5CAIA

Crystal structure of a putative lipoprotein from the duf903 family (kpn_03160) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.30 a resolution
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
53
structure length
53
Chain Sequence
b'SSNYVMHTNDGRTIVTDGKPQTDNDTGMISYKDAWGNKQQINRSDVKQLGELD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein from the DUF903 family
publication title Crystal structure of a putative lipoprotein from the DUF903 family (KPN_03160) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 2.30 A resolution
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Lipid binding protein
total genus 7
structure length 53
sequence length 53
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5caiA00
3JB9G 1LOJA 4EMGA 5CAIA 5GAMh 4XU2A 4OP0A 4PJOF 4N0AA 3JCMh 3HSBA 2RM4A 5GAOm 5GANh 3RERA 3JCMV 3FB9A 3INZA 4MMLA 5LJ3h 2FB7A 4M77F 4C92F 4HT8A 1KQ2A 4PJOG 5LJ5h 2ZGWA 2RD1A 1BIAA 4F7UF 4M7DE 3L2ZA 4N0AC 1WPYA 2EJ9A 4M75A 3QO3A 1X01A 5GAN2 2RA2A 4C92G 4PJOC 1WQWA 5GMKj 2CGHA 4PJOD 3QHSA 5GMKm 4C8QA 4JUVA 4F7UG 3JCMP 4M77C 2DEQA 4M7AA 5GAN7 4M78A 4PJOB 4C92C 2QTXA 1JRIA 3EFSA 1HXDA 4J6YA 3RKWA 4C92D 3JB9H 2YLCA 4XTZA 4XQ3A 3FJPA 1D3BA 4M77B 4M78G 4HA8A 2DZCA 4C92B 4M77E 3JB9J 4XTVA 4EMKA 2DVEA 3JCMX 4F7UB 2E1HA 1YCYA 3BW1A 4M78C 4XTUA 5GAMd 3QSUA 2E10A 4M78D 4A53A 1B34A 4J5YA 1WQ7A 3JCMd 2RB6A 5GMKe 5GANg 5GAOq 2JN0A 4XU0A 5GANd 5GAMf 1Y96B 3SWNA 5LJ3d 4M75F 2DKGA 1D3BB 2VXFA 3JCMf 5GAOp 5GANj 4DQ2A 2HNIA 1TH7A 5GANf 5LJ5d 4M7DA 5GAN3 4C8QF 5LJ3f 4J6WA 1N9SA 1LJOA 2DJZA 4PNOA 4M7AF 4M78F 4M75G 3JCMc 1LNXA 5LJ5f 1MGQA 4JRIA 4PJOE 4C8QG 1H641 4M75C 1KQ1A 4NOYA 4Y91A 3BDUA 4M7AG 4WF2A 4M75D 1U1SA 5GMKh 4C92E 3RIRA 4C8QC 3BY7A 4XU3A 3AHUA 1M5Q1 4M75B 2DTOA 3RESA 4C8QD 1U1TA 5GMKi 5GAMg 2VXEA 4M7AC 1JBMA 4M7AD 2Y90A 4F7UE 1M8VA 5GANe 3JCMg 3JCMQ 4C8QB 5GAN4 5GAMj 4MMKA 4XTYA 3V7CA 4M7AB 2E65A 1I8FA 2EJFA 4M78B 5LJ3g 3JCMW 3QUIA 3GIBA 2DTIA 4M78E 4M7DF 4EMKC 2EAYA 2DXTA 4RCBA 5LJ5g 4JRKA 5LJ3j 3SB2A 1I81A 2DXUA 2YHTA 5GAN8 4EMKB 5LJ5j 4M7DG 3BFMA 5GAOn 4NL3A 1BIBA 3RKXA 2FYKA 3M4GA 4QVDA 3SWNC 3JB9I 4XU1A 4EMHA 3HFNA 1B34B 3JCMb 2K57A 4X9CA 1I4K1 4M7DC 4PJOA 5DY9A 5GAOl 4A54A 4QVCA 3JB9D 4HT9A 4J6XA 3V8LA 3SWNB 4M7DD 4XTWA 5GAMe 2DZ9A 5I21A 3V7SA 4RCCA 4M77A 5GAOr 3V7RA 4C92A 4M7DB 2E41A 3JCMe 4M75E 3JCMJ 1I5LA 2E64A 3FIFA 5LJ3e 4M77G 2VC8A 3PGGA 3V8JA 4F7UA 2EWNA 3HFOA 4C8QE 1HK9A 4XTXA 4V2SA 4M7AE 5LJ5e 2DTHA 3VU3C 5GAN5 3JB9F 4NL2A 2EJGA 5GMKl 2I2LA 1N9RA 3L1AA 3RUXA 3V8KA 1Y96A 2YLBA 5GAN6 4JLIA 4M77D 1WNLA 4X9DA 3RKYA 3EFRA
chains in the Genus database with same CATH superfamily
1AOJA 1KK7A 1QVFS 1WLPB 4ELZC 3HTRA 2KI7A 1U06A 3QYHB 2JMAA 1Q7YR 3JCMV 1K8AR 2CKKA 1UGQB 2W0ZA 1VQ8Q 2D8HA 2P0KA 1V29B 1NJIR 2RA2A 4PJOC 3PFSA 1QVFP 5FW9A 4P5NA 1UHFA 4RG2A 2ZPGB 1U3OA 2RK1A 4M77B 4M78G 3LX7A 1KIKA 4F7UB 2CP0A 2RJDA 3CD6A 3EGDA 2K6DA 1VQLA 1OX8A 3L2UA 3TVTA 1TH7A 2LRQA 4CC2A 4E7HA 1Q82C 2BZYA 2R57A 1QKWA 4M75G 4D8DA 1YIJT 4MDXA 4QVZA 4IUQA 1QKXA 3I56A 3CC2T 1HD3A 1MMDA 3EG9A 3EHQA 2C0TA 1QWEA 5FWCA 4WF2A 2ED0A 4EIKA 3AHUA 4J9BA 4C0GA 4F14A 4LE9A 5GAN4 2CDTA 2RQRA 4JJCA 4FM4B 1RAIB 2LCSA 4J7FA 1WJRA 3CCVQ 3OS1A 3G4ST 1SHFA 1TS9A 1YI2A 2ZCFB 2V26A 3QDRB 4BE1A 3HFNA 4OF1A 1RI9A 1I4K1 1X2KA 5CCAA 4BD3A 3C95A 3T9NA 3JCMJ 1I5OB 4ZGEB 3V8JA 3KBGA 1X6GA 4HVUA 8AT1B 2LT4A 2QAZA 4KULA 4OMLA 3CMEQ 2MF2A 1CSKA 1K4US 1LOJA 4UC4A 2OTLA 4XU2A 4II1A 1VQ8T 3L42A 2M9UA 2FZKB 2H3JA 2MOXA 3OYBA 5FLXE 3OYAA 2LQWA 3TU4K 1WFWA 2X4XA 1KQ2A 4PJOG 3EH1A 3WXMB 2COYA 2M16A 2EQMA 2M0OA 3GNFB 3QO3A 2EQKA 4JZ3A 2KMTA 3EFOB 1VQKQ 2CUDA 3G6EA 4OVAA 2F5TX 1G3SA 1QVFA 4ZTFA 2MCNA 4Y92A 2AHJB 1G2BA 3CMAA 3MHXA 1S72A 2G6FX 1EX4A 2H3EB 3VS4A 4GY5A 1VUBA 1JXMA 1WDXA 2YUQA 1N8RU 2CP7A 1YITT 1X27A 4OGCA 1SF9A 3J7AF 4PK4A 3GOXA 2LJ1A 1AWJA 1GFCA 4CC7A 2CZ6B 2F2WA 3CCUA 1B07A 1UGPB 5CR2A 5GMKh 1K9AA 2SRCA 4M75B 5IT9E 1M90R 1OU9A 3D7SB 1MMAA 2FRWA 2BTTA 5GAMj 3WVEB 2EJFA 4IIOA 1KHIA 3GIBA 3MCAB 4Z88A 2E6ZA 2BZ8A 4EMKB 3CCEA 5LJ5j 1YN8A 4PL6A 4NL3A 1NLPC 3SWNC 2EYYA 2YT6A 3MO8A 2YUNA 3OY9A 2V8KA 4J6XA 2V8JA 1R0CB 5GAMe 4M77A 1BK2A 2RK2A 5KYXB 3CMET 4BI8B 3OYJA 1T3LA 2FVUA 4F7UA 2DL8A 2OTJA 5LJ5e 1ZBXA 1BKBA 4HKEA 3JRZA 4DOVA 2A0FB 1AD5A 1BI0A 2EQIA 1W1FA 2K3YA 3WVDB 1RLQC 1RUWA 1Q81C 3HSBA 2CYZB 3H0FA 3RERA 3VS7A 3REAB 2BIVA 1H8KA 2EIFA 1YNZA 2E4HA 2VKNA 1BCMA 1BIAA 1D0XA 4M7DE 4BDZA 3UATA 3CEYA 4PLLA 3P8BB 1Q86C 3QHSA 1Q7YU 3VS1A 4PJOB 1SRLA 4MZTA 2IG0A 4Z8AA 1M1FA 4EDUA 5KH6A 4M4ZA 3OMGA 3PIOA 1NJIU 2OAWA 1BCOA 3EG3A 3CCQQ 2HQEA 1W2BS 3BW1A 5GAMd 4JLGA 3CBMA 4M78D 1OYXA 3UPUA 2ROLA 5LJ5d 2P0QA 5LJ3f 3LLRA 4LN2A 4C5HA 2FG0A 4Y28E 1W2BP 1G3YA 1WI7A 4M75D 3G71A 2GGRA 2PUKB 3HPWA 3UA6A 1JBMA 1LPLA 1SRMA 2RQTA 4L59A 4R0KA 5LJ3g 2DTIA 2EFIA 2LTOA 3CCSQ 5CIUA 2RN8A 2DK3A 1H92A 5GAOn 2LT1A 2CT4A 1HSQA 3EFOA 2AK5A 4X9CA 4M7DC 2DYBA 1U5SA 4ZTJA 1AZEA 2DX1A 3I5SA 2RHUA 3CCJQ 2EQJA 1ACMB 1PKSA 2YWWA 3OB9A 1VQ7Q 2DBMA 3QBYA 2OAUA 2RQVA 2FHDA 3H0IA 1ABQA 5GAN5 2K9GA 2L3RA 2PZ1A 4O6JA 3DB4A 1WNLA 4F17A 2QTVA 1D1BA 1PG5B 4FYWB 4ME7A 1GFDA 5I2MA 5IAYA 5LJ3h 1VQPA 2F1LA 