5C9KA

Crystal structure of a highly fibrillogenic arg24gly mutant of the recombinant variable domain 6ajl2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
NFMLTQPHSVSESPGKTVTISCTGSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHVVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutating amyloidogenic lambda6 light chain AR back to germline 6aJL2
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Amyloid lambda 6 light chain variable region PIP
total genus 24
structure length 111
sequence length 111
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c9kA00
4JVWA 3L5XL 1PVHA 3OKEB 1XZ0B 3QWQB 2HFEB 3P4NB 4K3JL 4RFOH 3DXAD 4BQ9A 4P5TB 1YN7A 1RZKL 5DEGA 5DJDA 4JN2B 2BVPA 2DDQH 5TF1L 1FC2D 5CBAB 3PDOB 2VDPL 2Y36H 3LEXA 4JPVL 4NQXB 5IBLD 2AW2A 4LLVA 1TPXB 5EC1B 5IV2A 4Y8AA 2QQKH 2JLLA 1RJLB 4X6BB 3WIIH 5LCVL 4GAJL 2VE6B 1E6OL 1TIUA 1E4WH 5B4MC 2X4NA 2HLAB 4WFGE 5HGAB 5HYFA 2APTA 1I3GH 3T2NL 1KCVH 3V6ZB 2BOCB 4NO0B 5L0QC 3GHEL 4LNVA 3F6LA 2CGRL 1A6UH 1EFQA 3KLAA 4QRSA 3CLEL 4ALAL 2AXGB 4FQ1L 4XB8A 1DCLA 4NN5B 1QKZH 3O6ML 1KCRH 2KPNA 3A6BL 1FPTL 4EXPX 4L29A 2FYYA 5ESVA 4FS0A 4YIQA 2BSSA 1I1RA 2HTLC 3KWWB 5HPMB 3QIBD 4F3FA 3IDIB 3PNWB 4MD5B 1HI6A 3SCMC 4PJHB 3G6AA 1P6AB 1IGJA 4LHUA 2JK5B 4PJBE 5BW7C 4ORGA 1PBYA 5IMKA 1A7NL 5KSVA 1FNSL 5KVGH 1LK2B 2FECL 4D9RE 2CRIA 2P49B 4K07A 4NGHL 2ZWLT 5I66B 2GK0A 3CDGB 1BFSA 2AEWA 4TUKH 4HQQH 3W11D 3WNLA 1A3LH 3X3GL 5E70A 1QR1A 4H1LG 4I48B 1XH3A 1RUAH 3MRKB 2OJEA 1NUDA 3S88L 3TCLA 4Y4HB 1QRKA 4PJFB 3QPQD 2X10A 1UH4A 1FLRH 2R0WH 2GJ6A 4MQXD 3OXRA 3V4UL 1EHAA 4DUWA 2VL5B 1YMHB 4PGEB 4H1LH 5I1AA 1S7UB 2WWKT 3LN9A 4A6YH 1FSKB 3RQ3A 3PDDA 3W9EB 1NGZA 1TETH 1MCWM 5IB2A 4JFHD 1P53A 1OAKH 4Q7DA 5J11C 3Q3GB 1KLGB 2HN7A 3H9SD 3B6SB 4PRHD 3EO9L 4Y5XB 3RGHA 1VACA 2M2DA 2ICCA 4X4XA 1L0XA 2EDJA 5HXMA 5T1KA 5T3XE 4HUVA 4AMKH 2VH5H 3T65B 1EHNA 1N0XL 5KVGL 3MO1A 4IRZL 1ZVSB 2XQYG 3QHZL 2A1WL 3RBSA 4U0QB 43CAA 3G6JB 4M4PA 4YDVB 2BSTA 4ZS7L 3OAYK 4N5ED 4K7PL 2R0KH 3ARGD 4UV4H 4MA3A 4U6VL 1BAFH 4UDTA 5DMKA 1SYVA 2V5TA 2XWJA 3VD9A 1T2JA 4Y16A 5FCSH 1L0QA 2ENYA 4KPHL 3DJ9A 1W72L 3K1KC 1R3LA 4CBPA 2VLKB 3OTTA 4JO1H 4HEPG 4NKIL 2HG5B 4HKJA 1T2QH 1JPTH 4KI5D 4OZHE 4NWUL 4QGTA 5EORL 1A6TB 5HYQB 1U6AL 1RZIB 1QFWM 1UM6H 3LB6D 3Q2CA 2D31A 3MCKB 1OAZH 2WQ8A 3EHBD 4P57A 3O3EA 4S2SA 5IF0A 2B4CC 5ITFB 2A9NL 4OI8A 4ZTPH 1B88A 2O5YH 2FZ3B 2V6HA 5IGXL 3B9KC 2XNAB 5F89B 4LKXB 4ZS7H 4WY7H 2BSED 3HCVB 3EYVA 3RVXD 2BMKA 2FL5A 3NH7L 4D9QE 4DAGL 4XCYA 5C0JB 1OSPL 4JZOB 3TNNB 3QO0B 4HCRL 1NFDF 3OKOB 5L8LB 1Q9KB 1HOCA 2FBJL 3WS3A 2MHAB 2OMNA 3NA4A 1NAMA 5I8CA 3HB3D 2VITB 4RAUA 3FN3A 1V7NL 4JCLA 3NIGE 2FEEI 4J3TA 1DQJA 2Y4SA 3SGKC 4OFDA 3V0WH 1IZJA 3FB7A 3S37X 5L2KE 4XP4L 1HN1A 4PJ8D 3C2SA 2W91A 1YYLL 5J9PA 5FYJU 2VXSH 3CMGA 2LFGA 2NY0B 1HHHA 1JWSB 1W0YT 4HLZH 4LGRB 3VXNA 2DL9A 3MUJA 5LWYH 1BVLB 5ALCL 2JKXA 3S5LB 5I76A 1Q9WB 1E6OH 1SEQL 2MCPH 3DVGB 4KHTL 2H9GA 4M9OA 2FEDD 4KDWA 4X6DE 4Y4FB 2DQFA 3K80A 5C6WH 2R1WB 4ZPTB 4F7TA 2MQCA 1GL4B 5FYKL 4E0RB 3WE6A 1CE6A 5DHXB 1TJHH 4YQXH 2XTJD 4J3SA 4MZ3A 2J6EL 1RZKH 5F7WC 1I1YA 4L4TD 2R4SH 2EC9T 2E7LA 3E8UL 1NAMH 1TPXC 5IROA 3GIVB 3FO1A 1PW3A 4P59L 1T4KA 2X5PA 2YZ1A 4J6RL 4JM2C 2JJVA 4ONOA 2IAMA 2HFFB 2YUWA 2HLFC 2R2BB 2GAZB 1WCQA 1F3JB 5I15H 5ESAB 5T3XL 1RMFL 3HCVA 3BDYL 2F54A 4PY8I 1MVUB 3GJEB 5KW9H 3G6DL 1GJIA 1JF5A 1X5AA 2WUBL 4L3EB 2H26B 3HE7C 2MPAL 5BZWA 5KAQF 1QRNA 4M1GH 2DQGL 2BFVH 1A7PL 4YDIH 2H3NB 5JW4N 1TTGA 1ORSA 4Y4HA 5DUMH 2NY0C 2LQRA 5GIRA 4WW2B 3UJJL 2F74B 5HVHB 2KDGA 2AJZB 4M48H 1W72B 5GGUA 2VLJB 5E8NA 5HD8D 1IBGH 3JVGC 3NFPA 2ADFH 2EO9A 3DO7B 3PWLA 1EA9C 1KLGA 5C0RH 4OV5A 2FWOB 2LAGB 4O5LH 3WXWH 2IPUG 2C4FU 2DS4A 1MCFA 2QR0B 1ZHBB 1B4JH 4Z0BH 5JDSA 1VKXA 4F7EA 4G9FD 4V1DB 4NKDA 3EYVB 3MO1B 4K94L 4YBLC 3IF1A 1MSPA 4X99B 1QTYT 2IMNA 3NABL 1G9NH 2OSLB 3C5ZB 3BP6B 3DVFA 5I74C 3M17A 3VRLF 1D5XA 3CFBA 3RGVB 5HDBF 1RURH 2V9RA 4Y4HD 4F2MA 4OT1H 3OPZH 2VXUL 1I9IH 4PJHE 4UIMA 4E41B 5IG7A 1WC7B 5CEZD 3SKOA 4XNQA 1UC6A 2PR4L 5L8KB 1O7SA 1I1AA 4JPWH 5FA3A 1ZK9A 2QJDA 3IAQA 3PL6A 4ONFL 3VMNA 5C0BE 1ZHKA 3EOYG 1AGDA 5GRVK 4KXZH 3OSKA 4HZLB 4JFYB 2VWEE 3OJMB 2OJZH 1KLFA 2ZSWA 5EIVA 3U36B 1MLCB 5IM7B 2FX8H 3SDDD 3LKPA 4B7LA 1T04A 5J3HD 5EUOA 3O3DB 4P5MA 1BQHB 43C9A 3T1FB 1M05A 4LVEA 1NCAH 3W2DL 3GK8H 4ZAKD 5FCUL 4ZO9A 1NUNB 1T6WA 4O00A 3MUY1 4KK6C 4FFYL 4L4TA 1QBBA 4FFYH 4TPRL 2E27H 1OSZB 2FYYB 1U3HB 1T83C 4NUJB 4N8PA 5KVDH 3EOBB 1WWBX 2DBLH 2GSGB 1ND0B 4HKZB 4PJDA 3QUYB 1U36A 4NWTL 1QVOB 1XIWC 1UACH 2CIIB 2OTWA 3DXAE 3M1BB 4XP5H 5CLWA 5JQ6H 5JW5B 2G9HB 2R0LH 4P46A 2VUOA 3IJYA 4K71C 4MNGE 4WI4A 3W0WA 4QRQA 1UA6L 5D7IA 4N9GB 3RWCB 1H3WM 2R15A 4LCWA 4HXAH 3TPKA 4HXAL 1X5IA 2AJVH 1AJ7L 1S78C 3ALXA 3GRWA 1MCLA 4LVOC 5I30L 5CUSH 1KB5L 1GSMA 1JZ2A 1DQDH 4PRAB 3C6LB 3D2UD 3ZDYF 1UG9A 5HHQA 1J5OL 1R3KB 5C6TH 1M7XA 4KRPC 4MWFA 4QNPE 5JLZB 1LEIA 4PJ8C 2YD8A 4HZAA 4PY8J 1T03H 1UB6B 4OFPA 1B4RA 1F11B 3D69A 3OQ3B 4MDJB 4HWZB 1LNUB 2Z8WC 3HE6C 5EN2B 5DUPH 5IVZA 1IAKB 5LBSL 3FT3A 4QXGH 1RAMA 2YPVL 