3K7UA 4MXVF 3MV8B 1T22A 1IAKA 1ZLSL 1KTLA 5F96L 3H9SB 2VDKH 4EOWL 1QFWH 4EN3D 2VLKD 3V6ZB 3O3AA 4JPIB 2BSSB 1A6ZB 2IPTH 4FQQA 1CD9B 3G5XA 3QNYB 1Z3GH 3LRSB 1GVIA 5EOCH 3I9GL 1FSKB 4JM2F 2R56L 3LOWA 5HHXH 1AP2B 2JK5B 1CFNA 4OZGB 4TVPH 2L0DA 3OQ3B 3FN0L 3VFNA 5BS0B 3HI1B 5DD0H 4I5BB 5JW4M 2F9BT 3UBXA 4TSAH 1G84A 4KHTH 1EAJA 4N0CD 3FQXB 2GYSA 1F6AA 1TQCB 5J9PA 4F7CB 3MRIB 3GMMA 3MQIA 3U2SA 4OF5A 1FFRA 3DX6B 5GGVY 3SO5A 4V1DE 1PX3A 4S1DD 5DJCA 4JR9L 5D1ZA 1C5BL 4D3CL 1B0GA 4KPHL 4MD5B 4Y4FA 4Z7OF 1FL5B 4W4NA 1NDMA 4JFHD 4P3CL 1RU9H 3LQMA 4XXCA 1D9KA 2R9HD 5AZ2L 4Z6AT 1IAIH 5KSVA 3WO4B 1AGDB 4WI9A 3U83A 3QIBC 5DDHA 2Q86B 4L4TE 5HYFA 2QQQA 1A1NA 4KMQA 3F5WB 4QGYA 5DQ9A 1NGXA 4GRWH 3SKNB 3WCYA 1T0NA 1AIFB 4J3VA 4LVHB 2JCCA 3C60A 5ADPH 2R1XA 1OHQA 3OSKA 2O26U 5T1KA 5I1EL 3LQAC 2GQHA 4DFHA 1KCVH 2VN4A 1K9TA 4JO2L 4O9HL 2J12B 3H3BC 4JKPH 3GMRA 2YHGA 5FOJA 3JWDH 5GHWH 1X44A 4KZDL 1U8IA 4DKFL 2A6KA 3SDXB 1NMCB 4NRYB 1FGVH 3S36X 3RTQB 1JGEA 1FZJB 1TETL 1CLCA 2EZ0D 1SEQL 1BJ8A 2CGRH 1HHHA 3RWJA 4ZUTB 2B5IC 1HSBA 2ATPA 1Z9SA 4YE4L 2ZZUT 4GRLA 43CAB 3L5HA 2ZCHL 5CILL 1T6WA 4K71B 1R3JB 5AAMA 3OHXB 1E4JA 5GZNC 4R97C 4JLRB 2H3NB 5JW4Q 4DKDC 3PF2A 2VLMD 4JO4H 3BPLB 4ZDHA 4O5LL 4M6NL 4PJIB 5E6IC 5TDNB 3QFDA 4IMLA 2W9EL 2AJYL 2F8XC 1HEZB 1EHLL 4QRTA 4LSUH 3VXQA 4D94A 3BQUC 4X9BA 2CLZA 1TZHA 5SX4H 4F37F 1VFOA 2DMKA 1FVDB 4PJ9D 4CRPA 1CD1B 3B2UC 4EOWH 4XPHL 4CMHC 1S9WB 3C8DA 1KJ2L 3V6FA 4WFFE 5I1JH 4WI2A 2X9XA 4LHUB 2W1NA 3BH9B 1M71B 4RNRA 3Q5YA 4P9ML 1U91A 5E08H 3IGAB 4FQCL 2AK4A 3MRDA 3P9WB 3RVVC 1S7RB 3DX9A 2ZJSH 3MRQA 4WVRA 5L9DH 5L88H 5HHOD 1T66D 2HMIC 3T8XB 4M6MH 3L95B 5KSUA 4TYUA 2NTFB 2RCSL 5IMKB 3IETA 5IJVB 2DQEH 2O93L 5CINH 1AXSA 1ZT1A 1BP3B 1NGZA 3H9SA 4X6CF 4QRRE 2H32B 4WFHD 5CEZD 2A0LC 2BOBB 4I2XA 4PJFE 1GJIA 4DK6A 4DJMA 4DGYH 5HHMB 4X4XB 3ULVC 4WTWA 3V0VB 2XPGB 1Z9OA 5F1OB 3HG1E 5HHNA 4OBRA 5BZDA 1NCBL 4NYLA 4O2CB 4LQFL 3VI3E 4D9QE 4I18A 1J1OL 3MLZH 4U33A 1WV7T 3IJHB 5A16A 1DP0A 2I9TA 4K3DL 1QSED 1X4ZA 3LPWA 4HKZB 5FHBH 1MLBA 3OJMB 2ATKA 2B20A 4X0KA 5KSVB 5J1SC 1XGTB 4PJGE 1K5NA 1RZGB 3UO1L 3F7VA 3HC4L 3OG4B 3RWIA 3ARBC 2OSLA 4HSQA 1DDHB 4ERSH 5IMOB 3X11B 4O51B 5KG9B 2MNUA 2ZSWB 4JR9H 2OZ4H 5D7LB 5L8LB 1UXSA 3C08L 1JHLH 5D7SH 2FGWH 3AS0A 1ZKAA 1SHMA 3QIBA 4X6DE 3RVUC 5E2VL 3I75B 4OD3H 4XNQA 5FGCE 5D71L 1PZ5A 3S35X 4K3EL 3ALWA 1L9NA 4MMXC 4BSVA 1QR1A 3L5JA 4HJJL 4D0CB 2DD8L 3BDYL 5CP3A 4OT1L 1WC7A 3RWEB 2FZ3B 5EOCL 4QRPB 1YUHA 3NABH 4HZLA 2VZOA 1MPAL 3MV9D 1OAQH 4NOFA 5ETUB 4F37K 3UTOA 4Y1AD 1MCWW 1JTTA 2R0LL 2VXVL 2BVUA 1P4BH 1TNNA 4ZTOL 1ZLVH 3ULUE 1U3HD 1EXUB 3JBG7 1EO7A 3JWOC 2R23B 3EW3B 3OHXA 3WLWC 2FD6H 3ARTA 4Y16D 4O58H 1PG7L 2H26B 3SPVA 3K8KA 4GKSB 1MCSA 1XZ0A 4H1LH 4S1QH 3FO9A 1ZLVK 3LKQB 3V5HB 3WD5L 4RFOH 3MLUH 2YBRB 5LG1A 1OP5K 5IESL 5HTSA 4YDIL 5FDWA 3SGDI 3TBSA 2BVOA 5C0NC 1YQ2A 