1SHGA 4ZN1A 4E7SA 3GPLA 2JS0A 2F5KA 3VRYA 3M57A 4M75A 2AIRB 2HBPA 1RAFB 2GBQA 4PJOD 3HRSA 3CCQT 2L3QA 2C0OA 2K5IA 1AVZC 2J05A 1Y07A 3OYYA 4EMKA 2Y4YA 2DRMA 2JXBA 4E2FB 4PJLA 3TCJA 5GJVB 1AEYA 2QA4A 2D1XA 2WACA 2ED1A 2VYTA 4FT2A 5KYXA 3RDVA 2PVDB 4J83A 2K4YA 1OI1A 5DLQE 4RTVA 4PFOA 2FRYA 2O88A 2K2MA 1TU0B 1CKAA 1VQMA 4C92E 1W2BA 4DBRA 1M8VA 1TUCA 5AT1B 3G1JA 3JCMQ 1BB9A 2QDYB 3PVQA 3X26B 2KYBA 2ECZA 4C5EA 3JCMW 1I07A 1RAAB 2VASA 5J39A 1N6AA 2ABLA 1VQNA 2OI3A 5D7UA 2J6KA 1I81A 2BE7D 4E7LA 4PKCC 4M7DG 1ABOA 2MMPA 1M90U 3EG1A 3CCJT 2KEAA 2RHXA 1F1BB 1X6OA 1VQ7T 4PJOA 2JTMA 1VQ4Q 5HKCA 2D6FA 1NLOC 3SWNB 1OZ2A 2QYZA 4ANJA 3E9GA 3THKA 4C8QE 4M7AE 4NL2A 2EJGA 4Z89A 3HRUA 3P8DA 1OV3A 4J9IA 2DJQA 4OP0A 4N0AA 1H3HA 1OPLA 5HK3A 1ZX6A 4M77F 4PLIA 2M51A 3OYHA 4IUPA 1OU8A 4F7UF 2BUDA 1KJWA 3LGFA 2X4JA 3NHNA 1PSEA 2HQHA 1V1CA 1KC8R 1OULA 3CC2A 4C92C 1PCXA 4R56A 4RMOA 1ZA1B 5CVIA 4B6MA 1VIFA 2PNIA 5KYNA 3H6ZA 4E7KA 1SSFA 3M59A 2E10A 3QJYA 5GJWB 1WQ7A 1IZ6A 5GANg 1UGSB 1IB8A 2ZPEB 4XU0A 3OW2P 1D1CA 3EG2A 4DQ2A 3G4SA 1WYXA 3JAME 1BU1A 1UGVA 4VUBA 2MAMA 1QCOA 4LNPA 2O9SA 4Y91A 3VS5A 3BDUA 5C0MA 5FRNA 3PT9A 4C8QC 3F70A 4M7AC 1RADB 1M3CA 4E6RA 1QW1A 2OX7A 2LJ3A 2QQRA 2E12A 2LCLA 2ZPIB 2HZYA 2CH4W 1VQ4T 3BFMA 3RKXA 4O5VA 4QVDA 1WX6A 1M8MA 2AKLA 1ZUUA 4M7DB 1R8OB 3H0HA 3BDLA 2YRVA 2ESWA 4LDXA 2KNBB 4PJJA 5HY6A 3OYCA 3CC4A 2L89A 1JJ2P 2QK0A 2I2LA 1PNJA 4J9DA 1OX9A 4J8OA 3LWHA 3M9QA 2QEXT 1ZA2B 3CC7Q 1X69A 3INZA 3GF5A 2LJ0A 3O5ZA 4KGXB 4OB3B 4CRIA 1YITA 1VQ5Q 6AT1B 2RQWA 1WPYA 1W6XA 4KUIA 4C92G 1RACB 5EC7A 4DBFA 2EQUA 2KVQG 2MWOA 2LP5A 4JS5A 5GAN7 2CZ0B 2K5FA 4QKUA 2HKQB 2P4TA 2DZCA 1WHLA 2CSQA 4WTOB 2KQWA 2DD5A 4FU6A 3ZFJA 5AYFA 2V1QA 5GANd 3L2RA 3SWNA 4M75F 1YJ9Q 5IH2A 2VXFA 2CZ1B 2ZAEA 2F69A 1QP3A 1IGUA 2KK4A 2RPNA 4KH1B 2K2VA 4C8QG 2VGNA 3CXCS 2A08A 4M7AG 3CCLT 2QI2A 1GXIE 3PTAA 5D6YA 2XMFA 2DTOA 1ZHIA 3CMEA 1X43A 4AFUC 1XQHA 4N4HA 1P92A 2FPFA 2I0NA 3Q1JA 3V7CA 4C0FA 3OYDA 1B3QA 2EGCA 2LNHB 4JRKA 3CXCP 1SEMA 2XU8A 4LUEA 1WHHA 2B8AA 3A8OB 2EPDA 2FYKA 3M4GA 3RNJA 1B34B 3QZ5B 4A54A 4PFPA 3X24B 1YJWQ 7AT1B 4M7DD 3C0CA 3S6WA 2LQ8A 2GNCA 3M53A 3JCMe 2RHIA 5CK9A 1FMVA 3PGGA 2LDMA 2VGMA 1PWTA 2RH2A 3VRZA 1NZ9A 4OMQA 3URGA 4FYXB 4X9DA 3CC7T 2L2PA 3RKYA 1Q82R 1M2OA 5CAIA 1VQ6Q 4PJOF 1VQ5T 5GAOm 3LH5A 3TQ7P 4ZGJB 1UTIA 2CSIA 4QQ6A 3NFCA 2B86A 3SD4A 3VS0A 4RTTA 3EH2A 2JNGA 2NUPB 1K73U 2ZPBB 3ER0A 1T0JA 2XG8D 4JUVA 4RTZA 2YSQA 1M1KC 3OYEA 2CS7A 2ATCB 3JB9H 1VYUA 4HA8A 1YWPA 3QYGB 1QVPA 4C92B 3JB9J 1MV3A 5KCOA 4LDYA 1YJ9T 5IHNA 2DPPB 3NMZC 1KC8U 2L0AA 1TUDA 4BB7A 3JCMd 2CREA 1ZSGA 2EYZA 2JN0A 5GAMf 2BZXA 2DL7A 2DKGA 3QWYA 2XDDA 4M7DA 2KGTA 2MIOA 2A7YA 2MI6A 4LD6A 1U8RA 1M1KR 1VQLQ 5LJ5f 2JUFA 4DOWA 4ZNXA 1H641 3JSCA 4FYVB 5GAMg 2RI3A 2KXCA 1FX7A 4C8QB 4DA4A 4M7AB 4M78B 2AZVA 1PKTA 1VA7A 4IUVA 1QLYA 3A1PA 5LJ5g 2GTJA 2DXUA 2IVWA 5GAN8 1ZSZC 4L6V5 1EIFA 2EGEA 4K11A 3CXCA 1KD1C 2VV5A 3JB9I 2K57A 3PE0A 1LVKA 1UB4A 1YI2Q 3EHRA 3MEUA 2HSPA 4RCCA 4OB0B 5M9OA 5GAOr 5IXBA 1G5VA 3CCVT 2CP5A 2O2OA 3MJXA 3RUXA 1VQ6T 1BI1A 2A3LA 5GAN6 4JDSA 5A0GA 3CCQA 1Q95G 1W70A 3EFRA 5CKHA 5FU7C 5GAMh 1K9MC 2P4RA 2L3SA 1UE9A 3M0SA 4ZN3A 1ZBJA 1E6GA 2E70A 1YP5A 1D0YA 3MP1A 3OS2A 4HT8A 4E7ZA 1N5ZA 3A8GB 2OTLQ 5LJ5h 5ECAA 1IRXA 1YJNA 2XIDA 8ATCB 2QDLA 5GAN2 3JCMP 3X25B 1QVGP 1JRIA 1IXDA 4C92D 1WHJA 2V8IA 4J9FA 1K9MR 2IIMA 2KBTA 4LUDA 2DVEA 3G6EQ 1YHQA 3MEVA 3TEEA 3VYGA 1B34A 3CMAQ 1VQKT 1Y96B 2K5LA 1S72Q 2KSSA 1VQLT 4JPBW 4JRPA 2CT3A 3JCMc 1I1JA 1K8AU 2GF7A 2QXFA 3QDFA 3SFMA 3QG1A 1VQ7A 1GL5A 3TREA 3H8ZA 1YCSB 3MP6A 3S3OA 4RG8A 1Q81R 1JQQA 2KR3A 3QWXX 4C8QD 1O75A 2KAFA 4M7AD 1IO6A 1M3AA 2DYIA 3OYKA 2HBWA 2KT1A 3VJPA 3GLXA 1E7OA 3MKDA 1NPPA 1Q86R 2FO0A 2NUPA 1WGSA 3CCRQ 3A8MB 3X28B 4A63B 3JB9D 4RTUA 3CCEQ 3QZ9B 4C92A 2R5AA 3G7ZA 2E64A 3R6NA 2DIGA 4OMMA 1NM7A 2DILA 2COZA 4RTXA 3M54A 2OTJQ 1C6VX 2OTLT 3OSSC 4LDWA 3VS6A 1HJDA 2K3XA 2NLUA 4LXCA 1E6HA 3E9FA 1G3TA 2E3HA 3E19A 2DBKA 3DLLA 2K7AA 5IHKA 1Q82U 2CGHA 4C8QA 4M7AA 3OBYA 4M78A 3G6ET 3QIIA 1V76A 1KSWA 1B7TA 3CBOA 2HQXA 2RNAA 4M77E 3CPWS 2JS2A 3S3NA 1S72T 3VV0A 4XTUA 3QSUA 3OMCA 3I55Q 4RUGA 1R77A 1XOVA 4HCBA 2RHYA 4AFZC 3LW5E 2IPOB 1ZUYA 2LVMA 2DJZA 2DXCA 3ZL7C 4LD9K 3CPWP 3FEOA 3PNWC 1MGQA 4JRIA 2FEIA 1SPKA 3CCMQ 3KUFA 3J80E 5FROA 1M4ZA 2L3PA 2R58A 1VQ9Q 4IUTA 2EW3A 4OMNA 1M5Q1 4AG1C 4KRTA 3RR6A 3REBB 4JJNK 1NEBA 4BACA 1G83A 1I8FA 2JMCA 3G71Q 4BY6C 2GFAA 3CCRT 2QASA 4M7DF 4E7JA 1WA7A 4PJMA 1CKBA 1LCKA 1OEBA 1BIBA 1UGRB 4X1VA 5D6XA 2QEXA 4XU1A 2JJ9A 1ZSZB 5A0DA 2LZ6B 1JU5C 5GAOl 3OYFA 2DL5A 2DZ9A 2HEQA 2NUTB 2KYMA 3C4SA 4ZGDB 3CCST 4E7IA 4C5GA 1JEGA 3FIFA 3FRNA 3E2UA 2DTHA 2OTJT 2CUBA 1N9RA 3L1AA 1Y96A 1M2VB 2JVVA 5C6SA 4BE2A 2D0NA 1A0NB 1G8XA 4KT0E 1K76A 1AZGB 3E1SA 3OYMA 1Y71A 2D8JA 4FL6A 2HDAA 4LDUA 2C0IA 5KCHA 2XDBA 4C0ZA 1K0SA 2DEQA 4A4KA 3EAEA 1GCQC 1O9SA 1HXDA 2YLCA 3AT1B 3X20B 3CCLA 3FJPA 1WJSA 3I55T 3QXEB 2CH4A 2AZSA 3H41A 3OS0A 1XNIA 4WCIA 2RB6A 3UDCA 5J26A 3FLGA 5DM7R 1D3BB 3O8VA 2G3RA 5GANf 3CCMT 5I22A 1YIJA 1VQ9T 3OW2S 2O4XB 1K1ZA 2KXDA 2KRNA 2E6NA 3CPWA 1RAGB 1Y57A 3RIRA 1AWOA 5J3BA 1U1TA 3M5AA 2DNUA 2LX9A 2QGGA 2E65A 1VQMQ 