5CAAA

Structure of leishmania nucleoside diphosphate kinase mutant p100s/del5-cterm
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
137
structure length
137
Chain Sequence
SSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTTEQAQGHYKDLCSKPFFPALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQSGTIRGDFAVDVGRNVCHGSDSVESAEREIAFWFKADEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of the C-terminus and Kpn loop in the quaternary structure stability of nucleoside diphosphate kinase from Leishmania parasites.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 40
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 5caaA00
1BE4A 4CP5A 1HIYA 3FKBA 3ZTQA 4ANEA 1S59A 3B54A 3R9LA 2HVEA 1NDPA 1WKLA 3ETMA 4DUTA 2BEFA 4W98A 3ENAA 4UOFA 4KPCA 1LWXA 4WBFA 5CAAA 1XQIA 4ENOA 2DY9A 4F36A 4ANCA 3MPDA 4S0MA 1NDKA 2VU5A 3FBCA 3NGRA 3VGTA 3G2XA 3B6BA 3NGTA 3EVMA 3BBBA 2CWKA 4FKXA 5IOLA 1NSKL 3FC9A 1XIQA 3ZTOA 1F6TA 1S57A 1NSQA 3EJMA 4O0NA 1BHNA 2B8PA 1NSPA 1ZS6A 4DZ6A 3EM1A 3FCWA 3EE3A 3Q83A 4F4AA 3BH7B 1NDCA 3EMTA 3VGVA 1BUXA 3FBFA 3VVUA 2DXDA 3FCVA 3VGUA 3EVOA 3FBBA 3L7UA 3Q86A 4C6AA 1U8WA 5C7PA 1KDNA 3GPAA 3NGUA 1UCNA 1PAEX 1EHWA 3ELHA 1MN7A 1VYAA 3PJ9A 3ZTRA 4FKYA 2DXFA 1W7WA 3ZTSA 3GP9A 3NGSA 1K44A 3BH6B 2ZUAA 3BBCA 3PRVA 3Q89A 3DKDA 2AZ3A 1B99A 1HLWA 1NPKA 4HR2A 2DYAA 1F3FA 3VGSA 1PKUA 2NCKL 3Q8YA 2B8QA 3DDIA 1JXVA 2BX6A 4EK2A 1MN9A 1NDLA 1NHKL 3Q8VA 2DXEA 1NB2A 2HVDA 5CABA 4UOHA 3JS9A 2AZ1A 1LEOA 3BBFA 1B4SA 1NUEA 3ZTPA 3Q8UA 1WKJA 4UOGA 5BXIA 3WX8A 1HHQA 1S5ZA 1WKKA 1NCLA 4ANDA 3EICA 4DI6A 1NLKL 3VVTA 3FBEA 3EVWA 2HURA
chains in the Genus database with same CATH superfamily
2BM0A 5KG3A 1E6YB 2BJEA 4QWBA 1RHQB 4MH8A 1T9TA 4PWDB 2B5JB 1H0HB 1ZAVA 2DGUA 2RQKA 4AT1B 3CUNA 4X64J 1S59A 2NXNA 2P2CB 3BB5A 3S01A 2XLIA 1WF2A 3KLHA 5D78A 1GXTA 2XMUA 4NLOA 2V2KA 1L3VA 1K8AT 2PMWA 2AJ0A 1Y4ZB 4TXSA 4KTQA 2UXDJ 3FMBA 2MQNA 4RW6B 2CYYA 3LALA 1VC0A 3KUEA 2V4QA 2DNOA 3BPDA 4LVNP 1AFIA 1U6FA 2G2YA 2NUUG 3TZYA 3A1YG 4O44A 4OLPA 4NMXA 2R7UA 2OGUA 2D9PA 3DCAA 2M88A 2JNJA 4C8LA 4M8LA 2VH7A 2HHHF 4C9DA 2L48A 3LH2S 3M30B 3B4DA 4DQRA 1K0TA 1G4CA 1SKSA 2R8KA 2FJXA 1CSJA 1NSKL 4YUDA 4B3MF 3R3TA 2XS7A 1AYEA 1LW0A 2KO1A 1X60A 4F04B 2RU3A 1KOOA 1VK8A 4ZCLA 4LFCJ 1JXLA 4K4ZA 5G4DA 1URRA 4KHMA 1S1VB 1F9HA 3PRBA 2NZ4A 3MPYA 4ECTA 4Z7YA 5M2PA 1VQNS 1LOUA 1HBMA 3QFHA 4P7VA 1IN0A 3IRXB 5KFIA 4LSZB 1HHTP 3J7YI 5E41A 5A6WA 1IKYB 1ROFA 3MFHA 2DHXA 2X51A 4RZRA 2UU9J 3HHEA 2GJ2A 4OZNA 4NLSA 3PIPQ 4CLFA 3W65A 2ATCB 3EVOA 2RF2B 4LFAJ 3NAIA 2YQ1A 3MM6A 3J80Y 1G2EA 2NLWA 4PG4A 4DV5J 1DTQB 5KFAA 3DLKB 3PJWA 5K8MA 4DSFA 1GAOA 2X3GA 1HNXF 4P6QA 2EXUA 1UA1A 4ECYA 5CYJA 2H48B 1RTDB 2CXEA 2DGSA 4URGA 2UUAJ 2R42A 2GIRA 4Q2MA 1JLCA 2C3UA 3C66A 2W4DA 1U49A 1N48A 1DBDA 2AYGA 3NOGA 1YKWA 4FVCA 1NU4A 1Q95G 4PPZA 5B09A 2P9GA 1N6QB 4XK8C 4DSJA 2R7XA 5J2QA 3NNAA 3KLFA 2MMYA 4KFBB 4DSLA 1UJ4A 3GJTB 4J90A 1LWFA 2HHXA 4EO8A 2NXJA 5A8WA 2NCKL 5ADZA 1NH8A 2VKRA 4C8NA 3UDEA 3I5CA 2NSBA 4OJ1A 2UXCJ 4PEOA 2QMUB 2XSFA 4IOBA 2NYIA 2HK3A 4D3GA 4HT5A 3VAGA 1IKXB 1HNVB 3ZFVA 2QE5A 2RRAA 1T02A 1HWUA 1R6VA 2Z2ZA 3PFOA 4UOHA 4K7QA 4I2PB 1QAXA 2CJ9A 2J7WA 3SI8A 2JVRA 2E9RX 2K2PA 3KJVB 2D1CA 4NEZA 2DNQA 3HFKA 4X65F 2J9DA 3H5UA 1BQNA 1HI1A 2F65A 4O3QA 5HAOA 3WX8A 3FSIA 2ZJPQ 5HMYA 4ECRA 1WSVA 2BABA 4ZKAA 1WDTA 2DCLA 2ZH2A 1ZTWA 3ZNJ1 1D3WA 1FRLA 1NPRA 1TUVA 2ASYA 2KRBA 2L9NA 3MTKA 4B02A 5IV3A 2XS2A 4X2BA 3KG4A 3BS9A 2P6SA 2CDQA 1JKHB 1OYEA 2HRYA 5GMEA 3UNGC 2P9CA 5GADI 2BR0A 1IBMJ 4Q0BB 2FJDB 1MW7A 1WEYA 2CADA 4MT1A 3JAMU 1KR4A 4K4TA 3FDSA 2AW0A 5KFQA 2FJEB 3M8YA 1SKRA 1JIHA 3OTBA 4YB6A 3EX7B 2BANB 5E3AA 2ZKUA 5CAAA 4J9SA 3QO9B 3CD0A 2R7VA 4ZCMA 2ZH6A 1VQ9S 3OFGA 4OIXA 2C3MA 2C42A 3MCNA 4ZPCA 5H1SV 3SIPB 1X5PA 4OYPA 4WFBQ 2Z8QA 5LMNJ 2FQQB 3JTNA 2XULA 5F8GA 1IXKA 3T1YJ 2JHEA 3MMCB 3RG6A 3JTPA 3TP2A 3WIVA 4FYWB 5J2NB 2VU5A 1TMMA 4F3MA 3DRXA 5FD1A 1NK5A 3W5YA 1JJ2R 3TEHB 5IQ6A 4USUA 3IRWP 2D74B 1TAQA 3BKUA 3GB0A 3MR6A 4KH1B 3IRXA 3BO4A 4MKBA 1Y10A 4OFZA 4OYMA 5DG8A 3MURP 4JI0F 4FF3A 3R2DJ 4JI7F 1H3DA 1CC8A 4M5JA 3HD2A 2E5LJ 4TNOA 1RAOA 1S7HA 4J7CA 1RJJA 2IDLA 4WXWA 3TQEA 2YWGA 5A8KA 5L46A 2HS3A 4YP3A 3PIOQ 1DZ5A 2V50A 2XEXA 1U6BA 5D0HA 3TUJC 4B3RF 3TO8A 4F4AA 2DKOB 4C0BA 1MSWD 1ITPA 4K4WA 4DOZA 4KO0A 1V3SA 4IH6A 3OL8A 4PRFA 1NDCA 1C4AA 2G2ZA 3T5KA 2ZJRQ 4WU3A 2JEIA 1TL4A 3FCVA 3VVUA 2E5JA 4HDGA 2QSWA 1Z2LA 2DGXA 4C8MA 4C8KA 4JV5F 1IKWB 1VRTB 3JSMB 3LP2A 1ELOA 2Z56B 4DQPA 1RWWB 2LMIA 3JQMA 4JI8J 3C3LA 2ZBQA 3RB0A 3LAMA 2F4VF 5FDLA 2ZD1B 1PG5B 1PC4A 1CULA 1QD1A 2AX1A 1FWLA 2KJWA 2MHNA 3IM8A 3K5OA 3L09A 1BD6A 4ZPTR 5E3CA 5HI7A 4Q43A 2UVVA 2RMLA 1LK5A 1QAYA 4R5PB 3MCSA 4QIEA 2BE2A 2DNRA 2I8EA 2JX2A 2A10A 3CCTA 1MWYA 1SPBP 1XK8A 4LRBA 1ZM3A 2GJFA 4NXNF 2GMHA 4I2QA 1RU1A 2GIQA 3AD8C 3SBMA 3ZZTA 1S6OA 4RU9A 4EU0A 3G82A 3CD5A 1VOMA 1FRKA 2DHAA 3K8WA 2V0NA 4I64A 4OV6A 2AEJA 1K44A 2B7CB 3M8QA 4DN0A 2FHOB 2RRBA 3I4PA 4WCEQ 1JX4A 4NCGB 2DY1A 3FQKA 4DFMA 4CO4A 2HHQA 2BJ3A 3KK1B 1KRPA 1CG2A 2V2QA 3I0RA 3LP0B 4DV3F 1KFSA 2YWWA 2PFFB 4WE1B 1Y5NB 2KKHA 4JP8A 1MN9A 4F67A 1C2PA 4X4TA 2IRUA 4DR5J 4C3KA 3MD1A 4YY3F 2PEHA 2QA4G 3K5NA 1P27B 4NLQA 1Q1KA 4KO0B 4N7TA 1S0MA 4M5GA 2GQ2A 2HIYA 3UE2A 1N33F 3UN5A 3KMQA 4V19J 4B9UA 3PY8A 1MROB 1RHUB 2XMMA 3CCRS 1FD8A 3ISNC 1OJ4A 5AJ3J 3M2VA 5JVGQ 3CCSS 3Q8UA 5BXIA 2QTWA 2WOMA 1V9OA 3M8RA 3CC7S 1WKKA 3R6GB 3LPEA 4MMOA 2YWFA 4OMFG 4EO6A 2ZBIA 3I31A 5KFJA 4IOCQ 4EBCA 2PGCA 2JC1A 3BGLA 3I9ZA 1U1KA 4USMA 3BREA 4UY8T 4PR6A 3H8YA 3UDVA 4ED4A 1HBNA 1WEZA 1OPZA 1EQMA 1S4FA 1IKVA 2KI2A 1FTCA 1CC7A 1U2FA 1UP1A 2OEMA 3OSNA 5D4NA 4EBEA 5D77A 3B4MA 3TW0A 1VC5A 3M1VA 2BEFA 4W98A 1S9FA 1HW8A 4FYVB 3MPWA 3SQGA 2EG2A 3EGNA 3ZNUA 9ATCB 4I0WA 4Q5VA 1A7GE 4LRAA 3PYEA 4J91A 1VMBA 3A3PB 4H4MB 3GJQB 1T11A 1UMJA 1N5VA 2BA9A 3MDFA 4R0EA 4LF5J 4FYXB 2HGLA 4NASA 3MM5B 4QR2A 2WHOA 4ZLJA 5GMKa 4RUCA 1RDRA 3GU0A 1VIOA 4KHPJ 3NS6A 5CYMA 2B4VA 2HWIA 2N7YA 3T41A 1RK8A 2JC0A 2IVMA 1EX8A 2JH3A 3B6BA 3BBBA 1Y9OA 3G2XA 2M3DA 3HX9A 4I1TA 3CGIA 2XYGB 2AV5A 4JBCA 5D0RA 1GX6A 1VFJA 3N0VA 1FKAF 4MKVA 2R4FA 4LF4J 1RTZA 2ZH8A 3M2VB 2ZBPA 4ED8A 3I0SA 3RJMB 4KGZB 4LQ9A 1NSPA 1YRXA 4OZJA 4TYBA 2CJAA 1N5TA 1C0UB 3DOKB 1RAGB 3MMAB 3UN3A 3P6YC 5FJ4A 2VD3A 2QEXS 2A18A 1IQZA 2NPIA 4R8UB 3DLEA 2UVWA 1TV6A 4DHVA 5B0CA 3JSYA 4OZ0A 3IG1B 2ATLA 4IFVA 3F73A 4TKTA 2BACA 3F56A 2ASJA 2IRXA 5A8KB 4R25A 1XMQJ 1DQAA 1D9AA 1R8BA 3AB4B 3L7PA 1B7YB 2VKZG 3W62A 5HMWA 3OVSA 2PIIA 1YQHA 1T03B 1M1HA 3J80U 1VC6A 2UUAF 4PUOB 3VQSA 3HFVA 3SQGB 1KONA 2MB0B 2YQ0A 1VQYA 1DARA 2HVZA 2VF3A 1XMBA 4CTAA 1N4LA 1VIXA 2JSXA 3VZIA 2ZVIA 3R7SB 5AXMA 2ACYA 3G82B 2CPXA 1NJWA 3ELHA 2D7SA 2BUNA 2XHWA 2XTJP 2AX0A 2ZFHA 4HI1A 3AQPA 5CQGA 1VYAA 4A47A 2ZKTA 3RU0A 3Q0AA 5C25A 2GFFA 3HHLC 2J6TA 3E2EA 1SH2A 2RB7A 3LP0A 2V6AA 2LFVA 3IXQA 3OTCA 1Q16B 4N56A 4YY3J 3BQ2A 1KQGB 3KWMA 1VQ6S 5LSLA 4AD6A 2DO4A 4ZVQB 5DLGA 3EYZA 3MEEA 2KL8A 4KC5A 3W9HA 2HHUA 5B0FA 1SJ1A 4QWDA 1FJCA 2APOA 4ZLPA 3BJYA 1RI7A 4G1IA 1Q7YT 4X64F 3S1TA 1RYSA 3GONA 5F9NA 1JJ4A 3R7NB 2OEKA 3T6BA 2CFXA 1XR7A 3QSYB 3UWTA 2QV6A 3IG1A 3HHNB 1X0PA 5HQMA 2DK2A 2W24A 2WW8A 1PCAA 3MM8B 1K1QA 1PAUB 2XNQA 4IOAQ 1UPMB 4XDDA 2DGQA 3DN9A 4FDFA 1S1VA 3AJ2A 3TX0A 3MGJA 5LXRA 1SQGA 1DTQA 4F4WA 4DWIA 1CS4A 2IM3A 1TFWA 1T8EA 2NR0A 2IDEA 3IR6B 2E7VA 5A0YA 5GAHU 2XGPA 4A8WA 3JAMY 1DRZA 3LANA 3S6EA 1SC1B 4DUZJ 6AT1B 4P52A 2IFXA 2UUWA 1TQLA 3EDQB 2VPYB 1GXUA 4TY9A 3M30A 3K5MA 3N5BA 4QW8A 1N0VC 2C28A 1YSJA 1A9NB 1SC6A 3U7JA 2OTJS 2GC8A 3ZXWA 1I6JA 4B3MJ 3AFGA 2LEBA 1HPZA 4PG8A 2EC2A 1RCOB 2F5GA 1XNRF 1IVZA 1HIYA 2LEAA 3W60A 1LNQA 4ECUA 1U8SA 3CD6S 4PYAA 2AYMA 5KFVA 3ILJA 2B4UA 3S8SA 2HBQB 4RNNA 4EGLA 1FCAA 2O66A 4I56A 5DO2A 1QE1B 4JYAJ 2KYXA 1AT1B 2MKJA 4J37A 4UW2A 1URNA 2JLFA 1F5AA 2MHEA 2O5DA 1XQIA 4LBHA 2ZH3A 1VQ5S 1RAIB 3CWJA 4AQYJ 3MEKA 1DTTB 1RT6B 1VLYA 2HBRB 1L3UA 4S0MA 2WTFA 2YNFB 2HBYB 3U1NA 3FBCA 1XC9A 1RT5B 1S0OA 1R8CA 5KFRA 4RUAA 4E98A 5B0GA 2PI5A 3R5JB 2VJUA 3DLKA 3CJ3A 3FC9A 1APSA 4DG1B 1R0AB 5IT0A 1MG7A 2I9SA 4FPRA 3CCLS 2UUBF 2JL9A 2HVIA 2B43A 2JVOA 2FLOA 2JRSA 4NA3A 5T7LA 1GMWD 2QLFB 4ZN3A 1BHNA 1ZAWA 1WJ9A 1S6QA 1KOHA 2Y1RI 2DGVA 5L9XA 1HNIB 2PE8A 2BJ1A 3AD9C 4DX8H 8RUCA 4YQWA 2OFGX 1RE1B 1C4CA 2J0WA 1HNWF 1PJ5A 4K5RA 3D5MA 3TVYA 2DNNA 1QDUB 4RW4B 4DCJB 4PXDA 4DPWA 2B9XA 3X1LB 1GFWB 3GFHA 1BUXA 1JJHA 5BJRA 1RKIA 2RVJA 2RQCA 2W4PA 2RIJA 3DLEB 3BDEA 4A8SA 2C1EB 4OX9J 3OL9A 1WOOA 3N5FA 4AXIA 4C97A 2W7PA 2VPZB 2LYVA 2HAIA 3A3OB 4C6AA 2XQCA 4FYDA 2CQGA 1GH8A 1M1KT 3QO9A 2QN6B 3TA2A 1QE1A 1A6LA 4F25A 5DDRC 1S1UA 4F0HA 1FVSA 2M2BA 3G87A 3KXDA 4P2SA 5LJ3Y 4U9RA 1CQMA 1RT1A 1X4FA 2YNHA 3TEGA 4PXCA 3KOAA 4AUKA 1RP5A 3R5BA 7FD1A 1S0NA 5B0BA 3OQ2A 4OZ3A 2BJDA 2IM0A 2QLJB 1VLOA 2VBYA 3K89A 3NBPB 5AT1B 1RTJA 3M05A 4CRJA 1L3KA 4RU2A 2VPXB 4NPOA 2IA6A 5D8HB 4H4KC 2MKSA 2ZDOA 1VQLS 1WC1A 3QT8A 1HQUB 4IDKA 1R7IA 5ETSA 3WQPA 4CT9A 3VV2B 4ZHRA 4J9KA 1P9QC 1VHFA 3QRPA 5ETNA 3MM6B 1XBWA 1YJRA 2ZE2A 5CD4H 4DFKA 2DYAA 1J5OA 3POTB 3KLEB 2LKZA 1JKHA 2CIMA 2WCXA 4D3HA 5A8RB 3DHXA 4USKA 3L7OA 3H5SA 4G1QB 4IH7A 5AJ3F 3A13A 3AOBA 1JLFA 2HQIA 2V8VA 3HDSA 3QMQA 1D1UA 5ETPA 3OTDA 1CQNA 4KV8B 1FNXH 1KNZA 1ZA1B 3R27A 1WHWA 2QA2A 3VQTA 3MOJB 1RA7A 3IS9A 1NKEA 3LW5C 2GIFA 2XGQA 1A0OB 3D66A 4ZA1A 1WG5A 1S6PA 3ZTPA 3LWLA 2YBVA 3GJSB 3RRKA 1N32F 2OELA 1GTHA 3HHLA 1WC6A 4ZIVA 5C42B 3KMSA 1U1NA 1HQEB 4TU8A 1ZETA 1YRTA 2GCFA 2RU9A 2VG6A 1NZAA 3DOLA 4XPCA 4R5PA 4YHHJ 2M7SA 2CPFA 3I56S 3OR1B 2HHWA 4WFZA 1UVMA 2BVZA 1IKXA 1HNVA 1DLOA 3OXGA 4KKOA 5H9FK 4P75A 4B9MA 3R9LA 1FKPB 5THWA 1B7FA 2PEBA 1LWEB 3CJ2A 1CJKA 2Y3YA 3LP1A 1FT8A 4AL7A 4K8RA 4FXDA 3CDEA 4M1KA 2C22A 1U47A 3FGVA 2GA7A 1D0EA 3I5AA 1HD1A 2OSRA 4EWTA 1TTHB 5KFOA 2YNGA 2LXIA 3BGRA 4I2QB 2HNDB 3UD4P 4F4KA 1FRHA 4ILLA 3ISZA 4DUZF 5CH7B 3M4XA 3ILLA 3LGHA 2DIVA 4CLWA 2R2UA 4PQUA 2NSCA 2YVSA 2DNMA 2H4YB 4B9LA 2HFZA 3NGKA 5KT3A 3BSCA 1HBOA 3I0RB 4LVOP 4WTOB 2ZD1A 3Q8QB 2GAHC 1PJ6A 2YH0A 3H2VE 1OY6A 5D3GB 3T19A 4P71A 4DZDA 4LFCF 2J0XA 3AQOA 1XNRJ 2H5EA 3LGMA 3N4WA 4N8NA 4NA1A 1V6HA 5KFGA 2R7WA 4KGMA 2IY5B 3WBZA 3NCQA 2LDYA 1IM6A 1JLQB 4ZVSB 2RH3A 2ACMA 5HN0A 2WK4A 2CNKB 3G8QA 2ZHAA 2DR5A 3D9BA 5IM0B 2M5YA 1SJFA 3TAMB 1VJQA 5B0AA 1S6QB 3ILIA 2C2ZB 1VQ7S 2C2EA 2Z4PA 5GAGU 3X3UA 4ZP6A 3GWCA 2C2OB 4DCPB 4DS4A 1SUQB 1UJ5A 2I6WA 2RNEA 1FJGJ 4NRUA 2E44A 3C2PA 2X1FA 3Q86A 2ALZA 3IGVA 2YKNA 4P10A 5SZTA 4NWBA 3KNAA 4N8OA 3TUPA 4F8RA 4GKKJ 4K4UA 1UZDA 3CW2C 3K5PA 3T6JA 