2O5XL 3JWDC 1KYOJ 1QUNA 4A6YH 5B8CC 4N8VG 2F53E 3VXRA 2Z31B 3TO4D 4JQXC 4ZYKA 3GK8L 3MROB 3VH8B 4RISH 4BQ6A 2QQLH 2HLFD 4GAJL 2IH1B 3PWUA 3QEGH 4L4TB 3BWAA 3GGWB 1N6QL 4HKXB 3MJ9H 5TF1H 1HKLL 4ENED 3QIWA 3VWJA 2JCCF 3FMGL 3GSOA 1WBXB 3KPMA 5KSAD 4C56D 4YAQB 1BF8A 3MRDB 3T1WA 4PJ5E 1FG9C 1RULL 4JM2D 4QRUB 5DT1H 2CLVA 4LLUB 3KWWB 3VDAA 4MWFA 3DARA 3KJ6H 5FYLD 4OZFA 4WDIA 3MRFA 1X5IA 4LFHD 2XOTA 1XF5B 5IM7B 3KJ4B 4HFUL 2HT4C 3CNKA 3U6RB 2G2RB 4WI8A 3OR7A 1GGBH 3LH2H 4XP1L 5F9WB 1MEXH 3RDTA 1A6TA 1UM5L 3HMXA 3GSQB 4ODXA 2Y6SD 32C2B 3MV01 2CQVA 2ZCHH 4KDWA 3HA0A 1MLBB 4ZS7L 3VWKD 3OGCA 3SHSA 4M48H 3U36B 3C6LD 1NDGA 5IMMA 5I18L 3STLB 3MUJA 4M7LT 3KLAA 5SWSD 4GS7B 4Q0XH 4HK3N 1WITA 3ZDXE 4Y4HC 1KIPA 3EJZC 2AJ3B 3DVNB 5CSBA 2W07A 3CU1A 2GTWB 1RIUH 1LO4H 1RSFA 1MCIA 1RZ8B 3EJYC 5EBLA 5H37G 3BD3A 3QFJD 5EFIB 5KVFH 4W70A 3I75A 5MERA 5DLML 2V6HA 4FABL 1QRNA 5D7KE 1MCPL 4PG2A 3RJDA 3QIUD 4JHWL 1NDMB 4PFEA 2NW3A 4EN3A 1HSAA 1IGCL 1P1ZA 4GKNA 5DT1L 2E6QA 1X4YA 3RZWA 2ZUXA 1FIGL 3TFKC 4AK1A 1T0PB 5GGSB 3C8KB 4O2FA 5JO5B 3QCTL 3SDCB 1ULVA 4LSQL 3T2QA 3VWKC 5F6IB 4J8RA 4U6YB 4XMPH 3VXRD 1JN6B 2FL5A 3VXME 4IRJC 1T4KB 4N9GB 5B4MD 2NXZC 4TNWF 1NLBL 3LN5B 1JE6A 3GIZL 1AD0A 3HZVA 3QUYB 4YQXH 4RDQG 1T2QH 4R9HA 4YIQB 1BBJB 4HMDA 5I16A 4FQ2H 4GAJH 4P3DA 4YHYC 3BKYH 1N4XH 1QFPA 4GLRH 3LD8B 5ANMA 3A67L 5F3HA 4NN6B 2XG5A 3EZJB 5BOPA 4C83B 4KMTL 3G5VB 3PWPA 3T09A 4OQ1A 3U0TA 4GXVL 2E3VA 3S4SA 5L6YL 1E6OH 5M7QA 2RR3A 4RFOL 2CK0H 3IXTA 4Z7OE 1ZHBB 5I8OL 2PCPB 3QIWB 3VWJB 4NO5A 2FEDC 2P7TA 3PWLB 1QFUL 4YAQA 3F8UB 5F1NA 1KJVB 1EEYB 4YFLF 1LK2A 1T1XB 5FECA 3HE7C 3GJFK 5HJ3B 2WWKT 3F6LA 2G75A 4QXUH 3KPLB 3OMZA 4UIKH 4L5FH 2P24B 2UWEA 5DMIH 4S2SA 4OLUL 4JFQB 4EUPG 5C07A 4WTZG 2WUCH 5I73C 3WE6A 1ORQA 5F9JB 1CD1A 4YDKL 1WZ1L 1Q0YL 2F53D 4M1GL 4OCRH 2DD8H 1OVZA 3BP7A 4FZEH 2DDQL 5I15H 1PEZA 4MCZB 4XVUD 2DMBA 3SO3C 5JW4N 1UFUA 1D5XA 2PUQT 1NGQH 1XIWD 1T03H 1N7MH 2J8UA 1NKRA 4YDVA 2AK4B 2APVA 3SKMB 2AEPL 3WDHA 3DX9B 4UB0L 2Z0BA 4GKOA 2VXSH 1QFWM 3NTCL 2V2TA 3O3BA 4BQ9A 2WBJC 3MSPA 3O6MH 2FD6L 4RMQA 4GXUM 5DO2D 5EUOE 2BFVH 1DBAH 3BP6A 4K71C 1BZ9B 4ZPTA 1SY6L 1PW3A 1A7NH 5HGAB 3UJTL 5IW1B 4XXDA 3ULVH 4PJBF 1MIMH 3BPLC 3LMJH 1S7UA 1FBIH 5E99L 3BIKA 3P30L 3U4BL 4KI5E 1OTUD 5IW3A 4XVSL 4M9PA 4NPYB 4RBPH 3CU7A 4Y5XC 1YECH 1EJOL 3LEVH 2P8LA 4LU5H 5EBLB 2ZG1A 4ZO6A 5T1LD 3O2WH 3O6LH 1HHGB 1DBML 2NY6B 4IMKC 4P23D 1MFDH 4JKLA 3KYOA 5GGQL 3G6JB 2HKFH 3QA3A 1N6QH 2CIIA 4GMSH 4GRLD 2ICEB 1YYLL 3LS4H 1FG2B 1VEOA 5D2NA 1RZGA 4F15B 4PTTB 1UB6B 4KKCC 5JOEA 4OGYH 1ZVYA 5L8JB 2X1PA 1T7VA 3L3GA 1DDHA 3MV7B 4IRZH 3SE3A 5MHSE 3P9MB 5DGRA 2JELH 1ZT4B 1DQJA 1NCWL 3VFRB 4FABH 4LPCA 1ZHNB 2GITA 1CGXA 2GIYA 1JPTL 4U1NA 4F8QA 1KYOK 4KVCL 4XC3H 1MREL 5HI4C 5I19H 2OBGA 3ROOA 3QEQD 5F1KC 2P48B 3L9RA 4JPKH 5CCKH 4YHZH 3B9EA 1JPGA 3T0BA 5TE7H 2IBBA 5H35A 4CADA 