3VJ6B 4D0BA 1D9KC 3MRQB 3PP3H 1DP0A 5DFTA 2JF1A 3BN9D 5J6GB 2FEDC 2AJZA 5EFIB 4NPYA 3C60A 1QBAA 3TNMA 1U8KA 1WT5C 2DQUH 3WLBB 1U8NB 1V3JA 4GUPB 2YPLD 2DM3A 2Y9RT 5J7CC 1OAXL 4UT9H 4U7MA 4G8IA 1EFXA 3FKUS 4NNPH 1G7QA 4MD0B 1LP9A 1FGVH 2ARJA 3TCXA 2WSKA 3IB4A 1JHKL 4S1DC 4M5ZL 5H94B 1YECL 1T1ZB 4YQXL 2ED8A 5J56B 1OP9A 2HLFD 2Z91B 4Y2DD 4G6AC 4G8FA 1IGTB 1U3HA 2B0SH 4J4PA 3RL2B 5LAXA 3R8BB 1MFBL 5T3ZD 4DOHB 2NY2B 4YO0B 4KK8D 3WNOA 3WCYA 3NCMA 4N0YH 2XZQH 4PB0H 2H32H 1Y6NR 5I16A 4I2XE 3QFJE 4CMMA 4GW1B 2EYTB 2DWDA 4X5WA 2BVYA 4P46B 1IGYA 4QT5A 2QQKL 1VSCA 1VA9A 2X4UA 3CPLA 3WHE1 4J8RA 3MLYL 1IM9B 2YC1B 3ARUA 3X11A 5I15L 2J8UF 3U83A 4UNTA 2DQFB 4YHIB 3NFPB 1YC8A 1PD6A 5IWLA 2GITA 3D87B 4FXGA 5CHNB 4ENED 1JYNA 1N7MH 3UTTE 1XAUA 1BQHG 2I60H 3UP1A 5FM5M 2NY1B 3IS0X 1JPSH 1W0WA 3BE1H 2GJZA 3FO1B 2HFEA 5FA4B 1OP3H 3HMWH 2Y06L 4AIZB 1M05B 4OGXL 2KQNA 4ODSL 4UU9A 4AM0A 4ZXBA 4LSRH 3FQTB 4K7FA 3KPQA 5CSGA 1FAIL 1HINH 3I2CH 1H15A 5HDQH 4DQOH 3JWNC 4KAQL 1F3JA 4WEUD 4DVRL 4M7JH 3WFEL 2AQ1A 3MLSL 1I85A 4KV5E 5CEYB 4EN3C 1ZHLB 3PGFL 3RRQA 2N4IA 5HI3D 4MHHG 3G08A 5EZJA 1U8QA 4Q6IB 3U0WL 4NZRH 1QSED 3G5ZB 5J06A 4OLUL 2VQUA 2XKNA 2DM4A 1MJ8L 2H26A 1KG0A 3KAAA 4Y5YC 4DTGL 3SKOB 3U2SA 4JO4H 3C8DA 3RNQB 1GC1H 3RDTC 4CVUA 4ZMAT 2IADA 3WLWC 3RHWK 1CGVA 4JLRB 1J86A 4R2GD 4AG4H 2R2EB 1N3NB 3KDMA 4P2OB 4NC1E 4YR6A 3T09A 4LIQH 2I26N 1S3KL 2X4OB 3OJVC 2YPKA 4J4PD 2XQBL 3VFGL 3HC4H 2VDRH 3SDAD 4ODTH 1D5IL 1X5ZA 2VLMD 5C9KA 4LNRB 3P9WB 4PREB 4WEBH 3V2AR 3AS3A 2P8PA 4NQUA 4M5YH 1SHMA 1QLEH 4P23B 2X42A 3ARGB 1DEEA 4ZFZA 3LV3B 4AENA 4JANA 4U1GC 5F9AC 5DUBA 3QNZB 1M71A 3DROB 3C2AH 3JTSA 4X80H 3K4AA 3VE0A 3ZHDA 5ISZA 3P9MA 1PFCA 2WINB 1PKOA 4NP4H 4Z78A 5IBUB 1DDHB 1I9EA 5JHDD 3H7BB 2BRRH 2R2HA 3VXMB 3SPVA 3DRQB 1YJDH 1R3JA 5IKCB 3UC0L 1GZQA 4LAQL 2AVGA 3ARDB 3MV9E 4AL8H 1HHKA 3SDAA 5CJXC 2VDKH 3OKLA 2FBJH 1DE4A 1CFNA 3BUYA 4DCQA 5EWIL 5TE7L 1FL6B 1AGBB 4I9WE 3T0XA 4HAGA 5DK0B 5JPMB 3S7GA 25C8L 4X7CC 1HEZB 3QUZB 5D2LA 3G9AB 4RQQA 3CDFA 2Q76B 5D1QB 4MA7L 1L7TH 4JR9H 2ZG2A 2VUYA 2ZUTA 4ZD3L 2EXWD 3W0WD 1CLYH 3TJHC 4R7NA 4YDJA 3KXFD 1RIVL 4MAYA 1KSRA 5D70H 3FFCE 2VDKL 1B0RB 4OCSL 1OARH 2C1PA 3UX9B 4MJ5B 1NGQL 1CR9H 1ROWA 3QWRA 3WFDL 4YUEH 1CIDA 3FQWA 2XTJB 3GSNB 4JO3L 5C0GB 4JO3H 4PV9B 4FQIH 3TPUA 4K3GA 3FFDB 3U9PH 1DN0A 1S8DB 4F15C 3RWDA 2Y25A 1KTLA 1PG7X 2NPLX 3B9KB 1J1XH 3VFUA 1C5DB 3AB0C 4NO2B 4L4JA 3DVNA 5SX4H 2YA1A 3L95A 3BFOA 2UYLB 1YJDC 4ZSOB 3T65A 3L3OA 1EBAA 2H8PB 2UUDH 4FP8H 4WFHD 3TA3B 4GW4B 4YIQB 2ADIA 3V6OC 5BJTB 5DFVD 3BW9B 1L7TL 1CLZH 3G5ZA 5T3ZL 1LGVA 3MGOB 5KSAD 4JFEB 3S35H 3O6LH 4KV5F 1NCBH 2UWEE 4PJ7E 1X5GA 2OL3A 5F7YC 5I1CL 1W0VB 1MFEL 3SGDI 5J4MA 1VFMA 3RU8H 2JK5A 1FNHA 4PJ5A 5HYJB 2C4XA 2ADJA 1OCWL 1XGRA 3UTTB 4I18B 4NYLB 3BGAA 4PG2C 3MV01 4WU7B 1KJ2B 1MRDH 3UCRA 1G9NL 3TIEA 4K3DL 5D5MF 3TVMB 3VGAC 4IRSD 3ULUD 1WEJL 5CSZB 3QRGH 1Z9LA 5D9SB 4FFWC 2JCCA 1TQCC 3NCFB 1S9YB 3KXFE 3MRRA 4LASH 4PJAB 1EUTA 3SKJL 1YZZA 1UWEH 3WMSA 1V3KA 3BZDA 1KFAH 2VRAA 3BJ91 2VJXA 3NZHH 5ABDE 4HF5L 1G7MB 3V52H 2A9ML 4PYGA 2AV1B 3VGGA 3G5XB 1CK0L 4JCMA 5I1JL 1BBDL 1FG9C 5B39A 2MPAH 2AJ3B 4WUKL 4P3DA 1LEIB 4FQHA 3RAJH 4MAYC 1IGIH 1HIML 5F9WB 1T5XB 3RPIA 3PGCA 5IW1B 2QHRH 3W9DA 3UPRB 3GK8L 3QWOA 8CGTA 3DTXA 4KXZI 3RX8A 2YK1L 2LTQB 1LK3L 2HRLA 2NY7L 1BFTA 4PRIE 1FYTE 3H9HB 5E8OB 4XWGH 5DLMH 3LDBC 1SJHB 2D7TH 3S37H 5B39G 4LEOA 4GAJH 3VDCA 3HE7B 1QSFE 2VQTA 4F9PA 4R2GB 4JO4L 1A1OB 5DR5L 1A9BB 3RVWD 1KN2L 3OJ2C 4F37F 5CZKA 1MHEB 1IEAB 2PO6D 2ZUXA 1CG9B 4DZBA 3HMXA 3SDAC 1QO3B 2VLKE 3WKMH 4APQD 5DVLA 2PTTB 4X9BA 4TSBL 1DL7H 1JPSL 2B1AL 3B6SA 5DHYA 1V8HA 5IVXE 4LLYB 3U4BH 1UEMA 4UV7L 5MERA 4GJTB 5I8OL 4BUGA 1OAQH 2NY4C 5C0GA 1KCLA 1KTDB 4NOBA 4QRTA 5IHZA 2F8XC 4N5EC 2V7HA 4GRMA 2JCCB 3MQIA 2DQTH 4X98A 4NRXB 5HHXL 3ZO0A 1WFUA 4GO6B 2V9QA 4PJ9C 3VXOA 3F5WB 2DI7A 5IB5B 1F3DH 3SDDA 5LGHL 5ENWB 3TBWB 3ZDXE 5I1KL 3AFLA 3DRTA 4PJXB 5E95B 3O4LD 4BZ1L 5BOPA 1KXVC 4XBEL 2R56L 4HGWB 5F7DB 1J1OH 5JZ7C 4KROB 1IM3B 3HE6A 4JREB 4JFZH 3C5ZC 3D85D 4XB7A 2LE9A 5DVMA 3MPCA 1TNMA 2M8XA 3IDMB 5I30H 4XPTH 5B8CA 4EOWL 5L2KB 5JO5B 3ARDC 4U31A 4M1DL 5HYJA 2P8PB 5F6IC 3H3PL 1KOAA 3B9KD 4QF1A 1ZA6A 2HKFL 3CFDB 4KROD 5DJ6A 5DRXB 4R4FH 4UT7H 1DR9A 4OZGE 5HHNA 4FQLL 1G7IA 4Y19E 3CZJA 4F7TB 3W0WE 3KPSD 1NBYB 2ICEB 3U46A 1N59B 3UEZA 3D0LA 5J8OA 1NSNH 2D03L 3VE0B 1HQRB 2XN9A 4JG0H 1WFOA 5TFSH 4U1SB 3S6CA 2QV2A 4IMLB 4KK5C 2VXSL 3SJVE 1MFCH 4RMUA 4NCC2 5ACZB 2IEPA 1MH5A 3F58L 1CDYA 1HH6A 5TE6L 1ADQH 4Y2OA 2OQJA 4D9LL 4ZFOL 4LCWE 1FNFA 3OKOA 4GRLB 4PJHF 1J10A 3ARDA 3QH3B 2APBA 3EFFB 3BQUD 5DMYA 3P4OB 1MCWW 1WZ1H 4GT7A 1CICD 4BYHA 4JRXB 1ZGLP 3PWJA 4Z77B 2GI7A 3LKNA 4M93C 3C5ZA 3RKDC 3BPCB 3IAPA 4MJIB 5DQDH 1I7ZB 3ARRA 3QUZA 5MI0B 3D2UB 3UAJC 4YHYB 5K59E 3GUTB 1JHTA 4LF3A 5FHAH 1RZIA 3JTTA 3PV7A 3TFKD 3DGCR 4F57H 5ANMA 1DEDA 5E1AB 3VD3A 3ARGA 2DQUL 1YEFH 1KCUH 3RWFA 5DEFA 2JELL 3NH7H 4PP1D 3MXWH 5DJ2A 3AAZB 2Q8BH 1NUFA 3UTSD 4KRPB 2OI9B 4Y7MA 1FORL 4JO2H 1Q94A 2VR9A 2ZCKH 2JCCF 2W0PA 4CN6A 1QSEE 5E00B 5ELIA 5I1EH 4Z0BL 