1OSDA 2VBZA 2NQPA 4ZHRB 1IKVB 4P73A 2VDIA 2RS2A 3R5GA 3EDRB 4DR1J 2G4BA 2HNDA 2QLBB 1HI8A 2CPJA 4NA2A 2FVRA 2DNHA 3DMJA 3MR3A 2XZWA 4EI2A 3O6QA 5CXTA 1IQTA 2IVFB 4DR2J 3TI0A 1VBXA 3DRPB 1TL3A 1LXJA 1FFSB 5HROB 4UF4A 4UZBA 1TAUA 3QRQA 2B9WA 1JB0C 1WF0A 1S12A 1EKRA 3BH6B 3SZ2A 2EFQA 2LXUA 3D6MB 3JQJA 3QJPA 2KG0A 1SIZA 2RF2A 3W8PA 2LQBA 5JMNA 1WORA 3CO9A 2M52A 3IA0A 4DX7A 4C11B 4M95A 1EETB 1JJCB 1J2VA 1H73A 2CQ2A 3OVAA 3NWRA 1M0SA 4P2XA 1OS5A 7AT1B 1H7XA 1NO8A 2F63A 3CE8A 1HD0A 3LOUA 3PG9A 4IFVB 2HLUA 3KTQA 1NB2A 1NHUA 4ZLNA 2R8JA 4AL5A 2GQQA 4HHHA 1HL6A 1IBKJ 3DC2A 2IM1A 2IJNA 5AXLA 4QWCA 4MYUA 2HYIB 2VG6B 3DOLB 3PW4A 3CULA 1SB6A 3O3LA 4G1QA 3OL7A 4GKKF 4XTTA 2FGOA 2CG8A 3MMJA 3U1MA 4ZCIA 2OAUA 3JTOA 3PVXA 5LMUJ 4ELTA 4AL6A 3GG1A 2E1MC 5IZHA 4QIGA 1UZHA 2EFPA 2W2NP 3NG8A 2BRLA 2PD1A 1FDBA 4ANDA 2FY8A 2HQDA 2J8SA 3US5A 2N4CA 1K1SA 1LWEA 1Y5LB 1N54B 2MJUA 3IS9B 3MR5A 5I3UB 4Y2KA 3W2WB 3CJ4A 1WELA 4X66J 3KLVA 5RUBA 2VHGA 4DV0J 3PKMA 3WX4A 4NLVA 2DR7A 3PW0A 4JI2F 2F8MA 1HBUB 1X31C 2WBRA 1P1LA 4WPAA 1EP4A 1RXOB 4F3QA 3MPUB 3GYNA 1DHMA 2CPIA 2YNGB 3BM7A 1ZZFA 2XMVA 2CQPA 3FMWA 3JXOA 3NXZA 5F41A 4B3OB 1KVIA 4H54A 3MEEB 1Z2ZA 1ZM9A 3LF0A 4DUTA 5ETQA 1VJWA 1YJTA 3Q2TC 5DQGA 2DPIA 2ZJQQ 1KLNA 1R89A 1YJVA 2XMWA 3A3NB 1UVLA 1GMVA 1REGX 1NNDA 1T0TV 1O5JA 2QMWA 4WBFA 4XDCA 5KG6A 2CVIA 2BZ2A 5B0DA 2DITA 4PQUB 1FHTA 2GO8A 2DY9A 3TAQA 5ETVA 1JLBA 1N33J 2JZ5A 2VZ9A 2KN4A 5EWGA 2B51A 1YWXA 3RBEA 1TKXA 3K58A 2DNZA 4NYOA 1JMTA 1IJEB 2E5GA 1FE0A 1M90T 3EVMA 3PACA 4CWBA 4DR7J 4HHUA 5IOLA 2A0FB 3H90A 4Y6IA 3SMZA 1S9GA 5I42A 1KQSR 2WAQD 4ITSA 5EN1A 1L5UA 5DLFA 1FRJA 3HO1A 2KXFA 1FI4A 4L74A 1VBKA 6FDRA 1F5CA 2AGQA 3D3CJ 4FN5A 3VR1A 4LR8A 4BCAA 1DY3A 3KLIB 3FCWA 3ITHB 4OYOA 4ECZA 4OYAA 2MKIA 4LRFA 3W9IA 4F4ZA 1CJVB 1SL1A 3B82A 2VQEF 1W26A 1SJ4P 2E1PA 1XWLA 2RE1A 3GIIA 5H9EJ 1HNXJ 3OUYA 1GMWA 3UCUP 3RRGA 4LF9J 2C2NA 4DN9A 2BJ7A 2DXDA 2W8KA 2FLPA 4I68A 1H98A 3D7SB 2CG4A 3PNIA 2W9AA 5ETKA 2CJBA 4LSNB 3V6HA 1GNKA 3PEHA 5CD4A 1ZZNA 2GMJA 4FP9A 1UWBA 1HARA 3BKTA 3TWZA 3I0SB 4QYRA 1Q5YA 2ZNZA 2BJ8A 5LMUF 3P4UB 1VQMS 1UEKA 3QWPA 1SUQA 2FC8A 4NX9A 4DV4F 2E5LF 4WIIA 3PJXA 1UPPA 1ZPVA 3OTOJ 2QL7B 1DAXA 1CJUB 2X1GA 2QYGA 2GAGC 3NWGA 4B3RJ 4WK1A 5LSRA 4TU9A 2OSQA 2HZVA 3RBDA 2HNYA 3SSRA 4ZVGA 3OFFA 3NMAA 3E51A 4P72A 4EZ9A 2E7XA 3DLGA 4G6VB 4U7CA 2X1AA 1FK9B 1IWAA 2MKYA 5E3RA 5J2MB 4ILMA 2MZJA 1F2HA 3LP2B 4BC9A 1UFLA 3Q8YA 2V67A 3N28A 1B0VA 3W8GA 1RHJB 1WOPA 1NPPA 1X5OA 2DNKA 3AD7C 2GVDA 3C6TA 3Q8VA 2PSZA 2NUHA 1NXIA 4DPYA 5KFBA 1ACMB 1CBKA 1X4AA 3JSRA 4A8YA 1PYSB 3V6DA 3TUIC 2HVDA 2FDNA 1XTZA 4DQQA 2AHOB 4I6AA 3ZZPA 5DDOC 1IR1A 2MLXA 3E01B 3I4HX 2G0IA 1PBAA 3AA8A 2FIUA 3CJ0A 4C8YA 3CCVS 3JB9k 2W2MP 1RWPB 2XWYA 3BBFA 3H98A 4JI2J 1VGYA 4CO2A 3DXSX 4LSNA 1IBMF 1EIYB 5L1KA 3LGNA 4FNIA 2R8HA 4KAIA 3I9V9 2W9CB 5U47A 3G86A 1S5ZA 3PYFA 3PX6A 1RACB 4X4PA 2F1FA 1RT5A 2ZH4A 3CDUA 1NLKL 3M8PB 4YMEA 4IRCA 3NMRA 3MEDA 3FBEA 4CYUB 2QC3A 2X1BA 4WKYA 3GIMA 1X0FA 2IBKA 5DRKA 4OQJA 3A4TA 2W2QP 4KQZA 1K73T 2EFGA 5HVGA 1WDDA 1MWZA 1U26A 3VAIA 4DR3J 4ECSA 2ASDA 3F0NA 1XMQF 1Q81T 3ENAA 2BM1A 1UJ6A 2KU7A 3POTA 1S4EA 2KYZA 4OJHA 1YJUA 3BN7A 4O23A 4IG3A 5A0YB 5A76A 1RKJA 3FRZA 4ZPVR 3NBPA 1FEEA 1OWXA 1RT3A 4OZLA 4B3OA 4C7QA 3H59A 3UPFA 1M5OC 2H5JB 5L8RC 3HVAA 3GSDA 3EPIA 3DDKA 1MLAA 5ETOA 5LXYA 2QSFA 1YBUA 3NGRA 4ED7A 1UEUA 2B6AA 4PPDA 2Q3PA 4QOTA 2BW2A 2H54B 2CQ3A 2Y9HA 3W1YC 2OO4A 3T1AA 1T9YA 3MWBA 4WE1A 5KFPA 1KKHA 1CULB 3I5BA 4B08A 1VBYA 4DPTA 3TVKA 3MTJA 4JI4F 5F3TA 2KT3A 4Q8FA 2B8PA 2HHTA 4LF2A 2D9OA 2W4CA 3BV8A 2C3PA 3GMGA 4OZ2A 4DZ6A 1KD1T 5CZVA 3EM1A 3EE3A 4CCHA 3CVKA 5T41A 4H4KA 3NGDA 1D8YA 1RLDA 4NL5A 3OR1A 4X4VA 1U7LA 4PQAA 4J9UE 1DTTA 1RT6A 1U0HB 1HMVA 2LA6A 2WW4A 2ZITA 4UQTA 3ZZZA 5C5JA 2AD9A 2Y0BB 3FBFA 4ILRA 4MYTA 1VQSA 2CPHA 4DV4J 1WD6A 5KFHA 4ECWA 4O3PA 1PO6A 3J7AN 2PT0A 3LP1B 4NLTA 3H4BA 1W2IA 3B8HA 3QT5A 3SFGA 3HM9A 2UVUA 4WK3A 4M94A 4DL5A 3K0JA 2VFRA 5GAGI 3I6PA 2KXNB 3DRYA 1TELA 3GYXB 1UCNA 5HBMA 4CH0S 3G8SA 3KHHA 1FXDA 4C3LA 3MM7B 4K4XA 3HJFA 5CCLA 4QQBA 1RBOB 2WSEC 4TY8B 4M5LA 3SCLE 5D15A 4JV2A 3RZAA 5KT2A 2CQHA 3PZPA 3QT7A 3PJ9A 3KUHA 1FDNA 2AJ1A 2W1BA 1T95A 2DT9A 2QL9B 4NOHA 3O2IA 4FZVA 5CA5A 2H5IB 3HULA 3CD7A 5DJBA 1G3OA 1S49A 4RBVA 3ENVA 4TLQA 1B0PA 1VQ8S 1REVA 3DXBA 5C24A 4IQXA 4NLPA 3DGPB 2V4JB 1SC4B 5HQLA 4MIWA 4DDFA 4NLRA 5C42A 3KLFB 1WG4A 1RT7A 2AZ3A 1NPKA 2WSCC 3K2YA 4EYHB 3UW1A 4HTJA 5A2QY 4PUOA 3C16B 4OX8A 1JXVA 4JI5F 2OPQB 3PX4A 2XC9A 1QUPA 1WWHA 3BDPA 4EK2A 3H2UB 2RRNA 4EFAC 1YBTA 4L6V3 3U1LA 4DCOB 4V19X 1RAJA 4ER8A 3A8JA 3L9ZA 4WZMA 2NXCA 1LW2B 3RTVA 2JEJA 1WACA 5BYSA 3GQCA 3THTA 1NSAA 3W7BA 2MQLA 3MM8A 1N34J 1NZ8A 3FVYA 4DX6A 4ZVHA 2XYHB 2IJFA 3RRHA 3ENWA 3QSIA 2OPRA 3CIZA 4CZCA 2FLLA 2ZOMA 3OJSA 1WKJA 3CJRA 3L95X 4UOGA 2AKWB 3OV7A 2E1CA 2HVHA 2O01C 3GFZA 2GGPB 1Q8IA 5EHHA 3PTWA 3TAMA 1NH7A 2Q43A 3DYAA 3MM9A 3NAHA 3NLCA 4LIWA 3A12A 5DDPC 2ZM6F 1Y3JA 1S0VA 2KHCA 3KG1A 3WIUA 1M5VC 3EVWA 2AP6A 3P96A 5EGYA 1NK4A 2QLXA 4JV1A 2EC0A 3BSOA 4HDHA 1R0BG 3CSKA 1DJ0A 4OYZA 5K8OA 2CZ4A 1S1TB 1TR0A 3SCJE 3B54A 5F0WA 4YDXA 3FQLA 1ZH5A 3M9NB 1Q8KA 2KFZA 5LT5A 2FC9A 1HNWJ 4NCAA 5A8WB 3M2RB 2JEGA 5KFMA 4BS2A 3H7HB 5FIIA 2VG5A 2QZ8A 3UDCA 3W9JA 3RW7A 4IR9A 4A8XA 4RUBA 4YB1P 1FNOA 4O4GA 4F36A 3ULHA 1TL3B 2Y0SD 1T03A 4NLWA 5E2QA 3FRYA 3EXCX 4WYWA 5F8JA 1KEKA 4DR4F 2UUCJ 2CZ9A 2LEPA 4WFAQ 2UUBJ 2R2RA 8ATCB 1U09A 4A4JA 5KFXA 3ILOA 9RUBA 1EETA 3HHDA 3I96A 2Y1LB 1BQXA 4JUZA 4J9VA 5J2PB 2J8AA 4ZCKA 3KFWX 2E5IA 3BN4A 8AT1B 5KT4A 1X9SA 4NLGA 3PDNA 2VBXA 1ZS6A 3D6TB 4KIAA 2R8GA 1P9YA 5D0GA 3F41A 4RX6A 3S7RA 1C0TA 3Q83A 4USVA 5EX3A 3I87A 4HLBA 2ZZNA 4CLTA 4FS1A 2J76E 4N76A 3P8BB 2B4OA 2XBPA 1Q53A 2GVZB 3MCMA 4O4RA 3GV8B 1S72S 2WVBA 2XWXA 5HMXA 2GNKA 2VB6A 2YWEA 3EMTA 3N6MA 2OP5A 3KYLA 2QA4S 2D3OR 3LWMA 1U1QA 1FVQA 3B78A 1RTDA 3CTRA 5L39A 2XCAA 2M4MA 1QSYA 2PI4A 1X8DA 1M5PC 1W25A 2HSEB 1R8PA 4LF8F 2YKPA 2OMOA 3MOZA 4RW9A 3MECA 2J9CA 4K2JA 1FJ7A 3NNCA 1Y7PA 3RGIA 3KK2A 2EK1A 2V5HG 2GJIA 3DOMB 3GYGA 4PWWA 1VQOS 4J5OA 1EP4B 2DHHA 4WU2A 5KFSA 1SV5A 3KDOA 4PCQA 3OFEA 2UV8A 3ZTRA 4LFAF 2HAFA 1N5SA 3CEDA 3Q2SC 3R7BB 4EUVA 2RD5C 3BGOP 1LKZA 2RILA 2MGZB 4DV3J 4FVMA 3OXFA 1HWLA 3C6UA 5K14A 4A48A 3V6KA 3LPYA 1IBLJ 3MR2A 1PSDA 1RTIB 3C14B 4K5SA 2OPSB 3QGPA 3KHGA 3GFYA 1S9EB 1RHMB 3NGSA 1NBEB 2AJ2A 3BBCA 2HNZB 3OPKA 3PYGA 4KRWA 3ZZUA 3RBXA 1S77D 3WC0A 1TMJA 1U2RA 3AT1B 1Z1ZA 1PKUA 1RAEB 1O0PA 2J5AA 3QWUA 4HACA 1HPZB 3OTOF 3W3SA 3OXLA 1SKUB 3D1QA 1U1MA 4OYBA 1FFGB 2F40A 1KN6A 3OUYB 2M0GB 2PDAA 2IRYA 3HSDA 1RT1B 2MYFA 2YNHB 3V2UC 1VS3A 2GGPA 3HI9A 1BQMB 1Y3KA 3BYRA 1FX2A 1NHVA 3C16A 3KK3A 2R7RA 1HNIA 1KVKA 1RZMA 2ILYA 4G1PA 4OJ3A 4U96A 1Z4UA 4CLPA 5F8MA 1FTRA 1VRUA 4QIFA 2MXYA 4CH1A 3T5LA 5IC4B 5L38A 5DQHA 3G9CA 1F0XA 2MSSA 5IS2A 2AGOA 3M6WA 4LT6A 4BWJA 1ZPWX 3W64A 3I55S 2XG8A 4FBTA 2VJVA 3DRSA 3KLHB 2HGMA 2LQ5A 2PN6A 5CHCB 4DI6A 1U0SA 2XCPA 1UTAA 5CYQA 2AJ4A 2UP1A 3U27A 2ZC3A 3PXGa 4UQGA 3FCHA 1HBNB 2MGZA 3FSXA 2DNLA 1NK9A 1Y0HA 2XMKA 2C3OA 4O4GB 3W5XA 2XSJA 4LJMA 4ANEA 2RS8A 4OL8A 1Y00A 2HMIA 4ZMMA 1IR0A 4K2XA 1UVKA 1SI9A 4TQRA 1OYDA 4UOFA 1M5KC 5F8LA 4U67Q 1PC5A 1F3VA 1CJKB 1P1TA 2MJNA 4NLDA 5D4LA 2P9EA 1JXEA 5ETMA 5KG2A 4DSKA 2UXDF 1KC8T 2QA1A 4MFBA 4GKJJ 1S1TA 4C98A 3W66A 1ZM2A 2BE9B 4LF4F 2MQOA 5KG0A 1HQUA 3BYPA 4IDKB 4F50A 4HT7A 3O44A 4M5HA 2VG7A 1HWIA 3GCXP 3ZZRA 4DR3F 3MPDA 1S1XB 3C15A 2MQ8A 4RNOA 4ECXA 2VIHA 2BQ3A 1N32J 2VFTA 2UUTA 1GK8A 5HL7Q 1JNRB 1X4CA 2CWKA 3AHPA 3DM2A 3JSBA 5KFLA 2LXFA 4BBYA 3BSAA 1RTHB 1VBZA 3K57A 5M2UA 5A8RA 4IRDA 3NL0A 3BR9A 3ISND 1QTMA 1N8RT 4KY3A 1TUGB 2GMLA 3EJMA 5J1NA 2W7OA 5I3QA 1YK9A 1J5EF 1FKPA 2FVQA 1VCTA 3NEKA 1SJ3P 4UT4A 1J5EJ 1IBCB 2DH7A 2G13A 4KFBA 4RW7B 5KFNA 4XPEA 4DV7J 4JI3F 1C1BB 3KKFA 4KBIA 2BKPA 2EVZA 4DR2F 3THVA 1UVNA 1TV6B 2H1YA 4GKJF 4B17A 1M1GA 1TL7A 1N0UA 3BH7B 3AJDA 1IJFB 3BQ1A 5IM0A 2AYEA 2A6OA 2XMJA 5LJ5Y 4F02A 2HHSA 2CUYA 1CEZA 3OL6A 4OHZA 2ZVSA 4Q8EA 1ZA2B 2MY8A 1T9VA 2ZNYA 1SJRA 4J9MA 1WHYA 2ZBRA 4Y2AA 3J81Y 2HFVA 1S48A 3Q23A 4H4MA 1KDNA 4F7VA 2VDHA 3R1HA 2YKNB 1NKBA 2W01A 1RTIA 3C14A 3FEXB 1DLOB 2UV8G 1X5TA 1YJNS 1SVDA 2CJYB 3IBWA 4EMDA 1N6QA 2CNOB 2W9BA 5LL6d 2VUGA 2V94A 4WIQA 3RR7A 2IC3A 2VG7B 1X4BA 1FRXA 4KH0B 2JFDA 2YY3A 4M5NA 4I7FA 3TANA 3RAQA 2VFSA 4JI3J 5A2QU 2YQ3A 4B9TA 3BGFA 4OV1A 4YEAA 1OY8A 4JB8B 4OHXA 5KG4A 1HKAA 1YDLA 4RJVA 2PMZD 1X4GA 1HI0P 2W9CA 1WC3A 2UZAA 1JLEA 4ATNA 4E0DA 4OYIA 2KVIA 3CC4S 3PHEA 2ROGA 4ZITA 2WSFC 3GR0A 3Q89A 4CLUA 1QSLA 1R8HA 2AF6A 2DCUB 2I1RA 2P6TA 4TLRA 4DJBA 3V4IA 2OHDA 4YDDB 4H4OA 4F4XA 4LF7F 4WP8A 3C6UB 4DSEA 2QIFA 5HP1B 4I67A 1JLCB 3D1HA 2ZHOA 2HS0A 1B70B 1NHKL 2LP4A 3NY0A 4FYYB 1HMVB 3QJLA 1AB8A 3HT3A 2AQ4A 3FJ2A 3ADAC 5J1EB 3CXCR 1N5YB 2QGFB 2RDJA 3CCUS 1QVFR 2DPJA 1T7PA 4RBUA 3OR2A 3GE9A 3HMJG 3MUVP 1S76D 2Z2LA 4F0KA 3R5AA 1YJ7A 5D6GA 3C8YA 2MPUA 3UVJB 3HFZB 3BGUA 5EDWA 1FF2A 3LA0A 3BO3A 1NEEA 3NNHA 2FUG9 1YGYA 1OO0B 3P49B 1B4SA 3T9ZA 1MU2A 3PW5A 3SSQA 2IMOA 3AOAA 3N9UC 4MKYA 1XMOF 4IH5A 1F9FA 2OKQA 5JJBA 1HWJA 5C25B 4LFBF 4I2PA 2G1DA 3VVTA 3G4SS 2B56A 3PEJA 2QFIA 2Z58B 4WFYA 3VALA 3NP5A 4HKQA 5HANA 4N47A 1XNQJ 3MUTP 2B9YA 4HL9A 1N56A 3MD3A 2ABYA 5ETLA 2VBWA 3DFEA 2DR6A 4NZ6A 5IV4A 4QPTA 4NCBA 2XO6A 4URSA 3UDLA 1TL5A 5HO4A 3CJ8A 3RUBL 3HVWA 4B3TJ 2KZMA 3V4IB 3BPSP 3K17A 2VONA 2V2VA 4GMKA 3VAMA 1J27A 4L73A 1T05B 3NCRA 2Q66A 5J1PA 4QU7A 1OSCA 2ZHBA 2E5HA 1E6YA 3OHBA 4B3SF 4A8FA 1FD2A 4Y2CA 3PYDA 3SEOA 2D41A 2QLWA 4LF6F 1JLBB 4DV1J 1NDKA 1XERA 3M8PA 2VODA 4CYUA 5A6PA 5K8PA 2CQ1A 4RL1A 3TRGA 2DIUA 3DHWC 3H25A 2Z0GA 4PXBA 2XI2A 4QW9A 1O8BA 1GQEA 2XS5A 2MTLA 3LAKA 1TK0A 2OPQA 3VHQA 2L9WA 1XIQA 2XHCA 2VV5A 1F6TA 4OI1A 4DFJA 4BHQA 2M8HA 1UA0A 1NK0A 1MMLA 1MU2B 2V2ZA 4KSEB 2B4PA 3KUGA 1EB0A 3AXKA 3DM2B 3M8QB 1TK8A 2KT5A 2QO3A 1Q8LA 1VRTA 4YS2A 4U95A 5KFEA 2E1AA 3GJRB 3J81j 3J7Z5 4C4WA 4PYDA 1SQFA 3BO2A 1QJHA 1WTBA 4IRKA 2XNRA 5IT9Y 2QX0A 2RSQA 2CJXB 4LMZA 2HK2A 5KOWA 3HKZD 1CPZA 2CA9A 5J1EA 2Y8YA 3VGVA 3PO5A 2FVCA 5IWAJ 3T1YF 5EX0A 3EZOA 3VGUA 5KFUA 1B3TA 3UI3A 4UUWA 1KTQA 1HNZJ 2M8DB 2F8HA 4JV5J 2R9LA 4WKRA 3QLHA 2VG5B 2BYCA 4ERDA 3FZBA 4V1Ak 5K5MA 2UXBJ 4NLYA 3D3BJ 2WVFA 2Q6CA 3R97A 1JLEB 3D0HE 4TN2A 1U24A 2MEWA 5T14A 4X4UA 2ZH5A 2FY1A 1MN7A 2EFOA 2ZWOA 3IR7B 4C48A 1NKCA 1C1CB 4X84A 3H4DA 1OMSA 5FLXU 2D3ZA 2WVCA 3HJVA 3CF5Q 4UY85 1UKUA 2F8EX 2WONA 5JUMA 1AW0A 3SDEA 1UL3A 3ZTSA 1KVJA 4LREA 4OI6A 4UZCA 2W9BB 4JI7J 2DGWA 5G0RA 3R2CJ 1YTYA 2H4WB 3ZO7A 2J7UA 