2Y1VA 1T2XA 1HXYB 1F4HA 2HJKB 4K8RH 3ZDZE 1ZANL 1Q9LA 3SDAD 5C7XL 4ZTPH 4NRZB 1KFAH 3I2CL 1VHPA 2V5RA 4O02L 5J7CC 4PJCF 3V8OA 1JGDB 4IM8A 3OZ9H 4FQQB 5E6ZA 1H8SA 3VXMD 1YPZB 4PRPA 3EDEA 2ZG3A 5KANI 4WUUA 1J8HD 3O41B 4EXPX 4L4VD 5F70A 4HS6B 3FFCD 4K7PX 5DVOA 1NCUA 1BPVA 1LP9A 3EO0B 5LWYH 1RVFH 4X9IA 3CC5B 1D5IL 4FN0A 3UBXB 3EJYD 2HVKA 1IGCH 5DVLA 4CGTA 2NY0B 4K94H 1T6VN 4OCXL 2BRRL 2YWYA 5FGRA 3PV6B 3QCUL 4G9DA 5KSAC 1VFBB 4OM0H 3KPPA 2ZNXA 3LRHA 3B6SB 1JTOA 3X13A 2BK8A 4EKXA 1IFHH 3QXAB 2R69L 5F9JA 3WE6B 2ENSA 1FQ9C 2OL3H 3IYLW 3OF6D 3CPLA 1IT9L 4UQ3B 2IF7A 1G6RA 1CVSC 4AIXA 2I9LB 3DXAA 3MGAA 1MJ8H 3CX5J 2J1KA 2IMNA 2Y23A 3IFPB 3CSBA 1ORSA 3LZFH 3JV4B 2V2TB 3VG0L 1H8OA 4QRRB 3GKWL 2J8HA 4Z5RA 3VRLF 3MRMA 5F72S 4LMQE 4POUB 2JTDA 3DHMA 2E7MA 4LAQH 5ACLA 1JJUA 1BX2B 1CLYL 5CWSA 4PJHA 3MRKB 4Q9QL 4NRXB 1OAYH 1CFVL 4HWNA 3OR7B 4M7ZB 1EFQA 4YFDB 2QSCL 4UDTA 1MJJA 2D0HA 4ODXB 2C1PA 1RY7B 2DLIA 4OZ4A 3PV7A 1LO3H 3MACL 2EDLA 2ORBL 1HI6B 4XP4L 3U36A 1HSBB 4XNXL 3EDJA 5B3NA 4PTTA 5GRVL 5SX4I 5I1LA 1X4XA 3QCUH 5KW9H 3T4AA 1K4DA 2I25N 4ZFZA 4MCYB 4TUKH 2MHAB 1U58B 3ARDB 4TRPH 2Q3ZA 1SYSA 2AXFB 2VH5H 5DFVD 4ZDHB 3SE8L 1RUML 1VDGA 1T1ZA 3HPJA 4RIRA 2FJGA 2HKFL 4MNGE 1F90L 4OV5A 1N4XL 4M5YH 5E6IB 2FJFA 4UOW0 2BMKA 4HH8A 3RAJH 4CVXB 2VZVA 3LV3A 4LSTH 2O5YH 3VFPB 1TTFA 3GMOB 2ERJC 2XNAB 2FECI 4KZDH 2ITDB 5C2BH 4IRJD 5GHWL 2BXYA 4XVTH 1CN4A 4PGDB 1INEL 4Q9CA 5L2KE 3EGSA 4OD2A 4P57B 3FO0H 1NGPL 3TYFA 4NRZA 1P7QA 2X1QA 3TNNB 4NCDA 3U1SH 5E8EB 4DGVL 2CDEB 4LBEB 1I8LC 2CJUL 4W6XB 5I6XC 4LP5A 1F4WL 2IPKB 3E0GA 5DJYB 5DEZA 4E41B 5J13C 2AGJH 2VXTL 5TFSH 1H3PH 3VXOB 3TBTB 5B8CA 3BMVA 2PW2B 1O5DT 1KOAA 1SEBB 4PJDF 5JHLL 5F3HB 5E6YA 5CFHA 1QNZH 3FZUC 4GMSL 4K3EH 2DQDH 1T66C 2HMID 3MOAH 5ALCL 2RQ8A 2QSQA 4NQDA 3S4SB 2ZUYA 1IBGL 1RJYA 1N6VA 2KQNA 5EN2B 1QPPA 1YDPA 1K5NB 3RY5A 4WI3A 4ZFOB 1UACL 4YE4H 5E9DE 4HK0A 3O4LA 4X4ZA 1I9JH 2OSLB 1JK8B 2Q3AA 3BX7C 3NCJH 4LOUD 4PJDE 4FTVB 2BSTA 1LNUB 5FYKU 1HK6A 1CL7H 1MQ8A 3BQUD 3MUGA 4QRRA 2C3HA 4XWOD 5ADOH 1AFVH 3Q6GL 1WAAA 2XWBA 2JJUA 3TYGH 3ZDYE 5CEZH 3WMSA 1NFIA 2ITCB 2XA3A 3MACH 5GS2H 3GBLA 1J1PL 1ACYH 4HMCA 4HD9A 5K9OB 3EHBD 1DE4B 4M93B 2UUDH 5IEHB 1ROWA 5EULV 1I1AD 3SQOH 4NHCH 4I0PC 2C4XA 3ARVA 5HYJE 4U0RC 4HZLB 5CWSB 4P4RA 5IB3B 4OQTH 4DVRL 3E8UL 1QG3A 3SEPA 1BVKA 3TWCL 1FNFA 1Z6JT 2V9QA 3GHEH 4P9HL 3GSNA 5JIIA 4L8CA 3KDMA 1S7UB 4LLQA 2WLZA 3ALXA 1CGTA 1INDL 4ZFGL 4ODUB 3U7YL 2AAVA 3EYSL 1QO3A 3TO4C 2DQEL 4KJYB 1IM9A 2GEEA 5HGDA 1A14L 1BM3H 3NFPA 4FQHB 2IMMA 4Z18A 3C6SA 1FRGL 5EPMA 3RZCD 1NAMB 2BDNH 2NZ9D 3GJEB 2NQCA 4TNWK 3L3OB 1IFHL 4X7CC 1OARL 4ZPVB 5I8CB 3NVQA 2V5MA 2VZTA 2BCKB 4ONOA 4OZIE 5E8PA 4XP1H 1I8KB 4QRRD 3W0WE 1FAKT 1TJHH 5C8JB 5GRJH 1RK1A 3S37X 5I75B 4Y8AA 5F3BA 1WIPA 3DGCR 2ED9A 3BQUA 2DKMA 4RZCA 3TYGL 5CEZL 3BZFB 3IDNB 3EO9H 3TYFB 1J11A 3D0LB 4F57H 