1X5HA 3RU8L 5DGQA 3MCLL 3LPFA 4M00A 3D1MC 4ZOBA 2DLIA 3HC3L 1P2CB 3O41A 3BN3B 2NXZB 4TN9A 4OGYH 1U3ZA 5GJSH 2EC9U 3U6RB 2VC2H 4PRBA 5D5MB 1KULA 4NCDA 3BI9X 1F45A 4YPJA 4Q0XL 3WUWA 5ITBL 2APXA 3BYYA 4PJEE 3X3GH 1FDLL 1LDPH 1N64L 3O11B 3SDDB 1N64H 5BV7C 1LP9B 2VXTL 4OLYH 3LIZH 5A2IH 3C09B 1LO0H 3QDMB 2AQ3A 5F9OL 4AT6A 3EFFA 4Y4HC 4YC2C 2X89D 5INCB 4ALAH 1YC7A 1H9VA 5IB4B 3QCTL 1AP2A 1RUML 2V2WA 3V9FA 4GKSA 4NO3A 5E7BA 4MJIA 4EJ1C 1H3PL 4DVBA 1NL0L 4NNYA 3SCMB 4DW2L 1PQZA 3REWB 1TVBB 3GMQA 4NRZB 1BX2B 3D18B 3QQ4A 1FH5H 1YPZE 4XGZB 4YEEA 4ISVB 5L2JA 1AKJD 1NLDL 2B1HL 1PZUB 2CKBH 4OIAA 1IAKA 4HGKC 4U1LA 3HG1B 5KSUA 5J89A 1N6VA 2MJWA 3L7FA 1BPVA 5J1SC 1VGKA 3G04B 5E5RB 1UQSA 5EU5A 4PJBF 1KEMH 2LU3A 3ARBB 1L7IL 4UDUA 4BUHA 4GUPA 4D0CB 1HKFA 4PJFA 25C8H 5HTSA 2PNDA 1HQRA 3T0EC 2A73B 2X4RB 1HH6B 1FZOA 1KTDA 1BZ9B 2Y6SC 4NUGL 2BFVL 1X4ZA 2P48B 3DV6A 3IJYB 1KIQA 3GBML 5D8JH 3DETC 2L0DA 3SOBL 1EEZB 3L3KB 1HQ4A 4FABL 4PJXA 3DYPA 2XQBH 5D1ZB 1BLNA 4KWUA 4JM4H 3OAUL 2EEBA 3F5WA 2VDLH 3MOBL 4QTIH 1FZJA 3BXNA 4HJGB 3KPPB 3K8KA 3QA3B 1S7WA 1U8QB 2KBGA 4Q6IA 4PRAA 1NUGA 3QXTA 5F7NC 2WBJD 5MI0C 3VXSA 3BHBB 4UINH 1MJJA 3ES6A 4LRNH 3DGGB 1RZ8B 2D03H 1JMXA 3TO2A 3UJIL 1WZMA 4H88L 1AIFA 2GJJA 1PGRB 4N0RA 1NFDE 2GTWB 4NIKB 5GHWL 4LLYA 3PP4L 4LPUA 5DEFB 3B2VL 3QQ9C 4NN6C 4JM4L 1CFTB 4JJHA 3ULVC 5I8OH 3MLVL 2AXFB 5JOEA 4MAUL 3H3BC 1RULH 4FMKA 3VI4F 1IKFH 2X4QB 1BVZA 2HH0H 2HH0L 3OXSB 4I5BB 3VXMD 1X5FA 3ARTA 1JGDA 4NQEB 4U1GB 4XNXL 3KPTA 1JZ6A 5H94A 5D2LE 3Q3GA 4J2XA 1U2HA 2HJFB 4LPTA 3CLEH 3D85B 2JJUA 1SYSB 1VPOL 2NR6C 2X70B 4XVUD 3SGDH 3PJSB 1IC5L 4FZ8L 3D25B 3EJYD 4XNMB 1MRDL 2XPGB 3MNVB 3JVGA 5GS0L 3MFFB 1AGEB 2HT3C 3WL9A 1IAMA 3KPNB 4S1DD 2CJUH 2YN5A 5KOMC 4P4KA 3FQXB 1CICB 1U8MA 3G5VB 2DLGA 3FRPG 4G6AD 4TRPH 3EO0A 3C8KB 5FIEA 5JA8B 1MFEH 1NGYA 1LEGA 4HD9A 3C5SB 4IDJL 1T7VA 3M8OL 3TFKC 1RU9L 3QRFM 1HH9B 5DMKB 1JRHH 4HW6A 3E6HA 5IVZB 2XN9E 1QHOA 3MGAA 1BD2B 4QT5B 3VRLE 4GLRH 2DKSA 1YMHA 3T0EA 2D9CA 1OGAA 2HT2D 3T4YA 1UH2A 1N6QH 2ARWA 4D3CH 1CXHA 1MFDH 4IOIB 3BPOB 2P24B 3O6FD 2VLME 4XX1E 4LHJB 3UJJH 3V6OA 1N5AB 5F3BA 5DD6A 5TDPB 1KN4H 3D39A 4PY7B 5B38G 1FO0H 4F33A 3VFVA 2VC2L 5JQHC 3QRGL 4Z7UA 3NZ8B 3QDGA 5E0QA 4Y4KB 3INUL 4XWGL 3L3HB 1WLHA 3O9WB 3WS6A 5KW9L 2HFGL 3BVNA 1G0DA 1GGUA 2GIYA 3ZZ1A 5FECB 2GEEA 4WO4B 4NZUH 3T0VA 1CFQA 5EU6B 2DLFH 4GKZA 4RMRA 1E27A 3JZ7A 4TUOA 3K74B 1FO0B 2RR3A 5CBEA 2CO6B 5IQ9B 3RAJL 2XYCA 5KSAB 5A3IC 4G42B 1MI5D 3Q1SH 4G80A 3P4NA 3GGWB 1BIIB 3P0VH 5EOCJ 5GPRA 5GGSY 2IALA 2EDKA 2FIRT 1RIUL 3HAEB 1O7VA 2YUVA 4OLWL 4XBGB 4KVCL 4ENEC 3NAAL 3BT2L 2DLEA 1EVTC 5DXWA 1S5IL 1U8OA 4UIKL 4TOYH 1G7PB 3V5DA 3BQUA 4DEPB 3T3MF 1FNSH 1I85C 3VXRD 2A83A 7FABH 1RI8A 1S7WB 5F3HB 4WWID 2EYRA 2OL3B 2A1WH 2WK2A 1VFOA 4R0LB 2VH5L 4J4PC 4M7LL 4XCNA 1A7OL 2QKIA 4K2UL 4EI5B 5C0EA 3RX7A 1DLHA 3L5IA 2X9WA 4MNQA 1G7HA 4KKCD 1E4XL 1T20B 1KUMA 5T33H 3NGBB 3QHTC 4PJBA 5D2NC 4WHYG 1KACB 3U4EB 4ZTOL 3KVQA 5EA0L 2FO4B 3BP5A 3SE9H 2VZOA 5HHPA 1ITCA 1NCAL 3BZFB 1EXUA 1KTLB 2VLLA 2ICWI 3B9KA 3DMMB 3MUHL 5KANG 5JW4R 1UVQB 1CXEA 3KPOA 1W72H 1WBYA 1EAJA 3SDCC 1JWUA 2L7UA 4LPYA 3QUMB 5CILH 1EEYA 4ZPVB 3T08A 1FJ1A 4HIIB 5EU4B 3PIQB 5H2BB 3S88H 4OUUA 3RNKB 3O6KH 5JIKA 4QRRD 2UY7A 3LIZL 4NQVB 2MTPA 2Z9TA 4NWTH 4NFBA 4HMEA 1N26A 4LCYA 5GGRA 2NW3B 1B2WL 1JUFB 4PJXE 3BEVB 1I9JH 1MEXH 2OP4H 5DRWB 2HWZL 2IG2H 4P4RA 3FJTA 2CMRH 2LTQC 3FB7B 4X5LA 1MJJB 4I77L 5EG6C 4W4OC 1F4XH 3U7AA 4PLJC 4JAMA 4O2FB 3SDXA 3QDJE 1RZKC 3REWA 3RUGF 2H3NA 4JFZL 3T0DA 2D7OA 4N0CD 1NGWB 5DEZA 1FNEA 1KJ2A 1Y6KR 4RBPK 2WW8A 2ZKHL 4EVNB 4XNQB 4P2QB 2LVCA 2AXFA 4OLVL 4I18A 1C16B 4P23A 3RVVC 1FFPA 2DQTL 3C6SA 4U05A 2DQCH 4NQDE 5J57B 3OJDB 1YEDB 3VG0H 4ZUVA 4JFEE 2FH6A 1DZBA 3G08B 5EZJB 1J8HD 1QLEL 2YUZA 1CGYA 3LKRB 4DZ8B 5I9QC 1OT2A 2YOCA 1IC5H 4FZ8H 4NBYB 5JW4Q 4APQA 3KS0H 1KPRA 4UT6L 2JJTC 3D3VD 3N1GC 5JNYB 1VFBB 5F8RC 4YXHH 5D71L 1A4KB 3QNYB 5E2TH 3CFKA 3WFCH 1CI5A 5TH2B 5CIPB 3ARED 3GIVA 2ZCLL 5E8EB 2O5ZH 2VLRB 3GSNH 4WI9A 1EPFA 1RZGB 1QD0A 5FYLE 4HK3N 3V7AE 4C57C 2ED9A 3QDJD 4NRYA 2VLKA 3TIDB 1JRHL 5E9DA 4WHTA 1XEDA 5ID0B 2EXWC 4R8WH 3Q6FB 4FN0A 3QQ4B 3BUTA 4KRNA 1MNUH 5BMFL 1JPGB 5JXAH 4PGBA 4XC3L 1JNNL 1YNTA 4BFEA 1LE9B 5E94B 1T6VN 3STBA 3HI6L 4XWOC 2DMCA 4X0KA 5K9KA 2FR4A 1G9ML 4UTBH 1JNHA 3UBXA 4LCYB 1IGCH 4LCCB 1R5WB 3UZEA 4GKNA 2B4CH 5I8EB 2BY0A 3ZHKA 1FL3A 4JQVC 1UZ8B 1NC4D 3KYNB 5DTFB 3L9RA 5CJ5A 4E0RA 2W59A 5IFJB 2R1WA 3FB6A 1OTUD 1CU4H 5DRZA 2PCPA 4M93B 4U7SA 3SDXB 4XP9L 3L5XH 3LS5H 5I2IA 1A9EB 4L8BB 3IU4L 1RU9H 5DFVC 3B83A 5F1OB 4K7PY 4K94C 4LHUB 4YGAB 4Z7UF 3ZLQC 1MWAH 2C7UA 4Y1AA 4KKAC 3UTSB 2IAMB 1OLZA 4X6CA 3VGHA 4PP2B 5EPMA 2YRZA 4A2LA 3QG6A 4YFLF 2C3XA 1K5NB 4BQ6A 4OAWA 4NDMA 2UV3A 4BM7A 3DUUB 4U1SA 2VIRB 5IHLB 1T7XA 3TCLB 4Y8DC 5FDYA 4JVUA 4Z5RB 3VXRB 4WW2F 4ZPVA 4LKCB 5CWSA 3WO4C 3ZT7A 1JHLL 3PWPB 3HZVA 4OF6A 1WBYB 3IT8D 3V6ZA 5CEZL 4M8QB 5D1XC 3T04D 3EYSH 5KN5A 1SVCP 4U33A 4X83A 1MAML 5CKAA 4UAOB 3MV9A 5FOBA 3MR9A 2J6EH 4OZIB 5GGVH 4QRUA 3BE1L 4Y5YB 3RL2A 5DT1H 2B0SL 4Q2ZA 5DK2A 