1IBKF 2ZUAA 4YB7A 3PRVA 3M8SA 4LRCA 1YG0A 1MROA 4QPXA 4U8YA 4QCLA 2FHKA 2LLZA 1ICEB 3DGVA 5GVQA 2BX6A 3U02A 4CLKA 2XLJA 2VQFJ 1X4HA 2CPEA 4ZVFA 1CJTB 4P74A 5SUHA 1NRKA 4KGKA 4OX6A 2OFHX 2MQQA 3MAQA 4KT0C 4ETXA 5LMNF 3T1HF 4USIA 4KV8A 5JXSA 5ETTA 1RQ0A 1WI8A 4L76A 2AZ1A 4M5IA 4ZPDA 4CLZA 4ED3A 1X4EA 3ITHA 5DQIA 3ONQA 4EYIB 4X65J 3VAJA 1N34F 1CVJA 1X4DA 4LF5F 1NJXA 1S97A 4ZVTB 4LF7J 1Q78A 1YJWS 1NUEA 2DD8S 4ZJOA 5KFDA 3AJ1A 5H9FJ 3OR2B 3A8IA 1U4BA 1LWCB 3M1VB 2NXUA 2LVWA 3KG0A 2XY5A 4DEZA 1N36F 3WC2A 1PBUA 1MNEA 2ZZTA 2DJWA 1PJ7A 1TVRB 2KT2A 1C1CA 2PO4A 3D4JA 2LCWA 1EKSA 3N6NA 4QJVA 3TJ8A 4K0KJ 1NK7A 5K8NA 3DOMA 2C2KB 4IUFA 5GAHI 3OD2A 2J6SA 4LF6J 2B7BB 3IWLA 2FJBB 4YR0A 3THPA 5M2RA 1FJEB 3KLEA 4RW6A 4ELUA 4DG1A 1R0AA 4WJBA 2EPIA 4QYZK 2W8LA 5KTQA 3H42A 2W25A 1IR2A 2YPZA 2HS4A 2HZAA 3CJSA 1I51B 3T9NA 2DHSA 3TZXA 5E5NA 3CCES 4Q0BA 2LDIA 4QWEA 3GSIA 1KWMA 2FGCA 3EWGA 5HK4A 1R0CB 3I32A 3PX0A 3IBFB 4NI2B 3M7VA 1WNEA 3HK2A 1YBAA 1RWXB 3VGTA 2MLZA 4CM0A 2L9DA 2VOOA 1RAAB 2PFDA 3ZC4A 4FKXA 3QIPA 3PR4A 1U2CA 4A8QA 1RHRB 4N5SA 2RUSA 4OZ5A 5DG7A 4U8VA 4K0KF 2EBGA 4NYZA 3TA0A 4N77A 3CDAA 3H0PA 1FERA 4ID5B 2EWHA 2N3OA 3QGHA 1RABB 3FK4A 4ZP9A 2Q6BA 3E01A 3M2UA 5HVFA 5KFFA 3QZ7A 4ZDNA 4NZ0A 4FBUA 3HHKA 3QT6A 3ENQA 5K14B 1NK6A 3CJTA 1TKDA 1SKWA 3IGNA 2GZOA 2F4VJ 5E0OA 3CIMA 3V4MA 5KAKA 3CPWR 1QLNA 1U0HA 1TK5A 2IPOB 3BEGB 3UO0A 2KG1A 2GV1A 2UVRA 1TKTB 3R5CA 4QZVB 2HHPA 4CLLA 2N4DA 2DNGA 1OIAA 2C3YA 2R7QA 3RBZA 4LBPA 3VCDA 3MZIA 2DTJA 2IHR1 4MFBB 4ZPAA 4ES2A 4WTYA 5HLFB 1DQ8A 1U45A 3HPOA 2EG1A 2D3UA 4HH1A 4MK8A 3TZZA 3PW7A 5G0RB 1YI2S 5I4MA 4DX5A 1K0VA 4OHVA 2VFVA 5IQQA 1X5SA 2IIHA 2ROPA 1O51A 5EUHA 2ZH7A 2KH9A 1B64A 5KT7A 4PZVA 3DMJB 1YHQS 4UTGA 1N36J 3PO4A 4U6PA 1FWPA 1RB0A 3TJAA 4WP9A 2A6MA 1QVGR 1YIJS 2ERRA 1WHVA 2DGOA 2MKCA 4G65A 1IBLF 1HA1A 2A3JA 2RQ4A 3DOKA 2CQDA 3DRSB 3MMAA 1SXLA 1V3RA 1ZBTA 5C24B 3VZHA 3PR5B 2QFJA 4ID5A 4HR2A 3IO1A 2BANA 2CAJA 1TU0B 4A8MP 2B8QA 5KFTA 1RWMB 3EZUA 3M8ZA 3AH6A 5LOQA 5HQ8A 5IC6B 4YB5A 1NDLA 2CPYA 2DHGA 2DXEA 3LO3A 1PIEA 1SV5B 1HQEA 1T94A 4ZP8A 3AOCA 3GCWP 2DEIA 2WB4A 4ICLB 4M5KA 3TQ1A 1SL2A 4ZOSA 3JS9A 5E3PA 4MKAA 4NCGA 4RW7A 1RT3B 1GXLA 4ES1A 1VR6A 4OHWA 1S9EA 1N52B 4RBTA 2JLGA 2OPPB 4JI1F 2ALYB 3EUNA 1RBLA 2K06A 1OY9A 2KHDA 1VRQC 3NCPA 3BSNA 1RLCL 4AFFA 4IO1A 3BQ0A 1WC4A 2B6AB 5BR8F 3W61A 4LIRA 1TUWA 1PYOB 3GIJA 2I5JB 1X9WA 2KZZA 1WI6A 2XYPB 1GTEA 4LSLA 2OH2A 3E8OA 4DBQA 2DVIA 4K4YA 3UR0A 2F9JA 2V4RA 4IO9Q 4DU7A 3VTIA 5BYQA 2HRUA 2ZUGA 3MM7A 4O3RA 1RWUA 3J7A1 2CPZA 2DISA 2CZVC 3ETMA 1EARA 5I3PA 3UFCX 4RW8B 3KHRA 1KP6A 3D28A 4USJC 4J9OA 1H7WA 2KM8C 1IKWA 4H4OB 4RWXA 3L3CA 1Y5IB 2ZOGA 4LUBA 3GTYX 1UETA 4AQYF 3RW6A 2AEFA 3V5RA 3OHAA 2V69A 2DO0A 4IFYB 3GIKA 3CCMS 2J0QD 2Z2YB 2CDRB 4ANCA 1UAWA 4NZ7A 1H38A 2HPUA 1IWGA 2MZSA 3MMCA 4QR1A 3EGVA 1X7VA 2CQBA 3H20A 3OTEA 1NJZA 3L4BC 3LUYA 3TJ9A 4CT8A 3M2UB 4QYZJ 5DM6Q 2F4FA 3CCZA 3OBIA 4RW4A 4WYLA 4ED6A 2HIQA 4DSIA 4ZPWR 1KHVA 4JV0A 4NRTA 3KLGA 2XO7A 1NSQA 3CMES 4LF9F 2YNIA 4G3IA 3H5XA 3DI6B 2BW7A 1HW9A 5J2PA 4W90B 1RA6A 2LQ9A 2R2TA 5CYMB 3HSGA 2RKIA 2FPHX 2EBEA 4LSLB 3P5BP 4TVAB 4DUYF 1Q0NA 4KPYA 2IJRA 4GVBB 4LRDA 1FO1A 2DH8A 2BRKA 4L3KA 2GVZA 1NJYA 1JLFB 1HFEL 1UW9A 3PHTA 5F8HA 4KHRA 1YRUA 3RYLA 1NJIT 3P45B 1VQ4S 4FXWA 5B0EA 1N5QA 1RWVB 2BQRA 1F2GA 1WF1A 4WFXA 1R31A 3OJUA 1C0UA 3Q8PB 2V34A 1JNZB 3EZ5A 2O1PA 4ETZA 5C7PA 4NLXA 1S6UA 4OX7A 4DV5F 3OVBA 1H2VZ 2B5JA 3GILA 2X3DA 2NXEA 3ET6A 5IXUA 1ZYQA 5BYRA 1LW0B 4L72B 1AA1B 1JLGA 1AXQA 3P3DA 1HR0J 1DFDA 3HSZA 5E33A 2E1RA 2IAJB 4OYXA 2MZRA 3PW2A 2FLNA 2E7WA 1HR0F 1SH0A 1ZTTA 1BWVA 3CT9A 2L3MA 4K59A 1U25A 2BE2B 3M6UA 2CQ4A 3HF5A 4GRSA 4ZVUB 4CH7A 5GAEI 3T3FA 1SCJB 2A2DA 3EGZA 3UCZP 4Y0FA 1B0TA 2EFVA 3SCKE 1W2BR 4O3OA 1S1UB 1UFKA 5KT5A 2QRRA 4RR5A 4CTAB 4FPIA 3MM9B 1LFPA 3DLHA 2K3IA 4KJIA 5KFZA 1U48A 4C0OC 4A8KA 3SV4A 4DFPA 2C2MB 4MK7A 1Q7LB 3SV3A 4YR2A 2Y1IA 3HZGA 4I6WA 3G96A 3AAWB 2HHVA 1KLMB 1D09B 1V3ZA 2DNYA 3BF4A 4ZVOB 4CLYA 3QBCA 2WRMA 4ELVA 1G1XA 5D4PA 4PWUA 4ZS6A 1FESA 3KDNA 4B9SA 1RWOB 2X7IA 2CQ0A 3GR1A 4MJKA 1IM4A 4ZPBA 1NM2A 2CJQA 3R8YA 5DETA 3CDWA 5CABA 3IM9A 4P7TA 2QYCA 2I0XA 1J5OB 2E66A 2I5JA 3FZ2A 2A1BA 3D0IE 3F44A 2FD2A 2Z30B 3K8VA 4EZ6A 2G1HA 1FFWB 2J9EA 1FA0A 2JLEA 4ECVA 1VRUB 4NYPA 3TAPA 2KFYA 2WOMB 2ASLA 4DL2A 5L1JA 4ZP7A 2PMHA 3SXLA 1XEZA 2HNZA 4LBIA 1UEVA 4CNZA 1RBAA 3ICLA 2HG4A 3VAHA 4J9QA 4DV2J 1RT2A 2WZ1A 5J2QB 3UCGA 2GW8A 5LSOA 3FEYB 3KJNB 4ED5A 5HATA 3MEGB 4KB7A 1Q79A 4CQ1A 4B9VA 3QNWB 4AE5A 2WONB 3M9MB 3MI7X 4ALZA 1BE4A 1N5YA 5DS7A 5H9EK 4JI0J 3BGRB 3R6LB 5F8IA 2CNLB 3ZTQA 2ZE2B 1JLAA 3DRRB 2HVEA 1NDPA 3DDNA 2BQUA 2GO9A 4OZ1A 4BWMA 2DB1A 1RSCA 4KPCA 4Y65A 1QY7A 2C2RA 3QAUA 2H9ZA 2HGNA 2CJKA 3MMBB 2HFOA 2EFNA 4FXVA 1JWWA 3O1LA 4IQMA 4PG7A 1HWKA 1RAHB 2OPSA 1U6ZA 3ETOA 3KJQB 2JDJA 1QAIA 2BDPA 2G0JA 2RHQB 1P8GA 2ZC4A 2FHJA 2NPFA 5DM7Q 3T5JA 4Y28C 4DR6F 2EW9A 1U1PA 1UVJA 3NRBA 1G7CB 2LECA 2XY7A 2U2FA 3KK2B 2LA4A 2V8DA 3PKYA 4OHYA 3QLHB 2RKIB 2OLWA 5MLCV 4KYZA 3RR8A 4CO0A 3VF0B 1R27B 2B9EA 4DMZA 2N7CA 1NK8A 1XN9A 2HRTA 2VA3A 2D69A 4O0IA 5IFMA 2RDDA 2ADBA 2AU0A 2MKKA 1HYSB 2KTQA 2MZQA 3W2VA 4C8ZA 1QAJA 2G9OA 2K7JA 4RWWA 3AXMA 1WEXA 3GV5B 1H72C 2AJQA 1X9MA 3SDEB 3H2LA 3MEGA 2WVDA 5F9LA 2VOPA 3LQVA 1BXNA 3W63A 2AMCB 1LQ9A 4YFUA 2CQIA 4N41A 1OQ3A 4ZK7M 2JJ4D 4OI4A 3M9OB 3QYYA 1BMQB 4PAAA 5IT9U 2OIHA 1HQ2A 2IAJA 5T7LB 4LQ3A 2RDIA 3FFIB 2UU9F 2BXJA 4ED1A 2PC6A 2H51B 1I94J 5AE3A 1RTHA 4OLOA 3TYTA 3NGUA 3W5ZA 4J9RA 5HROA 5AXKA 2BBEA 1RADB 2VC1A 3OLBA 4BC7A 1BQMA 1EHWA 1M5SA 2XZDB 3KK3B 4DV1F 2AGPA 3WDOA 1S1WA 1SH3A 1KFDA 3M6XA 5D4OA 3SSSA 4C3MA 2VPWB 4X4SA 4WFNQ 2XM3A 3EPGA 1WC0A 1ULRA 2CQCA 2IC3B 4Y2MA 2DXFA 2OMLA 3IWXA 5DG9A 1QM9A 2BMBA 4AYBD 4F4YA 1JLGB 2FYXA 1BQNB 2IVYA 3IAS9 2YKOA 3ZZ0A 2HQFA 2V4JA 2K1RA 1LWCA 4C0HA 1FRMA 2YKQA 1I1GA 2YX4A 1TKZB 5IT4A 1B99A 3JYTB 3CC2S 4XIUA 3IR5B 5AE2A 2OTLS 2VQEJ 1MMNA 2AJFE 3CMQA 2XY6A 3GFXA 2V9KA 5KOXA 2QJ3A 1U1OA 2V9WA 2XSJB 3D54A 4Z37A 2DR9A 2J7KA 4GC7A 1IUJA 1BC6A 1QUVA 4HI2A 4OI0A 2E29A 5KFCA 2O3DA 2XMTA 1LEOA 1C1BA 1U02A 1CS4B 2EEYA 3HVTB 4F2SA 3K5LA 4DR7F 2DRAA 1Q82T 2ZH9A 1FX4A 1S9GB 1JQGA 5I42B 2KDOA 2COLA 3EICA 2H3EB 2JOQA 4I4BA 1LFWA 3Q8RB 1E6VB 4CI0B 1LK7A 3J7ZT 3DRPA 3VWSA 5KT6A 4NE9C 2CWXA 1KQKA 3TA1A 2HURA 2VICA 3N6LA 2FHJD 3QFWA 3KK1A 2YX1A 4ZVPB 2NREA 2W7AA 5FDLB 4CP5A 1SIWB 2RUGA 4CDIA 4ID8A 1FRIA 1RT2B 4RNMA 2Q1LA 1OPIA 1Q4RA 1RT4A 1YX2A 2N3LA 3SQOP 5DGBA 2Z57B 1QTNB 2JWNA 4AXJA 1HHSA 2VQFF 4ZJLA 2P5VA 1QSSA 2G0CA 3QIDA 4Q2LA 4RPFA 3GZ7A 1JLAB 3DRRA 5C2CA 5MAOA 1VQPS 4IR1A 4DR6J 1IKYA 3PM9A 4USTA 1RWKB 4MTPA 4ES3A 2V8GA 1XR5A 3PV8A 3A8KA 1LV5A 4W4MA 3NKYA 3KLIA 4L3NA 3W2VB 4FF4A 4X66F 3CJ5A 3MMBA 2MLYA 1BY9A 4QIVA 1Q86T 5JVHQ 3M8WA 3O8WA 4DPUA 4J9PA 4EEYA 4C2MA 2FZCB 1AUDA 4CO3A 4J9LA 3G6YA 3GG0A 2OUGA 3QRRA 4DV7F 3DLLQ 3V81A 4DV0F 2OEJA 3Q8SB 4RNFA 3H5YA 2UUCF 4RLEA 3UVJA 1HBUA 4FS2A 4NMLA 2QT7A 4OJGA 4O3NA 3TX8A 4DL6A 2HBZB 3VAFA 2DNPA 1MMDA 4MIAA 3TVZA 1AZSB 3O5TB 1T9WA 1GX5A 4NI2A 2Z2MA 4X62J 1WC5A 2YWHA 1ZOTA 1S1WB 2KVQE 1GEHA 2KXHA 5F0UA 3HD1A 4HVZA 5ETRA 2CPDA 3FBBA 3M2RA 3QATA 3TNVA 5HP1A 2VFUA 1FE4A 1L3SA 1RT4B 3L7UA 1RYRA 2UXBF 3BZQA 3IC1A 1WHXA 1R3NA 1TP7A 3GPAA 4ZJQA 1SJQA 4YR3A 4DL3A 1PAEX 2HNYB 3DGPA 1K47A 4TQSA 1BWEA 2HQGA 4PG5A 4KHPF 1F5BA 2CVEA 2MKHA 2F7VA 3FFIA 4P2FA 4GC6A 3V6JA 4DF4A 2CNNB 2FVSA 1PYTA 3D0GE 3MXHP 2J6UA 2JEFA 3OFHA 1WOSA 2VASA 4Q7AA 1T05A 2UXCF 1W7WA 4QU6A 1GT8A 3MEDB 4RKUC 1S10A 1FXRA 2OPPA 3MM5A 2MSTA 4J9NA 1SBRA 1YZ6A 3DLJA 1XNQF 2KB2A 3WHIA 1RU2A 5DZ6A 4DF8A 3HP6A 5D0EA 4MIBA 3CO0P 4PKDB 5IWAF 3D67A 1F3FA 4XO0A 3SCIE 4RO0A 5FLXY 2R2SA 1FJGF 3C46A 4A46A 2QL5B 3KJFB 1CJUA 1KBRA 4RUHA 3HVTA 3MR7A 4R0JA 4ECQA 3CJQA 1D8ZA 3BR8A 4GVBA 3I82A 1EZZB 3DYAB 3E3XA 2Y1JA 2R7TA 2D3O1 3UD5A 2FJVA 2J9DE 4CIOA 4EBDA 1HBMB 1HNZF 2M70A 2L41A 4JYAF 1E6VA 4R8UA 3DI6A 4LFBJ 4CM2A 2LU2A 2Y8WA 5EWEA 1R8AA 1D9FA 4IFYA 2AEMA 4C11A 1D9DA 3HVRA 1GMUA 1OQ6A 1Y11A 4CO1A 3UNYA 5D3GA 3N79A 1KHWA 3IN5A 1I3OB 5HJXA 4PG6A 1TL1B 2YKMB 4Z2XA 2R3VA 2FJWA 2XMAA 1XR6A 4YOEA 2ZBCA 1FKOB 3MAAB 4GO5X 4E8UA 5J2NA 2I2YA 1S79A 3OSPA 3D1OA 4NXNJ 1AFJA 1H6KX 4DQSA 3VAKA 3RB4A 2XB2D 2JFKA 3HHLD 3OT9A 4CLSA 1F9EB 3SFUA 2GS8A 2HZCA 3FKBA 1FK9A 3HZEA 3LTOA 4DXLA 4Z7CA 4C8OA 1WKLA 3SYZA 3UQSA 2OD4A 1JK9B 3TR5A 4Q45A 1UWAA 1M5HA 2LQ8A 2WB1D 4HACB 3TARA 1UW4A 4DV6J 1O6XA 4WP3A 4DPXA 1FXLA 5LM7E 4WZQA 2GHVC 1VQKS 3GV7B 2VA2A 3HXMA 3CB4A 4LR7A 3AODA 1FNMA 1PGZA 4F0MA 4W92B 1SQEA 3MHYA 2H65B 2FZGB 3RAMA 5HSPA 2OJ3A 4JI6J 2AWZA 2L08A 5KG5A 2ILZA 4FNHA 1FEHA 3MCOA 4DS5A 1XMOJ 4TY8A 2YWKA 3IAM9 1TVRA 3D2WA 4O3SA 3CCQS 4IG3B 5HJYA 1T3OA 4DL4A 1WUUA 2R7OA 3FNNA 5L9NA 1ZAXA 4JI4J 5E3QA 3ET6B 3ZTOA 2ZWPA 1I5OB 3BKFA 4QIWD 4DL7A 1AUSL 4GO7X 2GHWA 3IP0A 4OI3A 1LWFB 4NEYA 3J7YU 4RW9B 2IM2A 4TYAA 3KJVA 2IBOA 1TKXB 2EKNA 2F3JA 4K50A 2HQ3A 3MF5A 2EKYA 2W2OP 3M6VA 3JQKA 3HSJA 1V5IB 3Q24A 2OI2A 2VL1A 2QMXA 2I38A 3UD3P 4QR0A 1RCXB 2LU1A 2V8HA 4IKAA 4ED0A 3CMAS 3DNCA 2MQPA 2MZ1A 3NS5A 1RAFB 2BOAA 4M5MA 2J0SD 1U8WA 4PABA 4RNHA 2ZZMA 3OW2R 2YNIB 1TZ0A 2U1AA 2CKWA 4HH0A 3QPIA 4ZVRB 4BLGA 1REVB 4X4RA 1YLXA 2V8PA 3CNQP 4Q44A 1SL0A 1S1XA 3C15B 2E9TA 4KE5A 1VK3A 3IBCB 1UVIA 1P6TA 2GQCA 4FKYA 3W2WA 4ZIWA 4I7FB 1R43A 3C19A 3IMQJ 2W2PP 3GLJA 1FWKA 3D68A 5B08A 7FDRA 3EGWB 1EAYC 2PA8D 3M32B 4P2MA 1H2TZ 3KHLA 3K59A 2AYBA 4JI1J 2K3KA 1R6YA 2HWTA 3FSYA 3GP9A 4KGXB 2DGTA 4Y34A 1RGVA 1DURA 4DR1F 4LR9A 1HYSA 2V68A 3EXYA 1S99A 4OI2A 1HLWA 1T9UA 2NZCA 4QBUA 1RHKB 2YXLA 2IA0A 3PRDA 3JSMA 1NMEB 3DDIA 1YZ7A 4F26A 3RB6A 2OPRB 2DR8A 1F60B 5DZ7A 2KFNA 3DU6A 2K8GA 2Q79A 2C2DA 1TL7B 4K4VA 2B3TB 2FZKB 4M63A 2RJZA 3QZ8A 1CLFA 2HLTA 3IWNC 1U1RA 2BOPA 1TL1A 1FDAA 2YKMA 2WBMA 1WTFA 1V5VA 3K7RA 1KTVA 1FKOA 3MAAA 3MPVA 4WWSA 2M9KA 5J2MA 1VHIA 4USHA 4MAKA 4BDPA 3G6XA 1MWQA 2SXLA 4IG0A 2BJ9A 3PCOB 1K9MT 5HVHA 4Y00A 3DU5A 1HHQA 3AB2B 4XAKA 1NCLA 1WG1A 2FJAB 3CJKB 2BKOA 4MK9A 3QQCD 4X4QA 3QIPB 3G8TA 4B3TF 2YX7A 4DU8A 4DV6F 2FB0A 5B7WA 2BKNA 3PFEA 4DV2F 2KRRA 4FF1A 3D6FB 3TOQA 2XI3A 1C0TB 3RB3A 3RAXA 4JI5J 1KSPA 3T1HJ 4JI6F 3D6HB 4DR5F 4B3SJ 4K4SA 1RT7B 3QGIA 4O44B 3CCWA 4NLUA 2GHPA 2K1RB 4HEA9 2HQCA 2MDAA 4JOUA 2RT3A 4OX9F 4RW8A 2EI5A 4IYQA 4YHHF 1LWXA 2KJVA 5I3UA 1RISA 2QG9B 2XLKA 2HFUA 1ZM4A 4DUYJ 5F8NA 1F1BB 3UR3C 4ZN1A 3MECB 1WSRA 2ZOFA 4PWDA 2ROEA 4ENOA 3MAHA 4KR0B 2DRBA 1UFWA 2YNFA 1KQFB 3J81U 1TKTA 2DBBA 4HTIA 1L3TA 2E9ZA 2MY7A 4NXMF 2DRDA 3R5DA 3Q22A 5F3ZA 3G6ES 3NGTA 1RWNB 1EJ7L 4ZVEA 1U1LA 5HLFA 2CRLA 4OYWA 5CCMA 4DR4J 2KM8B 5CZXA 2HEKA 3TUZC 5GMDA 2BE7D 4L75A 1S57A 5AXNA 4KGVB 4DPOA 4IG0B 4O0NA 3DLBA 4HHJA 2POKA 2YKAA 4TU7A 4PXEA 1SC3B 1KS2A 2HHHJ 3QAEA 2OD6A 3G71S 5KG1A 4ED2A 2RHSB 4QWAA 4B9NA 1CJVA 2MQMA 2K7KA 1G6BA 3TZWA 4DL0C 1VI7A 2IYIA 3FEZA 2GVDB 3C6TB 1T9XA 2ZEJA 4YN3B 3V6DB 1AROP 3P5TL 1BLUA 4LF8J 3FUYA 3HHLB 2ZH1A 4CNYA 3OLAA 2FVPA 3NS7B 1H2UX 2IYGA 4E2FB 3JYTA 2PA3A 2GX8A 2MZTA 1EQ0A 2YPYA 5DGAA 3HLUA 1YITS 5K20B 1UWBB 3AY0A 3AA9A 2B0GA 2HFSA 4CO5A 1I94F 3M32A 4KKOB 5ITHA 3KLGB 1NB7A 3ZZOA 5GAEU 4ICLA 1HBOB 1YVFA 4X62F 3A8EA 1TFYA 3G6VA 5KFWA 4X4OA 4DLEA 2HWHA 3HCXA 2XZTB 1S7IA 1RTJB 4M5DB 1VISA 1Q5VA 1VDHA 2WVEA 4UUXA 1N88A 3MFIA 5HMZA 2R7SA 3QJJA 5EWFA 2O67A 4JI8F 4Y3CA 5AE1A 6FD1A 1YJ9S 3N01A 1S6PB 3MUMP 5HBMB 5L1IA 2RQMA 2DEJA 2F9DA 3DLGB 2A2CA 4DLGA 5K9FA 2NYHA 2AT1B 2YTCA 3DKDA 3V81B 3R1LA 4X4NA 2BV3A 3VGSA 4UOCA 1LXNA 4F2RA 1DQ9A 1H74A 4Y2IA 3H40A 2N82B 2G2OA 4U7UK 4A8OA 5KFKA 2IMWP 3HKWA 4FF2A 2NS1B 5DDQC 2YH1A 3KNGA 1FDDA 4WF9Q 1CJTA 2HW3A 3CCJS 1AZSA 4DQIA 4GVLA 4USWA 4WXOA 2V63A 5GADU 4I69A 5E7OB 3CJKA 2RAQA 5C2GA 1PILA 4ZLLA 2FHMA 1RUSA 1JLQA 2ZM6J 5CYQB 2P8IA 2ZDPA 2R8IA 1T3NA 3CDBA 1Q8BA 3IFEA 4P9SA 3HT0A 2HFNA 3NOCA 4I6YA 3WZ0A 4LF1A 4F3OA 1NAQA 2DH9A 1XJWB 5BR8J 2AIRB 1TKZA 2VC0A 3T5HA 4NXMJ 2HMIB 1BGXT 5KG7A 1LW2A 3ZZYA 5L1LA 2EK6A 3GIRA 2LQJA 4M5DA 2FTRA 4URQU 2HKEA 3UN2A 2ADCA 5KFYA 4U7UD 1KLMA 4HYKA 3QGGA