3MR9B 4JFDD 5BV7L 1RFDL 4EBQH 1R3KB 4PGDA 4IMLB 4N0CC 5GZOD 1G6VK 1HEZA 4FHBD 4Y4KC 3VXQB 4JHBA 1JGLH 4U1MA 1T1YA 5ILTH 1C5DB 3E2HC 1HE7A 4PJGA 3V6BR 2FHCA 3DWTA 2F54B 3LQZB 5IROC 4TUOA 2W9DH 4QRSA 4KUZH 1GGCL 3FB6B 4R4BA 5HYIA 3O6FB 2HJKA 2P45B 4ZUSB 4GAYB 1VA9A 2VLJB 4C58B 3QT2A 4IOSD 3MRQB 5DD1H 1VCAA 3SJVA 1AC6A 1PSKL 3SDXF 3ZTNH 3N9GH 5KJRH 2DOCA 3JTTB 3VW3H 1DEEB 3AS3A 5IIEA 3SDCD 1I9RL 3G08B 3RNKA 1FRGH 2ADJA 4IJ3B 4N8VB 2NXYC 2HFTA 3C60C 1E4XI 2VSDA 3VXUE 3OKLA 4HWBA 1MRDL 3TCLB 5LQBL 2ZUWA 4MLSA 4G43B 1HINH 1CXLA 3MUGB 1KJ2B 4JDVB 2BVQA 4YGVB 5D7IB 4N90D 3ZHLA 5DRXA 2X09A 3D48R 4LMQI 3FO1B 5DK3A 4QF1A 4S1DC 4FTVA 3E8UH 2JKXA 4L3CA 43C9B 4Z7WF 1GRWA 3GHEL 1URLA 2HA1A 4JCMA 4RCAA 2AVGA 3SGEH 2PTTA 5D70H 1LEKA 2ATKB 2R2EA 5EU5A 2C4FU 1DEDA 4CNIA 5HHQA 5EUOB 1JWMA 4GJTB 2I9LA 5L0QC 2E5EA 4XHJD 1R3HA 3CVHA 1TXKA 1F6FB 2DQIL 3MGOA 5TQ2H 3B8YA 2C7UB 4KK6C 3MRIA 3AAZA 3PWNB 4U1KB 3O4OC 3TVMB 3I6LD 1RZ7L 3MNWB 5DR5H 3RX8A 3Q3GA 5DJ2A 1VPOH 5TPWH 3TJEH 4PV9B 4Y4KA 4JKMA 4HG4J 1PZ5B 5E4IA 1IL1B 3BUYB 4HIXL 4QWWD 5ANMB 3SKUD 2FEDD 5EBMA 3O9WC 4AM0B 2AK4D 4ODTL 4PYHA 2JCCB 2QADD 3BKCH 4XWGL 1U2CA 5ETUA 3C5JB 4NN6C 2PR4H 3VMNA 5E8DH 5I1KH 4M43L 4F9LC 5JUEH 3IB4A 1FNSH 3BT2H 4I77H 4YPGA 5F9OH 3N50A 3BKJH 1ZGLM 2PCPA 1A7BA 4LLYA 4LHUD 5D2LE 1A7PL 4ETYA 3HMXH 3TT3L 1S7SA 1Q94A 1I1CA 3MMEA 2FB4L 3D9AL 2OMBA 1NMBH 1LK2B 1KSRA 4F2MB 3LSOA 4LCWA 4WWID 4BQBA 1S9VB 3CFBA 2LU4A 5DVNA 3X14A 5E6IA 2V5SA 1FZJA 2UWEB 1HXMA 1ZVHA 4BZ1L 1LD9A 2X4QA 3HZKA 4KRPC 4MS8C 3DX8B 3C6LB 3BSZH 4J6RH 3OJDA 3ZYOA 2FO1A 2XTJE 4CKVX 1J5OH 1ITBB 4H0HB 3PWVA 4ZO7A 4MNQB 1BD2A 4K94L 4HHAB 3LQZA 1GXEA 1N0XH 2B4CL 4N0UA 1U6AL 5HVGB 3QDJE 4O00A 1A8JH 1CGUA 2ZUVA 4G8EB 2NY2C 3D18A 5E2TH 1CE1L 3QHFH 4U6TA 4K7PL 3RPIB 4JPWL 2AJYH 2W9DL 1N64L 4AT6A 2UYLB 5FO7B 3SJVB 3K80A 1J05A 5EZOL 3HCVB 5DMKA 4M5YL 1TQCC 4KKAD 3VXOA 6FABH 5ENWB 2W38A 4N68A 2DIBA 4R6UA 4N8VA 2WV3A 2IFFH 4WW2B 5I1GH 1T5XA 5DI8B 5F97E 5HI3C 5I1JL 3ZKNC 3MBEC 3GKWH 4L3AA 4LEXH 1P53A 1CFNB 1DN0B 3QPXH 3SGKA 1H15A 3AC0A 5DTFA 4KH2A 4S1RL 5A2IH 1A6UH 2X10A 2IAMD 4WEUD 4Y4HA 5C0CB 3WFCL 2CIIB 3IT8D 1NGZB 2VDQH 3T4YA 3ZO0A 3QXDB 5EU5B 1IGJB 1QVOA 4CVWA 4CNIB 4YX2H 1I1AC 1HHIB 1U95A 2P44B 5DA0B 1Q9OB 2ZOLA 3KYMB 4MS8D 3DROB 35C8L 1RURH 3VGAB 5FYJD 4IRZL 4NO0D 4OZFG 1CGSH 3S37H 1M05B 4R3SA 2WANA 3SDDD 1TIUA 4M1CC 1ZEAH 3MJ7A 4AEIL 1AY1H 4OLVH 4W81A 2F54E 3THML 2DWDA 5HYSB 4Q6YA 1DANU 2EXWC 2I60L 1NFDB 1MVUA 1CIUA 5C0EA 3L6FB 4V1DB 5CUSL 5F9OL 5JHDE 5DD5L 1QACA 1OPGL 5DJDA 3W2DH 3ET9F 1EMTH 3T3PF 4OFYD 3GRWL 5HHVL 5C0BE 3O6LL 4CADB 1I7TB 4O51A 4FP8L 1M6OB 2QQKL 2B1HH 3UX9B 1T3FB 5IQ9B 4Q9RL 1UADC 4L4VA 1FO0A 3LEYL 1LDPH 2MCG1 5CKAA 4FTVD 3MXWL 1JGEB 1MHPL 4Z7UA 4QNPE 1J88A 3I6LE 3KXFD 1Q94B 1HHHB 1CL7L 3FO2B 3RWJB 4PRAB 1CD0A 4WW2F 2VITA 3HZVB 3QUYA 4KPHH 1A7RH 1SYVA 1D6VL 