2KT8A 2EAYA 2DAQA 1N8RC 2JT4A 1UG1A 1Q81U 3VKIA 1OPKA 1SKUB 1D0ZA 2WSFE 3HKSA 3QPHA 4FSXA 1VQNQ 1RL2A 4KBMB 1OOTA 1G3WA 4F16A 1MMGA 3TSWA 2COWA 2GTOA 1Q86U 1TWBA 4M77G 4FW1A 1PRLC 5A0LA 3HFOA 4XTXA 1M30A 4C5IA 1MHNA 5CO7A 5FU6C 3V8KA 5FRMA 2RF0A 2A28A 2YLBA 4J9GA 1N8RR 1VQOQ 2QTXA 1TOVA 1AWXA 1JJ2S 4FT4A 4KGZB 1VQ8A 4HVWA 1UDLA 3GNGA 3LWIA 1YWOA 5GANh 4IURA 3FB9A 3IQLA 2DIQA 2CP2A 2E3IA 4C92F 2HMAA 4DEYA 4N4GA 2R5MA 2ZGWA 2EJ9A 2EVRA 1PD0A 5GMKm 2PTKA 1RLPC 1PHTA 1JB0E 4XQ3A 2KROA 1UJ0A 4QT7A 2LMJA 2HKNA 1ZSZA 2RHZA 1RABB 3JCMf 2DL4A 2NUTA 3CQTA 4C8QF 4M7AF 5KE2A 4M78F 4KUDK 1XTDA 1BI3A 2QQ9A 5D6WA 3G4SQ 4KH0B 1M2VA 1Q7YC 2O9VA 1WXTA 1VQMT 2P0PA 2EKOA 2VXEA 3CCVA 4RTYA 1RI0A 3ULRB 3JCMg 2LX7A 1NJIC 2ZZDA 4RCBA 3DLMA 3I35A 3OW2A 1X2QA 4IUUA 3ZEHA 4BY6B 1PSFA 2DVJA 4FW2A 1NPRA 2KDSA 1MUZA 2AT1B 4IKFA 1MNDA 9ATCB 2YUOA 4XAXB 3EGXB 3KXTA 1Z9QA 2DA9A 1VQOT 2VC8A 2EWNA 1QCNA 1HK9A 1IHWA 3NTKA 3VU3C 3LYIA 4J7IA 1D3BA 1C0MA 2L8DA 1YBYA 3OSVA 3JB9G 2J6FA 3CC4Q 5EG2A 2DF6A 3SHWA 5A2QE 2O4XA 4R55A 3JCMh 1QQJA 1ZUKA 1ZLMA 3RMSA 2FB7A 2DM1A 3M0TA 2FZCB 1VQKA 4HXJA 4N0AC 5IN1A 3M58A 3ME9A 2WSEE 2XHCA 2FZGB 4AG2C 3A98A 2X3WD 1YITQ 1TSFA 3EFSA 1JJ2A 3UF4A 3H9NA 2W10A 2F2XA 5KYWB 2V1RA 4A4HA 1NEGA 2FPDA 2X4WA 3NPFA 4D8KA 1GBQA 3N5BB 1QWFA 1Y7XA 1K0XA 4JS4A 2LQNA 2A37A 2J6OA 4AFQC 3R6OA 2VB6A 2CP6A 2EGAA 2SEMA 1TTHB 4DBHA 1U1SA 1OZ3A 5CQYA 3RESA 2D0QB 3NTIA 2BKDN 1QMCA 1BYMA 4MMKA 3J81E 2DXTA 2LQKA 3CD6Q 2YHTA 4B9XA 2EKHA 4AT1B 4EPCA 1FXXA 2DRKA 3HP9A 2EYWA 2F2VA 3JCMb 1WHGA 3UWNA 2MYSA 3ZBDA 3PMIA 3I56Q 1KQSS 2MK5A 3V7RA 2E41A 1XJWB 4NS5A 5L8RE 1GCPA 3C94A 3S3MA 5KYYB 1Y0MA 2J06A 1FYNA 1ZQ1A 1PC0A 2FL7A 3CC4T 3OBWA 1UEBA 4M77D 3OYIA 4MZMA 1YJWT 5FU6B 4BI4A 2M1HA 3LH0A 4RKUE 4EMGA 1KQSP 1T0HA 1FWZA 2YXYA 1M90C 3EG0A 1IHVA 2EYQA 2RQUA 1I0CA 5KYUB 3M0QA 3L2ZA 1EZZB 5LL6S 4GLMA 5L23A 1WQWA 5GMKj 3M56A 2XDPA 3QKJA 3VS2A 3OA6A 2E5QA 1KD1R 1QVGS 3JCMX 1WXUA 2E1HA 1D09B 3TSZA 3EGXA 5GAOq 5GMKe 2DFUA 3CCRA 2QG9B 4IIMA 5GAOp 3KFVA 2YDLA 4YTLA 3M0RA 4FYYB 4OGEA 3SDZA 1PRMC 2J7IA 1HYOA 2JTEA 2LNVA 4X34A 1AT1B 5CKFA 1UECA 3CCSA 2X4YA 2FPEA 2Y90A 3CD6T 2A36A 1JXOA 1GBRA 3M55A 5HCKA 2GFUA 1SG5A 3SB2A 1WHMA 4OMPA 1W4SA 3CCJA 3I56T 2DETA 1QP2A 3UA7A 2E5KA 5FWBA 2P84A 5I21A 3CPFA 1GCQA 3DB3A 3CCUQ 2O31A 5KYWA 5DLOA 2MPXC 4V2SA 3I9QA 1PD1A 2LC4A 5GMKl 4CC3A 1YI2T 3I55A 3L2VA 3U23A 2WSCE 2RJEA 4MZPA 4LDVA 1KQSA 1IGQA 2DMOA 2DEUA 4QW2A 5HK0A 2GQIA 4FSSA 4Q5WA 3PVLA 1X01A 3FDRA 4D6WA 3CCMA 1AHJB 1VOMA 1VQ9A 2D9TA 5KE3A 1YJNQ 1M1GA 1VIEA 2YRDA 1IREB 3P8HA 4ESRA 1AWWA 1TXQA 1UJYA 1M3BA 1YCYA 3NGPA 3MEAA 4N4IA 1BBZA 1NYFA 4J5YA 1OQKA 3HHTB 4B9WA 3L2QA 1PM3A 4BUGA 1WJQA 1YHQQ 2HNIA 5GAN3 1LJOA 4FIBA 4J9CA 1RAEB 3A8HB 1LNXA 5KYYA 2NWMA 4NOYA 2X9HA 4F04B 1QVGA 2DLPA 2H8HA 3CMAT 2KY9A 2QGFB 4AMCA 4F7UE 1UUEA 4OMOA 4FCYA 4OB2B 4HCKA 2YUPA 3DKMA 4XTYA 4ELYC 4ATOA 5LJ3j 5KYUA 2KRSA 1VQ4A 2XK0A 3UT1A 4C0DC 2GCXA 4CC4B 4GLKA 4DBQA 2DD4A 2L5QA 2ZPHB 3CCUT 1H3ZA 1Z9ZA 4HT9A 2X3XD 2NUZA 3V7SA 1I5LA 2DO3A 5LJ3e 3OS5A 1M1KU 1N27A 2K3BA 3ASKA 3BE3A 2C06A 5CKBA 5IXFA 1R0BG 1WHKA 3FJ5A 5CQXA 3CCET 1RAHB 1C1AA 2PUOB 2M0YA 4MMLA 4PFZA 2XKOC 1FMWA 3CBPA 3LGLA 2RD1A 2RJFA 2XI9A 2PQWA 1YJNT 1WXBA 2JTFA 4JZ4A 4M77C 1VYVA 2QQAA 2RI2A 4HCZA 4XTZA 1MNEA 4QQDA 1MMNA 1BI2A 3OQ5A 3I5RA 4HVVA 1YHQT 5FU7B 2DL3A 1X6BA 2DE0X 3NTHA 4A53A 4TVRA 1WZOA 1DJ7B 1M9SA 3A8LB 5LJ3d 2DERA 2PVOB 1VQPQ 2HD0A 1KD1U 4J6WA 2DXBA 4PNOA 2JM9A 2VVKA 1K73C 3A5ZB 5IHIA 1KQ1A 1WIEA 2X51A 4J9HA 4QQGA 1VQOA 4L5GA 1SSHA 3JV3A 2JOYA 3QUIA 4M78E 3HL8A 1KC8C 1K9MU 1NE8A 3OYLA 1K73R 2JW4A 4JJDA 2QA4Q 2ENMA 4BI3A 3RBBB 4GBQA 3EGDB 4JRQA 5DY9A 3MP8A 2LCCA 3M4YA 4OB1B 3G71T 3RMQA 1KHCA 2QEXQ 4M75E 2KE9A 2Y4XA 1T3SA 3OYGA 3EG9B 3PIPA 2QQBA 4A4GA 2K79A 2Z0WA 3CC7A 2HL3A 3L2WA 3VUBA 4RTWA 2ZPFB 1VQ5A 2YRCA 2RM4A 2XD0A 1D1AA 3FC3A 4MDWA 2BE9B 1J3TA 3M0PA 2RO0A 4DEXA 2EYXA 2HCKA 2XICA 4F7UG 4AFSC 3VUZA 3HRTA 4J6YA 3RKWA 4CI0C 1GRIA 5CKDA 4Z02A 4J9EA 2CP3A 2KRMA 2O01E 3META 4XTVA 1YJ9A 5CKEA 3SEMA 4JJBA 2HAXA 1UFFA 4M78C 2M02A 3GP8A 3CCLQ 1VQPT 3EGUA 3PMTA 3QJ6A 2OJ2A 2X35A 5GANj 4HCCA 4A4EA 2VUBA 1N9SA 3VYHB 1FMKA 1UHCA 4PJNA 2PVGB 1QCFA 1KFZA 2EBPA 3M0UA 4PJOE 2HL5C 4M75C 1MV0B 1VYTA 4OMFB 1JO8A 1YIJQ 4BE0A 3CC2Q 3BY7A 4XU3A 2JM8A 5GMKi 1ARKA 2CZ7B 5GANe 4E47A 2RJCA 3OYNA 2QA4T 4EMKC 1NG2A 1X75C 2ROTA 1YJWA 2VWFA 4A4FA 2PU9B 3MPUB 5I11A 3GBQA 4EMHA 4C0DB 2MWPA 1K8AC 4QVCA 1TUGB 1M27C 3V8LA 5I2SA 1NBEB 4XTWA 2JZ2A 2QQSA 4XK8E 1EFNA 4KGVB 1NYGA 1TG0A 4BDYA 2GQVA 2HSEB 1VQ6A 3JB9F 3MEWA 2RI5A 2RMOA 1KG1A 1YFNA 1VQNT 4ORZA 4JLIA 3C12A 1S1NA 2NYSA 3VS3A 2AKKA
chains in the Genus database with same CATH topology