chains in the Genus database with same CATH topology
1BE4A 4CP5A 1HIYA 3FKBA 3ZTQA 4ANEA 1S59A 3B54A 3R9LA 2HVEA 1NDPA 1WKLA 3ETMA 4DUTA 2BEFA 4W98A 3ENAA 4UOFA 4KPCA 1LWXA 4WBFA 5CAAA 1XQIA 4ENOA 2DY9A 4F36A 4ANCA 3MPDA 4S0MA 1NDKA 2VU5A 3FBCA 3NGRA 3VGTA 3G2XA 3B6BA 3NGTA 3EVMA 3BBBA 2CWKA 4FKXA 5IOLA 1NSKL 3FC9A 1XIQA 3ZTOA 1F6TA 1S57A 1NSQA 3EJMA 4O0NA 1BHNA 2B8PA 1NSPA 1ZS6A 4DZ6A 3EM1A 3FCWA 3EE3A 3Q83A 4F4AA 3BH7B 1NDCA 3EMTA 3VGVA 1BUXA 3FBFA 3VVUA 2DXDA 3FCVA 3VGUA 3EVOA 3FBBA 3L7UA 3Q86A 4C6AA 1U8WA 5C7PA 1KDNA 3GPAA 3NGUA 1UCNA 1PAEX 1EHWA 3ELHA 1MN7A 1VYAA 3PJ9A 3ZTRA 4FKYA 2DXFA 1W7WA 3ZTSA 3GP9A 3NGSA 1K44A 3BH6B 2ZUAA 3BBCA 3PRVA 3Q89A 3DKDA 2AZ3A 1B99A 1HLWA 1NPKA 4HR2A 2DYAA 1F3FA 3VGSA 1PKUA 2NCKL 3Q8YA 2B8QA 3DDIA 1JXVA 2BX6A 4EK2A 1MN9A 1NDLA 1NHKL 3Q8VA 2DXEA 1NB2A 2HVDA 5CABA 4UOHA 3JS9A 2AZ1A 1LEOA 3BBFA 1B4SA 1NUEA 3ZTPA 3Q8UA 1WKJA 4UOGA 5BXIA 3WX8A 1HHQA 1S5ZA 1WKKA 1NCLA 4ANDA 3EICA 4DI6A 1NLKL 3VVTA 3FBEA 3EVWA 2HURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE4 A;  4CP5 A;  1HIY A;  3FKB A;  3ZTQ A;  4ANE A;  1S59 A;  3B54 A;  3R9L A;  2HVE A;  1NDP A;  1WKL A;  3ETM A;  4DUT A;  2BEF A;  4W98 A;  3ENA A;  4UOF A;  4KPC A;  1LWX A;  4WBF A;  5CAA A;  1XQI A;  4ENO A;  2DY9 A;  4F36 A;  4ANC A;  3MPD A;  4S0M A;  1NDK A;  2VU5 A;  3FBC A;  3NGR A;  3VGT A;  3G2X A;  3B6B A;  3NGT A;  3EVM A;  3BBB A;  2CWK A;  4FKX A;  5IOL A;  1NSK L;  3FC9 A;  1XIQ A;  3ZTO A;  1F6T A;  1S57 A;  1NSQ A;  3EJM A;  4O0N A;  1BHN A;  2B8P A;  1NSP A;  1ZS6 A;  4DZ6 A;  3EM1 A;  3FCW A;  3EE3 A;  3Q83 A;  4F4A A;  3BH7 B;  1NDC A;  3EMT A;  3VGV A;  1BUX A;  3FBF A;  3VVU A;  2DXD A;  3FCV A;  3VGU A;  3EVO A;  3FBB A;  3L7U A;  3Q86 A;  4C6A A;  1U8W A;  5C7P A;  1KDN A;  3GPA A;  3NGU A;  1UCN A;  1PAE X;  1EHW A;  3ELH A;  1MN7 A;  1VYA A;  3PJ9 A;  3ZTR A;  4FKY A;  2DXF A;  1W7W A;  3ZTS A;  3GP9 A;  3NGS A;  1K44 A;  3BH6 B;  2ZUA A;  3BBC A;  3PRV A;  3Q89 A;  3DKD A;  2AZ3 A;  1B99 A;  1HLW A;  1NPK A;  4HR2 A;  2DYA A;  1F3F A;  3VGS A;  1PKU A;  2NCK L;  3Q8Y A;  2B8Q A;  3DDI A;  1JXV A;  2BX6 A;  4EK2 A;  1MN9 A;  1NDL A;  1NHK L;  3Q8V A;  2DXE A;  1NB2 A;  2HVD A;  5CAB A;  4UOH A;  3JS9 A;  2AZ1 A;  1LEO A;  3BBF A;  1B4S A;  1NUE A;  3ZTP A;  3Q8U A;  1WKJ A;  4UOG A;  5BXI A;  3WX8 A;  1HHQ A;  1S5Z A;  1WKK A;  1NCL A;  4AND A;  3EIC A;  4DI6 A;  1NLK L;  3VVT A;  3FBE A;  3EVW A;  2HUR A; 
#chains in the Genus database with same CATH topology
 2BM0 A;  5KG3 A;  1E6Y B;  2BJE A;  4QWB A;  1RHQ B;  4MH8 A;  1T9T A;  4PWD B;  2B5J B;  1H0H B;  1ZAV A;  2DGU A;  2RQK A;  4AT1 B;  3CUN A;  4X64 J;  1S59 A;  2NXN A;  2P2C B;  3BB5 A;  3S01 A;  2XLI A;  1WF2 A;  3KLH A;  5D78 A;  1GXT A;  2XMU A;  4NLO A;  2V2K A;  1L3V A;  1K8A T;  2PMW A;  2AJ0 A;  1Y4Z B;  4TXS A;  4KTQ A;  2UXD J;  3FMB A;  2MQN A;  4RW6 B;  2CYY A;  3LAL A;  1VC0 A;  3KUE A;  2V4Q A;  2DNO A;  3BPD A;  4LVN P;  1AFI A;  1U6F A;  2G2Y A;  2NUU G;  3TZY A;  3A1Y G;  4O44 A;  4OLP A;  4NMX A;  2R7U A;  2OGU A;  2D9P A;  3DCA A;  2M88 A;  2JNJ A;  4C8L A;  4M8L A;  2VH7 A;  2HHH F;  4C9D A;  2L48 A;  3LH2 S;  3M30 B;  3B4D A;  4DQR A;  1K0T A;  1G4C A;  1SKS A;  2R8K A;  2FJX A;  1CSJ A;  1NSK L;  4YUD A;  4B3M F;  3R3T A;  2XS7 A;  1AYE A;  1LW0 A;  2KO1 A;  1X60 A;  4F04 B;  2RU3 A;  1KOO A;  1VK8 A;  4ZCL A;  4LFC J;  1JXL A;  4K4Z A;  5G4D A;  1URR A;  4KHM A;  1S1V B;  1F9H A;  3PRB A;  2NZ4 A;  3MPY A;  4ECT A;  4Z7Y A;  5M2P A;  1VQN S;  1LOU A;  1HBM A;  3QFH A;  4P7V A;  1IN0 A;  3IRX B;  5KFI A;  4LSZ B;  1HHT P;  3J7Y I;  5E41 A;  5A6W A;  1IKY B;  1ROF A;  3MFH A;  2DHX A;  2X51 A;  4RZR A;  2UU9 J;  3HHE A;  2GJ2 A;  4OZN A;  4NLS A;  3PIP Q;  4CLF A;  3W65 A;  2ATC B;  3EVO A;  2RF2 B;  4LFA J;  3NAI A;  2YQ1 A;  3MM6 A;  3J80 Y;  1G2E A;  2NLW A;  4PG4 A;  4DV5 J;  1DTQ B;  5KFA A;  3DLK B;  3PJW A;  5K8M A;  4DSF A;  1GAO A;  2X3G A;  1HNX F;  4P6Q A;  2EXU A;  1UA1 A;  4ECY A;  5CYJ A;  2H48 B;  1RTD B;  2CXE A;  2DGS A;  4URG A;  2UUA J;  2R42 A;  2GIR A;  4Q2M A;  1JLC A;  2C3U A;  3C66 A;  2W4D A;  1U49 A;  1N48 A;  1DBD A;  2AYG A;  3NOG A;  1YKW A;  4FVC A;  1NU4 A;  1Q95 G;  4PPZ A;  5B09 A;  2P9G A;  1N6Q B;  4XK8 C;  4DSJ A;  2R7X A;  5J2Q A;  3NNA A;  3KLF A;  2MMY A;  4KFB B;  4DSL A;  1UJ4 A;  3GJT B;  4J90 A;  1LWF A;  2HHX A;  4EO8 A;  2NXJ A;  5A8W A;  2NCK L;  5ADZ A;  1NH8 A;  2VKR A;  4C8N A;  3UDE A;  3I5C A;  2NSB A;  4OJ1 A;  2UXC J;  4PEO A;  2QMU B;  2XSF A;  4IOB A;  2NYI A;  2HK3 A;  4D3G A;  4HT5 A;  3VAG A;  1IKX B;  1HNV B;  3ZFV A;  2QE5 A;  2RRA A;  1T02 A;  1HWU A;  1R6V A;  2Z2Z A;  3PFO A;  4UOH A;  4K7Q A;  4I2P B;  1QAX A;  2CJ9 A;  2J7W A;  3SI8 A;  2JVR A;  2E9R X;  2K2P A;  3KJV B;  2D1C A;  4NEZ A;  2DNQ A;  3HFK A;  4X65 F;  2J9D A;  3H5U A;  1BQN A;  1HI1 A;  2F65 A;  4O3Q A;  5HAO A;  3WX8 A;  3FSI A;  2ZJP Q;  5HMY A;  4ECR A;  1WSV A;  2BAB A;  4ZKA A;  1WDT A;  2DCL A;  2ZH2 A;  1ZTW A;  3ZNJ 1;  1D3W A;  1FRL A;  1NPR A;  1TUV A;  2ASY A;  2KRB A;  2L9N A;  3MTK A;  4B02 A;  5IV3 A;  2XS2 A;  4X2B A;  3KG4 A;  3BS9 A;  2P6S A;  2CDQ A;  1JKH B;  1OYE A;  2HRY A;  5GME A;  3UNG C;  2P9C A;  5GAD I;  2BR0 A;  1IBM J;  4Q0B B;  2FJD B;  1MW7 A;  1WEY A;  2CAD A;  4MT1 A;  3JAM U;  1KR4 A;  4K4T A;  3FDS A;  2AW0 A;  5KFQ A;  2FJE B;  3M8Y A;  1SKR A;  1JIH A;  3OTB A;  4YB6 A;  3EX7 B;  2BAN B;  5E3A A;  2ZKU A;  5CAA A;  4J9S A;  3QO9 B;  3CD0 A;  2R7V A;  4ZCM A;  2ZH6 A;  1VQ9 S;  3OFG A;  4OIX A;  2C3M A;  2C42 A;  3MCN A;  4ZPC A;  5H1S V;  3SIP B;  1X5P A;  4OYP A;  4WFB Q;  2Z8Q A;  5LMN J;  2FQQ B;  3JTN A;  2XUL A;  5F8G A;  1IXK A;  3T1Y J;  2JHE A;  3MMC B;  3RG6 A;  3JTP A;  3TP2 A;  3WIV A;  4FYW B;  5J2N B;  2VU5 A;  1TMM A;  4F3M A;  3DRX A;  5FD1 A;  1NK5 A;  3W5Y A;  1JJ2 R;  3TEH B;  5IQ6 A;  4USU A;  3IRW P;  2D74 B;  1TAQ A;  3BKU A;  3GB0 A;  3MR6 A;  4KH1 B;  3IRX A;  3BO4 A;  4MKB A;  1Y10 A;  4OFZ A;  4OYM A;  5DG8 A;  3MUR P;  4JI0 F;  4FF3 A;  3R2D J;  4JI7 F;  1H3D A;  1CC8 A;  4M5J A;  3HD2 A;  2E5L J;  4TNO A;  1RAO A;  1S7H A;  4J7C A;  1RJJ A;  2IDL A;  4WXW A;  3TQE A;  2YWG A;  5A8K A;  5L46 A;  2HS3 A;  4YP3 A;  3PIO Q;  1DZ5 A;  2V50 A;  2XEX A;  1U6B A;  5D0H A;  3TUJ C;  4B3R F;  3TO8 A;  4F4A A;  2DKO B;  4C0B A;  1MSW D;  1ITP A;  4K4W A;  4DOZ A;  4KO0 A;  1V3S A;  4IH6 A;  3OL8 A;  4PRF A;  1NDC A;  1C4A A;  2G2Z A;  3T5K A;  2ZJR Q;  4WU3 A;  2JEI A;  1TL4 A;  3FCV A;  3VVU A;  2E5J A;  4HDG A;  2QSW A;  1Z2L A;  2DGX A;  4C8M A;  4C8K A;  4JV5 F;  1IKW B;  1VRT B;  3JSM B;  3LP2 A;  1ELO A;  2Z56 B;  4DQP A;  1RWW B;  2LMI A;  3JQM A;  4JI8 J;  3C3L A;  2ZBQ A;  3RB0 A;  3LAM A;  2F4V F;  5FDL A;  2ZD1 B;  1PG5 B;  1PC4 A;  1CUL A;  1QD1 A;  2AX1 A;  1FWL A;  2KJW A;  2MHN A;  3IM8 A;  3K5O A;  3L09 A;  1BD6 A;  4ZPT R;  5E3C A;  5HI7 A;  4Q43 A;  2UVV A;  2RML A;  1LK5 A;  1QAY A;  4R5P B;  3MCS A;  4QIE A;  2BE2 A;  2DNR A;  2I8E A;  2JX2 A;  2A10 A;  3CCT A;  1MWY A;  1SPB P;  1XK8 A;  4LRB A;  1ZM3 A;  2GJF A;  4NXN F;  2GMH A;  4I2Q A;  1RU1 A;  2GIQ A;  3AD8 C;  3SBM A;  3ZZT A;  1S6O A;  4RU9 A;  4EU0 A;  3G82 A;  3CD5 A;  1VOM A;  1FRK A;  2DHA A;  3K8W A;  2V0N A;  4I64 A;  4OV6 A;  2AEJ A;  1K44 A;  2B7C B;  3M8Q A;  4DN0 A;  2FHO B;  2RRB A;  3I4P A;  4WCE Q;  1JX4 A;  4NCG B;  2DY1 A;  3FQK A;  4DFM A;  4CO4 A;  2HHQ A;  2BJ3 A;  3KK1 B;  1KRP A;  1CG2 A;  2V2Q A;  3I0R A;  3LP0 B;  4DV3 F;  1KFS A;  2YWW A;  2PFF B;  4WE1 B;  1Y5N B;  2KKH A;  4JP8 A;  1MN9 A;  4F67 A;  1C2P A;  4X4T A;  2IRU A;  4DR5 J;  4C3K A;  3MD1 A;  4YY3 F;  2PEH A;  2QA4 G;  3K5N A;  1P27 B;  4NLQ A;  1Q1K A;  4KO0 B;  4N7T A;  1S0M A;  4M5G A;  2GQ2 A;  2HIY A;  3UE2 A;  1N33 F;  3UN5 A;  3KMQ A;  4V19 J;  4B9U A;  3PY8 A;  1MRO B;  1RHU B;  2XMM A;  3CCR S;  1FD8 A;  3ISN C;  1OJ4 A;  5AJ3 J;  3M2V A;  5JVG Q;  3CCS S;  3Q8U A;  5BXI A;  2QTW A;  2WOM A;  1V9O A;  3M8R A;  3CC7 S;  1WKK A;  3R6G B;  3LPE A;  4MMO A;  2YWF A;  4OMF G;  4EO6 A;  2ZBI A;  3I31 A;  5KFJ A;  4IOC Q;  4EBC A;  2PGC A;  2JC1 A;  3BGL A;  3I9Z A;  1U1K A;  4USM A;  3BRE A;  4UY8 T;  4PR6 A;  3H8Y A;  3UDV A;  4ED4 A;  1HBN A;  1WEZ A;  1OPZ A;  1EQM A;  1S4F A;  1IKV A;  2KI2 A;  1FTC A;  1CC7 A;  1U2F A;  1UP1 A;  2OEM A;  3OSN A;  5D4N A;  4EBE A;  5D77 A;  3B4M A;  3TW0 A;  1VC5 A;  3M1V A;  2BEF A;  4W98 A;  1S9F A;  1HW8 A;  4FYV B;  3MPW A;  3SQG A;  2EG2 A;  3EGN A;  3ZNU A;  9ATC B;  4I0W A;  4Q5V A;  1A7G E;  4LRA A;  3PYE A;  4J91 A;  1VMB A;  3A3P B;  4H4M B;  3GJQ B;  1T11 A;  1UMJ A;  1N5V A;  2BA9 A;  3MDF A;  4R0E A;  4LF5 J;  4FYX B;  2HGL A;  4NAS A;  3MM5 B;  4QR2 A;  2WHO A;  4ZLJ A;  5GMK a;  4RUC A;  1RDR A;  3GU0 A;  1VIO A;  4KHP J;  3NS6 A;  5CYM A;  2B4V A;  2HWI A;  2N7Y A;  3T41 A;  1RK8 A;  2JC0 A;  2IVM A;  1EX8 