3VD5A 5FCSH 5I74B 4Z7WA 1F8TH 2X4QB 2VDLH 4J1UB 4L8SA 1WEJL 1SM3L 3U9PH 4M93C 4ELMA 3HFMH 2NY0C 3RKDD 4XX1E 4JPWH 4WU5A 2CD0A 4JJHA 3PWPB 3QCTH 4U1IB 1ZWIA 4XVUC 1MLCA 2DYPB 2Q76A 2CKBB 4RZCB 1JZ8A 2GCYA 1CDJA 3DYPA 2XZQL 2K1MA 1CQYA 3TWCH 3A0OA 5A3IC 5GS0L 5D72H 1XMWA 5CGYC 1V3LA 4MNHB 4Q9BA 4ONFL 2QTEA 5EG6C 3T0DA 4P2OC 3S35L 3C5ZC 3T8XA 1JF1B 3M45A 4PJEA 3FQNA 1CE6A 4PP2B 1S7TA 4P2RA 1P5UA 3U82B 1JPTH 4MQ7B 1RD6A 2IH1A 4M03A 5I1HL 1UB5B 4GG6A 1JZ2A 4U05A 4QHKJ 2A9ML 5E99H 1DN0A 2DBLL 3IKCA 4JRXE 4KJQD 4YBLC 4M8QA 5E5UB 3QSKB 4D3CH 4RAVA 3QCVL 4M43H 1ZGLB 2HFGH 4P3CH 4OZHE 4Z76B 2VLKE 1JNJA 1A3RH 5J56B 3ARBB 1HI6A 2EXYD 4DUWA 2YSSA 3PGFL 4RMWA 3QRGL 4NKMB 1MFDL 2QL1A 3TBWA 3HR6A 2VO5A 4YHLL 4YZFF 3TCLA 1BQLH 2O5ZL 1KIQB 2AABH 4JDVA 1WZ1H 4TUKL 5D1QD 3VXSD 3N1MC 1WIOA 1CCZA 4I4WB 2XWTB 5T1MB 3ARDC 3ZHDA 3E6FB 1ETZA 1UXWB 2BNQB 3QNZA 1ZE3C 5GJSH 1G9MC 4U1GC 3ETBF 1SJHB 1UZ8B 3QJFB 3MRHA 4N0YL 4YWGH 3O6FD 5EU7E 3GJFB 2AJUL 1BOYA 2UUDK 4EEEA 1HKFA 3CUPB 2GJZA 4HAFA 5J12B 3BKML 3X17A 2ITDA 2PO6D 4JO3H 5GGTL 4KTDH 1Z0NA 5C0EB 4E42B 3VXPA 4F9PC 4MDIA 4M7LL 1BQHB 4OLYH 2NY7L 3ZYZA 2DM2A 2CUIA 3JWOH 4WI7A 4DGYL 3FO0L 1A6AA 1DQJB 4EQ3A 1JIBA 1ZTXH 4TNVK 4P2QE 2P49B 4QXTB 1DFBL 1F3JA 3EAKA 4JM4L 2B1AL 3RNQA 2R9HC 3Q48A 3QCVH 3QDMB 3H6JA 4G3YL 1KLUB 4KKAC 1KPRA 1P6FA 4G42A 2KH2B 5B8CB 4H0IA 3L9RB 4P4KC 1HH9A 1U8OA 4Y2DA 3OXSB 1NSNH 3MPCA 4EDWL 4HCRH 1J8KA 1IEAA 3V5HA 3DBXB 4NUGL 3TO2A 3L5XH 4LCCA 4ONGL 4F58H 3S8WA 2ESVD 2R4RH 4JFEB 1JN6A 4X6EB 5GRZA 1T4KA 4N9GA 2CMRL 5D8JL 1IC5H 4HULB 5IV2A 5J6GB 4XC1H 4GMTL 2MWCA 1RZFL 1HILA 1B0WA 1FNHA 5GGSY 5C3TA 1XF2B 3OKNB 3VWKA 2L7UA 3MRBB 5DZNA 5GS1B 4DN4L 1H3GA 3BN9D 5JXED 2W9LA 4FQ2L 4MXQD 2DLGA 4YC2B 5I1GL 5IHUL 1RIHH 2CIKB 3V4UH 2WUBH 5D7JB 4PRHD 4PP2A 1S7TB 4P2RB 3ZLQC 4MNHA 3W2DL 4TUJB 1BM3L 1GZPB 5HI5C 3KPPB 3UPCA 3QZWG 3DMMB 3OKEB 4MNQA 4TSAL 3CSYA 1NH6A 3GI8L 2B4CC 1BVZA 4ZQKA 3HG1D 4HX1A 1GZQA 5IHBA 5GJTH 1CDCA 4G9FA 2X4SB 4UQ3A 2FSEA 3G6DL 3SKJH 3NCFB 2Z35B 4QOKE 4R2GC 3SCMA 5CJBA 3IF1B 3RDTB 4LSVH 3TBWB 1IGFL 3KDMB 3SGJA 5DLMH 4XCCL 3UJIL 4JHAH 5DD3H 3D3VA 3ARBA 3PQYD 3QDAA 3QUKA 2J8UB 2X4PA 2OQJB 4OUUB 4N8CH 5C08E 3MA7A 2X4OA 3EHBC 1YJDH 4LPVA 4R0LA 4NJ9H 3BZDA 2VE6A 5GRWA 1BWWA 2D7TL 5LCVH 4HWBH 1R3LB 4BSJA 1CVRA 2XZCH 2YN3A 1YYLH 4XPGL 5FGSA 4ZPTB 1YNKL 5HPMA 2LABA 2D4DA 4XB8A 5C0RH 4U1HB 3FOLB 1BLNA 5FUZH 1AGFB 4MAYC 1E27A 2P8PB 2VDOL 1AH1A 3F7YA 3BZFA 1KCRH 4Y8DC 3WNNA 4IRJB 4JY6A 2ED7A 2IAMC 3WXWL 4ZFZB 4JJ5A 3DV4B 1R3KA 4HFUH 3T0EA 4R26H 2I07B 2V2XB 3MBED 4MSWA 2BJML 4O2FB 4JVUA 5FXCH 2J5LC 4UINL 4HUUB 2DWDB 3ARYA 4JPKL 4WW2C 5A43C 1MVUB 3TIEA 5IB5A 4MZ3A 3LKPA 4HC1L 4RFEA 1JWSA 1HH9B 1U8OB 1K8DA 2FEEI 2OJEA 3RWGB 4YXLH 2XNAA 3NZ8A 2FATH 1B4JH 2V5TA 3PDOB 3SDDC 3KPSD 2JCCE 4WO4B 5IFJA 2DQJH 1U8NA 3LN9A 5CZVH 4ONHB 1OM3L 1YNLL 3U9UB 