1YJWT 5FU6B 4BI4A 3M54A 2M1HA 3LH0A 4ELZC 4RKUE 1QVFS 4EMGA 3QYHB 2OTLT 4OP0A 4N0AA 3OSSC 4LDWA 1FWZA 5HK3A 2K3XA 2NLUA 3JCMV 1M90C 2CKKA 4M77F 1UGQB 4PLIA 2EYQA 3E9FA 1G3TA 3E19A 3OYHA 3DLLA 4IUPA 4F7UF 1Q82U 3L2ZA 2BUDA 2P0KA 5LL6S 1V29B 3LGFA 2X4JA 2RA2A 4PJOC 3PFSA 1PSEA 1WQWA 5GMKj 2CGHA 3M56A 2XDPA 4P5NA 4C8QA 3CC2A 3OBYA 4M7AA 4M78A 3G6ET 3QIIA 3QKJA 4C92C 4R56A 3CBOA 2HQXA 4RG2A 2ZPGB 4RMOA 2RK1A 3OA6A 4M77B 4M78G 3LX7A 5CVIA 2E5QA 4M77E 1VIFA 3CPWS 1QVGS 3S3NA 1S72T 3JCMX 3VV0A 4F7UB 3H6ZA 2E1HA 2RJDA 4XTUA 3QSUA 4E7KA 1SSFA 3M59A 2E10A 3OMCA 3QJYA 3CD6A 1WQ7A 1IZ6A 5GANg 5GMKe 1UGSB 5GAOq 2ZPEB 4XU0A 1VQLA 3CCRA 1XOVA 4HCBA 2RHYA 3L2UA 3LW5E 5GAOp 4DQ2A 1TH7A 2LRQA 3G4SA 4YTLA 3JAME 2LVMA 2DJZA 4E7HA 4OGEA 3SDZA 1Q82C 1YIJT 2R57A 2DXCA 4M75G 4VUBA 4LD9K 4QVZA 2MAMA 4IUQA 4MDXA 3I56A 3CC2T 3FEOA 3PNWC 1MGQA 4JRIA 4Y91A 3KUFA 3BDUA 5C0MA 4WF2A 5FROA 3J80E 1M4ZA 2LNVA 2R58A 5FRNA 4X34A 3PT9A 4IUTA 4C8QC 3F70A 5CKFA 1M5Q1 3AHUA 4M7AC 3CCSA 2X4YA 2Y90A 3CD6T 4C0GA 4JJNK 5GAN4 1QW1A 4BACA 4FM4B 1I8FA 2QQRA 2E12A 4BY6C 2GFAA 3CCRT 3M55A 4M7DF 4J7FA 2GFUA 1WJRA 2LCLA 2ZPIB 3OS1A 3SB2A 3G4ST 4E7JA 1VQ4T 1YI2A 3BFMA 1W4SA 1UGRB 2ZCFB 1BIBA 3RKXA 3QDRB 4O5VA 5D6XA 4QVDA 3I56T 2QEXA 4BE1A 4XU1A 3HFNA 1QP2A 4OF1A 1I4K1 5A0DA 5GAOl 5CCAA 3OYFA 2DZ9A 5I21A 4BD3A 3C95A 4M7DB 1R8OB 3BDLA 3C4SA 3CPFA 2YRVA 3DB3A 3T9NA 4ZGDB 3CCST 4C5GA 4E7IA 4ZGEB 3FIFA 3JCMJ 3V8JA 5DLOA 4LDXA 3OYCA 3KBGA 5HY6A 4V2SA 3CC4A 2L89A 3FRNA 2DTHA 2LC4A 2OTJT 5GMKl 2I2LA 1N9RA 3L1AA 2LT4A 1Y96A 2JVVA 4KULA 5C6SA 2MF2A 4BE2A 1YI2T 1LOJA 4UC4A 3I55A 4J8OA 3LWHA 4XU2A 3L2VA 2OTLA 3M9QA 4II1A 2QEXT 1VQ8T 2WSCE 3L42A 2M9UA 2RJEA 4KT0E 4MZPA 2H3JA 3INZA 3OYBA 5FLXE 3OYAA 3TU4K 4LDVA 1KQSA 3GF5A 2X4XA 4QW2A 1KQ2A 4PJOG 3WXMB 3E1SA 4OB3B 2M16A 4CRIA 2EQMA 3OYMA 1YITA 5HK0A 1Y71A 2M0OA 3GNFB 4FL6A 1WPYA 4Q5WA 4LDUA 3QO3A 1X01A 3FDRA 4KUIA 4D6WA 5KCHA 4C92G 4C0ZA 3CCMA 1AHJB 2XDBA 2EQUA 2EQKA 2KVQG 2KMTA 2MWOA 1VQ9A 2D9TA 2DEQA 3G6EA 4A4KA 4OVAA 5GAN7 4JS5A 2F5TX 2CZ0B 2K5FA 3EAEA 1O9SA 1G3SA 1HXDA 5KE3A 4ZTFA 1QVFA 2YLCA 3X20B 3CCLA 3FJPA 1M1GA 2P4TA 1VIEA 1IREB 2AHJB 1WJSA 2DZCA 3I55T 3CMAA 3MHXA 3P8HA 1S72A 3QXEB 2KQWA 1YCYA 2DD5A 4GY5A 3MEAA 3OS0A 4N4IA 1VUBA 1XNIA 4J5YA 4FU6A 3HHTB 3ZFJA 2RB6A 3UDCA 4B9WA 3L2QA 5AYFA 4BUGA 5GANd 1WJQA 5J26A 3L2RA 1N8RU 3FLGA 3SWNA 4M75F 5DM7R 1YITT 1D3BB 2VXFA 3O8VA 4OGCA 2CZ1B 2G3RA 2HNIA 5GANf 3J7AF 5GAN3 3CCMT 1LJOA 3GOXA 1YIJA 4FIBA 2F69A 3OW2S 1VQ9T 2O4XB 3A8HB 1LNXA 1QP3A 2KK4A 2CZ6B 2K2VA 2VGNA 4C8QG 3CXCS 3CCUA 4M7AG 4NOYA 3CCLT 1UGPB 5CR2A 2E6NA 3CPWA 2QI2A 1QVGA 1GXIE 3PTAA 5D6YA 5GMKh 3CMAT 3RIRA 2KY9A 5J3BA 4M75B 2DTOA 1ZHIA 1U1TA 3M5AA 5IT9E 4F7UE 2LX9A 3CMEA 1XQHA 4N4HA 1P92A 4OB2B 3Q1JA 5GAMj 3WVEB 3DKMA 4XTYA 3V7CA 2E65A 2EJFA 4C0FA 1KHIA 3GIBA 3OYDA 2EAYA 4ELYC 4ATOA 3MCAB 4JRKA 5LJ3j 2DAQA 2E6ZA 1N8RC 2XU8A 1VQ4A 1Q81U 2XK0A 2B8AA 3UT1A 3A8OB 3VKIA 2GCXA 4C0DC 4EMKB 4GLKA 5LJ5j 3CCEA 4PL6A 4NL3A 2WSFE 2FYKA 3M4GA 3HKSA 3SWNC 3MO8A 2DD4A 2L5QA 3QPHA 1B34B 3QZ5B 4FSXA 1RL2A 2ZPHB 3OY9A 3CCUT 2V8KA 1H3ZA 4KBMB 4A54A 4HT9A 1G3WA 3X24B 4J6XA 4M7DD 2V8JA 5GAMe 3V7SA 4M77A 3S6WA 2LQ8A 3M53A 3JCMe 2RK2A 1Q86U 2RHIA 5CK9A 1I5LA 2DO3A 3CMET 4BI8B 3OYJA 5LJ3e 4M77G 2LDMA 2FVUA 1N27A 3OS5A 2VGMA 3PGGA 4F7UA 2RH2A 3HFOA 3ASKA 5A0LA 4XTXA 2OTJA 4C5IA 1MHNA 5LJ5e 5CO7A 5FU6C 1M1KU 1NZ9A 1ZBXA 3V8KA 1BKBA 5FRMA 2C06A 5CKBA 2YLBA 4HKEA 3JRZA 4DOVA 3URGA 2QTXA 4X9DA 3CC7T 3RKYA 1BI0A 5CQXA 2K3YA 1JJ2S 3WVDB 4FT4A 5CAIA 3CCET 1VQ8A 4PJOF 3GNGA 3LWIA 1Q81C 1VQ5T 3HSBA 2CYZB 2PUOB 5GAOm 4ZGJB 5GANh 4IURA 3RERA 3FB9A 4QQ6A 4MMLA 2BIVA 2DIQA 3NFCA 2XKOC 2EIFA 4C92F 3SD4A 4N4GA 3CBPA 2R5MA 2ZGWA 3LGLA 2RD1A 2JNGA 1BIAA 4M7DE 2RJFA 2XI9A 4BDZA 2PQWA 2EJ9A 1YJNT 2ZPBB 1K73U 3CEYA 4PLLA 2JTFA 3P8BB 1Q86C 3QHSA 3ER0A 5GMKm 2XG8D 4JUVA 1Q7YU 4M77C 1M1KC 3OYEA 2CS7A 4PJOB 3JB9H 2QQAA 2RI2A 4MZTA 1JB0E 4HCZA 4XQ3A 4XTZA 2IG0A 4HA8A 1M1FA 3QYGB 1QVPA 4QQDA 4C92B 4EDUA 5KH6A 3JB9J 1BI2A 3OQ5A 5KCOA 3OMGA 4LDYA 3PIOA 1YHQT 5FU7B 1YJ9T 1W2BS 1NJIU 2HQEA 3BW1A 5GAMd 2DPPB 4JLGA 3CBMA 3NTHA 4M78D 4A53A 4TVRA 1KC8U 4BB7A 1OYXA 3JCMd 3UPUA 2JN0A 5GAMf 1DJ7B 1M9SA 2RHZA 3A8LB 5LJ3d 2DKGA 2XDDA 2PVOB 3JCMf 4M7DA 5LJ5d 2P0QA 2HD0A 4C8QF 5LJ3f 4J6WA 1KD1U 2DXBA 3LLRA 4PNOA 2A7YA 4M7AF 5KE2A 4M78F 2MI6A 4LD6A 1U8RA 4C5HA 1K73C 5LJ5f 3A5ZB 4Y28E 2JUFA 4KUDK 1XTDA 1BI3A 4DOWA 1G3YA 2QQ9A 5D6WA 1H641 1KQ1A 1Q7YC 3JSCA 4M75D 3G71A 1VQMT 2P0PA 2EKOA 5GAMg 2PUKB 3HPWA 2VXEA 3CCVA 1JBMA 1RI0A 2RI3A 4QQGA 3JCMg 1VQOA 1FX7A 4L5GA 4C8QB 4L59A 4DA4A 1NJIC 4M7AB 5LJ3g 4M78B 2JOYA 3QUIA 4IUVA 2DTIA 2EFIA 2LTOA 2ZZDA 3HL8A 4M78E 3CCJA 1KC8C 4RCBA 5LJ5g 3DLMA 5CIUA 1K9MU 3OW2A 4BY6B 1NE8A 2DK3A 2DXUA 2IVWA 1PSFA 4IUUA 3ZEHA 5GAN8 3OYLA 4L6V5 1NPRA 1EIFA 2KDSA 5GAOn 2LT1A 3CXCA 4IKFA 1KD1C 2VV5A 3JB9I 4BI3A 2K57A 4X9CA 4XAXB 4JRQA 4M7DC 4ZTJA 5DY9A 3MP8A 3KXTA 1UB4A 2LCCA 3M4YA 3MEUA 4OB1B 2RHUA 4RCCA 3RMQA 4OB0B 5M9OA 2EQJA 3G71T 5GAOr 1KHCA 3OB9A 4M75E 1G5VA 3CCVT 1VQOT 2VC8A 3QBYA 2Y4XA 2EWNA 1HK9A 2OAUA 2FHDA 3NTKA 3OYGA 3VU3C 5GAN5 3LYIA 3PIPA 2QQBA 4A4GA 3RUXA 1VQ6T 1BI1A 2L3RA 2A3LA 5GAN6 4JDSA 5A0GA 3CCQA 4O6JA 4J7IA 3CC7A 3DB4A 1WNLA 1D3BA 2L8DA 1YBYA 3OSVA 3EFRA 3L2WA 5CKHA 5FU7C 3VUBA 3JB9G 5GAMh 5EG2A 5A2QE 1K9MC 4ME7A 2ZPFB 1VQ5A 2O4XA 4R55A 5I2MA 3JCMh 4ZN3A 5IAYA 2RM4A 3RMSA 2E70A 5LJ3h 2FB7A 1VQPA 2XD0A 3MP1A 3OS2A 4HT8A 4ZN1A 3A8GB 1VQKA 5LJ5h 3GPLA 2F5KA 3FC3A 4MDWA 1YJNA 2XIDA 3M57A 4N0AC 5IN1A 4M75A 2HBPA 2RO0A 3M58A 5GAN2 3ME9A 2WSEE 2XHCA 4PJOD 2XICA 4F7UG 3JCMP 3HRSA 3X25B 3VUZA 