A;  2JH3 A;  3B6B A;  3BBB A;  1Y9O A;  3G2X A;  2M3D A;  3HX9 A;  4I1T A;  3CGI A;  2XYG B;  2AV5 A;  4JBC A;  5D0R A;  1GX6 A;  1VFJ A;  3N0V A;  1FKA F;  4MKV A;  2R4F A;  4LF4 J;  1RTZ A;  2ZH8 A;  3M2V B;  2ZBP A;  4ED8 A;  3I0S A;  3RJM B;  4KGZ B;  4LQ9 A;  1NSP A;  1YRX A;  4OZJ A;  4TYB A;  2CJA A;  1N5T A;  1C0U B;  3DOK B;  1RAG B;  3MMA B;  3UN3 A;  3P6Y C;  5FJ4 A;  2VD3 A;  2QEX S;  2A18 A;  1IQZ A;  2NPI A;  4R8U B;  3DLE A;  2UVW A;  1TV6 A;  4DHV A;  5B0C A;  3JSY A;  4OZ0 A;  3IG1 B;  2ATL A;  4IFV A;  3F73 A;  4TKT A;  2BAC A;  3F56 A;  2ASJ A;  2IRX A;  5A8K B;  4R25 A;  1XMQ J;  1DQA A;  1D9A A;  1R8B A;  3AB4 B;  3L7P A;  1B7Y B;  2VKZ G;  3W62 A;  5HMW A;  3OVS A;  2PII A;  1YQH A;  1T03 B;  1M1H A;  3J80 U;  1VC6 A;  2UUA F;  4PUO B;  3VQS A;  3HFV A;  3SQG B;  1KON A;  2MB0 B;  2YQ0 A;  1VQY A;  1DAR A;  2HVZ A;  2VF3 A;  1XMB A;  4CTA A;  1N4L A;  1VIX A;  2JSX A;  3VZI A;  2ZVI A;  3R7S B;  5AXM A;  2ACY A;  3G82 B;  2CPX A;  1NJW A;  3ELH A;  2D7S A;  2BUN A;  2XHW A;  2XTJ P;  2AX0 A;  2ZFH A;  4HI1 A;  3AQP A;  5CQG A;  1VYA A;  4A47 A;  2ZKT A;  3RU0 A;  3Q0A A;  5C25 A;  2GFF A;  3HHL C;  2J6T A;  3E2E A;  1SH2 A;  2RB7 A;  3LP0 A;  2V6A A;  2LFV A;  3IXQ A;  3OTC A;  1Q16 B;  4N56 A;  4YY3 J;  3BQ2 A;  1KQG B;  3KWM A;  1VQ6 S;  5LSL A;  4AD6 A;  2DO4 A;  4ZVQ B;  5DLG A;  3EYZ A;  3MEE A;  2KL8 A;  4KC5 A;  3W9H A;  2HHU A;  5B0F A;  1SJ1 A;  4QWD A;  1FJC A;  2APO A;  4ZLP A;  3BJY A;  1RI7 A;  4G1I A;  1Q7Y T;  4X64 F;  3S1T A;  1RYS A;  3GON A;  5F9N A;  1JJ4 A;  3R7N B;  2OEK A;  3T6B A;  2CFX A;  1XR7 A;  3QSY B;  3UWT A;  2QV6 A;  3IG1 A;  3HHN B;  1X0P A;  5HQM A;  2DK2 A;  2W24 A;  2WW8 A;  1PCA A;  3MM8 B;  1K1Q A;  1PAU B;  2XNQ A;  4IOA Q;  1UPM B;  4XDD A;  2DGQ A;  3DN9 A;  4FDF A;  1S1V A;  3AJ2 A;  3TX0 A;  3MGJ A;  5LXR A;  1SQG A;  1DTQ A;  4F4W A;  4DWI A;  1CS4 A;  2IM3 A;  1TFW A;  1T8E A;  2NR0 A;  2IDE A;  3IR6 B;  2E7V A;  5A0Y A;  5GAH U;  2XGP A;  4A8W A;  3JAM Y;  1DRZ A;  3LAN A;  3S6E A;  1SC1 B;  4DUZ J;  6AT1 B;  4P52 A;  2IFX A;  2UUW A;  1TQL A;  3EDQ B;  2VPY B;  1GXU A;  4TY9 A;  3M30 A;  3K5M A;  3N5B A;  4QW8 A;  1N0V C;  2C28 A;  1YSJ A;  1A9N B;  1SC6 A;  3U7J A;  2OTJ S;  2GC8 A;  3ZXW A;  1I6J A;  4B3M J;  3AFG A;  2LEB A;  1HPZ A;  4PG8 A;  2EC2 A;  1RCO B;  2F5G A;  1XNR F;  1IVZ A;  1HIY A;  2LEA A;  3W60 A;  1LNQ A;  4ECU A;  1U8S A;  3CD6 S;  4PYA A;  2AYM A;  5KFV A;  3ILJ A;  2B4U A;  3S8S A;  2HBQ B;  4RNN A;  4EGL A;  1FCA A;  2O66 A;  4I56 A;  5DO2 A;  1QE1 B;  4JYA J;  2KYX A;  1AT1 B;  2MKJ A;  4J37 A;  4UW2 A;  1URN A;  2JLF A;  1F5A A;  2MHE A;  2O5D A;  1XQI A;  4LBH A;  2ZH3 A;  1VQ5 S;  1RAI B;  3CWJ A;  4AQY J;  3MEK A;  1DTT B;  1RT6 B;  1VLY A;  2HBR B;  1L3U A;  4S0M A;  2WTF A;  2YNF B;  2HBY B;  3U1N A;  3FBC A;  1XC9 A;  1RT5 B;  1S0O A;  1R8C A;  5KFR A;  4RUA A;  4E98 A;  5B0G A;  2PI5 A;  3R5J B;  2VJU A;  3DLK A;  3CJ3 A;  3FC9 A;  1APS A;  4DG1 B;  1R0A B;  5IT0 A;  1MG7 A;  2I9S A;  4FPR A;  3CCL S;  2UUB F;  2JL9 A;  2HVI A;  2B43 A;  2JVO A;  2FLO A;  2JRS A;  4NA3 A;  5T7L A;  1GMW D;  2QLF B;  4ZN3 A;  1BHN A;  1ZAW A;  1WJ9 A;  1S6Q A;  1KOH A;  2Y1R I;  2DGV A;  5L9X A;  1HNI B;  2PE8 A;  2BJ1 A;  3AD9 C;  4DX8 H;  8RUC A;  4YQW A;  2OFG X;  1RE1 B;  1C4C A;  2J0W A;  1HNW F;  1PJ5 A;  4K5R A;  3D5M A;  3TVY A;  2DNN A;  1QDU B;  4RW4 B;  4DCJ B;  4PXD A;  4DPW A;  2B9X A;  3X1L B;  1GFW B;  3GFH A;  1BUX A;  1JJH A;  5BJR A;  1RKI A;  2RVJ A;  2RQC A;  2W4P A;  2RIJ A;  3DLE B;  3BDE A;  4A8S A;  2C1E B;  4OX9 J;  3OL9 A;  1WOO A;  3N5F A;  4AXI A;  4C97 A;  2W7P A;  2VPZ B;  2LYV A;  2HAI A;  3A3O B;  4C6A A;  2XQC A;  4FYD A;  2CQG A;  1GH8 A;  1M1K T;  3QO9 A;  2QN6 B;  3TA2 A;  1QE1 A;  1A6L A;  4F25 A;  5DDR C;  1S1U A;  4F0H A;  1FVS A;  2M2B A;  3G87 A;  3KXD A;  4P2S A;  5LJ3 Y;  4U9R A;  1CQM A;  1RT1 A;  1X4F A;  2YNH A;  3TEG A;  4PXC A;  3KOA A;  4AUK A;  1RP5 A;  3R5B A;  7FD1 A;  1S0N A;  5B0B A;  3OQ2 A;  4OZ3 A;  2BJD A;  2IM0 A;  2QLJ B;  1VLO A;  2VBY A;  3K89 A;  3NBP B;  5AT1 B;  1RTJ A;  3M05 A;  4CRJ A;  1L3K A;  4RU2 A;  2VPX B;  4NPO A;  2IA6 A;  5D8H B;  4H4K C;  2MKS A;  2ZDO A;  1VQL S;  1WC1 A;  3QT8 A;  1HQU B;  4IDK A;  1R7I A;  5ETS A;  3WQP A;  4CT9 A;  3VV2 B;  4ZHR A;  4J9K A;  1P9Q C;  1VHF A;  3QRP A;  5ETN A;  3MM6 B;  1XBW A;  1YJR A;  2ZE2 A;  5CD4 H;  4DFK A;  2DYA A;  1J5O A;  3POT B;  3KLE B;  2LKZ A;  1JKH A;  2CIM A;  2WCX A;  4D3H A;  5A8R B;  3DHX A;  4USK A;  3L7O A;  3H5S A;  4G1Q B;  4IH7 A;  5AJ3 F;  3A13 A;  3AOB A;  1JLF A;  2HQI A;  2V8V A;  3HDS A;  3QMQ A;  1D1U A;  5ETP A;  3OTD A;  1CQN A;  4KV8 B;  1FNX H;  1KNZ A;  1ZA1 B;  3R27 A;  1WHW A;  2QA2 A;  3VQT A;  3MOJ B;  1RA7 A;  3IS9 A;  1NKE A;  3LW5 C;  2GIF A;  2XGQ A;  1A0O B;  3D66 A;  4ZA1 A;  1WG5 A;  1S6P A;  3ZTP A;  3LWL A;  2YBV A;  3GJS B;  3RRK A;  1N32 F;  2OEL A;  1GTH A;  3HHL A;  1WC6 A;  4ZIV A;  5C42 B;  3KMS A;  1U1N A;  1HQE B;  4TU8 A;  1ZET A;  1YRT A;  2GCF A;  2RU9 A;  2VG6 A;  1NZA A;  3DOL A;  4XPC A;  4R5P A;  4YHH J;  2M7S A;  2CPF A;  3I56 S;  3OR1 B;  2HHW A;  4WFZ A;  1UVM A;  2BVZ A;  1IKX A;  1HNV A;  1DLO A;  3OXG A;  4KKO A;  5H9F K;  4P75 A;  4B9M A;  3R9L A;  1FKP B;  5THW A;  1B7F A;  2PEB A;  1LWE B;  3CJ2 A;  1CJK A;  2Y3Y A;  3LP1 A;  1FT8 A;  4AL7 A;  4K8R A;  4FXD A;  3CDE A;  4M1K A;  2C22 A;  1U47 A;  3FGV A;  2GA7 A;  1D0E A;  3I5A A;  1HD1 A;  2OSR A;  4EWT A;  1TTH B;  5KFO A;  2YNG A;  2LXI A;  3BGR A;  4I2Q B;  2HND B;  3UD4 P;  4F4K A;  1FRH A;  4ILL A;  3ISZ A;  4DUZ F;  5CH7 B;  3M4X A;  3ILL A;  3LGH A;  2DIV A;  4CLW A;  2R2U A;  4PQU A;  2NSC A;  2YVS A;  2DNM A;  2H4Y B;  4B9L A;  2HFZ A;  3NGK A;  5KT3 A;  3BSC A;  1HBO A;  3I0R B;  4LVO P;  4WTO B;  2ZD1 A;  3Q8Q B;  2GAH C;  1PJ6 A;  2YH0 A;  3H2V E;  1OY6 A;  5D3G B;  3T19 A;  4P71 A;  4DZD A;  4LFC F;  2J0X A;  3AQO A;  1XNR J;  2H5E A;  3LGM A;  3N4W A;  4N8N A;  4NA1 A;  1V6H A;  5KFG A;  2R7W A;  4KGM A;  2IY5 B;  3WBZ A;  3NCQ A;  2LDY A;  1IM6 A;  1JLQ B;  4ZVS B;  2RH3 A;  2ACM A;  5HN0 A;  2WK4 A;  2CNK B;  3G8Q A;  2ZHA A;  2DR5 A;  3D9B A;  5IM0 B;  2M5Y A;  1SJF A;  3TAM B;  1VJQ A;  5B0A A;  1S6Q B;  3ILI A;  2C2Z B;  1VQ7 S;  2C2E A;  2Z4P A;  5GAG U;  3X3U A;  4ZP6 A;  3GWC A;  2C2O B;  4DCP B;  4DS4 A;  1SUQ B;  1UJ5 A;  2I6W A;  2RNE A;  1FJG J;  4NRU A;  2E44 A;  3C2P A;  2X1F A;  3Q86 A;  2ALZ A;  3IGV A;  2YKN A;  4P10 A;  5SZT A;  4NWB A;  3KNA A;  4N8O A;  3TUP A;  4F8R A;  4GKK J;  4K4U A;  1UZD A;  3CW2 C;  3K5P A;  3T6J A;  1OSD A;  2VBZ A;  2NQP A;  4ZHR B;  1IKV B;  4P73 A;  2VDI A;  2RS2 A;  3R5G A;  3EDR B;  4DR1 J;  2G4B A;  2HND A;  2QLB B;  1HI8 A;  2CPJ A;  4NA2 A;  2FVR A;  2DNH A;  3DMJ A;  3MR3 A;  2XZW A;  4EI2 A;  3O6Q A;  5CXT A;  1IQT A;  2IVF B;  4DR2 J;  3TI0 A;  1VBX A;  3DRP B;  1TL3 A;  1LXJ A;  1FFS B;  5HRO B;  4UF4 A;  4UZB A;  1TAU A;  3QRQ A;  2B9W A;  1JB0 C;  1WF0 A;  1S12 A;  1EKR A;  3BH6 B;  3SZ2 A;  2EFQ A;  2LXU A;  3D6M B;  3JQJ A;  3QJP A;  2KG0 A;  1SIZ A;  2RF2 A;  3W8P A;  2LQB A;  5JMN A;  1WOR A;  3CO9 A;  2M52 A;  3IA0 A;  4DX7 A;  4C11 B;  4M95 A;  1EET B;  1JJC B;  1J2V A;  1H73 A;  2CQ2 A;  3OVA A;  3NWR A;  1M0S A;  4P2X A;  1OS5 A;  7AT1 B;  1H7X A;  1NO8 A;  2F63 A;  3CE8 A;  1HD0 A;  3LOU A;  3PG9 A;  4IFV B;  2HLU A;  3KTQ A;  1NB2 A;  1NHU A;  4ZLN A;  2R8J A;  4AL5 A;  2GQQ A;  4HHH A;  1HL6 A;  1IBK J;  3DC2 A;  2IM1 A;  2IJN A;  5AXL A;  4QWC A;  4MYU A;  2HYI B;  2VG6 B;  3DOL B;  3PW4 A;  3CUL A;  1SB6 A;  3O3L A;  4G1Q A;  3OL7 A;  4GKK F;  4XTT A;  2FGO A;  2CG8 A;  3MMJ A;  3U1M A;  4ZCI A;  2OAU A;  3JTO A;  3PVX A;  5LMU J;  4ELT A;  4AL6 A;  3GG1 A;  2E1M C;  5IZH A;  4QIG A;  1UZH A;  2EFP A;  2W2N P;  3NG8 A;  2BRL A;  2PD1 A;  1FDB A;  4AND A;  2FY8 A;  2HQD A;  2J8S A;  3US5 A;  2N4C A;  1K1S A;  1LWE A;  1Y5L B;  1N54 B;  2MJU A;  3IS9 B;  3MR5 A;  5I3U B;  4Y2K A;  3W2W B;  3CJ4 A;  1WEL A;  4X66 J;  3KLV A;  5RUB A;  2VHG A;  4DV0 J;  3PKM A;  3WX4 A;  4NLV A;  2DR7 A;  3PW0 A;  4JI2 F;  2F8M A;  1HBU B;  1X31 C;  2WBR A;  1P1L A;  4WPA A;  1EP4 A;  1RXO B;  4F3Q A;  3MPU B;  3GYN A;  1DHM A;  2CPI A;  2YNG B;  3BM7 A;  1ZZF A;  2XMV A;  2CQP A;  3FMW A;  3JXO A;  3NXZ A;  5F41 A;  4B3O B;  1KVI A;  4H54 A;  3MEE B;  1Z2Z A;  1ZM9 A;  3LF0 A;  4DUT A;  5ETQ A;  1VJW A;  1YJT A;  3Q2T C;  5DQG A;  2DPI A;  2ZJQ Q;  1KLN A;  1R89 A;  1YJV A;  2XMW A;  3A3N B;  1UVL A;  1GMV A;  1REG X;  1NND A;  1T0T V;  1O5J A;  2QMW A;  4WBF A;  4XDC A;  5KG6 A;  2CVI A;  2BZ2 A;  5B0D A;  2DIT A;  4PQU B;  1FHT A;  2GO8 A;  2DY9 A;  3TAQ A;  5ETV A;  1JLB A;  1N33 J;  2JZ5 A;  2VZ9 A;  2KN4 A;  5EWG A;  2B51 A;  1YWX A;  3RBE A;  1TKX A;  3K58 A;  2DNZ A;  4NYO A;  1JMT A;  1IJE B;  2E5G A;  1FE0 A;  1M90 T;  3EVM A;  3PAC A;  4CWB A;  4DR7 J;  4HHU A;  5IOL A;  2A0F B;  3H90 A;  4Y6I A;  3SMZ A;  1S9G A;  5I42 A;  1KQS R;  2WAQ D;  4ITS A;  5EN1 A;  1L5U A;  5DLF A;  1FRJ A;  3HO1 A;  2KXF A;  1FI4 A;  4L74 A;  1VBK A;  6FDR A;  1F5C A;  2AGQ A;  3D3C J;  4FN5 A;  3VR1 A;  4LR8 A;  4BCA A;  1DY3 A;  3KLI B;  3FCW A;  3ITH B;  4OYO A;  4ECZ A;  4OYA A;  2MKI A;  4LRF A;  3W9I A;  4F4Z A;  1CJV B;  1SL1 A;  3B82 A;  2VQE F;  1W26 A;  1SJ4 P;  2E1P A;  1XWL A;  2RE1 A;  3GII A;  5H9E J;  1HNX J;  3OUY A;  1GMW A;  3UCU P;  3RRG A;  4LF9 J;  2C2N A;  4DN9 A;  2BJ7 A;  2DXD A;  2W8K A;  2FLP A;  4I68 A;  1H98 A;  3D7S B;  2CG4 A;  3PNI A;  2W9A A;  5ETK A;  2CJB A;  4LSN B;  3V6H A;  1GNK A;  3PEH A;  5CD4 A;  1ZZN A;  2GMJ A;  4FP9 A;  1UWB A;  1HAR A;  3BKT A;  3TWZ A;  3I0S B;  4QYR A;  1Q5Y A;  2ZNZ A;  2BJ8 A;  5LMU F;  3P4U B;  1VQM S;  1UEK A;  3QWP A;  1SUQ A;  2FC8 A;  4NX9 A;  4DV4 F;  2E5L F;  4WII A;  3PJX A;  1UPP A;  1ZPV A;  3OTO J;  2QL7 B;  1DAX A;  1CJU B;  2X1G A;  2QYG A;  2GAG C;  3NWG A;  4B3R J;  4WK1 A;  5LSR A;  4TU9 A;  2OSQ A;  2HZV A;  3RBD A;  2HNY A;  3SSR A;  4ZVG A;  3OFF A;  3NMA A;  3E51 A;  4P72 A;  4EZ9 A;  2E7X A;  3DLG A;  4G6V B;  4U7C A;  2X1A A;  1FK9 B;  1IWA A;  2MKY A;  5E3R A;  5J2M B;  4ILM A;  2MZJ A;  1F2H A;  3LP2 B;  4BC9 A;  1UFL A;  3Q8Y A;  2V67 A;  3N28 A;  1B0V A;  3W8G A;  1RHJ B;  1WOP A;  1NPP A;  1X5O A;  2DNK A;  3AD7 C;  