3CFEA 4LCYB 3M17A 4LQFH 2NY0D 3RKDC 1MFBL 2FECL 4FG6D 4XNUL 4OIIH 1TJIL 5IGXL 1O7SA 1KG0A 2ADFH 5GZOC 3ZDYF 1YN7B 4WI4A 3AGVA 3O3UN 5ALCH 1ZMYA 1QLRB 2B4CH 2WM0A 1A9BB 5CD5C 3U0TB 4OM1H 3QG6A 3ILQD 1ND0A 1MF2L 2I24N 2GK0A 4PJFB 3KLHD 4MJ6A 1H3WM 2ARWA 1K8IA 2ICCA 3GSWA 1MHHA 2BHZA 3RWHB 1S7VA 2YS4A 3FT2B 1DQTA 5AYQA 5EZJB 3RP1A 4DN3L 1I3VA 1RUKH 1NMCC 3PGDA 5D6CA 3TESA 3VD3A 3N0PB 4NQCA 3RA7L 5J3HC 1CI5A 2F19H 3UTTB 5E8OA 2E7HA 4TN9A 2APTA 3U46B 4BSWA 3V6OC 5HYJD 3VMOA 5KVDL 5EN2A 2XN9B 2NY1C 4C56E 2A1WL 4W6WB 1BGXH 1TQBC 2E6PA 4NO0A 1GGUA 4DCQB 1N3NA 1RIVH 3L3DA 4YHLH 5BO1H 5D4QA 3FB8B 4ZQKB 3B9VA 4FRWA 1JK8A 4P0DA 2FEEL 5TQ2L 3MGTB 5LWYL 4Y5XB 4U1LB 4TSBL 2Q87A 4NQEB 5D7LE 3QEHB 3PQYB 5FYLE 1C1EH 1KN4H 3DUSA 4TULH 2AEQH 4H25A 1K6QL 3ULUD 1OGTB 4BA8A 3IXAA 5DWUL 1SY6A 3QO1A 3MRCA 5E5RB 4DUVA 2Q7NA 2SEBA 1G7PB 5DHVA 5CSZA 4AEIH 5GISH 5MENB 3JWDL 2YD9A 2GI7A 2ORBH 1DQML 4XBEH 2VKWA 4YDJB 5C0CE 1G1YA 3P0VL 4XBPB 1OQOA 2J8OA 5GSVA 1AGFA 1TJGL 1U8PA 1FV1B 3RGVA 1U8LA 5L8KB 4BH7B 1AQKH 2D7MA 4YO0B 3DTXB 3ARGC 4UUJA 1EGJH 1J0JA 4P2OB 3D39E 1UT9A 1EV2E 1CXEA 4TVPE 2VR5A 5EO1A 4MXWL 5C0RL 3FFDA 3IDIA 1EGJA 3O9WD 3T77B 1NAMA 4OI9A 2MPAL 1FZKB 4KRNA 1VFAB 3S4SG 1HHKA 1CG9B 3GM8A 2VL4A 2RBLA 1MJ8L 3HZMB 1UQSB 3L7FA 5F8RC 3P73A 1PZUB 2VIRA 1YQVL 1KCRL 5E8PB 3CXDH 4KGJA 4ZOEA 3MUY1 3Q1SL 1QLFB 3MRNB 4PPTA 5D6DC 1O7VA 3HZYA 3K1KC 5DD3L 3P77B 3ZT5A 1C5CH 1A2YA 3VXSA 1RZIB 1XIWA 3CDGB 4UAOC 3MV7E 5I1CL 4E5XB 2BMKB 1M7DA 4G8EA 4WTZA 4FQIH 4DKFH 5JDSA 5FO9B 1WAAF 1A9EB 1WT5A 2YXFA 4LF3B 2YUXA 5JQHC 3BH8A 3W9DB 1DR9A 5J57B 1D5ZB 2NY2B 2IC2A 1JVKA 3F7RA 3OB0H 5F7DA 5JMOC 1F02I 4N5UA 1EHLH 5EC2B 4XP5L 3P11L 5KTEH 4PJ8C 1FYTE 3I3BA 2FLBT 4RWHA 5SWSE 3NCMA 3QDJD 3DUUB 4O02H 3KPSE 4Z7VE 3KG5A 3PP3H 4NFCA 2Q8BH 2AJVL 3UTZB 3T0WA 5D5ME 3C2SA 4K23H 1K8IB 4U6XB 3MBEB 2FIKB 5F89A 2W65B 5FYKE 4I3GA 3G04A 4EBQL 4LRNL 1DEEA 4LPTA 4UIMA 3GMRB 5EUKB 3N1GC 2MPAH 4APQA 3SDXA 3ARUA 2K7PA 3VE0B 3WFDH 2DIAA 2M26A 2ZCKH 5CCKL 5IVOA 3TA3B 1WICA 2NZ9C 5IB1A 1DSFL 4ZUTA 4PLJD 4Z7VF 2BXZA 3VGAC 3HLAA 3EDDA 1CXHA 2FJHB 3REWA 4M7ZC 3HNSL 4P4KA 2EDOA 4JRYA 4F7PB 1NFDA 4RWYH 3VFWB 5LBSH 4WCYL 5ACZB 1L6ZA 5DF0A 4RA3A 3OKEA 3DETD 3VFSB 1MFCH 5IK3A 4G7VL 1I4FB 4NQSA 4P23B 3LN4B 3PHOA 2OXGA 2Q8AH 1A6UL 1FVEB 1FZOB 4S1RH 1BX2A 5J11C 2GJ6E 1ZK9A 4H88L 1S3KL 4NT6A 1B0RA 2FBJL 1AE6L 1G0XA 1XGPA 1U8PB 4OAWA 3GBNH 4P46A 4F9PA 4ZXBC 2H6PB 12E8H 1D5BA 2WIIA 1U3JA 5E2UH 1MQKH 1OY3B 2Z8SA 4Y19E 5E2TL 4PJGF 1XR9A 1VGEL 3EYQD 1F42A 5EBWB 1RIHL 2E8ZA 1J86A 1F2XK 1U8LB 2KZWA 3RRQA 3BGFB 3BN3B 4LSRL 4KDTC 1HIMH 2CDGB 4B50A 3MLXH 4XWOC 5E00A 2DICA 4PBWD 5IJVA 1HHKB 3HI6L 3UPRB 3CAFA 5GGRB 3U4AA 2W0KA 1GL4B 1PQZB 4CVUA 3GSVB 4MAUL 4QKXB 3QEQE 2GTZA 3PXHA 5JZ7D 4Y1AE 1DBJH 1ZWIB 4ODHH 3CMOL 3MRJB 4E0RA 1ZSDA 4ZNCD 2VC2H 5HHOE 2VLRE 3OX8A 1G7QA 4X5WA 4MX7B 