3EFSA 1JRIA 3HRTA 4J6YA 3RKWA 4C92D 2K5IA 4CI0C 3CCQT 1JJ2A 5CKDA 4Z02A 1Y07A 2V8IA 3OYYA 2O01E 3META 4XTVA 4EMKA 5CKEA 2DVEA 1YJ9A 1YHQA 2HAXA 4A4HA 4M78C 2Y4YA 2X4WA 3MEVA 3TEEA 3VYGA 3GP8A 1B34A 1VQPT 3TCJA 3PMTA 1VQKT 1Y96B 2K5LA 3N5BB 2KSSA 1VQLT 3QJ6A 2QA4A 4JRPA 2X35A 2WACA 1Y7XA 5GANj 4HCCA 2VYTA 4JS4A 4FT2A 4A4EA 2VUBA 1N9SA 2PVDB 4J83A 3VYHB 2PVGB 3JCMc 2K4YA 3R6OA 1K8AU 2GF7A 1OI1A 5DLQE 2QXFA 4PJOE 3SFMA 3QG1A 1VQ7A 4M75C 4OMFB 3TREA 1U1SA 3H8ZA 3MP6A 3S3OA 4RG8A 1VQMA 1OZ3A 5CQYA 4C92E 4BE0A 1W2BA 3BY7A 4XU3A 3RESA 2D0QB 4C8QD 5GMKi 1O75A 2BKDN 2KAFA 3NTIA 2CZ7B 4M7AD 5GANe 1M8VA 1BYMA 4E47A 3JCMQ 2QDYB 3X26B 4MMKA 3J81E 3OYKA 2RJCA 4C5EA 3JCMW 3OYNA 3VJPA 3GLXA 4EMKC 2QA4T 5J39A 2DXTA 1N6AA 1VQNA 2LQKA 1NPPA 1X75C 1YJWA 1I81A 2YHTA 4A4FA 4B9XA 2PU9B 1WGSA 4E7LA 4PKCC 4EPCA 4M7DG 1FXXA 2MMPA 3HP9A 1M90U 3CCJT 3A8MB 3X28B 3JCMb 2RHXA 4EMHA 4C0DB 2MWPA 1X6OA 1VQ7T 4PJOA 2JTMA 1K8AC 3UWNA 4QVCA 5HKCA 3JB9D 2D6FA 3V8LA 3SWNB 1OZ2A 4XTWA 2JZ2A 5I2SA 2QQSA 3QZ9B 3ZBDA 3PMIA 4XK8E 1KQSS 3V7RA 4C92A 2E41A 4NS5A 2R5AA 3G7ZA 2E64A 3E9GA 5L8RE 2DIGA 4BDYA 3C94A 3S3MA 4C8QE 2GQVA 1ZQ1A 2FL7A 3CC4T 4M7AE 3JB9F 3OBWA 1VQ6A 4NL2A 2EJGA 1UEBA 2RI5A 3MEWA 1KG1A 1VQNT 4JLIA 3C12A 4M77D 3OYIA 3HRUA 4MZMA 3P8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JB9 G;  1LOJ A;  4EMG A;  5CAI A;  5GAM h;  4XU2 A;  4OP0 A;  4PJO F;  4N0A A;  3JCM h;  3HSB A;  2RM4 A;  5GAO m;  5GAN h;  3RER A;  3JCM V;  3FB9 A;  3INZ A;  4MML A;  5LJ3 h;  2FB7 A;  4M77 F;  4C92 F;  4HT8 A;  1KQ2 A;  4PJO G;  5LJ5 h;  2ZGW A;  2RD1 A;  1BIA A;  4F7U F;  4M7D E;  3L2Z A;  4N0A C;  1WPY A;  2EJ9 A;  4M75 A;  3QO3 A;  1X01 A;  5GAN 2;  2RA2 A;  4C92 G;  4PJO C;  1WQW A;  5GMK j;  2CGH A;  4PJO D;  3QHS A;  5GMK m;  4C8Q A;  4JUV A;  4F7U G;  3JCM P;  4M77 C;  2DEQ A;  4M7A A;  5GAN 7;  4M78 A;  4PJO B;  4C92 C;  2QTX A;  1JRI A;  3EFS A;  1HXD A;  4J6Y A;  3RKW A;  4C92 D;  3JB9 H;  2YLC A;  4XTZ A;  4XQ3 A;  3FJP A;  1D3B A;  4M77 B;  4M78 G;  4HA8 A;  2DZC A;  4C92 B;  4M77 E;  3JB9 J;  4XTV A;  4EMK A;  2DVE A;  3JCM X;  4F7U B;  2E1H A;  1YCY A;  3BW1 A;  4M78 C;  4XTU A;  5GAM d;  3QSU A;  2E10 A;  4M78 D;  4A53 A;  1B34 A;  4J5Y A;  1WQ7 A;  3JCM d;  2RB6 A;  5GMK e;  5GAN g;  5GAO q;  2JN0 A;  4XU0 A;  5GAN d;  5GAM f;  1Y96 B;  3SWN A;  5LJ3 d;  4M75 F;  2DKG A;  1D3B B;  2VXF A;  3JCM f;  5GAO p;  5GAN j;  4DQ2 A;  2HNI A;  1TH7 A;  5GAN f;  5LJ5 d;  4M7D A;  5GAN 3;  4C8Q F;  5LJ3 f;  4J6W A;  1N9S A;  1LJO A;  2DJZ A;  4PNO A;  4M7A F;  4M78 F;  4M75 G;  3JCM c;  1LNX A;  5LJ5 f;  1MGQ A;  4JRI A;  4PJO E;  4C8Q G;  1H64 1;  4M75 C;  1KQ1 A;  4NOY A;  4Y91 A;  3BDU A;  4M7A G;  4WF2 A;  4M75 D;  1U1S A;  5GMK h;  4C92 E;  3RIR A;  4C8Q C;  3BY7 A;  4XU3 A;  3AHU A;  1M5Q 1;  4M75 B;  2DTO A;  3RES A;  4C8Q D;  1U1T A;  5GMK i;  5GAM g;  2VXE A;  4M7A C;  1JBM A;  4M7A D;  2Y90 A;  4F7U E;  1M8V A;  5GAN e;  3JCM g;  3JCM Q;  4C8Q B;  5GAN 4;  5GAM j;  4MMK A;  4XTY A;  3V7C A;  4M7A B;  2E65 A;  1I8F A;  2EJF A;  4M78 B;  5LJ3 g;  3JCM W;  3QUI A;  3GIB A;  2DTI A;  4M78 E;  4M7D F;  4EMK C;  2EAY A;  2DXT A;  4RCB A;  5LJ5 g;  4JRK A;  5LJ3 j;  3SB2 A;  1I81 A;  2DXU A;  2YHT A;  5GAN 8;  4EMK B;  5LJ5 j;  4M7D G;  3BFM A;  5GAO n;  4NL3 A;  1BIB A;  3RKX A;  2FYK A;  3M4G A;  4QVD A;  3SWN C;  3JB9 I;  4XU1 A;  4EMH A;  3HFN A;  1B34 B;  3JCM b;  2K57 A;  4X9C A;  1I4K 1;  4M7D C;  4PJO A;  5DY9 A;  5GAO l;  4A54 A;  4QVC A;  3JB9 D;  4HT9 A;  4J6X A;  3V8L A;  3SWN B;  4M7D D;  4XTW A;  5GAM e;  2DZ9 A;  5I21 A;  3V7S A;  4RCC A;  4M77 A;  5GAO r;  3V7R A;  4C92 A;  4M7D B;  2E41 A;  3JCM e;  4M75 E;  3JCM J;  1I5L A;  2E64 A;  3FIF A;  5LJ3 e;  4M77 G;  2VC8 A;  3PGG A;  3V8J A;  4F7U A;  2EWN A;  3HFO A;  4C8Q E;  1HK9 A;  4XTX A;  4V2S A;  4M7A E;  5LJ5 e;  2DTH A;  3VU3 C;  5GAN 5;  3JB9 F;  4NL2 A;  2EJG A;  5GMK l;  2I2L A;  1N9R A;  3L1A A;  3RUX A;  3V8K A;  1Y96 A;  2YLB A;  5GAN 6;  4JLI A;  4M77 D;  1WNL A;  4X9D A;  3RKY A;  3EFR A; 
#chains in the Genus database with same CATH topology
 1AOJ A;  1KK7 A;  1QVF S;  1WLP B;  4ELZ C;  3HTR A;  2KI7 A;  1U06 A;  3QYH B;  2JMA A;  1Q7Y R;  3JCM V;  1K8A R;  2CKK A;  1UGQ B;  2W0Z A;  1VQ8 Q;  2D8H A;  2P0K A;  1V29 B;  1NJI R;  2RA2 A;  4PJO C;  3PFS A;  1QVF P;  5FW9 A;  4P5N A;  1UHF A;  4RG2 A;  2ZPG B;  1U3O A;  2RK1 A;  4M77 B;  4M78 G;  3LX7 A;  1KIK A;  4F7U B;  2CP0 A;  2RJD A;  3CD6 A;  3EGD A;  2K6D A;  1VQL A;  1OX8 A;  3L2U A;  3TVT A;  1TH7 A;  2LRQ A;  4CC2 A;  4E7H A;  1Q82 C;  2BZY A;  2R57 A;  1QKW A;  4M75 G;  4D8D A;  1YIJ T;  4MDX A;  4QVZ A;  4IUQ A;  1QKX A;  3I56 A;  3CC2 T;  1HD3 A;  1MMD A;  3EG9 A;  3EHQ A;  2C0T A;  1QWE A;  5FWC A;  4WF2 A;  2ED0 A;  4EIK A;  3AHU A;  4J9B A;  4C0G A;  4F14 A;  4LE9 A;  5GAN 4;  2CDT A;  2RQR A;  4JJC A;  4FM4 B;  1RAI B;  2LCS A;  4J7F A;  1WJR A;  3CCV Q;  3OS1 A;  3G4S T;  1SHF A;  1TS9 A;  1YI2 A;  2ZCF B;  2V26 A;  3QDR B;  4BE1 A;  3HFN A;  4OF1 A;  1RI9 A;  1I4K 1;  1X2K A;  5CCA A;  4BD3 A;  3C95 A;  3T9N A;  3JCM