2GVD A;  3C6T A;  3Q8V A;  2PSZ A;  2NUH A;  1NXI A;  4DPY A;  5KFB A;  1ACM B;  1CBK A;  1X4A A;  3JSR A;  4A8Y A;  1PYS B;  3V6D A;  3TUI C;  2HVD A;  2FDN A;  1XTZ A;  4DQQ A;  2AHO B;  4I6A A;  3ZZP A;  5DDO C;  1IR1 A;  2MLX A;  3E01 B;  3I4H X;  2G0I A;  1PBA A;  3AA8 A;  2FIU A;  3CJ0 A;  4C8Y A;  3CCV S;  3JB9 k;  2W2M P;  1RWP B;  2XWY A;  3BBF A;  3H98 A;  4JI2 J;  1VGY A;  4CO2 A;  3DXS X;  4LSN A;  1IBM F;  1EIY B;  5L1K A;  3LGN A;  4FNI A;  2R8H A;  4KAI A;  3I9V 9;  2W9C B;  5U47 A;  3G86 A;  1S5Z A;  3PYF A;  3PX6 A;  1RAC B;  4X4P A;  2F1F A;  1RT5 A;  2ZH4 A;  3CDU A;  1NLK L;  3M8P B;  4YME A;  4IRC A;  3NMR A;  3MED A;  3FBE A;  4CYU B;  2QC3 A;  2X1B A;  4WKY A;  3GIM A;  1X0F A;  2IBK A;  5DRK A;  4OQJ A;  3A4T A;  2W2Q P;  4KQZ A;  1K73 T;  2EFG A;  5HVG A;  1WDD A;  1MWZ A;  1U26 A;  3VAI A;  4DR3 J;  4ECS A;  2ASD A;  3F0N A;  1XMQ F;  1Q81 T;  3ENA A;  2BM1 A;  1UJ6 A;  2KU7 A;  3POT A;  1S4E A;  2KYZ A;  4OJH A;  1YJU A;  3BN7 A;  4O23 A;  4IG3 A;  5A0Y B;  5A76 A;  1RKJ A;  3FRZ A;  4ZPV R;  3NBP A;  1FEE A;  1OWX A;  1RT3 A;  4OZL A;  4B3O A;  4C7Q A;  3H59 A;  3UPF A;  1M5O C;  2H5J B;  5L8R C;  3HVA A;  3GSD A;  3EPI A;  3DDK A;  1MLA A;  5ETO A;  5LXY A;  2QSF A;  1YBU A;  3NGR A;  4ED7 A;  1UEU A;  2B6A A;  4PPD A;  2Q3P A;  4QOT A;  2BW2 A;  2H54 B;  2CQ3 A;  2Y9H A;  3W1Y C;  2OO4 A;  3T1A A;  1T9Y A;  3MWB A;  4WE1 A;  5KFP A;  1KKH A;  1CUL B;  3I5B A;  4B08 A;  1VBY A;  4DPT A;  3TVK A;  3MTJ A;  4JI4 F;  5F3T A;  2KT3 A;  4Q8F A;  2B8P A;  2HHT A;  4LF2 A;  2D9O A;  2W4C A;  3BV8 A;  2C3P A;  3GMG A;  4OZ2 A;  4DZ6 A;  1KD1 T;  5CZV A;  3EM1 A;  3EE3 A;  4CCH A;  3CVK A;  5T41 A;  4H4K A;  3NGD A;  1D8Y A;  1RLD A;  4NL5 A;  3OR1 A;  4X4V A;  1U7L A;  4PQA A;  4J9U E;  1DTT A;  1RT6 A;  1U0H B;  1HMV A;  2LA6 A;  2WW4 A;  2ZIT A;  4UQT A;  3ZZZ A;  5C5J A;  2AD9 A;  2Y0B B;  3FBF A;  4ILR A;  4MYT A;  1VQS A;  2CPH A;  4DV4 J;  1WD6 A;  5KFH A;  4ECW A;  4O3P A;  1PO6 A;  3J7A N;  2PT0 A;  3LP1 B;  4NLT A;  3H4B A;  1W2I A;  3B8H A;  3QT5 A;  3SFG A;  3HM9 A;  2UVU A;  4WK3 A;  4M94 A;  4DL5 A;  3K0J A;  2VFR A;  5GAG I;  3I6P A;  2KXN B;  3DRY A;  1TEL A;  3GYX B;  1UCN A;  5HBM A;  4CH0 S;  3G8S A;  3KHH A;  1FXD A;  4C3L A;  3MM7 B;  4K4X A;  3HJF A;  5CCL A;  4QQB A;  1RBO B;  2WSE C;  4TY8 B;  4M5L A;  3SCL E;  5D15 A;  4JV2 A;  3RZA A;  5KT2 A;  2CQH A;  3PZP A;  3QT7 A;  3PJ9 A;  3KUH A;  1FDN A;  2AJ1 A;  2W1B A;  1T95 A;  2DT9 A;  2QL9 B;  4NOH A;  3O2I A;  4FZV A;  5CA5 A;  2H5I B;  3HUL A;  3CD7 A;  5DJB A;  1G3O A;  1S49 A;  4RBV A;  3ENV A;  4TLQ A;  1B0P A;  1VQ8 S;  1REV A;  3DXB A;  5C24 A;  4IQX A;  4NLP A;  3DGP B;  2V4J B;  1SC4 B;  5HQL A;  4MIW A;  4DDF A;  4NLR A;  5C42 A;  3KLF B;  1WG4 A;  1RT7 A;  2AZ3 A;  1NPK A;  2WSC C;  3K2Y A;  4EYH B;  3UW1 A;  4HTJ A;  5A2Q Y;  4PUO A;  3C16 B;  4OX8 A;  1JXV A;  4JI5 F;  2OPQ B;  3PX4 A;  2XC9 A;  1QUP A;  1WWH A;  3BDP A;  4EK2 A;  3H2U B;  2RRN A;  4EFA C;  1YBT A;  4L6V 3;  3U1L A;  4DCO B;  4V19 X;  1RAJ A;  4ER8 A;  3A8J A;  3L9Z A;  4WZM A;  2NXC A;  1LW2 B;  3RTV A;  2JEJ A;  1WAC A;  5BYS A;  3GQC A;  3THT A;  1NSA A;  3W7B A;  2MQL A;  3MM8 A;  1N34 J;  1NZ8 A;  3FVY A;  4DX6 A;  4ZVH A;  2XYH B;  2IJF A;  3RRH A;  3ENW A;  3QSI A;  2OPR A;  3CIZ A;  4CZC A;  2FLL A;  2ZOM A;  3OJS A;  1WKJ A;  3CJR A;  3L95 X;  4UOG A;  2AKW B;  3OV7 A;  2E1C A;  2HVH A;  2O01 C;  3GFZ A;  2GGP B;  1Q8I A;  5EHH A;  3PTW A;  3TAM A;  1NH7 A;  2Q43 A;  3DYA A;  3MM9 A;  3NAH A;  3NLC A;  4LIW A;  3A12 A;  5DDP C;  2ZM6 F;  1Y3J A;  1S0V A;  2KHC A;  3KG1 A;  3WIU A;  1M5V C;  3EVW A;  2AP6 A;  3P96 A;  5EGY A;  1NK4 A;  2QLX A;  4JV1 A;  2EC0 A;  3BSO A;  4HDH A;  1R0B G;  3CSK A;  1DJ0 A;  4OYZ A;  5K8O A;  2CZ4 A;  1S1T B;  1TR0 A;  3SCJ E;  3B54 A;  5F0W A;  4YDX A;  3FQL A;  1ZH5 A;  3M9N B;  1Q8K A;  2KFZ A;  5LT5 A;  2FC9 A;  1HNW J;  4NCA A;  5A8W B;  3M2R B;  2JEG A;  5KFM A;  4BS2 A;  3H7H B;  5FII A;  2VG5 A;  2QZ8 A;  3UDC A;  3W9J A;  3RW7 A;  4IR9 A;  4A8X A;  4RUB A;  4YB1 P;  1FNO A;  4O4G A;  4F36 A;  3ULH A;  1TL3 B;  2Y0S D;  1T03 A;  4NLW A;  5E2Q A;  3FRY A;  3EXC X;  4WYW A;  5F8J A;  1KEK A;  4DR4 F;  2UUC J;  2CZ9 A;  2LEP A;  4WFA Q;  2UUB J;  2R2R A;  8ATC B;  1U09 A;  4A4J A;  5KFX A;  3ILO A;  9RUB A;  1EET A;  3HHD A;  3I96 A;  2Y1L B;  1BQX A;  4JUZ A;  4J9V A;  5J2P B;  2J8A A;  4ZCK A;  3KFW X;  2E5I A;  3BN4 A;  8AT1 B;  5KT4 A;  1X9S A;  4NLG A;  3PDN A;  2VBX A;  1ZS6 A;  3D6T B;  4KIA A;  2R8G A;  1P9Y A;  5D0G A;  3F41 A;  4RX6 A;  3S7R A;  1C0T A;  3Q83 A;  4USV A;  5EX3 A;  3I87 A;  4HLB A;  2ZZN A;  4CLT A;  4FS1 A;  2J76 E;  4N76 A;  3P8B B;  2B4O A;  2XBP A;  1Q53 A;  2GVZ B;  3MCM A;  4O4R A;  3GV8 B;  1S72 S;  2WVB A;  2XWX A;  5HMX A;  2GNK A;  2VB6 A;  2YWE A;  3EMT A;  3N6M A;  2OP5 A;  3KYL A;  2QA4 S;  2D3O R;  3LWM A;  1U1Q A;  1FVQ A;  3B78 A;  1RTD A;  3CTR A;  5L39 A;  2XCA A;  2M4M A;  1QSY A;  2PI4 A;  1X8D A;  1M5P C;  1W25 A;  2HSE B;  1R8P A;  4LF8 F;  2YKP A;  2OMO A;  3MOZ A;  4RW9 A;  3MEC A;  2J9C A;  4K2J A;  1FJ7 A;  3NNC A;  1Y7P A;  3RGI A;  3KK2 A;  2EK1 A;  2V5H G;  2GJI A;  3DOM B;  3GYG A;  4PWW A;  1VQO S;  4J5O A;  1EP4 B;  2DHH A;  4WU2 A;  5KFS A;  1SV5 A;  3KDO A;  4PCQ A;  3OFE A;  2UV8 A;  3ZTR A;  4LFA F;  2HAF A;  1N5S A;  3CED A;  3Q2S C;  3R7B B;  4EUV A;  2RD5 C;  3BGO P;  1LKZ A;  2RIL A;  2MGZ B;  4DV3 J;  4FVM A;  3OXF A;  1HWL A;  3C6U A;  5K14 A;  4A48 A;  3V6K A;  3LPY A;  1IBL J;  3MR2 A;  1PSD A;  1RTI B;  3C14 B;  4K5S A;  2OPS B;  3QGP A;  3KHG A;  3GFY A;  1S9E B;  1RHM B;  3NGS A;  1NBE B;  2AJ2 A;  3BBC A;  2HNZ B;  3OPK A;  3PYG A;  4KRW A;  3ZZU A;  3RBX A;  1S77 D;  3WC0 A;  1TMJ A;  1U2R A;  3AT1 B;  1Z1Z A;  1PKU A;  1RAE B;  1O0P A;  2J5A A;  3QWU A;  4HAC A;  1HPZ B;  3OTO F;  3W3S A;  3OXL A;  1SKU B;  3D1Q A;  1U1M A;  4OYB A;  1FFG B;  2F40 A;  1KN6 A;  3OUY B;  2M0G B;  2PDA A;  2IRY A;  3HSD A;  1RT1 B;  2MYF A;  2YNH B;  3V2U C;  1VS3 A;  2GGP A;  3HI9 A;  1BQM B;  1Y3K A;  3BYR A;  1FX2 A;  1NHV A;  3C16 A;  3KK3 A;  2R7R A;  1HNI A;  1KVK A;  1RZM A;  2ILY A;  4G1P A;  4OJ3 A;  4U96 A;  1Z4U A;  4CLP A;  5F8M A;  1FTR A;  1VRU A;  4QIF A;  2MXY A;  4CH1 A;  3T5L A;  5IC4 B;  5L38 A;  5DQH A;  3G9C A;  1F0X A;  2MSS A;  5IS2 A;  2AGO A;  3M6W A;  4LT6 A;  4BWJ A;  1ZPW X;  3W64 A;  3I55 S;  2XG8 A;  4FBT A;  2VJV A;  3DRS A;  3KLH B;  2HGM A;  2LQ5 A;  2PN6 A;  5CHC B;  4DI6 A;  1U0S A;  2XCP A;  1UTA A;  5CYQ A;  2AJ4 A;  2UP1 A;  3U27 A;  2ZC3 A;  3PXG a;  4UQG A;  3FCH A;  1HBN B;  2MGZ A;  3FSX A;  2DNL A;  1NK9 A;  1Y0H A;  2XMK A;  2C3O A;  4O4G B;  3W5X A;  2XSJ A;  4LJM A;  4ANE A;  2RS8 A;  4OL8 A;  1Y00 A;  2HMI A;  4ZMM A;  1IR0 A;  4K2X A;  1UVK A;  1SI9 A;  4TQR A;  1OYD A;  4UOF A;  1M5K C;  5F8L A;  4U67 Q;  1PC5 A;  1F3V A;  1CJK B;  1P1T A;  2MJN A;  4NLD A;  5D4L A;  2P9E A;  1JXE A;  5ETM A;  5KG2 A;  4DSK A;  2UXD F;  1KC8 T;  2QA1 A;  4MFB A;  4GKJ J;  1S1T A;  4C98 A;  3W66 A;  1ZM2 A;  2BE9 B;  4LF4 F;  2MQO A;  5KG0 A;  1HQU A;  3BYP A;  4IDK B;  4F50 A;  4HT7 A;  3O44 A;  4M5H A;  2VG7 A;  1HWI A;  3GCX P;  3ZZR A;  4DR3 F;  3MPD A;  1S1X B;  3C15 A;  2MQ8 A;  4RNO A;  4ECX A;  2VIH A;  2BQ3 A;  1N32 J;  2VFT A;  2UUT A;  1GK8 A;  5HL7 Q;  1JNR B;  1X4C A;  2CWK A;  3AHP A;  3DM2 A;  3JSB A;  5KFL A;  2LXF A;  4BBY A;  3BSA A;  1RTH B;  1VBZ A;  3K57 A;  5M2U A;  5A8R A;  4IRD A;  3NL0 A;  3BR9 A;  3ISN D;  1QTM A;  1N8R T;  4KY3 A;  1TUG B;  2GML A;  3EJM A;  5J1N A;  2W7O A;  5I3Q A;  1YK9 A;  1J5E F;  1FKP A;  2FVQ A;  1VCT A;  3NEK A;  1SJ3 P;  4UT4 A;  1J5E J;  1IBC B;  2DH7 A;  2G13 A;  4KFB A;  4RW7 B;  5KFN A;  4XPE A;  4DV7 J;  4JI3 F;  1C1B B;  3KKF A;  4KBI A;  2BKP A;  2EVZ A;  4DR2 F;  3THV A;  1UVN A;  1TV6 B;  2H1Y A;  4GKJ F;  4B17 A;  1M1G A;  1TL7 A;  1N0U A;  3BH7 B;  3AJD A;  1IJF B;  3BQ1 A;  5IM0 A;  2AYE A;  2A6O A;  2XMJ A;  5LJ5 Y;  4F02 A;  2HHS A;  2CUY A;  1CEZ A;  3OL6 A;  4OHZ A;  2ZVS A;  4Q8E A;  1ZA2 B;  2MY8 A;  1T9V A;  2ZNY A;  1SJR A;  4J9M A;  1WHY A;  2ZBR A;  4Y2A A;  3J81 Y;  2HFV A;  1S48 A;  3Q23 A;  4H4M A;  1KDN A;  4F7V A;  2VDH A;  3R1H A;  2YKN B;  1NKB A;  2W01 A;  1RTI A;  3C14 A;  3FEX B;  1DLO B;  2UV8 G;  1X5T A;  1YJN S;  1SVD A;  2CJY B;  3IBW A;  4EMD A;  1N6Q A;  2CNO B;  2W9B A;  5LL6 d;  2VUG A;  2V94 A;  4WIQ A;  3RR7 A;  2IC3 A;  2VG7 B;  1X4B A;  1FRX A;  4KH0 B;  2JFD A;  2YY3 A;  4M5N A;  4I7F A;  3TAN A;  3RAQ A;  2VFS A;  4JI3 J;  5A2Q U;  2YQ3 A;  4B9T A;  3BGF A;  4OV1 A;  4YEA A;  1OY8 A;  4JB8 B;  4OHX A;  5KG4 A;  1HKA A;  1YDL A;  4RJV A;  2PMZ D;  1X4G A;  1HI0 P;  2W9C A;  1WC3 A;  2UZA A;  1JLE A;  4ATN A;  4E0D A;  4OYI A;  2KVI A;  3CC4 S;  3PHE A;  2ROG A;  4ZIT A;  2WSF C;  3GR0 A;  3Q89 A;  4CLU A;  1QSL A;  1R8H A;  2AF6 A;  2DCU B;  2I1R A;  2P6T A;  4TLR A;  4DJB A;  3V4I A;  2OHD A;  4YDD B;  4H4O A;  4F4X A;  4LF7 F;  4WP8 A;  3C6U B;  4DSE A;  2QIF A;  5HP1 B;  4I67 A;  1JLC B;  3D1H A;  2ZHO A;  2HS0 A;  1B70 B;  1NHK L;  2LP4 A;  3NY0 A;  4FYY B;  1HMV B;  3QJL A;  1AB8 A;  3HT3 A;  2AQ4 A;  3FJ2 A;  3ADA C;  5J1E B;  3CXC R;  1N5Y B;  2QGF B;  2RDJ A;  3CCU S;  1QVF R;  2DPJ A;  1T7P A;  4RBU A;  3OR2 A;  3GE9 A;  3HMJ G;  3MUV P;  1S76 D;  2Z2L A;  4F0K A;  3R5A A;  1YJ7 A;  5D6G A;  3C8Y A;  2MPU A;  3UVJ B;  3HFZ B;  3BGU A;  5EDW A;  1FF2 A;  3LA0 A;  3BO3 A;  1NEE A;  3NNH A;  2FUG 9;  1YGY A;  1OO0 B;  3P49 B;  1B4S A;  3T9Z A;  1MU2 A;  3PW5 A;  3SSQ A;  2IMO A;  3AOA A;  3N9U C;  4MKY A;  1XMO F;  4IH5 A;  1F9F A;  2OKQ A;  5JJB A;  1HWJ A;  5C25 B;  4LFB F;  4I2P A;  2G1D A;  3VVT A;  3G4S S;  2B56 A;  3PEJ A;  2QFI A;  2Z58 B;  4WFY A;  3VAL A;  3NP5 A;  4HKQ A;  5HAN A;  4N47 A;  1XNQ J;  3MUT P;  2B9Y A;  4HL9 A;  1N56 A;  3MD3 A;  2ABY A;  5ETL A;  2VBW A;  3DFE A;  2DR6 A;  4NZ6 A;  5IV4 A;  4QPT A;  4NCB A;  2XO6 A;  4URS A;  3UDL A;  1TL5 A;  5HO4 A;  3CJ8 A;  3RUB L;  3HVW A;  4B3T J;  2KZM A;  3V4I B;  3BPS P;  3K17 A;  2VON A;  2V2V A;  4GMK A;  3VAM A;  1J27 A;  4L73 A;  1T05 B;  3NCR A;  2Q66 A;  5J1P A;  4QU7 A;  1OSC A;  2ZHB A;  2E5H A;  1E6Y A;  3OHB A;  4B3S F;  4A8F A;  1FD2 A;  4Y2C A;  3PYD A;  3SEO A;  2D41 A;  2QLW A;  4LF6 F;  1JLB