4CNIA 1N5AA 5KG9B 4XCNB 2LVEA 3GKZA 1DQMH 3VMPA 1PG7H 3ZT5A 5DSCA 4TNWK 1XR9A 3ARVA 1CLZL 5DVKA 3O0RH 3MACL 5DJ6B 4KKCC 1RIHH 5SWZE 5DJ2B 2CKBL 5C09B 1YN6A 4HDIA 3OJDA 4MAYD 1QSVA 5EBGA 4XAKD 1BJ1J 1UENA 5F9JB 5EC1A 1U8KB 5HGGS 3MJ8A 5CBEB 4PG2A 35C8H 4P99A 5LKNA 1KT2A 4KMLB 5CSBA 4MSWB 3IS1X 5TE4L 3HZYB 1EHLL 1JWMB 1YMME 3QCTH 5DD3H 3RVTD 2QQLL 2A0LD 3SDCD 1OAKL 5IVOA 1C8PA 3BO8A 4R3SA 1KJ2L 1P4IH 2OJZL 1NL0H 2NY1C 2EO1A 1A02N 1WGOA 1F4WH 5KVFH 2HJLB 4HMCA 2BP3A 3RJDA 1UXWB 4KPHH 1MJ7L 1OTTC 2XA8H 1MAJA 5IMMB 5FO9A 3AC0A 1P7QD 1T7YA 5GRYA 5L7XH 1IQWL 1HXMB 4XMPL 5GGQL 3PL6C 3DBXB 1LNUA 4HFWA 4WUUE 1LO3H 1OW0C 3DMMD 1I1AC 4EN3B 1ZSDA 2BNRE 3OMZA 3QNXB 5EWIH 5TE7H 5JZ7D 3D3VB 5FK9B 1I9RH 1J87A 5CJOH 5AYUL 3VDBA 2QR0A 3I50H 1LK2A 2DBLL 2R0LL 3B8SA 4OFKA 2IWGA 5BZDA 2A38A 4ELME 4N0CC 1I1CA 3MMEB 2ZPKH 4E41E 2ICEA 4W6WB 3CPLB 1MF2H 1NQBA 3VXUB 2ORBL 1NCDL 3RVVD 1DQQA 3QJFB 4OZFB 4XRCB 4PRDA 4N0FA 4OF0A 1LWRA 4IRJC 4PJ9D 2CXKA 4WV1B 3VRJA 1PG7W 1UM4H 3FQNB 4QRSB 3HPLB 1NEZA 5FGSA 2W9EL 4QRQB 3QISA 4PJGE 4JFFA 1LO3L 2G9HA 3QUXA 5AD0A 5DMGD 4S0SD 3H3KA 3QHZH 2LABA 1TVHB 4LPWA 1QNZH 5JQ6L 4XP5L 3VRIA 4MYWB 4MD4A 3VXPA 1C5CH 1C5CL 2E9WA 3SGKA 3HN3A 1KT2B 4NBZB 4OF3A 5HVWA 1DUYA 1X3DA 2Y72A 3T2OA 5GRUH 2BK8A 4N0UE 5E56A 1ZT1B 1IAIL 1NCUA 2XWBA 2Y5TB 3UZQA 4PLKC 2HFGH 3V0AC 3ILPB 1KB9K 3BN9C 4ODWA 5FKAA 1AO7A 1Q0YH 4QRUB 1J0ZA 4A6YA 3RFZC 4KKLD 3W5MA 4DGYH 4U6XA 4X0KB 5LQBL 4XH2A 2FGWH 4KK5D 3GMLA 3MSPA 4DFHA 1OQOA 2XT1B 2CRMA 3BWAB 5EC2B 1QQDB 4PP1C 5BO1H 3O6FB 3ARQA 5E2UH 1BX2A 2Y23A 5DDHA 4X7SL 4XNYL 1KN4L 2Q87A 1CD0A 2BNRB 4D3CL 4J3XA 1DEEB 4ZFZB 4ZSOE 3QG7H 5EOCH 3WEXA 1P9MC 1TZGL 3MYJB 4TTDC 4MXQD 2AI0L 1K8DA 1MHCB 4D0CA 1HKLL 4X6CF 1R3IL 1CU4L 3K0WA 3NCYS 5F7EH 2YBRB 2H45A 2QQNL 3QAZB 1DQQB 5JR1L 1UEYA 3QZWB 3AUVA 3MBXH 2PYFA 1JHKH 3PWPA 2WINA 4OZHB 3ABZA 4KU1A 4NJ9H 1R6VA 2I60L 1TJGH 1MI5B 3DXAA 5HI4C 5IT2L 1KIQB 5T1LA 3PABA 2DLFL 1J0YA 3A0OA 4HIHA 3BPOC 1E4XH 4YBQD 2CLVA 4GFTB 5D1XD 3VD7A 4K9EL 2UYLA 3MLRL 1HNGA 2IH1B 1DBML 2XZQL 4I3RL 1P84J 4O02H 1AGEA 4FG6D 5FOJA 3R1GL 1AGCB 5IMMA 4P59H 3NIDF 5D2NE 4HMDA 4XGZA 3INUH 3EKCA 4QXTB 2YPKB 3TVMD 3P0YH 5I18H 3V6OE 2DJUA 5CZVL 1S7QA 3GSXB 2IPKB 4LRIA 4G7VL 4Z18A 3LRSA 1MCNA 4ZXBB 4AM0B 2Z93A 4HKBB 4RWYL 4U1MA 4X5XB 3NFNA 5EULV 2C3VB 4EI6B 4QY8B 3QG6B 4AEHL 1TZIA 2J7LA 1D6EA 4XP6L 1CE6B 4JY6A 5GRVL 2OR9H 3CCHA 3ZDZF 4LFHD 4IJ3C 3L7EA 4J3OC 4FQJL 1JF6A 12E8H 3VFPB 1M6OB 1P5VA 1PYWA 3MLUH 4L4VD 4LIQL 4JRYB 3T0ED 4IIQB 3P0YL 1UZ6F 4LAQH 3WUWB 5D1XA 2D2OA 5C07B 4F7PA 5GRWA 2P46B 4XVTH 5DJZB 3MOBH 5I1DB 3EYUL 1Q1JH 1N3NA 1WFTA 4NKDB 2VITA 4Q9CA 2H32A 1MREH 4Y89A 3LZFH 3S37L 4HPOL 3QDMA 5EUOE 4PLOB 4Z95H 3PWPD 5HDBE 3MV7E 2HWZH 1AC6A 5FOBB 4O9HL 1NCWL 4LLQA 5EBLB 4U6VH 3ARFD 1PAMA 1FVDA 4NOFA 4NUGH 3F7VA 4QYOB 5L2KD 3U0PB 3RTQD 4NC1C 5C0AE 3GMQB 1HXYB 5DZOA 5DUML 5HDQL 2H9GB 1Z3GL 3DURB 3GSRA 1LD9A 2IANB 5E6IA 2QADD 2K7QA 3ME0A 4P57B 2ITCA 4M7ZB 4QRRB 4MJ5A 3QEUB 5DFWH 5E2WH 1RHFA 4CJ0A 4ODTL 2O61A 1TZHA 1T22A 1KEML 4YX2H 1K5NA 3FB8B 4G43A 4ZAKA 2FJHA 3QUYD 1UM6L 4XBPA 1UB5B 5D7IF 1I3RA 3RVXC 3SN6N 2AS5M 1QFWI 4LSQL 2E7HA 4AG4L 2PO6A 3P77B 2BCKA 4JDZB 4C55A 2M26A 3TBSB 5JDJA 3IFNH 2ZP0T 3TN0A 2BVUA 4KGJA 4EZMA 3QDGE 2R2EA 3F58H 1MIEH 4ZO7A 5CCKH 3KPRA 4LSUL 3IAGC 1J0IA 5GRUL 4Q58C 3QT2A 3U4EA 1D6EB 5HGDB 1QFHA 5ILTL 4C83A 1GXEA 4PV8B 2L7JA 3VXSD 1CZ8L 1C08A 1IKFL 4KFZC 3TH3T 4HFUL 4P0DA 3UTQA 1JZ4A 4RRPA 1UVQA 2ICWA 3QEQB 5CD5C 2YPLE 1FRGH 3ARZA 4WU5A 3DHMA 3H3PH 3KYOA 2P45B 4YNYA 5JHDB 2APWA 5E8OA 1NC2B 3W0WB 1JBJA 4F7CA 4H88H 5GGSB 4JANB 2W0KA 1UACL 4BQBA 3CVIH 5IR1B 2OR7A 4U2YA 2RGSA 4U6XB 4U1HB 4XXCA 5DJYA 2VKWA 1G0XA 5L88H 4U2ZA 3PDGA 3F62A 1CZ8H 5ESVB 1CGXA 1XF5A 4KKNA 1J7VR 4AL8L 4G6ML 1JGUL 4FNLH 4KVNH 4LARH 5SWZB 4OCSH 1XT5A 1U58A 2XIDA 4FTVD 1ITBB 2HT3D 1OP5H 3WFDH 3RIFF 5C70A 4Y1AE 4TTDD 3ROLB 5M94B 1UXWA 3GMNB 3MRPA 2I07B 4UBDC 3O9WA 4MA7H 5HHOA 4PJ5D 2NTSP 2H1PH 2DYPA 3QSKB 4XMKH 2DM7A 1FLTX 1QRND 2KQMA 1U8NA 3K8LA 1VPOH 4WFFD 3HRZA 2BDNH 4QHLA 4MJID 3EJJX 3C8KA 1OAYH 5FHAL 3FHQA 3E8UH 4LIQE 4NRXA 3P0VL 5K9QG 1OPGH 1G1YA 3EJZC 1XGUA 1AJ7H 1BWWA 1ZT1A 1LILA 4YHOH 3S96B 3O9WC 2BHYA 2ESVB 5DQ9B 4ZFFB 4PS4L 1VB9A 1XGYH 1QSFB 2DQDL 2F8VA 1T1ZA 3IU3A 5I18L 3L5WB 2HN7B 4WO4C 1ACYH 4Z7VA 1RVFH 4UT9L 4Z77A 1LO2H 3OKKA 4OCWH 5DR5H 4CMHC 3M45A 4NZUL 4ELKA 1JUFA 1BD2A 4WGWB 2FX7H 3M8OH 1BQLL 5MENA 4TUJB 2WANA 4XAKE 1QSEA 5EN2A 3RJQB 5SWZD 3NFSL 4MDJA 5B8CB 3A6CH 4F33B 2BNRA 3SE3C 2QHRL 1QLFB 5EU3B 3MV8D 2I5YH 5I66A 1GZPB 4JFDA 4PRNB 3L95B 4JN2A 1ED3B 1FV1B 2FECI 3PQYA 5D7LB 2DDQL 3RL1A 1CBVL 1PX3A 4WEMB 4OCMC 4JFDE 3VGEA 4MJ6B 1RPQA 5I0ZA 4XPGL 3QCUL 2OTPA 1EFXB 2ADFL 3MFGB 3OKYA 4RZCB 2MCG1 4I18C 5GRJH 4P3DB 4H25A 3VH8G 4LPXA 2P7TA 1F4HA 1JZ5A 2BXZA 3GKWL 8FABB 4NQDA 1T3FB 5HI5D 3B2UD 2BVEA 4O9HH 3WIFB 2QSCH 3MOAL 3MV7B 1J11A 2PXYA 3EOAA 2XG4A 3RZCB 4PGZA 1AC0A 2EH8H 5HYSG 5L9DL 1SM3L 3E2HC 1TETL 2VDNL 3FO9B 1GPOL 5HBBA 2I5YL 4MA8H 4RCAA 5C0DB 1MFAH 2BVQB 2WWMC 4QTIL 5JHDA 5E2VL 2X05A 1FN4B 