J;  1I5O B;  4ZGE B;  3V8J A;  3KBG A;  1X6G A;  4HVU A;  8AT1 B;  2LT4 A;  2QAZ A;  4KUL A;  4OML A;  3CME Q;  2MF2 A;  1CSK A;  1K4U S;  1LOJ A;  4UC4 A;  2OTL A;  4XU2 A;  4II1 A;  1VQ8 T;  3L42 A;  2M9U A;  2FZK B;  2H3J A;  2MOX A;  3OYB A;  5FLX E;  3OYA A;  2LQW A;  3TU4 K;  1WFW A;  2X4X A;  1KQ2 A;  4PJO G;  3EH1 A;  3WXM B;  2COY A;  2M16 A;  2EQM A;  2M0O A;  3GNF B;  3QO3 A;  2EQK A;  4JZ3 A;  2KMT A;  3EFO B;  1VQK Q;  2CUD A;  3G6E A;  4OVA A;  2F5T X;  1G3S A;  1QVF A;  4ZTF A;  2MCN A;  4Y92 A;  2AHJ B;  1G2B A;  3CMA A;  3MHX A;  1S72 A;  2G6F X;  1EX4 A;  2H3E B;  3VS4 A;  4GY5 A;  1VUB A;  1JXM A;  1WDX A;  2YUQ A;  1N8R U;  2CP7 A;  1YIT T;  1X27 A;  4OGC A;  1SF9 A;  3J7A F;  4PK4 A;  3GOX A;  2LJ1 A;  1AWJ A;  1GFC A;  4CC7 A;  2CZ6 B;  2F2W A;  3CCU A;  1B07 A;  1UGP B;  5CR2 A;  5GMK h;  1K9A A;  2SRC A;  4M75 B;  5IT9 E;  1M90 R;  1OU9 A;  3D7S B;  1MMA A;  2FRW A;  2BTT A;  5GAM j;  3WVE B;  2EJF A;  4IIO A;  1KHI A;  3GIB A;  3MCA B;  4Z88 A;  2E6Z A;  2BZ8 A;  4EMK B;  3CCE A;  5LJ5 j;  1YN8 A;  4PL6 A;  4NL3 A;  1NLP C;  3SWN C;  2EYY A;  2YT6 A;  3MO8 A;  2YUN A;  3OY9 A;  2V8K A;  4J6X A;  2V8J A;  1R0C B;  5GAM e;  4M77 A;  1BK2 A;  2RK2 A;  5KYX B;  3CME T;  4BI8 B;  3OYJ A;  1T3L A;  2FVU A;  4F7U A;  2DL8 A;  2OTJ A;  5LJ5 e;  1ZBX A;  1BKB A;  4HKE A;  3JRZ A;  4DOV A;  2A0F B;  1AD5 A;  1BI0 A;  2EQI A;  1W1F A;  2K3Y A;  3WVD B;  1RLQ C;  1RUW A;  1Q81 C;  3HSB A;  2CYZ B;  3H0F A;  3RER A;  3VS7 A;  3REA B;  2BIV A;  1H8K A;  2EIF A;  1YNZ A;  2E4H A;  2VKN A;  1BCM A;  1BIA A;  1D0X A;  4M7D E;  4BDZ A;  3UAT A;  3CEY A;  4PLL A;  3P8B B;  1Q86 C;  3QHS A;  1Q7Y U;  3VS1 A;  4PJO B;  1SRL A;  4MZT A;  2IG0 A;  4Z8A A;  1M1F A;  4EDU A;  5KH6 A;  4M4Z A;  3OMG A;  3PIO A;  1NJI U;  2OAW A;  1BCO A;  3EG3 A;  3CCQ Q;  2HQE A;  1W2B S;  3BW1 A;  5GAM d;  4JLG A;  3CBM A;  4M78 D;  1OYX A;  3UPU A;  2ROL A;  5LJ5 d;  2P0Q A;  5LJ3 f;  3LLR A;  4LN2 A;  4C5H A;  2FG0 A;  4Y28 E;  1W2B P;  1G3Y A;  1WI7 A;  4M75 D;  3G71 A;  2GGR A;  2PUK B;  3HPW A;  3UA6 A;  1JBM A;  1LPL A;  1SRM A;  2RQT A;  4L59 A;  4R0K A;  5LJ3 g;  2DTI A;  2EFI A;  2LTO A;  3CCS Q;  5CIU A;  2RN8 A;  2DK3 A;  1H92 A;  5GAO n;  2LT1 A;  2CT4 A;  1HSQ A;  3EFO A;  2AK5 A;  4X9C A;  4M7D C;  2DYB A;  1U5S A;  4ZTJ A;  1AZE A;  2DX1 A;  3I5S A;  2RHU A;  3CCJ Q;  2EQJ A;  1ACM B;  1PKS A;  2YWW A;  3OB9 A;  1VQ7 Q;  2DBM A;  3QBY A;  2OAU A;  2RQV A;  2FHD A;  3H0I A;  1ABQ A;  5GAN 5;  2K9G A;  2L3R A;  2PZ1 A;  4O6J A;  3DB4 A;  1WNL A;  4F17 A;  2QTV A;  1D1B A;  1PG5 B;  4FYW B;  4ME7 A;  1GFD A;  5I2M A;  5IAY A;  5LJ3 h;  1VQP A;  2F1L A;  1SHG A;  4ZN1 A;  4E7S A;  3GPL A;  2JS0 A;  2F5K A;  3VRY A;  3M57 A;  4M75 A;  2AIR B;  2HBP A;  1RAF B;  2GBQ A;  4PJO D;  3HRS A;  3CCQ T;  2L3Q A;  2C0O A;  2K5I A;  1AVZ C;  2J05 A;  1Y07 A;  3OYY A;  4EMK A;  2Y4Y A;  2DRM A;  2JXB A;  4E2F B;  4PJL A;  3TCJ A;  5GJV B;  1AEY A;  2QA4 A;  2D1X A;  2WAC A;  2ED1 A;  2VYT A;  4FT2 A;  5KYX A;  3RDV A;  2PVD B;  4J83 A;  2K4Y A;  1OI1 A;  5DLQ E;  4RTV A;  4PFO A;  2FRY A;  2O88 A;  2K2M A;  1TU0 B;  1CKA A;  1VQM A;  4C92 E;  1W2B A;  4DBR A;  1M8V A;  1TUC A;  5AT1 B;  3G1J A;  3JCM Q;  1BB9 A;  2QDY B;  3PVQ A;  3X26 B;  2KYB A;  2ECZ A;  4C5E A;  3JCM W;  1I07 A;  1RAA B;  2VAS A;  5J39 A;  1N6A A;  2ABL A;  1VQN A;  2OI3 A;  5D7U A;  2J6K A;  1I81 A;  2BE7 D;  4E7L A;  4PKC C;  4M7D G;  1ABO A;  2MMP A;  1M90 U;  3EG1 A;  3CCJ T;  2KEA A;  2RHX A;  1F1B B;  1X6O A;  1VQ7 T;  4PJO A;  2JTM A;  1VQ4 Q;  5HKC A;  2D6F A;  1NLO C;  3SWN B;  1OZ2 A;  2QYZ A;  4ANJ A;  3E9G A;  3THK A;  4C8Q E;  4M7A E;  4NL2 A;  2EJG A;  4Z89 A;  3HRU A;  3P8D A;  1OV3 A;  4J9I A;  2DJQ A;  4OP0 A;  4N0A A;  1H3H A;  1OPL A;  5HK3 A;  1ZX6 A;  4M77 F;  4PLI A;  2M51 A;  3OYH A;  4IUP A;  1OU8 A;  4F7U F;  2BUD A;  1KJW A;  3LGF A;  2X4J A;  3NHN A;  1PSE A;  2HQH A;  1V1C A;  1KC8 R;  1OUL A;  3CC2 A;  4C92 C;  1PCX A;  4R56 A;  4RMO A;  1ZA1 B;  5CVI A;  4B6M A;  1VIF A;  2PNI A;  5KYN A;  3H6Z A;  4E7K A;  1SSF A;  3M59 A;  2E10 A;  3QJY A;  5GJW B;  1WQ7 A;  1IZ6 A;  5GAN g;  1UGS B;  1IB8 A;  2ZPE B;  4XU0 A;  3OW2 P;  1D1C A;  3EG2 A;  4DQ2 A;  3G4S A;  1WYX A;  3JAM E;  1BU1 A;  1UGV A;  4VUB A;  2MAM A;  1QCO A;  4LNP A;  2O9S A;  4Y91 A;  3VS5 A;  3BDU A;  5C0M A;  5FRN A;  3PT9 A;  4C8Q C;  3F70 A;  4M7A C;  1RAD B;  1M3C A;  4E6R A;  1QW1 A;  2OX7 A;  2LJ3 A;  2QQR A;  2E12 A;  2LCL A;  2ZPI B;  2HZY A;  2CH4 W;  1VQ4 T;  3BFM A;  3RKX A;  4O5V A;  4QVD A;  1WX6 A;  1M8M A;  2AKL A;  1ZUU A;  4M7D B;  1R8O B;  3H0H A;  3BDL A;  2YRV A;  2ESW A;  4LDX A;  2KNB B;  4PJJ A;  5HY6 A;  3OYC A;  3CC4 A;  2L89 A;  1JJ2 P;  2QK0 A;  2I2L A;  1PNJ A;  4J9D A;  1OX9 A;  4J8O A;  3LWH A;  3M9Q A;  2QEX T;  1ZA2 B;  3CC7 Q;  1X69 A;  3INZ A;  3GF5 A;  2LJ0 A;  3O5Z A;  4KGX B;  4OB3 B;  4CRI A;  1YIT A;  1VQ5 Q;  6AT1 B;  2RQW A;  1WPY A;  1W6X A;  4KUI A;  4C92 G;  1RAC B;  5EC7 A;  4DBF A;  2EQU A;  2KVQ G;  2MWO A;  2LP5 A;  4JS5 A;  5GAN 7;  