3NZHH 4U4BA 1C08B 5EPMB 2PW1B 4EZMA 2IG2L 1CICB 5BV7B 3WFEL 4LF3A 5ISZA 2CRZA 3VXSB 3VI4E 3CDGA 1Q38A 2EIEA 2LV4A 3BGAA 2OZ4A 1QBMH 4XMLH 4XVTL 1DBKL 4J2XA 4MQ7A 2YR3A 4XH2A 1UB5A 4KQ4L 5EOTB 2KQMA 4CN1A 3FQTB 2NW2B 4YHOH 5E1AB 2ZSWA 3PDOA 4R4NC 3V7AE 3EFFA 3D39D 1V3JA 3PNWA 2VH5L 5ESAB 4F7TB 3RL1A 2WP3T 3QHZH 4XP6H 1DBBL 3DUUA 1RPQA 4YHML 2XN9D 4X5XB 2CRYA 3MBEA 1QR1B 2JJSA 3SDDA 4D0CA 1YA5A 4HKBB 5IHLB 2VL5B 3HAEH 4FQXA 4BFIB 4TSCH 1W72A 3WFHB 3VFTB 2YD6A 3O6FA 2J5LB 3QUYD 4XPAL 4NQTA 4RFNB 2AABL 4YJZL 3GZKA 4KUZL 5KZCB 1W72H 1FYTD 2FJHA 1LO4L 4LDEB 4F7PA 5EZJA 1LNUA 4AL8H 4R4FL 1UENA 1S9XB 2BSSA 1TETH 1RHHA 3IKKA 3MA9H 1HNGA 3B5HA 1LILA 5MEND 3LKQA 3OAZK 4QNPF 2OS7A 4NKDA 2VDML 1TJIH 5IGXH 5IWLC 4J12A 4Y88A 4YGVA 5MEPA 2A6IA 4KK6D 4UV4L 2X1OA 1YY9D 4A6YA 2FHBA 1GCFA 3V52H 2ZUUA 4O9HH 2YPLB 4H8WC 4P4RB 5DJCB 3S96A 3LRGA 3V6OA 4HLZH 5TE6L 1HOCA 1PSKH 5F7YC 1IQDA 2HKHH 3QWQB 2YA1A 1OCWL 1IGYB 3QQ4B 1U3HC 1A1OA 4RDQF 1O0VA 3WFCH 3LS5H 2HN7A 1P4IH 4KI1A 5DQ9B 5TQ0L 5IP4A 5GJSL 3DIFB 3N85H 4QRUA 1H8NA 1JPFB 5EOCJ 3NA4A 3V7MA 3X3GH 3FFCE 3RUGE 3AAZB 5E95B 1FNEA 5EZIL 3S97C 5H8DA 1KGCD 5DFVC 3GSVA 3O2VL 4WDIB 4P2QD 4KTEH 3WKMH 3V79C 1JGLL 2XZAH 3BW9A 3CDFA 4JQVA 3UYRH 1OP9A 3BFOA 4EUPB 3VGHA 3HC3H 4I48B 2GY5A 2A83A 5D71H 4PJIE 2EDQA 5IVXB 4Y4KB 1QKZL 2XG4A 4OCSH 1Z5LB 2QSVA 2QR0A 2DYPD 5DK2B 3B9KB 1IAII 3KPNB 3NFSL 3OB8A 4FMKA 2AK1H 3RWCA 3GSXB 4G7VH 4RGMB 3SDAB 4NZUL 5GS1C 1I1YA 4O4YL 3QDGB 3WLBB 1QLEL 1NDGB 4HBQA 3FT3A 1IRAY 3VFVB 3VH8G 1MFAH 2ATPB 3HZMA 3L7FB 4PRNB 3VFGH 2Y9RT 1T1YB 3GO1L 3MRRA 4KVCH 4HCRL 4XC3L 1NC2D 5HVHC 3MFFB 4CDGC 5I19L 4F58L 1QSVA 4X98A 3DLQR 3LKOB 3D2UD 4GRMA 2FWOB 3KYNA 5GS3A 1N0LA 4TPRL 4F15C 3BD4A 5GJTL 3RU8H 2F8OA 2X4NA 1OF2B 2AI0L 3P0YH 3WHE1 2YD8A 1YMHB 4GAYA 1Z0MA 3CX2A 2E7BA 3PP4H 4R96B 4LDLB 4TTDC 3MCLL 4J3OC 5DURB 1FORH 4MJIA 2X4PB 1JHKH 3HE6C 5IQ7L 1WTLA 2XICA 4B7LA 3ARED 3MJ9A 4N0UB 3PWJA 3M07A 2GW5A 4Z95L 1D9KD 1R3LA 3QEUA 3OKDA 3D18B 4X9HA 3NCEB 5HPMB 1SJXA 4HS8H 5L9DL 3Q6FB 2X05A 3Q0HA 5M94B 1A3LH 5C0IB 1L0QA 5EU6B 3BI9X 5I17A 2AK1L 3I6GB 2VKXA 5HHOB 2VLRB 3VDCA 5DMKB 2XN9E 3S36L 5I1CH 4XCFL 1C8PA 4PJ9C 3QUZC 3NGBC 3RFZC 2E7LC 2E27L 4IRSD 5IB2B 4MAYB 4CW1B 4A6YB 4WTXA 1AGEB 5DEGA 5ERWA 1A7NL 5J4MA 2AQ1A 2E9BA 1V3KA 3P4MA 1EH9A 3PQYE 3UTQB 5E4EB 1KT2A 3VFOA 4MSWB 3WIHA 1J1XH 2BZDA 5C08D 3ZSSA 2D03H 2HTLC 1KPUB 1K4CA 4FZ8H 2W92A 4ELMF 4GG8A 3CVHL 3VFWA 1EEZA 7FABH 5I0ZA 4O2EA 1EJOH 3LEVL 1MCDA 2VDRL 4DUXA 3KYMA 3LB6C 2ZOLB 1Q9OA 1NL0H 1K8DB 3MNWA 5SX5K 2OL3B 2D7TH 5LCVL 5CD5D 2Y5TB 1NEUA 5CSGA 3CFIC 4AEEA 4YBQC 5IFJB 2ADIA 1IGYA 5IJKC 3EYQC 2HFFA 4U31A 5TE6H 1TTUA 3MBXH 3ARPA 4KY1L 4LHQB 4NZRH 1I85C 3DETC 4ZYKB 3U30C 1SBSH 1MUJA 4HIHA 3GSNH 4LVOB 1WZLA 1Q9KB 5D2LF 4XAWH 1SVZA 4ZUVB 5I1EH 4HUWA 3AUVA 4OM1L 4PS4H 1PAMA 1ZHKB 3MV9A 1BZ7A 3R1GL 3GSXA 