5JHLH 1IAOB 4XVJH 5C0CE 2YA2A 2R39A 5IW6A 4HWEL 1WWAX 3SDCB 4IM8A 1EH9A 2XZAL 5K93A 4FQLH 4Y19A 3C60B 1GAFL 3UBXB 1OLLA 3V4VH 1F97A 1T2XA 2MMXA 4ELKB 3U48A 4FABH 2BC4A 1MIML 4YDKL 4HHAA 1Z9OA 2MQ3A 2X4NB 3IXAB 2AABH 4PJ9B 4QHMA 3BH9B 1BAFL 4BSWA 3NN8B 1JPFA 1ND0A 4HKZA 5FM8A 3N9GL 4ISVA 5L2JB 3BIAX 4X7EC 3H9ZA 5F7UA 3T77B 3C60D 3KLHD 4NT6B 1HHGB 1Q72H 3MREB 5MEOA 2DD8H 3IDJB 1VFAA 3HA0A 1NMAL 4UILL 2FCBA 2I9LA 3NBNA 3IVKA 4I0PA 1NFIA 5EORH 3KLAB 3O4LB 4HDIB 5E8EA 1S78D 1YQVH 3UO1H 5D1QD 5JPNB 1UYWL 2DI9A 1C1EL 4JFOA 3HC0A 5C07D 3O4OB 3OBAA 4PJIB 1ZOXA 2AV7B 3VXQB 3LKPB 5BQ7A 4MS8C 1JNNH 3KYOB 3MLXH 2ZJSL 4RGNE 4U1NA 3CIQA 4WW2C 1DN0B 1S8DA 5JMRA 2P47B 1QYGH 5EBWA 4YHLH 3QI9C 4UV4L 2ED7A 5D93B 2I25N 4L9LA 2D4FA 2FLBT 5F7EL 2WZPD 4M7LT 2JB5H 4XPHL 5DJDB 2P42B 4QHUA 3BKCL 4KDVA 4P5KA 2CDFA 2BY3A 3KPSB 3FO0H 4PJIF 1KLUA 4ZQKA 1CCZA 1KBGH 5IMOA 3STZB 1KGCD 3C6LD 1FNLA 5D2LB 3D18A 2NNAA 3IDNA 4LLUB 2NCMA 5DC4B 1J1XL 2NW2B 4IRZH 5EZLB 2DLHA 4OZFG 4BZ1H 1SEBB 1H15B 1FYTB 4G6FD 4X7DC 1IJ9A 2NLJA 5SWZA 2BCKB 3DROA 4JDZA 3WHXA 1C5BH 1O5DT 2F58L 5GGRB 1OW0A 1BBJB 5HY9A 3DUSB 1CIUA 1R24B 3O8XB 4ZS6C 5DJCB 3HRZB 1CTNA 5IEHA 3L3GB 1AQKH 4WFEE 3FZUC 3VXTA 4TULH 2X1OA 5MEQB 1Q0XL 5HHOB 1HHJB 3AREB 4Y16C 3U7YH 4KK8C 3GUTA 3NCJH 3Q6FA 3U7WH 2D4DA 4JQXA 4RGMC 4B41A 2CLZB 1FORH 4JO2L 1ZA3B 4KRMB 4YNYB 4BKLB 3O2DH 4JFPA 2FD6L 3BH8B 5SV4A 4AYFA 2EDYA 2BVOA 5TGBA 3BGMB 1IGYB 3PV6B 2VISB 4P9HC 3IRPX 2VDPH 3L6FA 3LD8B 2VAAA 5CIPH 3OX8B 4OM1H 4OZIA 2CSPA 2AI0H 1AE6H 3GSVB 1PJ9A 3SE8L 3G6JE 4HWUA 3ZKQD 4OGYL 4KJYB 1CLOH 4KJQD 3IGAB 4HS6A 1NMCB 5CEZH 2X9XA 1SY6L 3L3JA 4G9FA 4PG9A 4PPTA 1F3DJ 3UTZA 3PWUA 1Q0XH 2GY5A 2HTLD 1S7SA 5BXFB 3MRIB 1AGFA 4U1JB 4FQ1H 2BC4B 2A73A 3PWJB 1BVLA 3GO1L 3KPQB 1AXIB 1Z5LB 1IARB 3LPWA 1UXSA 3HMXH 4LP4A 4FTVB 4PTUA 3S36H 4AK1A 4A6YL 1I1YB 3D3VE 2PKDA 2BSRA 1FZMA 3BD3A 1WIPA 4BFGA 5AG8A 4ZPTA 3LH2L 3MXWL 4U1IA 3G5YB 3RY5A 5BW7A 3B9VA 4OLWH 2V2TA 3QFDA 2DMKA 5T1LD 3WUZA 3S35L 4TSAH 1IL1A 4R2GC 3X11B 4G7YH 1SYVB 4OT1L 3MYZA 3SKJH 1BOYA 1FDLH 1LDPL 1MWAA 2QL1A 1U3YA 3GBNH 1V5JA 3L9RB 3IFLL 5DRNB 1I7UB 1MAMH 2N7AA 2IC2A 5EIIA 1WQVT 4M61B 4HUUB 5HYQA 4BZ2H 4PREA 5A2KH 4CVXB 1EHLH 1NBVL 5E9DE 5J9PB 5T1LB 4WNQA 4PJGF 2WBWB 1OVZA 3KYKL 5B3NA 3MODL 3QDGD 3JWDL 2NY6B 4WENB 1IAOA 4URTB 4ZO6A 2NY4B 5D7LE 3TYGH 2D31B 2OX5A 1ZT7B 1WTLA 1AGCA 4S1SL 1UKTA 3MRJA 1XGQB 2HVJB 3VI3E 2VERN 4WJ5B 4UAOC 1QFPA 5K9OB 1H5BB 3QWRD 3G6JA 2OR8A 4JPWL 3UYPA 1VGEL 2WP3O 4NO5B 1PZ5B 4Q6IC 4KI5F 4Z9KB 5ECJE 1VFUA 4V2CB 4G9FE 3TZVB 5D1ZD 1GAFH 4LP5A 1E28B 4HIXL 5DF0A 3KPRE 1I1AD 2Z8VC 2E9IA 4MAUH 4QCIB 3QDMD 2PW1A 3HZKA 2FHBA 4TSBH 4HIEA 3RWGB 1KPVA 5EDXA 4MX7A 1DN2A 2GSGA 3BPNC 4J1UA 1CFVH 3VG9C 1ZTXH 5IV2B 4GOSA 2CRZA 1EZVY 1HSBB 2NY7H 1ZS8B 3QUMA 1RV6X 1OP3K 5IB1B 1I7RA 2X7LA 4ETYA 4JHAL 1U93A 3T0EE 4OKDA 3V7AG 4FQXC 1YN6B 2DBJA 2R0ZH 4CADB 3MRHA 1TJIH 1B2WH 4M3JA 3TGXA 4XH2B 3S35X 4ONHB 2RCSH 1KLUB 4ZQKB 1GVIA 2NXYD 5JO5A 3N9GH 1HI6B 3F6IA 3P73B 5DI8B 4OCNC 4MXVF 2GFBB 2EIZA 4ZNEE 3F7RA 4PY7A 4OD3L 1SEQH 2FNBA 4A2MA 4H8WL 1T1XA 3UC0H 1NCCL 5DZNA 5BRZE 2H8PA 3TA3A 5CBAA 4HS3A 5B39B 1CFQB 5EU6A 4P2RD 3DX7B 4L1DA 3DMMA 2ZUWA 1N59A 3NIFF 2IBGA 4J8RB 3JBG7 3K1DA 1BFVL 4UB0L 2VAJA 1CT8B 2GSIB 4GH7B 5I73B 3TZVC 2J12B 5CZXD 2E6PA 4JHAH 5HGAA 3K4DA 4YPGB 2KZWA 1P6FA 4F37K 3FMGL 3SDCA 4ODHL 4M02A 3HI5H 5C0BB 3ETBF 5C6TL 1MHPH 3KR3H 1ERNA 1QRNB 4M43H 4H8WH 5CEXA 2ZCLH 3ARYA 4GLRI 3OL2A 5LJYH 1CDHA 4NKMA 4G8FB 4JG1L 5DRNA 3ZKSD 4C83B 3D5OF 1KB5B 4Z7VB 2ZZUT 3O3AB 2CR3A 2GT9A 5FDWA 1BQSA 4EDWH 1YMMA 1CE1L 1DLFL 3NZHL 1ACYL 4PLNC 5KTEL 1S9YA 4HWZA 1NCNA 3U30C 1A6WH 5ALBH 1IRAY 4RBPH 1FFNA 1K4DB 3MNWA 2BZDA 3FN0H 4E5XA 5I17B 2HJFA 3VH8B 4MWFB 5JLZA 1J05B 4RWYH 3S36L 3DIFB 3QIUC 1F58H 4WFGD 3LD8C 3H0TB 3H9SA 2AV1A 1QR4A 4XBPB 1GC1C 5FHBL 1CBVH 2YD3A 2C3WA 3WL9B 1YNLH 5DD0L 4LLWB 3TESA 4L8SA 4EUPA 5K9OA 1JZ3A 1A0QL 3MRQA 4WJ5A 3UBXI 3M1BA 2C3GA 5A3ID 3AXLA 2GJ6D 4I4WA 1WBXB 1H5BC 3TN0B 3L3IB 1T03L 3C5SA 1U58B 2ZNXA 4LCUA 1BQLH 5DUPL 1MCIA 4L29B 3RY4A 5FA3B 3QIBB 4NHUA 2EIBA 2EDWA 5D96B 4NO0D 5BVPL 3LQAC 1IKNC 1OGTA 3OKDB 3CC5B 5DJXA 4MX7B 4YHKH 4AEEA 4NDMB 4L1HA 3S3PA 4DFIA 4I0KA 2VISA 4Y4KC 3Q5TA 3RIAK 2VR5A 5CMAB 2ARJQ 4LHQB 1S7RA 1RURL 3FO2A 4UIKH 1BZ9A 4P46C 3VFNB 3WJJA 1IQWH 2DWEB 5C7XH 3L3JB 1SJVA 3IDGB 5A16B 1D3CA 4HC1A 4P2OD 4MXWH 3QEGL 3BPNB 4YGVA 1CDBA 1RUQL 4X6DA 5J12B 2D0GA 5DA4A 4AEIL 4LMQI 2OZ4L 3HR5A 1EFXD 2NY4D 3EZJB 5IEHB 4PJAE 1JGEB 2QQLH 3IDXH 5FEBA 4OV6F 3LRGA 1XGTA 3AMKA 2FJFB 4X7FC 3BJLA 4ZAKB 2FX9H 2X41A 5E7FA 1IGMH 1D5XB 3CFBB 3ZYIA 2D7QA 5L6YH 3LEVL 3IETB 3CU1A 4OCYL 1I9JL 1MEXL 2OP4L 1G1CA 4X6CB 1Q72L 1RJZA 2YXMA 4OSUH 1RQ5A 2FB4H 1BD2E 5HJ3A 4YBLB 4J3WA 1MCCA 3VCLB 2XKUA 5IIEA 4PRBB 2H6PB 2SEBB 2XG5A 3DUUA 1P7QA 1RZFL 3P4OA 3NMEA 4KAQH 2H41A 5CILL 3IDYC 3BP7A 5AYUH 4KUCD 1V3LA 4GS7C 4PJXF 5F6HJ 3C5ZD 1T21B 2F53B 4PRPE 5I8KH 4CU7A 4LCIH 3RWGA 3O2VL 4OZGB 3GJFA 4HSQA 4ZTOH 4HK0A 3ZE1E 2XICA 2G75A 4LCWD 3LKSA 3MGTA 2GUOA 3HZMA 3GMPA 1XR8B 1LD9B 3JV4A 