2CZ0 B;  2K5F A;  4QKU A;  2HKQ B;  2P4T A;  2DZC A;  1WHL A;  2CSQ A;  4WTO B;  2KQW A;  2DD5 A;  4FU6 A;  3ZFJ A;  5AYF A;  2V1Q A;  5GAN d;  3L2R A;  3SWN A;  4M75 F;  1YJ9 Q;  5IH2 A;  2VXF A;  2CZ1 B;  2ZAE A;  2F69 A;  1QP3 A;  1IGU A;  2KK4 A;  2RPN A;  4KH1 B;  2K2V A;  4C8Q G;  2VGN A;  3CXC S;  2A08 A;  4M7A G;  3CCL T;  2QI2 A;  1GXI E;  3PTA A;  5D6Y A;  2XMF A;  2DTO A;  1ZHI A;  3CME A;  1X43 A;  4AFU C;  1XQH A;  4N4H A;  1P92 A;  2FPF A;  2I0N A;  3Q1J A;  3V7C A;  4C0F A;  3OYD A;  1B3Q A;  2EGC A;  2LNH B;  4JRK A;  3CXC P;  1SEM A;  2XU8 A;  4LUE A;  1WHH A;  2B8A A;  3A8O B;  2EPD A;  2FYK A;  3M4G A;  3RNJ A;  1B34 B;  3QZ5 B;  4A54 A;  4PFP A;  3X24 B;  1YJW Q;  7AT1 B;  4M7D D;  3C0C A;  3S6W A;  2LQ8 A;  2GNC A;  3M53 A;  3JCM e;  2RHI A;  5CK9 A;  1FMV A;  3PGG A;  2LDM A;  2VGM A;  1PWT A;  2RH2 A;  3VRZ A;  1NZ9 A;  4OMQ A;  3URG A;  4FYX B;  4X9D A;  3CC7 T;  2L2P A;  3RKY A;  1Q82 R;  1M2O A;  5CAI A;  1VQ6 Q;  4PJO F;  1VQ5 T;  5GAO m;  3LH5 A;  3TQ7 P;  4ZGJ B;  1UTI A;  2CSI A;  4QQ6 A;  3NFC A;  2B86 A;  3SD4 A;  3VS0 A;  4RTT A;  3EH2 A;  2JNG A;  2NUP B;  1K73 U;  2ZPB B;  3ER0 A;  1T0J A;  2XG8 D;  4JUV A;  4RTZ A;  2YSQ A;  1M1K C;  3OYE A;  2CS7 A;  2ATC B;  3JB9 H;  1VYU A;  4HA8 A;  1YWP A;  3QYG B;  1QVP A;  4C92 B;  3JB9 J;  1MV3 A;  5KCO A;  4LDY A;  1YJ9 T;  5IHN A;  2DPP B;  3NMZ C;  1KC8 U;  2L0A A;  1TUD A;  4BB7 A;  3JCM d;  2CRE A;  1ZSG A;  2EYZ A;  2JN0 A;  5GAM f;  2BZX A;  2DL7 A;  2DKG A;  3QWY A;  2XDD A;  4M7D A;  2KGT A;  2MIO A;  2A7Y A;  2MI6 A;  4LD6 A;  1U8R A;  1M1K R;  1VQL Q;  5LJ5 f;  2JUF A;  4DOW A;  4ZNX A;  1H64 1;  3JSC A;  4FYV B;  5GAM g;  2RI3 A;  2KXC A;  1FX7 A;  4C8Q B;  4DA4 A;  4M7A B;  4M78 B;  2AZV A;  1PKT A;  1VA7 A;  4IUV A;  1QLY A;  3A1P A;  5LJ5 g;  2GTJ A;  2DXU A;  2IVW A;  5GAN 8;  1ZSZ C;  4L6V 5;  1EIF A;  2EGE A;  4K11 A;  3CXC A;  1KD1 C;  2VV5 A;  3JB9 I;  2K57 A;  3PE0 A;  1LVK A;  1UB4 A;  1YI2 Q;  3EHR A;  3MEU A;  2HSP A;  4RCC A;  4OB0 B;  5M9O A;  5GAO r;  5IXB A;  1G5V A;  3CCV T;  2CP5 A;  2O2O A;  3MJX A;  3RUX A;  1VQ6 T;  1BI1 A;  2A3L A;  5GAN 6;  4JDS A;  5A0G A;  3CCQ A;  1Q95 G;  1W70 A;  3EFR A;  5CKH A;  5FU7 C;  5GAM h;  1K9M C;  2P4R A;  2L3S A;  1UE9 A;  3M0S A;  4ZN3 A;  1ZBJ A;  1E6G A;  2E70 A;  1YP5 A;  1D0Y A;  3MP1 A;  3OS2 A;  4HT8 A;  4E7Z A;  1N5Z A;  3A8G B;  2OTL Q;  5LJ5 h;  5ECA A;  1IRX A;  1YJN A;  2XID A;  8ATC B;  2QDL A;  5GAN 2;  3JCM P;  3X25 B;  1QVG P;  1JRI A;  1IXD A;  4C92 D;  1WHJ A;  2V8I A;  4J9F A;  1K9M R;  2IIM A;  2KBT A;  4LUD A;  2DVE A;  3G6E Q;  1YHQ A;  3MEV A;  3TEE A;  3VYG A;  1B34 A;  3CMA Q;  1VQK T;  1Y96 B;  2K5L A;  1S72 Q;  2KSS A;  1VQL T;  4JPB W;  4JRP A;  2CT3 A;  3JCM c;  1I1J A;  1K8A U;  2GF7 A;  2QXF A;  3QDF A;  3SFM A;  3QG1 A;  1VQ7 A;  1GL5 A;  3TRE A;  3H8Z A;  1YCS B;  3MP6 A;  3S3O A;  4RG8 A;  1Q81 R;  1JQQ A;  2KR3 A;  3QWX X;  4C8Q D;  1O75 A;  2KAF A;  4M7A D;  1IO6 A;  1M3A A;  2DYI A;  3OYK A;  2HBW A;  2KT1 A;  3VJP A;  3GLX A;  1E7O A;  3MKD A;  1NPP A;  1Q86 R;  2FO0 A;  2NUP A;  1WGS A;  3CCR Q;  3A8M B;  3X28 B;  4A63 B;  3JB9 D;  4RTU A;  3CCE Q;  3QZ9 B;  4C92 A;  2R5A A;  3G7Z A;  2E64 A;  3R6N A;  2DIG A;  4OMM A;  1NM7 A;  2DIL A;  2COZ A;  4RTX A;  3M54 A;  2OTJ Q;  1C6V X;  2OTL T;  3OSS C;  4LDW A;  3VS6 A;  1HJD A;  2K3X A;  2NLU A;  4LXC A;  1E6H A;  3E9F A;  1G3T A;  2E3H A;  3E19 A;  2DBK A;  3DLL A;  2K7A A;  5IHK A;  1Q82 U;  2CGH A;  4C8Q A;  4M7A A;  3OBY A;  4M78 A;  3G6E T;  3QII A;  1V76 A;  1KSW A;  1B7T A;  3CBO A;  2HQX A;  2RNA A;  4M77 E;  3CPW S;  2JS2 A;  3S3N A;  1S72 T;  3VV0 A;  4XTU A;  3QSU A;  3OMC A;  3I55 Q;  4RUG A;  1R77 A;  1XOV A;  4HCB A;  2RHY A;  4AFZ C;  3LW5 E;  2IPO B;  1ZUY A;  2LVM A;  2DJZ A;  2DXC A;  3ZL7 C;  4LD9 K;  3CPW P;  3FEO A;  3PNW C;  1MGQ A;  4JRI A;  2FEI A;  1SPK A;  3CCM Q;  3KUF A;  3J80 E;  5FRO A;  1M4Z A;  2L3P A;  2R58 A;  1VQ9 Q;  4IUT A;  2EW3 A;  4OMN A;  1M5Q 1;  4AG1 C;  4KRT A;  3RR6 A;  3REB B;  4JJN K;  1NEB A;  4BAC A;  1G83 A;  1I8F A;  2JMC A;  3G71 Q;  4BY6 C;  2GFA A;  3CCR T;  2QAS A;  4M7D F;  4E7J A;  1WA7 A;  4PJM A;  1CKB A;  1LCK A;  1OEB A;  1BIB A;  1UGR B;  4X1V A;  5D6X A;  2QEX A;  4XU1 A;  2JJ9 A;  1ZSZ B;  5A0D A;  2LZ6 B;  1JU5 C;  5GAO l;  3OYF A;  2DL5 A;  2DZ9 A;  2HEQ A;  2NUT B;  2KYM A;  3C4S A;  4ZGD B;  3CCS T;  4E7I A;  4C5G A;  1JEG A;  3FIF A;  3FRN A;  3E2U A;  2DTH A;  2OTJ T;  2CUB A;  1N9R A;  3L1A A;  1Y96 A;  1M2V B;  2JVV A;  5C6S A;  4BE2 A;  2D0N A;  1A0N B;  1G8X A;  4KT0 E;  1K76 A;  1AZG B;  3E1S A;  3OYM A;  1Y71 A;  2D8J A;  4FL6 A;  2HDA A;  4LDU A;  2C0I A;  5KCH A;  2XDB A;  4C0Z A;  1K0S A;  2DEQ A;  4A4K A;  3EAE A;  1GCQ C;  1O9S A;  1HXD A;  2YLC A;  3AT1 B;  3X20 B;  3CCL A;  3FJP A;  1WJS A;  3I55 T;  3QXE B;  2CH4 A;  2AZS A;  3H41 A;  3OS0 A;  1XNI A;  4WCI A;  2RB6 A;  3UDC A;  5J26 A;  3FLG A;  5DM7 R;  1D3B B;  3O8V A;  2G3R A;  5GAN f;  3CCM T;  5I22 A;  1YIJ A;  1VQ9 T;  3OW2 S;  2O4X B;  1K1Z A;  2KXD A;  