3SDAA 4QRPA 5D1XB 2DQUL 3U4EA 4JGUA 1BZ9A 1FAIL 4L4JA 4PRDB 5HGAA 3V95A 5E8DL 2YD4A 2DQCH 3ULVE 2V17H 1P4LA 4NDMB 3L1OL 1OLLA 2Z8RA 4P23C 1QKZH 4OCSL 2PXYB 3RIFK 1Q1JL 4X6EA 2WQRA 1N8ZB 3JUYA 1PGRB 1RMFL 3WFBL 5SWQA 1NCDH 4LSTL 2HAZA 1ZSDB 3EDKA 4AMKL 2UV3A 2D03L 4TQEH 4TNVF 4APQD 3F7PC 1ACZA 3HI1A 4UTBL 5GZND 1VPOL 1FCCA 4G6JL 3C8HA 4ZTPL 4J7RA 2D0FA 4X99B 5KANG 3F58H 3U79A 1I1FA 3RIAF 2ZNWA 3DRTA 4HWZB 1KJ2H 1CTOA 1R3IH 2A74A 4IS6A 1WBZB 5CGTA 4PGBA 5DD6B 4ISVA 4HUMB 3O6ML 1MCFA 3RPIA 5EORH 2ZUQB 3PWUB 5DS8A 3GMPA 1RVFL 4GW1B 3NPZB 1D9KB 4MQXD 3UJIH 3VFRA 3WLWD 3QEUB 1JUFA 4RAUB 1OAYL 1MH5B 2ZPKH 4FNLH 3F5WA 5IUSA 3BEVA 4H20L 2V5YA 4HIIA 1HKLH 4OD1H 4LSSL 2GFBA 2DJSA 5EU6A 1G7IB 3OB0K 5FM5O 5DMIL 3O0RH 2Z35A 3ROOB 1JHKL 2EEBA 4KROD 1AY1L 1S5IH 5DC9B 3NPSB 3RGVB 5C6PB 1YNKH 2IG2H 2R2BA 1CICC 4YO0A 1HSAB 5BV7C 3QQ3A 4HEME 2IJ0C 4XNMB 4M4RA 1FFOA 2XKNA 2WINB 1YMMD 1G0DA 4P49A 5J13B 1CD8A 2L7JA 4PUBL 5T3ZE 1OCWH 1RZJL 1CDBA 3H3PH 4YR6A 3CD4A 3V5DB 5IB2A 1AGCA 3T77A 4J8RB 4JFDE 2FGZA 5IR1B 1LP9F 1DUZB 4UT9H 3BO8B 1YNTB 3X3FL 3HI5H 2M1KA 3LAFA 3AY4C 4K8RC 3QYCA 5INDB 1A14H 4LCWE 3QFJE 9CGTA 1A5FL 4N1HB 4NJAH 4D8PB 2YXMA 1BLNB 1VERA 3D0VA 1P2CB 3L6FA 5DZLA 5MEOA 3ULVL 2P8PA 1BOGB 3ARGD 3ECBA 1IAIL 2P5WE 4NQUA 4PGZA 1EHAA 4HKJB 3E3QC 4GBXC 2Y6SC 1VFBA 3HE6A 5JW5A 3TCXA 1BREA 1NBVH 1BQLL 4ORZC 1L7TH 1CZ8L 1DQQB 3JTSA 1G9NL 3KXFB 4H8WL 1XAUA 3BAEL 3O2DL 4ZAKD 3W9DA 1LQSR 5DD5H 1JI2A 4FNLL 5ESQB 3CUPA 3MRLA 1ZANH 1C7SA 3HG1B 4XPGH 3EUUA 1AGBB 1Y0LB 1R5VB 2QHRH 4WUKL 4OF8A 4Q74A 5F7EH 3C9NB 3UEZA 2IQAA 3A6OA 5DJ6A 1ZHLA 5DUML 4GRWB 1XGYH 5KS9F 4OLZH 3LCYA 1RURL 4PB0L 4MNQD 4JFOB 1FPTL 2VZ3A 4U0RB 2YPVL 4OF3A 1T04B 4LSPL 5L7XH 4XCEA 1C5CL 3BOVA 3SOBL 1H5BC 2XT1B 4QHNA 1MY7A 4LLDB 4LCUA 3VXUB 2Q7YA 3MREA 3V0VA 3ZKXC 1W0VA 5KJRL 1I7RB 4DKEH 5C0BD 1FGNH 1YY8B 2VABA 2NXZD 1BAFH 3P9LA 3QDGA 5D7IE 1EZVY 4XXCC 5J1TC 4LSSH 4QHUB 1L7IL 3LKRB 1PY4A 4X8XA 3OKOB 1MCRA 4WY7L 3JWOL 4J3SA 4G6KL 5HYQA 1K4DB 3BIKB 3MFGB 3BJ91 4NQXA 1NUDA 4NQED 4ZUUB 3BP4A 4IS6B 3F6IA 4MXQC 1YEGH 2P47B 3CFCH 4FQLH 4G80B 2BSRB 2AEQL 1WCBA 1IAIM 1KJMB 3ZSTA 4G8GA 4JFPA 1LK3L 2YKLH 4ODHL 3LV3B 2YRLA 2ARJB 3WJJA 4S2SB 3VU2A 5EORL 1D6VH 1FBIL 4RAVB 2EIZB 1WSST 5HHPA 1YEIL 2Q6WB 2B0SL 2VUOA 4DOHE 1OAUH 4KK5C 2IFGA 1KGCE 3O9WA 4H26B 5B39G 4H1LA 4HGKC 2WINA 1OGTA 3V2AR 7FABL 3PWJB 5INCA 4FXLA 4EVNB 1YUHB 1N7ML 2F53B 3BO8A 1DUYA 2DQGL 3HMWH 4XNMA 5J12C 1G7PA 3BP6B 2M2DA 3UROR 4PYGA 4LVEA 1GC1H 3DYMA 3QRGH 4QYOA 2I27N 4XXDB 2WMPA 1OB1B 2CUMA 5F9WC 3E6FA 3K8MA 1EXUA 1W8OA 8CGTA 2R23A 4P59L 1GHFH 1DFBH 3NAAL 3UZVB 1KC5H 1NLDH 1BAFL 1BBDH 3NIDF 5ISZD 4UT6L 3MRJA 2CRMA 2PYFB 1BMGA 2AJSH 4J3TA 4HKJA 2COQA 3RVTC 3PHQB 1CFSB 1PKOA 4XWGH 3VJ6B 1WZMA 5E94A 1WFTA 2Z93A 2RCSH 4Z8FL 1OGAE 4C57C 1FZMA 1ONQB 1KT2B 3P40A 1CFQA 4I0CC 4C4KO 3HE6B 5D5MF 4AQ1B