2BJML 3O45A 5D6CB 3MBED 1R5WA 3BSZH 4JRWA 1JF1B 1BFOB 3FAWA 5DZLA 2QSQA 3AY4A 3OAUH 4MLSA 5DJYB 4X6FA 5KSBB 4PJAF 5K9JL 4NZRL 4JN1H 4AEFA 2EH7H 4JJ5B 5INDA 4ONFH 1X7QA 4HH9A 5I2IB 2F5BL 1FBIL 3SJVD 1FGNL 3K2UH 4LU5H 5MEND 1S7XA 2VLRD 2RJMA 32C2B 1JV5B 4HIXH 2WNGA 5BS0D 3OAZK 1YEKL 4WY7L 4IRJB 3HE6D 3LVEA 2ATPA 4GRWB 4YDVA 3PWNB 1MLBA 4KI5E 4HX1A 4FFVC 4GMTH 4NZJA 4M61A 5KS9E 1A6AB 5I8CB 1R3JB 1GGYA 2BOBA 4LHUD 1D9KD 1WZ1L 2IADB 4XI5C 4XPTL 1HE7A 1KCKA 1UH3A 3CU7A 4OGAC 1LO4L 4NM4H 5E94A 2OTUB 1SBSH 3QIBA 1K9TA 4NQCB 5B38A 2ERJB 3WIHA 4JZOA 3TNNA 3HKFA 2JJWA 3QUKB 1GIGH 1FE8L 3EJZD 1TITA 5C9JB 2IH3A 3DARA 3BAEH 3AAZA 3GHBH 3RBGA 4KMQA 2ESVE 5DO2C 2CJUL 1NH6A 2W0FA 2D0HA 1LE5B 4PJIA 3VXNB 3HAEH 4N0YL 1HHHB 1TLKA 2VL5A 1MJUH 2XQYK 1A7BA 2EDQA 3GSNL 4UOW0 4JDVA 4HS8H 2GJZB 3V7MA 1L6XA 1A4KA 3QNYA 5IW3A 1JYXA 4YAQA 1U2CA 3TWCL 5DS8A 3UTTD 3IDGA 3CVHB 1T5WB 1U95A 4ONGH 4F15B 1P7KA 1XGPB 3SQOH 4OZFA 1BWMA 3MCKA 5CGYC 5CZVH 5IHBA 3V4PL 1WVZA 5JR1H 5IJVA 4PJDE 3U6RA 4PB9L 5EC2A 5FGCE 3STZA 2YPLB 4XC1L 1A7PH 2MHAA 4PJHA 2ZUYA 5KSBA 3U0TA 3A6CL 5DJAA 5C09E 4WO4D 3SE4A 5H37H 2DQJL 3UZVB 3WIHH 1NEZB 4DW2H 5H35B 5C0BA 5LWYL 4YFDB 8FABA 3FL7A 3V6FB 1WFNA 1AFVL 4P2RA 4DEPC 3MRKA 4I48A 2JIXD 4I3RH 3B2UC 5EU6D 1JHLH 5ETUB 2X4OA 3VXQA 2Q8BL 2BVQA 3B5GA 3DPBA 4HLJA 3PXJA 4JFOB 3U0WH 3OKKB 3O2WH 5I1AB 1UFUA 4ODBD 3AREA 4TUKL 4Y4KD 4OZIF 4JHZA 3GSWA 4E42B 2X9YA 3AY4C 3FAXA 5D4QA 5FYKD 3WYRA 3UBXG 4HUKB 1TJGL 1CK0H 2PYED 1WZKA 5IBLC 5I1JH 4Y5VA 3SHSA 3F12A 1WAAE 3EIFA 1AO7B 1A7QH 2CLVB 5F9OH 1X9QA 1ES0B 4RMVA 5C2BH 5B4MD 3DYMA 2D7PA 5A16A 4IOIA 3O6FA 4CKVX 1G7PA 3OB0H 3V5DB 1OAYL 3BWAA 3LH2H 4IRSA 2LU4A 5GRZA 3VFTB 4EDXA 2XZCL 1QG3A 1RIUH 2GY7B 3OGOE 5LGJA 4HBCH 5GS0C 3RVTC 4DZBB 2PW2A 4TVPD 4YWGL 1S7VB 3SKMA 3ARGC 4PJCB 1XCTB 1NPUA 3MLYH 2FEEL 2F19H 2CKNA 3NCCB 3WNPA 3VWKB 1G84A 5L2KA 2ESVA 4Z7UB 5DQ9A 4NHCH 4OFVA 4ZFFA 1AD9A 3BW9A 2IAND 1ETZB 4V1DA 4I0PC 3SCMD 3IDJA 3SDXF 1E27B 4TUOB 5CJXA 2AK4E 1RUAL 2WWMD 3I50L 1A7OH 2EICA 4OF8A 3BZFA 3TP4A 4XCFH 3PGCB 5IW1A 4C56B 3W11C 1IFHH 5JW4M 5KANI 4GG6E 1ZHNB 4LCCC 3DX8A 5AUMA 1N5YL 1QLFA 3BHBA 4G5ZL 1I8IB 2ITDA 2CK2A 3RIFK 2A77H 3RY6C 2XFXB 2X44D 1RK0B 5D6DC 2PR4H 4MJ4A 3VFSB 5EO0A 3B8YA 1WT5A 1U91A 2VZTA 4YHMH 4CW1A 2R9HD 3HE6B 2WUCL 4BSVA 4NHCL 1T04B 3HLAB 3E0GA 4X4YA 5MHSD 1S7TA 2GYSA 5K9QI 1ORQB 1AD0B 4Y4KA 2IPTL 5C0NC 3U9UA 1R5IB 3FTGB 4LVNB 2AKRA 2FGZA 2AK4B 3PQYE 5IM7A 5DMGC 1Y18A 4F8QA 3HHRB 1CFNB 2E8YA 3KPLB 3MRFB 3QIWD 2WBJA 4XAWH 3SEPA 2PXYC 1CN4A 3BESR 1R5VA 1G7MA 5IHZB 1A6AA 3MNVA 1UXSB 3CSGA 4NQCE 1X5YA 4WI3A 3TT3L 4ZG1A 4L8CA 1CVSC 4MD4B 5JW5A 1MRFL 5JUEL 2OSLA 3B3IB 2CIIA 1KTRL 1MCBA 2A9NH 1G9MC 2EXYC 5CD3A 1QBLH 1EIBA 5D7JA 4L8SC 3RGVA 5IBTH 4DKDC 4EKXA 5TF0A 1NGYB 2BDNL 2J3SA 4ETQA 2V2TB 1GGIH 5F7HA 5FB8B 1F6LL 1ZHKB 1I4FB 3LMJL 4LL9A 5CCKL 4P3CH 5E2JA 1DUZA 5A40E 4PJ8B 4LLMB 4CVXA 2IQAA 3KR3L 3HFMH 4L5FH 1F3RB 1FE8H 1UM5L 1XZ0A 1U92A 2BNUA 2HA1A 3EOTL 4RFEB 1LO4H 3DX6A 4H26B 4XNUL 4RDQF 1F4AA 3K4ZA 4ORZC 5IESL 2HKHL 4X6EA 3ZDYE 4YAQB 4LAJH 2VZ3A 3I6GB 1X7QB 1IGFL 2WMPA 2R4SL 1HYRC 3LN5B 1QA9B 2Q86B 4F57L 2WLZA 2VOTA 2NXZC 1JNLL 1X4YA 3TWCH 3KJ6L 1HINL 5HYSB 5HI4D 1HKLH 3CH8A 2C1OB 2BOBB 5E8PA 1D9KA 4TOYL 1S7VA 5CIPA 1A7NH 4BFBD 2LV4A 4YBQC 5I1LA 2Z8SA 3QFDB 4XP9H 3I3EA 4MCZB 1QBML 2X4SB 3BKCH 1T1WB 1CGSH 4G6KH 4M1DH 1XR8A 1ZLVH 2WIMA 2NY2D 3HNTL 4JFPB 1IILE 3CZFA 3GI9H 2VO5A 2EKSA 1BZ7A 3STLA 4GAFB 3K81A 3UTQB 1FIEA 4HUUA 4UDUB 1GRWA 1C08B 3H42H 4GAYA 3MRCB 2NTFA 1ACZA 3D9AH 1XF2A 1JYWA 5H8DA 1SY6A 1SM3H 4PGJA 1F58L 1LE5A 1EV2E 3BIKA 4O02L 1G7JB 5TPWL 3FN9A 3D0VB 4G9FB 4PG9B 5C2UB 2R2HB 3HAEG 3MRNA 1NBQA 5BXFA 4MB5A 4PUBH 1IM9A 2YC1A 4XT1C 5E6IB 3TF7C 1E6JL 4BH7B 3FOMB 5C0AB 4NO3B 3SGEH 3LKQB 3QZWA 3P11L 4PJCF 4JZNA 1QRNE 4ZUSA 4PGCB 3CUPB 1GHFL 3L7EB 5IVNA 3WO3B 1BJMA 5B8CC 4NN5C 5FA4A 1L7IH 2NY6D 1A6TA 4PJIE 4LNRA 3LS4H 3UTOA 1EGJA 3KHOA 2PUQT 3MLWH 4GG8A 2NZIA 1I3UA 1MCEA 4HIIA 5C07A 2YSSA 1JWSA 3S3SA 5C0AD 1JWUB 4RGNC 4N8CH 2Z4QB 4M1GL 1T0MA 4XTRD 3WUWG 4K3DH 3CH1A 3TBSA 2FLRT 3I02B 1ADQA 4I0PD 2XNAA 5F89A 3ALPA 3QNZA 5GJTL 1I8LC 3EO1A 5F1NA 5HGBA 4S1SH 1D5ZA 3DRTB 3NCEB 1WCBB 3ORJA 3NPSC 2X40A 1LO5B 3ARFC 4LKCA 5CWSB 4P4RB 5AZEL 4OLVH 1LEKB 3BEVA 4XVTL 5EOQH 3ZMRA 1MFAL 3LQMA 2EYTA 1TCRB 5E1AA 3MUGA 2Z35B 2D7NA 3N1PC 4Y5XC 2VXQH 3O2VH 1DVFC 1IQDA 3BKYH 4JM2A 5HHVH 2F53E 4PRPB 4R90H 3FQUA 2Z31D 3ULVL 3DRQA 4EI5A 5C0EB 5J0BA 3ESUF 4XP6H 4ZAKC 1C12B 4M7KH 4Q9QH 3JUZA 1DBKH 4I77H 3EW3B 4JPKH 2GHWB 3EYOB 4N5UA 2GK0B 3CDGA 1Q94B 5C6PB 4LLDB 1PDKA 4Y19D 1OAQL 2ILLA 4LMQE 4ZUVB 1F4YH 1MCSA 5FYJL 2AABL 1NBYA 1YMMB 2CUMA 4HCRH 1F4WL 4H26A 3DX6B 1XIWD 4N1HB 5KVFL 1A1NB 1EGJH 1AP2B 4BSVB 2UWEB 1FRGL 2DTMH 2OQJB 1RZFH 4MDIB 1YJDL 1YYML 1HSAB 3MRGB 3QPXL 4AMKL 4MGXA 1JPTL 4U3CA 2VDOH 5K9JH 1N2RB 5J1AB 4BH7A 4ZUUA 1EJ6A 1IGTA 2HRPL 4RZCA 3ZKMD 2IBBA 4XCCL 4BZ2L 2AAVA 2R4RL 4KJWC 4Y4FA 1FP5A 4RISH 2A6KA 3IFNL 4FQQB 5C8JB 1DFBL 4GMTL 1PEWA 1IGJB 1QHPA 4OKVA 5A43C 3F7YB 1KB5H 1NCDH 2DICA 3VA6A 1OARL 