B;  4DV1 J;  1NDK A;  1XER A;  3M8P A;  2VOD A;  4CYU A;  5A6P A;  5K8P A;  2CQ1 A;  4RL1 A;  3TRG A;  2DIU A;  3DHW C;  3H25 A;  2Z0G A;  4PXB A;  2XI2 A;  4QW9 A;  1O8B A;  1GQE A;  2XS5 A;  2MTL A;  3LAK A;  1TK0 A;  2OPQ A;  3VHQ A;  2L9W A;  1XIQ A;  2XHC A;  2VV5 A;  1F6T A;  4OI1 A;  4DFJ A;  4BHQ A;  2M8H A;  1UA0 A;  1NK0 A;  1MML A;  1MU2 B;  2V2Z A;  4KSE B;  2B4P A;  3KUG A;  1EB0 A;  3AXK A;  3DM2 B;  3M8Q B;  1TK8 A;  2KT5 A;  2QO3 A;  1Q8L A;  1VRT A;  4YS2 A;  4U95 A;  5KFE A;  2E1A A;  3GJR B;  3J81 j;  3J7Z 5;  4C4W A;  4PYD A;  1SQF A;  3BO2 A;  1QJH A;  1WTB A;  4IRK A;  2XNR A;  5IT9 Y;  2QX0 A;  2RSQ A;  2CJX B;  4LMZ A;  2HK2 A;  5KOW A;  3HKZ D;  1CPZ A;  2CA9 A;  5J1E A;  2Y8Y A;  3VGV A;  3PO5 A;  2FVC A;  5IWA J;  3T1Y F;  5EX0 A;  3EZO A;  3VGU A;  5KFU A;  1B3T A;  3UI3 A;  4UUW A;  1KTQ A;  1HNZ J;  2M8D B;  2F8H A;  4JV5 J;  2R9L A;  4WKR A;  3QLH A;  2VG5 B;  2BYC A;  4ERD A;  3FZB A;  4V1A k;  5K5M A;  2UXB J;  4NLY A;  3D3B J;  2WVF A;  2Q6C A;  3R97 A;  1JLE B;  3D0H E;  4TN2 A;  1U24 A;  2MEW A;  5T14 A;  4X4U A;  2ZH5 A;  2FY1 A;  1MN7 A;  2EFO A;  2ZWO A;  3IR7 B;  4C48 A;  1NKC A;  1C1C B;  4X84 A;  3H4D A;  1OMS A;  5FLX U;  2D3Z A;  2WVC A;  3HJV A;  3CF5 Q;  4UY8 5;  1UKU A;  2F8E X;  2WON A;  5JUM A;  1AW0 A;  3SDE A;  1UL3 A;  3ZTS A;  1KVJ A;  4LRE A;  4OI6 A;  4UZC A;  2W9B B;  4JI7 J;  2DGW A;  5G0R A;  3R2C J;  1YTY A;  2H4W B;  3ZO7 A;  2J7U A;  1IBK F;  2ZUA A;  4YB7 A;  3PRV A;  3M8S A;  4LRC A;  1YG0 A;  1MRO A;  4QPX A;  4U8Y A;  4QCL A;  2FHK A;  2LLZ A;  1ICE B;  3DGV A;  5GVQ A;  2BX6 A;  3U02 A;  4CLK A;  2XLJ A;  2VQF J;  1X4H A;  2CPE A;  4ZVF A;  1CJT B;  4P74 A;  5SUH A;  1NRK A;  4KGK A;  4OX6 A;  2OFH X;  2MQQ A;  3MAQ A;  4KT0 C;  4ETX A;  5LMN F;  3T1H F;  4USI A;  4KV8 A;  5JXS A;  5ETT A;  1RQ0 A;  1WI8 A;  4L76 A;  2AZ1 A;  4M5I A;  4ZPD A;  4CLZ A;  4ED3 A;  1X4E A;  3ITH A;  5DQI A;  3ONQ A;  4EYI B;  4X65 J;  3VAJ A;  1N34 F;  1CVJ A;  1X4D A;  4LF5 F;  1NJX A;  1S97 A;  4ZVT B;  4LF7 J;  1Q78 A;  1YJW S;  1NUE A;  2DD8 S;  4ZJO A;  5KFD A;  3AJ1 A;  5H9F J;  3OR2 B;  3A8I A;  1U4B A;  1LWC B;  3M1V B;  2NXU A;  2LVW A;  3KG0 A;  2XY5 A;  4DEZ A;  1N36 F;  3WC2 A;  1PBU A;  1MNE A;  2ZZT A;  2DJW A;  1PJ7 A;  1TVR B;  2KT2 A;  1C1C A;  2PO4 A;  3D4J A;  2LCW A;  1EKS A;  3N6N A;  4QJV A;  3TJ8 A;  4K0K J;  1NK7 A;  5K8N A;  3DOM A;  2C2K B;  4IUF A;  5GAH I;  3OD2 A;  2J6S A;  4LF6 J;  2B7B B;  3IWL A;  2FJB B;  4YR0 A;  3THP A;  5M2R A;  1FJE B;  3KLE A;  4RW6 A;  4ELU A;  4DG1 A;  1R0A A;  4WJB A;  2EPI A;  4QYZ K;  2W8L A;  5KTQ A;  3H42 A;  2W25 A;  1IR2 A;  2YPZ A;  2HS4 A;  2HZA A;  3CJS A;  1I51 B;  3T9N A;  2DHS A;  3TZX A;  5E5N A;  3CCE S;  4Q0B A;  2LDI A;  4QWE A;  3GSI A;  1KWM A;  2FGC A;  3EWG A;  5HK4 A;  1R0C B;  3I32 A;  3PX0 A;  3IBF B;  4NI2 B;  3M7V A;  1WNE A;  3HK2 A;  1YBA A;  1RWX B;  3VGT A;  2MLZ A;  4CM0 A;  2L9D A;  2VOO A;  1RAA B;  2PFD A;  3ZC4 A;  4FKX A;  3QIP A;  3PR4 A;  1U2C A;  4A8Q A;  1RHR B;  4N5S A;  2RUS A;  4OZ5 A;  5DG7 A;  4U8V A;  4K0K F;  2EBG A;  4NYZ A;  3TA0 A;  4N77 A;  3CDA A;  3H0P A;  1FER A;  4ID5 B;  2EWH A;  2N3O A;  3QGH A;  1RAB B;  3FK4 A;  4ZP9 A;  2Q6B A;  3E01 A;  3M2U A;  5HVF A;  5KFF A;  3QZ7 A;  4ZDN A;  4NZ0 A;  4FBU A;  3HHK A;  3QT6 A;  3ENQ A;  5K14 B;  1NK6 A;  3CJT A;  1TKD A;  1SKW A;  3IGN A;  2GZO A;  2F4V J;  5E0O A;  3CIM A;  3V4M A;  5KAK A;  3CPW R;  1QLN A;  1U0H A;  1TK5 A;  2IPO B;  3BEG B;  3UO0 A;  2KG1 A;  2GV1 A;  2UVR A;  1TKT B;  3R5C A;  4QZV B;  2HHP A;  4CLL A;  2N4D A;  2DNG A;  1OIA A;  2C3Y A;  2R7Q A;  3RBZ A;  4LBP A;  3VCD A;  3MZI A;  2DTJ A;  2IHR 1;  4MFB B;  4ZPA A;  4ES2 A;  4WTY A;  5HLF B;  1DQ8 A;  1U45 A;  3HPO A;  2EG1 A;  2D3U A;  4HH1 A;  4MK8 A;  3TZZ A;  3PW7 A;  5G0R B;  1YI2 S;  5I4M A;  4DX5 A;  1K0V A;  4OHV A;  2VFV A;  5IQQ A;  1X5S A;  2IIH A;  2ROP A;  1O51 A;  5EUH A;  2ZH7 A;  2KH9 A;  1B64 A;  5KT7 A;  4PZV A;  3DMJ B;  1YHQ S;  4UTG A;  1N36 J;  3PO4 A;  4U6P A;  1FWP A;  1RB0 A;  3TJA A;  4WP9 A;  2A6M A;  1QVG R;  1YIJ S;  2ERR A;  1WHV A;  2DGO A;  2MKC A;  4G65 A;  1IBL F;  1HA1 A;  2A3J A;  2RQ4 A;  3DOK A;  2CQD A;  3DRS B;  3MMA A;  1SXL A;  1V3R A;  1ZBT A;  5C24 B;  3VZH A;  3PR5 B;  2QFJ A;  4ID5 A;  4HR2 A;  3IO1 A;  2BAN A;  2CAJ A;  1TU0 B;  4A8M P;  2B8Q A;  5KFT A;  1RWM B;  3EZU A;  3M8Z A;  3AH6 A;  5LOQ A;  5HQ8 A;  5IC6 B;  4YB5 A;  1NDL A;  2CPY A;  2DHG A;  2DXE A;  3LO3 A;  1PIE A;  1SV5 B;  1HQE A;  1T94 A;  4ZP8 A;  3AOC A;  3GCW P;  2DEI A;  2WB4 A;  4ICL B;  4M5K A;  3TQ1 A;  1SL2 A;  4ZOS A;  3JS9 A;  5E3P A;  4MKA A;  4NCG A;  4RW7 A;  1RT3 B;  1GXL A;  4ES1 A;  1VR6 A;  4OHW A;  1S9E A;  1N52 B;  4RBT A;  2JLG A;  2OPP B;  4JI1 F;  2ALY B;  3EUN A;  1RBL A;  2K06 A;  1OY9 A;  2KHD A;  1VRQ C;  3NCP A;  3BSN A;  1RLC L;  4AFF A;  4IO1 A;  3BQ0 A;  1WC4 A;  2B6A B;  5BR8 F;  3W61 A;  4LIR A;  1TUW A;  1PYO B;  3GIJ A;  2I5J B;  1X9W A;  2KZZ A;  1WI6 A;  2XYP B;  1GTE A;  4LSL A;  2OH2 A;  3E8O A;  4DBQ A;  2DVI A;  4K4Y A;  3UR0 A;  2F9J A;  2V4R A;  4IO9 Q;  4DU7 A;  3VTI A;  5BYQ A;  2HRU A;  2ZUG A;  3MM7 A;  4O3R A;  1RWU A;  3J7A 1;  2CPZ A;  2DIS A;  2CZV C;  3ETM A;  1EAR A;  5I3P A;  3UFC X;  4RW8 B;  3KHR A;  1KP6 A;  3D28 A;  4USJ C;  4J9O A;  1H7W A;  2KM8 C;  1IKW A;  4H4O B;  4RWX A;  3L3C A;  1Y5I B;  2ZOG A;  4LUB A;  3GTY X;  1UET A;  4AQY F;  3RW6 A;  2AEF A;  3V5R A;  3OHA A;  2V69 A;  2DO0 A;  4IFY B;  3GIK A;  3CCM S;  2J0Q D;  2Z2Y B;  2CDR B;  4ANC A;  1UAW A;  4NZ7 A;  1H38 A;  2HPU A;  1IWG A;  2MZS A;  3MMC A;  4QR1 A;  3EGV A;  1X7V A;  2CQB A;  3H20 A;  3OTE A;  1NJZ A;  3L4B C;  3LUY A;  3TJ9 A;  4CT8 A;  3M2U B;  4QYZ J;  5DM6 Q;  2F4F A;  3CCZ A;  3OBI A;  4RW4 A;  4WYL A;  4ED6 A;  2HIQ A;  4DSI A;  4ZPW R;  1KHV A;  4JV0 A;  4NRT A;  3KLG A;  2XO7 A;  1NSQ A;  3CME S;  4LF9 F;  2YNI A;  4G3I A;  3H5X A;  3DI6 B;  2BW7 A;  1HW9 A;  5J2P A;  4W90 B;  1RA6 A;  2LQ9 A;  2R2T A;  5CYM B;  3HSG A;  2RKI A;  2FPH X;  2EBE A;  4LSL B;  3P5B P;  4TVA B;  4DUY F;  1Q0N A;  4KPY A;  2IJR A;  4GVB B;  4LRD A;  1FO1 A;  2DH8 A;  2BRK A;  4L3K A;  2GVZ A;  1NJY A;  1JLF B;  1HFE L;  1UW9 A;  3PHT A;  5F8H A;  4KHR A;  1YRU A;  3RYL A;  1NJI T;  3P45 B;  1VQ4 S;  4FXW A;  5B0E A;  1N5Q A;  1RWV B;  2BQR A;  1F2G A;  1WF1 A;  4WFX A;  1R31 A;  3OJU A;  1C0U A;  3Q8P B;  2V34 A;  1JNZ B;  3EZ5 A;  2O1P A;  4ETZ A;  5C7P A;  4NLX A;  1S6U A;  4OX7 A;  4DV5 F;  3OVB A;  1H2V Z;  2B5J A;  3GIL A;  2X3D A;  2NXE A;  3ET6 A;  5IXU A;  1ZYQ A;  5BYR A;  1LW0 B;  4L72 B;  1AA1 B;  1JLG A;  1AXQ A;  3P3D A;  1HR0 J;  1DFD A;  3HSZ A;  5E33 A;  2E1R A;  2IAJ B;  4OYX A;  2MZR A;  3PW2 A;  2FLN A;  2E7W A;  1HR0 F;  1SH0 A;  1ZTT A;  1BWV A;  3CT9 A;  2L3M A;  4K59 A;  1U25 A;  2BE2 B;  3M6U A;  2CQ4 A;  3HF5 A;  4GRS A;  4ZVU B;  4CH7 A;  5GAE I;  3T3F A;  1SCJ B;  2A2D A;  3EGZ A;  3UCZ P;  4Y0F A;  1B0T A;  2EFV A;  3SCK E;  1W2B R;  4O3O A;  1S1U B;  1UFK A;  5KT5 A;  2QRR A;  4RR5 A;  4CTA B;  4FPI A;  3MM9 B;  1LFP A;  3DLH A;  2K3I A;  4KJI A;  5KFZ A;  1U48 A;  4C0O C;  4A8K A;  3SV4 A;  4DFP A;  2C2M B;  4MK7 A;  1Q7L B;  3SV3 A;  4YR2 A;  2Y1I A;  3HZG A;  4I6W A;  3G96 A;  3AAW B;  2HHV A;  1KLM B;  1D09 B;  1V3Z A;  2DNY A;  3BF4 A;  4ZVO B;  4CLY A;  3QBC A;  2WRM A;  4ELV A;  1G1X A;  5D4P A;  4PWU A;  4ZS6 A;  1FES A;  3KDN A;  4B9S A;  1RWO B;  2X7I A;  2CQ0 A;  3GR1 A;  4MJK A;  1IM4 A;  4ZPB A;  1NM2 A;  2CJQ A;  3R8Y A;  5DET A;  3CDW A;  5CAB A;  3IM9 A;  4P7T A;  2QYC A;  2I0X A;  1J5O B;  2E66 A;  2I5J A;  3FZ2 A;  2A1B A;  3D0I E;  3F44 A;  2FD2 A;  2Z30 B;  3K8V A;  4EZ6 A;  2G1H A;  1FFW B;  2J9E A;  1FA0 A;  2JLE A;  4ECV A;  1VRU B;  4NYP A;  3TAP A;  2KFY A;  2WOM B;  2ASL A;  4DL2 A;  5L1J A;  4ZP7 A;  2PMH A;  3SXL A;  1XEZ A;  2HNZ A;  4LBI A;  1UEV A;  4CNZ A;  1RBA A;  3ICL A;  2HG4 A;  3VAH A;  4J9Q A;  4DV2 J;  1RT2 A;  2WZ1 A;  5J2Q B;  3UCG A;  2GW8 A;  5LSO A;  3FEY B;  3KJN B;  4ED5 A;  5HAT A;  3MEG B;  4KB7 A;  1Q79 A;  4CQ1 A;  4B9V A;  3QNW B;  4AE5 A;  2WON B;  3M9M B;  3MI7 X;  4ALZ A;  1BE4 A;  1N5Y A;  5DS7 A;  5H9E K;  4JI0 J;  3BGR B;  3R6L B;  5F8I A;  2CNL B;  3ZTQ A;  2ZE2 B;  1JLA A;  3DRR B;  2HVE A;  1NDP A;  3DDN A;  2BQU A;  2GO9 A;  4OZ1 A;  4BWM A;  2DB1 A;  1RSC A;  4KPC A;  4Y65 A;  1QY7 A;  2C2R A;  3QAU A;  2H9Z A;  2HGN A;  2CJK A;  3MMB B;  2HFO A;  2EFN A;  4FXV A;  1JWW A;  3O1L A;  4IQM A;  4PG7 A;  1HWK A;  1RAH B;  2OPS A;  1U6Z A;  3ETO A;  3KJQ B;  2JDJ A;  1QAI A;  2BDP A;  2G0J A;  2RHQ B;  1P8G A;  2ZC4 A;  2FHJ A;  2NPF A;  5DM7 Q;  3T5J A;  4Y28 C;  4DR6 F;  2EW9 A;  1U1P A;  1UVJ A;  3NRB A;  1G7C B;  2LEC A;  2XY7 A;  2U2F A;  3KK2 B;  2LA4 A;  2V8D A;  3PKY A;  4OHY A;  3QLH B;  2RKI B;  2OLW A;  5MLC V;  4KYZ A;  3RR8 A;  4CO0 A;  3VF0 B;  1R27 B;  2B9E A;  4DMZ A;  2N7C A;  1NK8 A;  1XN9 A;  2HRT A;  2VA3 A;  2D69 A;  4O0I A;  5IFM A;  2RDD A;  2ADB A;  2AU0 A;  2MKK A;  1HYS B;  2KTQ A;  2MZQ A;  3W2V A;  4C8Z A;  1QAJ A;  2G9O A;  2K7J A;  4RWW A;  3AXM A;  1WEX A;  3GV5 B;  1H72 C;  2AJQ A;  1X9M A;  3SDE B;  3H2L A;  3MEG A;  2WVD A;  5F9L A;  2VOP A;  3LQV A;  1BXN A;  3W63 A;  2AMC B;  1LQ9 A;  4YFU A;  2CQI A;  4N41 A;  1OQ3 A;  4ZK7 M;  2JJ4 D;  4OI4 A;  3M9O B;  3QYY A;  1BMQ B;  4PAA A;  5IT9 U;  2OIH A;  1HQ2 A;  2IAJ A;  5T7L B;  4LQ3 A;  2RDI A;  3FFI B;  2UU9 F;  2BXJ A;  4ED1 A;  2PC6 A;  2H51 B;  1I94 J;  5AE3 A;  1RTH A;  4OLO A;  3TYT A;  3NGU A;  3W5Z A;  4J9R A;  5HRO A;  5AXK A;  2BBE A;  1RAD B;  2VC1 A;  3OLB A;  4BC7 A;  1BQM A;  1EHW A;  1M5S A;  2XZD B;  3KK3 B;  4DV1 F;  2AGP A;  3WDO A;  1S1W A;  1SH3 A;  1KFD A;  3M6X A;  5D4O A;  3SSS A;  4C3M A;  2VPW B;  4X4S A;  4WFN Q;  2XM3 A;  3EPG A;  1WC0 A;  1ULR A;  2CQC A;  2IC3 B;  4Y2M A;  2DXF A;  2OML A;  3IWX A;  5DG9 A;  1QM9 A;  2BMB A;  4AYB D;  4F4Y A;  1JLG B;  2FYX A;  1BQN B;  2IVY A;  3IAS 9;  2YKO A;  3ZZ0 A;  2HQF A;  2V4J A;  2K1R A;  1LWC A;  4C0H A;  1FRM A;  2YKQ A;  1I1G A;  2YX4 A;  1TKZ B;  5IT4 A;  1B99 A;  3JYT B;  3CC2 S;  4XIU A;  3IR5 B;  5AE2 A;  2OTL S;  2VQE J;  1MMN A;  2AJF E;  3CMQ A;  2XY6 A;  3GFX A;  2V9K A;  5KOX A;  2QJ3 A;  1U1O A;  2V9W A;  2XSJ B;  3D54 A;  