1YEKH 4GG8B 5IVXB 4O2CA 1GGCH 1IAIH 4RMQA 4NHUB 1YEEH 1BJ8A 3QO0A 2VSDA 1NKOA 4PTTB 4QOKA 4XWOD 2DM2A 1HDMB 2JB6A 5F1IA 1RK0A 4QRPD 1EGJL 1W8OA 4B0MM 3DBXA 4HFWB 5EB9A 5DQDL 1XF4B 3MV8A 3VG0L 1QNZL 2BNRD 5LGJB 2HJKA 2IAMC 4WGVB 1ORQA 2Y07L 5HYEA 1CLCA 2H1PL 3ZSTA 2YWYA 4WUUA 5JW3L 4XCCH 3QEQD 4G42A 1IC1A 2E7LC 4JFQB 1TCMA 1J05A 3CXDL 4LVHC 1RIVH 5DD0H 5IK3A 4X4XB 4NNXB 2AK4A 4N0UB 4KY1H 4Q6YA 4XX1G 1WIOA 1YEJH 3FT2B 2FGWL 2RFXB 4W70A 1EEUA 1CR9L 3HE7A 1A5FL 4BSWB 1I8KA 4UUJB 1ZLWK 3G6AB 4XHQA 5GSRA 1V05A 1LO2L 4OCWL 3NOIA 3IETA 2X70A 3VD4A 1CFBA 4G6JH 1RZ7L 3VFVB 1CG9A 4LDEB 5EBMA 1D9KB 3L3DB 1QSFA 4KRPD 3VWJC 3QUXB 2XFXA 1T0NB 3ROOB 3S96A 5C3TA 3ISWA 5TF1H 5TQ2L 1FIGH 2J8UA 3MJGX 3BD4A 4NKMB 3QDJA 4UOW1 2X4TA 4F7EB 5I1IL 5JIPA 5E99L 4TTGA 4MMZC 3GB7B 4EN3A 5GZND 2EZ0C 1UJ3C 4L4TB 3VXPB 4MCYA 2E6QA 4RX4A 1NFKA 4I3SH 4TVPH 5HHPB 5F71A 5E4IA 4H1LA 4ZXBC 3HNSH 3HNVL 5HSFA 4N90E 5JOFA 5KZCB 1MCKA 1S9XB 4MZ2A 1YUHB 3FQRB 1I3GL 3T2NH 3VFOB 5F1SA 4BZYA 3VXUA 3QBTB 1BREA 3E6HB 1T1XB 3GZKA 3MJ9H 2XOTA 4QXWA 1A6UL 4DK6A 1JZ8A 3C9NA 4L3EE 5TE4H 3VFWB 3H9SB 1S9VB 1LEGB 4P2YA 4HV8B 4V2BA 1ONQB 1K8IB 2E6JA 4I5BA 5FO7A 1DBBH 4P2OC 1QPPA 1QEWA 2E8ZA 2Y36L 3QEQE 4CVZB 1MFDL 1SVZA 2AERT 2R69H 3R8QA 1DVFA 3NAAH 1GOHA 2NX5D 4LBEB 1EK3A 1DBAL 3RDTD 5KSBF 3L3HA 3OG6B 1AXTH 2APVA 2BNQD 4QTHB 3I3BA 4OF5A 4WWKC 2E9BA 5IOPA 4WCYL 4PD4K 5IK3B 3ULVH 5J1AA 2BNQA 1U8MB 5A2LH 2A9MH 1DE4B 3CFEB 1HYSD 4M7KL 5KSAA 4Q9QL 2QSVA 4GRMB 3OV6A 1QSEB 1QSZA 3FB8A 3OHXA 4G43B 1QPXA 4W6YB 5F9WC 3OKMA 4OBSA 3REVB 2J88H 1A4JB 3D9AL 5DJAB 1DBJH 3D6GA 3R4DA 1LEKA 5DD3L 5AAWA 5SWSE 1GPOH 2Z31C 4NJAH 4P9HL 1KENL 1KF9B 3R1GH 4IHOA 5KVEH 4N8CL 4LK4A 1TDQA 2ADGB 4EBQL 4FQJH 3VDAA 4JFXA 1AGDB 1D5BB 4LPVA 5BRZB 5DUBB 4OLUH 4DQOL 4YWGH 3PL6B 1R0AL 2Y6SD 3DVGA 3ET9F 5EU7E 4MNHA 1GYAA 5CEZE 1R3KA 1JE6A 4WU7A 1BVKA 3LRHA 3CNKA 3QO1B 3WFBH 5C0CD 3LEYL 3WN5C 2J6EA 4WV1A 3ZT6A 4OLZL 4E42A 2VWEC 1Z6JT 2AQ2A 1CYGA 3V4VL 1FL5A 1ZXQA 1INQA 2A74B 4N8VG 3OKEA 2OK0H 3DVNB 1SYSA 1MIMH 5KAQG 4LEXL 4Y88A 2J8OA 1JV5A 4NO2A 3MLXL 4K23H 3VFGH 3ZDXF 4HKXA 3U4BL 1DQJB 4JZJA 2VXVL 2VZ1A 5DD1H 5DWUL 5GGSA 5D1QC 1J8HB 3RX5A 3DLQR 3V5HA 3VFRA 2D0FA 4YHNB 4P9HH 3ULSB 3J7HA 4JFHE 2W9EH 4NC2B 1FZMB 2DJSA 3H6JA 3PF2A 4HAFA 4U1HA 2G60L 2DJ4A 1TENA 4WFED 2DQCL 4L3CB 3TJHD 1Q9LB 3BWUC 1ODAA 3QIWB 4PR5B 1ZWIB 1IL1B 4FFVD 4JB9H 1FAKT 1KIRA 2H2PD 4HC1L 4RAVB 3LSOA 1EEQA 1VESA 3EYOA 1OWWA 3V0WL 4LLAA 5TDNB 3GMPB 4KKLC 1G6VK 4ELMF 1WK0A 4WUUD 1JI2A 4JKMA 4QOKE 3SE3A 1H0DA 2VDMH 3WFCL 3U0PA 5E2TL 4DAGH 2CMRL 3TIEB 1MAKA 3GMRB 4ZFGL 1KGCE 1MPAH 1I3VA 4EQ3A 4RMTA 3OGCA 4DKFL 3EJYC 3VXSE 4P2QA 4YK4C 4JGUA 1WZLA 3FB5B 3LHPL 4RDQG 1K3ZA 3U7YL 3DUHA 3LRSB 1MCPH 1ZLSH 1FBIH 1ZT7A 2XN9B 1IGFH 4G6JL 1JCKA 3IKCB 1EXUB 1P7KB 1XGPA 3FZUD 5DRXA 4ODUB 3UJTL 1Y6MR 4UNUA 3I75B 3CGTA 3DOSA 1FZKA 4DN4H 1QACA 3BISA 1BF8A 4PTUB 4NO5A 3GSQB 3SBWA 4KZEH 5C0FB 4HX1B 1OB1A 4KY1L 1NLBL 1U8HB 2VZUA 4D8PA 4LARL 4Z7QE 3U0TB 2MKLC 1U3HC 4C58B 1DQDL 1LDSA 2HT2C 1XGYL 4U0RB 4IOFD 1EEYB 5D1XB 2VLRA 2ZCKL 1KPRB 2JELH 4NZTL 1MHHA 4POYA 3WO4B 4PD4J 3IFLH 2R1YB 4G8GE 2FZ3A 3F7VB 1NMCC 1I7ZA 5E9DB 4K3HA 3MBXL 1VERA 1QLRB 3LHPH 1FVEB 3W39A 3GMOB 4JY5L 1YECH 4MQ7B 2R29H 3GSVA 4Z5RA 5DRWA 2NNAB 4LDLB 2ICWB 2F54E 5ALBL 2AJUH 1RUPH 5GGTA 2LU7A 5CGYD 3BRGC 2Z93B 1FFPB 3VXMA 2NX5E 3UYRL 1AQKL 3E6FA 2Q6WA 3QFJB 1AGFB 4K8RL 1FNEB 32C2A 5TDNA 1YNTB 3CXDH 3RY6A 4W4NA 2Q7YB 4FXKB 4M6OH 1ZKAA 5T3XH 1J9CT 4MA1C 2Y7QB 3IJSB 3TO4A 3QJHA 4KUZL 4QXUH 3QEGH 4O58H 1AD0A 3KXFA 3R0MA 3U30B 1J1PL 1RVFL 4QHKI 2V5RA 2YD7A 3I6KB 1W0WB 4WHYH 4GMSL 1B3JA 3KYNA 5DTFA 4K7FB 4MLIA 4ACPA 2A74A 3VXOB 4UTAH 4PGEA 5KSAC 1SJXA 1WIUA 3L1OH 3WIHL 1NDMA 1XFPA 3CFKB 3OWEA 2IH1A 4KDTA 3I6GA 2AXGA 4WWKA 5MEPB 3TEUA 2VXUH 4PJGB 3VFRB 4Z0XB 5DGRA 4YPGA 1TNNA 2PO6C 2Q8AL 2Q8AH 4ODSH 5F3HA 2Q3ZA 2JJTA 1IBGL 5EO9A 4Y2DA 1AHWB 1G6RA 1F2XK 4APQC 1ZWIA 4X4ZA 4ONGL 4JLRA 4FZEL 3OKNA 1EERB 4ZOCA 4J12A 1TTFA 4HXBL 1JPST 4LOUD 1Q38A 2IGFL 3CK0L 1MOEA 3SKUD 1OGAE 1NGXA 4UTAL 5ANMB 3RKPA 1T20A 1IM9D 3NFNB 5ISZD 4S1RL 4P23C 1I4FA 2R0ZL 2C3HA 3MA9L 5IEKB 5IMLA 1JK8B 2BVPB 1DBJL 2WUBH 4RISL 4JFXB 1DUZB 3MA7A 2VYRE 1YEGH 4D0DA 1S9VA 1HXMA 3N50A 2XWJB 5EFIA 5T5FH 5TQ0H 4ZDHA 3W2DH 1OTSD 2FX8L 3ARXA 3CD4A 4YBHA 1S7RB 3EFDL 4JVPA 4YR6B 2R9HC 3HC0B 3PWVA 4HBCL 5MHSE 1UCBH 1YY9C 1DQML 2YKLL 2EDLA 2A6DB 4UILH 4K7PX 3K2MC 1X6LA 1AXTL 5E6YA 4ZFOB 2DQEH 2XWTA 1KPUA 2AEPH 3V8OA 3VW3H 1H3XA 4WCYH 4Z7NF 3H2WA 1JIBA 1E0OB 2Z91A 4F9LC 1WISA 3D2UA 5C0CB 4C4KT 2P8MB 1JPFB 5C09A 4JPKL 1UADC 4MA3B 4AJ0A 5AUMB 1YUHA 3FQRA 2DWDB 1QYGL 4X5WB 4K94H 4J7RA 2B1HH 2YKLH 3RVWC 4GW1A 5GHWH 1KJ2H 1P4IL 3RPKA 1Q9LA 1ZMYA 1KJMB 5D2NA 4RRPG 4NKIH 2YK1H 5DMIH 2X7LB 5F8QC 3I6LD 1SBSL 4XZUB 5DK2B 4C4KO 3GM0A 2J8UE 4Y0GA 5KSBE 5KS9F 3BSZL 4NQEE 1EMTL 4M6NL 2VZVA 5EO0B 2J1KA 2KH2B 5C0ND 2Y1VA 1FFNB 3MNWB 1CXLA 2O5XH 3QEHB 4R4FL 4UT7L 4XNXH 2HYMA 4M3KB 1KC5L 4U1NB 2HMID 1INEL 4X4YB 2AGJH 3BQUC 1T5XA 5D71H 4ODWB 4LU5L 5GS3A 5EU3A 5I74B 1O0VA 4DK3A 4HS8L 1VADA 3B2VH 2X4RA 2YD2A 1R5VB 5FUCC 4M62H 4RA3A 3QG7L 5EOCL 5DURD 1FGVL 2WBJB 4U1KB 4LSSH 4EDWL 2EXYD 4LVOB 3A67L 1R3IH 2APFA 1EMTH 5ERWA 3V0VA 5D2LF 4LCUB 1EDQA 5DMIL 2GJ6E 4Z7WB 3N1MC 5D7JB 1MVFA 2V17L 2VQ1B 5I6XC 2ZCHH 5HHOD 3ZE1F 5IESH 1HQ4B 3RI5K 2EDOA 3RWDB 5AD0B 3WS6C 4Z76B 3BAEL 1A2YA 3RZCA 3LMJH 2J5LB 2AJ3A 3CFCL 1F6FB 4DCQB 2CRYA 2V5YA 3QNXA 2DI8A 3VXRE 1CICA 3X3FH 3UMTA 3C5JA 1MCQA 3O8XC 4OLXL 3MFFA 1EO5A 5DJ8B 1CLOL 2WWKO 2GTWA 5KZCD 5L8JB 4E5XB 5I17A 1NGXB 3FRUA 4NBXB 3TC9A 1QBMH 3P0GB 4O4YH 3DGGA 2DQDH 4Y1AB 4PJ5B 4K8RD 5GGVY 5DSCB 2OI9C 3VU2A 2XXMB 2R1XA 2NXZD 4YHZL 5ICZA 3RL1B 5C71A 3LQAH 1IC7L 4LLDA 3K7UA 4X7SH 1MRFH 4XNYH 2CDGA 4TQEH 1JVKA 4ZOEA 3JXAA 5BV7B 3P9LA 5AG9A 3PHOA 1FZOB 3MCLH 4P49A 4U6TA 5GIRB 4QHLB 2YRPA 4GXVH 1A9BA 1U8LB 3MLRH 4M03A 3QXVA 3F8UB 4PYHA 5IKCA 5BJTA 3AU1A 3OG4B 1ADQL 1WEJH 1SY6H 3MXVH 3O3DA 4LSVL 4P5MB 1BGXL 1JN6B 2HJLA 4WHDA 3D85A 2A6JB 3LPGA 1S7SB 1E4XI 4V1DD 3E3QE 4OGZA 5D1ZA 2IANA 4PJGA 5LVEA 4L5FL 4JRXE 3GBNL 4AH2B 4FQQA 3ZYZA 1MCOL 5EZIH 3QA3A 4NZDA 5ESAA 1B4JL 1OQXA 1YEDA 1P4LB 4JHWL 4X4MA 4HGMA 3D3VA 1P69B 5FK9A 4NQCA 5B38B 3LN4A 3CVHH 4FQXB 4YZFE 1T21A 3EDDA 1MCRA 3OGCB 1RJCA 4UIMB 1PLGH 4XCFL 4JM2B 3GJEA 1OD7A 4YDJB 1IEBA 1G6RH 3BDXA 3QHFL 3JWDC 1AIFB 3HC3H 1MWAB 2Q7YA 1I9IL 4QXTA 4JPIA 4ESKA 2F74A 1N0XH 4QHNB 5EZIL 2QEJA 4NWUH 4EUPH 1E4JA 2WP3T 2CUHA 1CF8H 35C8L 2W9DH 4WHTB 2W9DL 2X4QA 2YWZA 4XTRC 4HUWA 1VKXB 4R4ND 3G6DH 4GRWH 1A64A 2UWEA 1TZIB 2OS7A 3SDAB 1FLRL 2YXFA 4WTWA 4EVNA 5FF6A 2R8SL 3MJ6A 1TXKA 5E4EC 2FWOA 1S5HA 5FKPA 5ADOL 3K8MA 1B0WA 5JORB 1NBVH 1WICA 5F7LB 2AJYH 1WUNT 1U41A 4I13B 5DK0A 1DVFD 4OQ1A 1F4YL 2DF3A 4Z0XA 4NC0B 1PG7L 4POZD 1PLGL 1H3GA 5J1TC 3PXHA 4ZUUB 1QLRA 4GG6A 3FOLB 3LB6C 4PGDA 2UZYB 4FA8A 4IIQA 1MPAL 3DI2B 4XMPH 1N8ZA 2XZCH 5GGQH 5MEPA 3WXVH 4UV7H 2CLZA 3QPQC 3ZKMC 4L4VA 4MQXC 1GGCL 3MROA 5ISZE 1DTUA 2B7DT 4O51B 3MC0A 1XF5B 2DKMA 4LHUG 2JJSC 4GQPH 2YUXA 1UWXK 3MRBA 2OYPA 3QI9D 2I9TA 1UCTA 4OLZH 3BH8A 1PY9A 4JFFE 5DC9B 3LZFL 3QIUA 3WJLA 4LFHG 4YXLL 3U79A 3LKOA 3PV6A 4DTGH 2EEDA 3MLPA 4HH8A 4HC1H 4RX4D 3BQUB 1ZHLA 4QHKJ 3NN8A 2GQHA 2E7CA 4R7DA 3BRDA 2DTML 4OF7A 5ADPH 3QUML 1FG2A 3FFCA 1DLHB 4HEME 3IVKB 4CN1A 3OZ9H 2NLJB 5DC0A 2G2RA 3IFOB 2RHEA 1MH5B 2YRLA 4XC1H 5EO1A 4ODVH 4IMLA 5F7MC 2ERJC 2GITB 3TYFA 1Q9OA 2EDBA 5FGBA 4Y16D 5AAMA 3V95A 4LVNC 4ERSH 3CSYA 2UZXB 5IB2B 2AJSL 3MLVH 4HJ0D 5E03A 4YFLI 4XBGA 4U3XA 1FJ1B 3CAFA 2F54D 2W60B 1AQDA 9CGTA 3KLSA 4KHTH 2MCPL 1XF3B 3Q5YA 4X9HA 5AYQA 2P4AB 4NQVA 4HWBA 5HGHA 5I1DA 3GBLA 3EOTH 3WFHA 3BGMA 2MKWA 3RWHB 4IDJH 3U4AA 3DNKA 5C07E 3IDMA 3T0BA 4FXLA 1XMWA 4HUVB 5ADPL 1IVLA 3FOLA 4PGDB 1S9KC 1BM3H 5MP6L 1BFVH 4M6NH 2EYRB 4KRLB 4F7MA 5E5MA 4JKPH 1WF5A 4JKPL 1RFDH 3KGRA 4R8WL 4X4ME 5IT2H 5I71C 3R0NA 4TQEL 1UGNA 3MBEA 4QYOA 4KJQC 1G7IB 1N4XH 2HTKC 5C2BL 2CKBB 2PTTA 4WW1B 2QKIB 4PRID 2I9TB 3D69B 1L9MA 1LMKA 2ZOKB 4LSDA 3CFDA 1D5MA 4ZYKA 3DUSA 1U91B 1OSZA 4Q9BA 1PKQE 4JPVH 2P5EB 4P3WA 2AXJA 4HV8A 4PS4H 3TNMB 3FONA 1FFRA 4MQTB 2CO7B 3SQOL 3P9LB 2IQ9H 2W07A 4ODXB 5FV1L 4JRYA 2AKRB 1CL7H 4NKQB 2KZ1B 4HWBH 5T3ZE 5I6XB 4FG6C 4HPYH 4UU9B 3F7QA 4H20L 3VMOA 1BM3L 1F6AB 3TBWA 2ZCHL 3H0TA 5EH1A 3NFSH 1QFOA 4B50A 4GKOA 3JWDH 4PB0L 3GB7A 4DKEL 1P4LA 1H3PH 4X6DB 4YHNA 1MHEA 1F8TH 5E08L 3CFEA 1FH5L 5FGCB 3UYRH 3X13A 4PBXA 3I2CL 2OBGA 2CK0L 2EC8A 5CEYA 1I8IA 1KPVB 3H7LA 2ICES 3FT3B 5C7XL 5I1CH 3HNVH 3HNSL 4RAVA 4XXDA 4YHOL 2A77L 3LS5L 3CK0H 4I3SL 3O6FC 5FUZL 3VJ6A 4EI5D 5CEXB 3B9DA 4FZEH 3V52L 2IQAB 4JM2D 3FO9A 5C08A 1K8IA 3CC5A 3HUJF 4RAHA 3CDYA 2OJEB 1T1YB 5JOPD 2EYSB 1GHFH 4NPYB 4CW1B 5DD5L 5ERWB 3I85A 5ACZA 4W4OA 1EO8H 2EDXA 3FTGA 3WKML 4X6EB 4M7ZC 2B39A 3SE9L 3SKMB 3OB0K 3CFJA 5D7IB 3MMEA 3WHE0 3MRPB 2BOCA 4NO0A 1NGPL 3W9EA 1WWCA 3DV4A 5D1ZC 3DVIA 1H3UA 5E2VH 3SDDC 4LLWA 2NX5B 1A1MB 3WN5B 4ELMB 2VL4A 3C09C 4XVSH 3VD5A 3PQYB 1GCFA 5GS1C 4GG6F 3NTCH 4POZC 4P48A 5J6HA 3SE4C 2N1KA 5LAXB 4H25B 5T1KB 4S1RH 4LCIL 4E41D 5CJOL 1MCJA 4AEIH 1ZS8A 2F5AH 2HVKB 2EH8L 3MJ7A 4KQ4H 3F12B 1CXKA 3VFOA 2IG2L 2QSCL 3MOAH 4RNRA 3ZYOA 4HUXB 4XNMA 3BKJH 1I7TA 3HC4L 3O3AA 5CUSL 1EEZA 3CX2A 1KNOA 1TFHA 2AJYL 4FQXD 3TBYB 3BP4A 3QZWG 1UCBL 1OOAA 1UKSA 5E5MB 4P2RE 1S5IH 1J0JA 3RIAF 3WXVL 2ZSVB 3C08L 3MGOA 3LOWA 2JB5L 3O3BB 4OZHF 4XPHH 1AKJA 4PRHA 4QWWD 4HT1L 5FUOL 3FQUB 1FG2B 3AMLA 3S36X 2YPVH 4F9PC 4KTEH 4KZDH 3PHQB 4WW1A 1ZE3C 3NTCL 3ROLA 5IG7B 4E41A 3QWOB 3KPRB 4JDTH 2NMSA 5C09D 3ES6B 3MV9D 2G5RA 2FX9L 2X89A 1NFDB 4JREC 5T33L 3FONB 3MA7B 1PSKL 3UTPE 4D0DB 2IH3B 5BZDB 4JG0L 1JGDB 2XI9A 1T89C 2BVTA 3UJTH 5HPMA 1M71B 4KHXH 1W72A 1SJEA 2QHLA 3IXTB 1NCCH 2YSSB 3WIFA 5CZXC 3VRJB 4M62L 2H2PC 3ARBC 4YDLC 3ZTNH 1JMZA 1AQDB 4YX2L 5ACMA 2XPGA 4OQTA 4AT6B 4O51A 3BXNB 4HK3J 5IHUH 1FVCA 3BEWA 2RQ8A 4G9DA 3MR9B 4P2QD 5F96H 1NC4B 5JUEH 1U3HD 1MQKH 4KK9C 4KMTH 2IFGA 1NAKH 1C7TA 1FHGA 1EAPB 4RQQB 3VXSB 1JGLH 4JB9L 3DECA 4X8XA 3WFHB 2VDML 5KG9A 1Z2KA 4JRXD 4OLXH 5DK3A 1MJUL 1AGBA 4NP4L 5HHMB 1ZSDB 4BA8A 3KYMA 1MELA 2Q6WB 3X3FL 4GQ9L 3HG1A 1WC7A 1B0RA 5KSUB 4UBDD 3I84A 3UTSA