4Z37 A;  2DR9 A;  2J7K A;  4GC7 A;  1IUJ A;  1BC6 A;  1QUV A;  4HI2 A;  4OI0 A;  2E29 A;  5KFC A;  2O3D A;  2XMT A;  1LEO A;  1C1B A;  1U02 A;  1CS4 B;  2EEY A;  3HVT B;  4F2S A;  3K5L A;  4DR7 F;  2DRA A;  1Q82 T;  2ZH9 A;  1FX4 A;  1S9G B;  1JQG A;  5I42 B;  2KDO A;  2COL A;  3EIC A;  2H3E B;  2JOQ A;  4I4B A;  1LFW A;  3Q8R B;  1E6V B;  4CI0 B;  1LK7 A;  3J7Z T;  3DRP A;  3VWS A;  5KT6 A;  4NE9 C;  2CWX A;  1KQK A;  3TA1 A;  2HUR A;  2VIC A;  3N6L A;  2FHJ D;  3QFW A;  3KK1 A;  2YX1 A;  4ZVP B;  2NRE A;  2W7A A;  5FDL B;  4CP5 A;  1SIW B;  2RUG A;  4CDI A;  4ID8 A;  1FRI A;  1RT2 B;  4RNM A;  2Q1L A;  1OPI A;  1Q4R A;  1RT4 A;  1YX2 A;  2N3L A;  3SQO P;  5DGB A;  2Z57 B;  1QTN B;  2JWN A;  4AXJ A;  1HHS A;  2VQF F;  4ZJL A;  2P5V A;  1QSS A;  2G0C A;  3QID A;  4Q2L A;  4RPF A;  3GZ7 A;  1JLA B;  3DRR A;  5C2C A;  5MAO A;  1VQP S;  4IR1 A;  4DR6 J;  1IKY A;  3PM9 A;  4UST A;  1RWK B;  4MTP A;  4ES3 A;  2V8G A;  1XR5 A;  3PV8 A;  3A8K A;  1LV5 A;  4W4M A;  3NKY A;  3KLI A;  4L3N A;  3W2V B;  4FF4 A;  4X66 F;  3CJ5 A;  3MMB A;  2MLY A;  1BY9 A;  4QIV A;  1Q86 T;  5JVH Q;  3M8W A;  3O8W A;  4DPU A;  4J9P A;  4EEY A;  4C2M A;  2FZC B;  1AUD A;  4CO3 A;  4J9L A;  3G6Y A;  3GG0 A;  2OUG A;  3QRR A;  4DV7 F;  3DLL Q;  3V81 A;  4DV0 F;  2OEJ A;  3Q8S B;  4RNF A;  3H5Y A;  2UUC F;  4RLE A;  3UVJ A;  1HBU A;  4FS2 A;  4NML A;  2QT7 A;  4OJG A;  4O3N A;  3TX8 A;  4DL6 A;  2HBZ B;  3VAF A;  2DNP A;  1MMD A;  4MIA A;  3TVZ A;  1AZS B;  3O5T B;  1T9W A;  1GX5 A;  4NI2 A;  2Z2M A;  4X62 J;  1WC5 A;  2YWH A;  1ZOT A;  1S1W B;  2KVQ E;  1GEH A;  2KXH A;  5F0U A;  3HD1 A;  4HVZ A;  5ETR A;  2CPD A;  3FBB A;  3M2R A;  3QAT A;  3TNV A;  5HP1 A;  2VFU A;  1FE4 A;  1L3S A;  1RT4 B;  3L7U A;  1RYR A;  2UXB F;  3BZQ A;  3IC1 A;  1WHX A;  1R3N A;  1TP7 A;  3GPA A;  4ZJQ A;  1SJQ A;  4YR3 A;  4DL3 A;  1PAE X;  2HNY B;  3DGP A;  1K47 A;  4TQS A;  1BWE A;  2HQG A;  4PG5 A;  4KHP F;  1F5B A;  2CVE A;  2MKH A;  2F7V A;  3FFI A;  4P2F A;  4GC6 A;  3V6J A;  4DF4 A;  2CNN B;  2FVS A;  1PYT A;  3D0G E;  3MXH P;  2J6U A;  2JEF A;  3OFH A;  1WOS A;  2VAS A;  4Q7A A;  1T05 A;  2UXC F;  1W7W A;  4QU6 A;  1GT8 A;  3MED B;  4RKU C;  1S10 A;  1FXR A;  2OPP A;  3MM5 A;  2MST A;  4J9N A;  1SBR A;  1YZ6 A;  3DLJ A;  1XNQ F;  2KB2 A;  3WHI A;  1RU2 A;  5DZ6 A;  4DF8 A;  3HP6 A;  5D0E A;  4MIB A;  3CO0 P;  4PKD B;  5IWA F;  3D67 A;  1F3F A;  4XO0 A;  3SCI E;  4RO0 A;  5FLX Y;  2R2S A;  1FJG F;  3C46 A;  4A46 A;  2QL5 B;  3KJF B;  1CJU A;  1KBR A;  4RUH A;  3HVT A;  3MR7 A;  4R0J A;  4ECQ A;  3CJQ A;  1D8Z A;  3BR8 A;  4GVB A;  3I82 A;  1EZZ B;  3DYA B;  3E3X A;  2Y1J A;  2R7T A;  2D3O 1;  3UD5 A;  2FJV A;  2J9D E;  4CIO A;  4EBD A;  1HBM B;  1HNZ F;  2M70 A;  2L41 A;  4JYA F;  1E6V A;  4R8U A;  3DI6 A;  4LFB J;  4CM2 A;  2LU2 A;  2Y8W A;  5EWE A;  1R8A A;  1D9F A;  4IFY A;  2AEM A;  4C11 A;  1D9D A;  3HVR A;  1GMU A;  1OQ6 A;  1Y11 A;  4CO1 A;  3UNY A;  5D3G A;  3N79 A;  1KHW A;  3IN5 A;  1I3O B;  5HJX A;  4PG6 A;  1TL1 B;  2YKM B;  4Z2X A;  2R3V A;  2FJW A;  2XMA A;  1XR6 A;  4YOE A;  2ZBC A;  1FKO B;  3MAA B;  4GO5 X;  4E8U A;  5J2N A;  2I2Y A;  1S79 A;  3OSP A;  3D1O A;  4NXN J;  1AFJ A;  1H6K X;  4DQS A;  3VAK A;  3RB4 A;  2XB2 D;  2JFK A;  3HHL D;  3OT9 A;  4CLS A;  1F9E B;  3SFU A;  2GS8 A;  2HZC A;  3FKB A;  1FK9 A;  3HZE A;  3LTO A;  4DXL A;  4Z7C A;  4C8O A;  1WKL A;  3SYZ A;  3UQS A;  2OD4 A;  1JK9 B;  3TR5 A;  4Q45 A;  1UWA A;  1M5H A;  2LQ8 A;  2WB1 D;  4HAC B;  3TAR A;  1UW4 A;  4DV6 J;  1O6X A;  4WP3 A;  4DPX A;  1FXL A;  5LM7 E;  4WZQ A;  2GHV C;  1VQK S;  3GV7 B;  2VA2 A;  3HXM A;  3CB4 A;  4LR7 A;  3AOD A;  1FNM A;  1PGZ A;  4F0M A;  4W92 B;  1SQE A;  3MHY A;  2H65 B;  2FZG B;  3RAM A;  5HSP A;  2OJ3 A;  4JI6 J;  2AWZ A;  2L08 A;  5KG5 A;  2ILZ A;  4FNH A;  1FEH A;  3MCO A;  4DS5 A;  1XMO J;  4TY8 A;  2YWK A;  3IAM 9;  1TVR A;  3D2W A;  4O3S A;  3CCQ S;  4IG3 B;  5HJY A;  1T3O A;  4DL4 A;  1WUU A;  2R7O A;  3FNN A;  5L9N A;  1ZAX A;  4JI4 J;  5E3Q A;  3ET6 B;  3ZTO A;  2ZWP A;  1I5O B;  3BKF A;  4QIW D;  4DL7 A;  1AUS L;  4GO7 X;  2GHW A;  3IP0 A;  4OI3 A;  1LWF B;  4NEY A;  3J7Y U;  4RW9 B;  2IM2 A;  4TYA A;  3KJV A;  2IBO A;  1TKX B;  2EKN A;  2F3J A;  4K50 A;  2HQ3 A;  3MF5 A;  2EKY A;  2W2O P;  3M6V A;  3JQK A;  3HSJ A;  1V5I B;  3Q24 A;  2OI2 A;  2VL1 A;  2QMX A;  2I38 A;  3UD3 P;  4QR0 A;  1RCX B;  2LU1 A;  2V8H A;  4IKA A;  4ED0 A;  3CMA S;  3DNC A;  2MQP A;  2MZ1 A;  3NS5 A;  1RAF B;  2BOA A;  4M5M A;  2J0S D;  1U8W A;  4PAB A;  4RNH A;  2ZZM A;  3OW2 R;  2YNI B;  1TZ0 A;  2U1A A;  2CKW A;  4HH0 A;  3QPI A;  4ZVR B;  4BLG A;  1REV B;  4X4R A;  1YLX A;  2V8P A;  3CNQ P;  4Q44 A;  1SL0 A;  1S1X A;  3C15 B;  2E9T A;  4KE5 A;  1VK3 A;  3IBC B;  1UVI A;  1P6T A;  2GQC A;  4FKY A;  3W2W A;  4ZIW A;  4I7F B;  1R43 A;  3C19 A;  3IMQ J;  2W2P P;  3GLJ A;  1FWK A;  3D68 A;  5B08 A;  7FDR A;  3EGW B;  1EAY C;  2PA8 D;  3M32 B;  4P2M A;  1H2T Z;  3KHL A;  3K59 A;  2AYB A;  4JI1 J;  2K3K A;  1R6Y A;  2HWT A;  3FSY A;  3GP9 A;  4KGX B;  2DGT A;  4Y34 A;  1RGV A;  1DUR A;  4DR1 F;  4LR9 A;  1HYS A;  2V68 A;  3EXY A;  1S99 A;  4OI2 A;  1HLW A;  1T9U A;  2NZC A;  4QBU A;  1RHK B;  2YXL A;  2IA0 A;  3PRD A;  3JSM A;  1NME B;  3DDI A;  1YZ7 A;  4F26 A;  3RB6 A;  2OPR B;  2DR8 A;  1F60 B;  5DZ7 A;  2KFN A;  3DU6 A;  2K8G A;  2Q79 A;  2C2D A;  1TL7 B;  4K4V A;  2B3T B;  2FZK B;  4M63 A;  2RJZ A;  3QZ8 A;  1CLF A;  2HLT A;  3IWN C;  1U1R A;  2BOP A;  1TL1 A;  1FDA A;  2YKM A;  2WBM A;  1WTF A;  1V5V A;  3K7R A;  1KTV A;  1FKO A;  3MAA A;  3MPV A;  4WWS A;  2M9K A;  5J2M A;  1VHI A;  4USH A;  4MAK A;  4BDP A;  3G6X A;  1MWQ A;  2SXL A;  4IG0 A;  2BJ9 A;  3PCO B;  1K9M T;  5HVH A;  4Y00 A;  3DU5 A;  1HHQ A;  3AB2 B;  4XAK A;  1NCL A;  1WG1 A;  2FJA B;  3CJK B;  2BKO A;  4MK9 A;  3QQC D;  4X4Q A;  3QIP B;  3G8T A;  4B3T F;  2YX7 A;  4DU8 A;  4DV6 F;  2FB0 A;  5B7W A;  2BKN A;  3PFE A;  4DV2 F;  2KRR A;  4FF1 A;  3D6F B;  3TOQ A;  2XI3 A;  1C0T B;  3RB3 A;  3RAX A;  4JI5 J;  1KSP A;  3T1H J;  4JI6 F;  3D6H B;  4DR5 F;  4B3S J;  4K4S A;  1RT7 B;  3QGI A;  4O44 B;  3CCW A;  4NLU A;  2GHP A;  2K1R B;  4HEA 9;  2HQC A;  2MDA A;  4JOU A;  2RT3 A;  4OX9 F;  4RW8 A;  2EI5 A;  4IYQ A;  4YHH F;  1LWX A;  2KJV A;  5I3U A;  1RIS A;  2QG9 B;  2XLK A;  2HFU A;  1ZM4 A;  4DUY J;  5F8N A;  1F1B B;  3UR3 C;  4ZN1 A;  3MEC B;  1WSR A;  2ZOF A;  4PWD A;  2ROE A;  4ENO A;  3MAH A;  4KR0 B;  2DRB A;  1UFW A;  2YNF A;  1KQF B;  3J81 U;  1TKT A;  2DBB A;  4HTI A;  1L3T A;  2E9Z A;  2MY7 A;  4NXM F;  2DRD A;  3R5D A;  3Q22 A;  5F3Z A;  3G6E S;  3NGT A;  1RWN B;  1EJ7 L;  4ZVE A;  1U1L A;  5HLF A;  2CRL A;  4OYW A;  5CCM A;  4DR4 J;  2KM8 B;  5CZX A;  2HEK A;  3TUZ C;  5GMD A;  2BE7 D;  4L75 A;  1S57 A;  5AXN A;  4KGV B;  4DPO A;  4IG0 B;  4O0N A;  3DLB A;  4HHJ A;  2POK A;  2YKA A;  4TU7 A;  4PXE A;  1SC3 B;  1KS2 A;  2HHH J;  3QAE A;  2OD6 A;  3G71 S;  5KG1 A;  4ED2 A;  2RHS B;  4QWA A;  4B9N A;  1CJV A;  2MQM A;  2K7K A;  1G6B A;  3TZW A;  4DL0 C;  1VI7 A;  2IYI A;  3FEZ A;  2GVD B;  3C6T B;  1T9X A;  2ZEJ A;  4YN3 B;  3V6D B;  1ARO P;  3P5T L;  1BLU A;  4LF8 J;  3FUY A;  3HHL B;  2ZH1 A;  4CNY A;  3OLA A;  2FVP A;  3NS7 B;  1H2U X;  2IYG A;  4E2F B;  3JYT A;  2PA3 A;  2GX8 A;  2MZT A;  1EQ0 A;  2YPY A;  5DGA A;  3HLU A;  1YIT S;  5K20 B;  1UWB B;  3AY0 A;  3AA9 A;  2B0G A;  2HFS A;  4CO5 A;  1I94 F;  3M32 A;  4KKO B;  5ITH A;  3KLG B;  1NB7 A;  3ZZO A;  5GAE U;  4ICL A;  1HBO B;  1YVF A;  4X62 F;  3A8E A;  1TFY A;  3G6V A;  5KFW A;  4X4O A;  4DLE A;  2HWH A;  3HCX A;  2XZT B;  1S7I A;  1RTJ B;  4M5D B;  1VIS A;  1Q5V A;  1VDH A;  2WVE A;  4UUX A;  1N88 A;  3MFI A;  5HMZ A;  2R7S A;  3QJJ A;  5EWF A;  2O67 A;  4JI8 F;  4Y3C A;  5AE1 A;  6FD1 A;  1YJ9 S;  3N01 A;  1S6P B;  3MUM P;  5HBM B;  5L1I A;  2RQM A;  2DEJ A;  2F9D A;  3DLG B;  2A2C A;  4DLG A;  5K9F A;  2NYH A;  2AT1 B;  2YTC A;  3DKD A;  3V81 B;  3R1L A;  4X4N A;  2BV3 A;  3VGS A;  4UOC A;  1LXN A;  4F2R A;  1DQ9 A;  1H74 A;  4Y2I A;  3H40 A;  2N82 B;  2G2O A;  4U7U K;  4A8O A;  5KFK A;  2IMW P;  3HKW A;  4FF2 A;  2NS1 B;  5DDQ C;  2YH1 A;  3KNG A;  1FDD A;  4WF9 Q;  1CJT A;  2HW3 A;  3CCJ S;  1AZS A;  4DQI A;  4GVL A;  4USW A;  4WXO A;  2V63 A;  5GAD U;  4I69 A;  5E7O B;  3CJK A;  2RAQ A;  5C2G A;  1PIL A;  4ZLL A;  2FHM A;  1RUS A;  1JLQ A;  2ZM6 J;  5CYQ B;  2P8I A;  2ZDP A;  2R8I A;  1T3N A;  3CDB A;  1Q8B A;  3IFE A;  4P9S A;  3HT0 A;  2HFN A;  3NOC A;  4I6Y A;  3WZ0 A;  4LF1 A;  4F3O A;  1NAQ A;  2DH9 A;  1XJW B;  5BR8 J;  2AIR B;  1TKZ A;  2VC0 A;  3T5H A;  4NXM J;  2HMI B;  1BGX T;  5KG7 A;  1LW2 A;  3ZZY A;  5L1L A;  2EK6 A;  3GIR A;  2LQJ A;  4M5D A;  2FTR A;  4URQ U;  2HKE A;  3UN2 A;  2ADC A;  5KFY A;  4U7U D;  1KLM A;  4HYK A;  3QGG A; 
#chains in the Genus database with same CATH homology
 1BE4 A;  4CP5 A;  1HIY A;  3FKB A;  3ZTQ A;  4ANE A;  1S59 A;  3B54 A;  3R9L A;  2HVE A;  1NDP A;  1WKL A;  3ETM A;  4DUT A;  2BEF A;  4W98 A;  3ENA A;  4UOF A;  4KPC A;  1LWX A;  4WBF A;  5CAA A;  1XQI A;  4ENO A;  2DY9 A;  4F36 A;  4ANC A;  3MPD A;  4S0M A;  1NDK A;  2VU5 A;  3FBC A;  3NGR A;  3VGT A;  3G2X A;  3B6B A;  3NGT A;  3EVM A;  3BBB A;  2CWK A;  4FKX A;  5IOL A;  1NSK L;  3FC9 A;  1XIQ A;  3ZTO A;  1F6T A;  1S57 A;  1NSQ A;  3EJM A;  4O0N A;  1BHN A;  2B8P A;  1NSP A;  1ZS6 A;  4DZ6 A;  3EM1 A;  3FCW A;  3EE3 A;  3Q83 A;  4F4A A;  3BH7 B;  1NDC A;  3EMT A;  3VGV A;  1BUX A;  3FBF A;  3VVU A;  2DXD A;  3FCV A;  3VGU A;  3EVO A;  3FBB A;  3L7U A;  3Q86 A;  4C6A A;  1U8W A;  5C7P A;  1KDN A;  3GPA A;  3NGU A;  1UCN A;  1PAE X;  1EHW A;  3ELH A;  1MN7 A;  1VYA A;  3PJ9 A;  3ZTR A;  4FKY A;  2DXF A;  1W7W A;  3ZTS A;  3GP9 A;  3NGS A;  1K44 A;  3BH6 B;  2ZUA A;  3BBC A;  3PRV A;  3Q89 A;  3DKD A;  2AZ3 A;  1B99 A;  1HLW A;  1NPK A;  4HR2 A;  2DYA A;  1F3F A;  3VGS A;  1PKU A;  2NCK L;  3Q8Y A;  2B8Q A;  3DDI A;  1JXV A;  2BX6 A;  4EK2 A;  1MN9 A;  1NDL A;  1NHK L;  3Q8V A;  2DXE A;  1NB2 A;  2HVD A;  5CAB A;  4UOH A;  3JS9 A;  2AZ1 A;  1LEO A;  3BBF A;  1B4S A;  1NUE A;  3ZTP A;  3Q8U A;  1WKJ A;  4UOG A;  5BXI A;  3WX8 A;  1HHQ A;  1S5Z A;  1WKK A;  1NCL A;  4AND A;  3EIC A;  4DI6 A;  1NLK L;  3VVT A;  3FBE A;  3EVW A;  2HUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...