2KRN A;  2E6N A;  3CPW A;  1RAG B;  1Y57 A;  3RIR A;  1AWO A;  5J3B A;  1U1T A;  3M5A A;  2DNU A;  2LX9 A;  2QGG A;  2E65 A;  1VQM Q;  2KT8 A;  2EAY A;  2DAQ A;  1N8R C;  2JT4 A;  1UG1 A;  1Q81 U;  3VKI A;  1OPK A;  1SKU B;  1D0Z A;  2WSF E;  3HKS A;  3QPH A;  4FSX A;  1VQN Q;  1RL2 A;  4KBM B;  1OOT A;  1G3W A;  4F16 A;  1MMG A;  3TSW A;  2COW A;  2GTO A;  1Q86 U;  1TWB A;  4M77 G;  4FW1 A;  1PRL C;  5A0L A;  3HFO A;  4XTX A;  1M30 A;  4C5I A;  1MHN A;  5CO7 A;  5FU6 C;  3V8K A;  5FRM A;  2RF0 A;  2A28 A;  2YLB A;  4J9G A;  1N8R R;  1VQO Q;  2QTX A;  1TOV A;  1AWX A;  1JJ2 S;  4FT4 A;  4KGZ B;  1VQ8 A;  4HVW A;  1UDL A;  3GNG A;  3LWI A;  1YWO A;  5GAN h;  4IUR A;  3FB9 A;  3IQL A;  2DIQ A;  2CP2 A;  2E3I A;  4C92 F;  2HMA A;  4DEY A;  4N4G A;  2R5M A;  2ZGW A;  2EJ9 A;  2EVR A;  1PD0 A;  5GMK m;  2PTK A;  1RLP C;  1PHT A;  1JB0 E;  4XQ3 A;  2KRO A;  1UJ0 A;  4QT7 A;  2LMJ A;  2HKN A;  1ZSZ A;  2RHZ A;  1RAB B;  3JCM f;  2DL4 A;  2NUT A;  3CQT A;  4C8Q F;  4M7A F;  5KE2 A;  4M78 F;  4KUD K;  1XTD A;  1BI3 A;  2QQ9 A;  5D6W A;  3G4S Q;  4KH0 B;  1M2V A;  1Q7Y C;  2O9V A;  1WXT A;  1VQM T;  2P0P A;  2EKO A;  2VXE A;  3CCV A;  4RTY A;  1RI0 A;  3ULR B;  3JCM g;  2LX7 A;  1NJI C;  2ZZD A;  4RCB A;  3DLM A;  3I35 A;  3OW2 A;  1X2Q A;  4IUU A;  3ZEH A;  4BY6 B;  1PSF A;  2DVJ A;  4FW2 A;  1NPR A;  2KDS A;  1MUZ A;  2AT1 B;  4IKF A;  1MND A;  9ATC B;  2YUO A;  4XAX B;  3EGX B;  3KXT A;  1Z9Q A;  2DA9 A;  1VQO T;  2VC8 A;  2EWN A;  1QCN A;  1HK9 A;  1IHW A;  3NTK A;  3VU3 C;  3LYI A;  4J7I A;  1D3B A;  1C0M A;  2L8D A;  1YBY A;  3OSV A;  3JB9 G;  2J6F A;  3CC4 Q;  5EG2 A;  2DF6 A;  3SHW A;  5A2Q E;  2O4X A;  4R55 A;  3JCM h;  1QQJ A;  1ZUK A;  1ZLM A;  3RMS A;  2FB7 A;  2DM1 A;  3M0T A;  2FZC B;  1VQK A;  4HXJ A;  4N0A C;  5IN1 A;  3M58 A;  3ME9 A;  2WSE E;  2XHC A;  2FZG B;  4AG2 C;  3A98 A;  2X3W D;  1YIT Q;  1TSF A;  3EFS A;  1JJ2 A;  3UF4 A;  3H9N A;  2W10 A;  2F2X A;  5KYW B;  2V1R A;  4A4H A;  1NEG A;  2FPD A;  2X4W A;  3NPF A;  4D8K A;  1GBQ A;  3N5B B;  1QWF A;  1Y7X A;  1K0X A;  4JS4 A;  2LQN A;  2A37 A;  2J6O A;  4AFQ C;  3R6O A;  2VB6 A;  2CP6 A;  2EGA A;  2SEM A;  1TTH B;  4DBH A;  1U1S A;  1OZ3 A;  5CQY A;  3RES A;  2D0Q B;  3NTI A;  2BKD N;  1QMC A;  1BYM A;  4MMK A;  3J81 E;  2DXT A;  2LQK A;  3CD6 Q;  2YHT A;  4B9X A;  2EKH A;  4AT1 B;  4EPC A;  1FXX A;  2DRK A;  3HP9 A;  2EYW A;  2F2V A;  3JCM b;  1WHG A;  3UWN A;  2MYS A;  3ZBD A;  3PMI A;  3I56 Q;  1KQS S;  2MK5 A;  3V7R A;  2E41 A;  1XJW B;  4NS5 A;  5L8R E;  1GCP A;  3C94 A;  3S3M A;  5KYY B;  1Y0M A;  2J06 A;  1FYN A;  1ZQ1 A;  1PC0 A;  2FL7 A;  3CC4 T;  3OBW A;  1UEB A;  4M77 D;  3OYI A;  4MZM A;  1YJW T;  5FU6 B;  4BI4 A;  2M1H A;  3LH0 A;  4RKU E;  4EMG A;  1KQS P;  1T0H A;  1FWZ A;  2YXY A;  1M90 C;  3EG0 A;  1IHV A;  2EYQ A;  2RQU A;  1I0C A;  5KYU B;  3M0Q A;  3L2Z A;  1EZZ B;  5LL6 S;  4GLM A;  5L23 A;  1WQW A;  5GMK j;  3M56 A;  2XDP A;  3QKJ A;  3VS2 A;  3OA6 A;  2E5Q A;  1KD1 R;  1QVG S;  3JCM X;  1WXU A;  2E1H A;  1D09 B;  3TSZ A;  3EGX A;  5GAO q;  5GMK e;  2DFU A;  3CCR A;  2QG9 B;  4IIM A;  5GAO p;  3KFV A;  2YDL A;  4YTL A;  3M0R A;  4FYY B;  4OGE A;  3SDZ A;  1PRM C;  2J7I A;  1HYO A;  2JTE A;  2LNV A;  4X34 A;  1AT1 B;  5CKF A;  1UEC A;  3CCS A;  2X4Y A;  2FPE A;  2Y90 A;  3CD6 T;  2A36 A;  1JXO A;  1GBR A;  3M55 A;  5HCK A;  2GFU A;  1SG5 A;  3SB2 A;  1WHM A;  4OMP A;  1W4S A;  3CCJ A;  3I56 T;  2DET A;  1QP2 A;  3UA7 A;  2E5K A;  5FWB A;  2P84 A;  5I21 A;  3CPF A;  1GCQ A;  3DB3 A;  3CCU Q;  2O31 A;  5KYW A;  5DLO A;  2MPX C;  4V2S A;  3I9Q A;  1PD1 A;  2LC4 A;  5GMK l;  4CC3 A;  1YI2 T;  3I55 A;  3L2V A;  3U23 A;  2WSC E;  2RJE A;  4MZP A;  4LDV A;  1KQS A;  1IGQ A;  2DMO A;  2DEU A;  4QW2 A;  5HK0 A;  2GQI A;  4FSS A;  4Q5W A;  3PVL A;  1X01 A;  3FDR A;  4D6W A;  3CCM A;  1AHJ B;  1VOM A;  1VQ9 A;  2D9T A;  5KE3 A;  1YJN Q;  1M1G A;  1VIE A;  2YRD A;  1IRE B;  3P8H A;  4ESR A;  1AWW A;  1TXQ A;  1UJY A;  1M3B A;  1YCY A;  3NGP A;  3MEA A;  4N4I A;  1BBZ A;  1NYF A;  4J5Y A;  1OQK A;  3HHT B;  4B9W A;  3L2Q A;  1PM3 A;  4BUG A;  1WJQ A;  1YHQ Q;  2HNI A;  5GAN 3;  1LJO A;  4FIB A;  4J9C A;  1RAE B;  3A8H B;  1LNX A;  5KYY A;  2NWM A;  4NOY A;  2X9H A;  4F04 B;  1QVG A;  2DLP A;  2H8H A;  3CMA T;  2KY9 A;  2QGF B;  4AMC A;  4F7U E;  1UUE A;  4OMO A;  4FCY A;  4OB2 B;  4HCK A;  2YUP A;  3DKM A;  4XTY A;  4ELY C;  4ATO A;  5LJ3 j;  5KYU A;  2KRS A;  1VQ4 A;  2XK0 A;  3UT1 A;  4C0D C;  2GCX A;  4CC4 B;  4GLK A;  4DBQ A;  2DD4 A;  2L5Q A;  2ZPH B;  3CCU T;  1H3Z A;  1Z9Z A;  4HT9 A;  2X3X D;  2NUZ A;  3V7S A;  1I5L A;  2DO3 A;  5LJ3 e;  3OS5 A;  1M1K U;  1N27 A;  2K3B A;  3ASK A;  3BE3 A;  2C06 A;  5CKB A;  5IXF A;  1R0B G;  1WHK A;  3FJ5 A;  5CQX A;  3CCE T;  1RAH B;  1C1A A;  2PUO B;  2M0Y A;  4MML A;  4PFZ A;  2XKO C;  1FMW A;  3CBP A;  3LGL A;  2RD1 A;  2RJF A;  2XI9 A;  2PQW A;  1YJN T;  1WXB A;  2JTF A;  4JZ4 A;  4M77 C;  1VYV A;  2QQA A;  2RI2 A;  4HCZ A;  4XTZ A;  1MNE A;  4QQD A;  1MMN A;  1BI2 A;  3OQ5 A;  3I5R A;  4HVV A;  1YHQ T;  5FU7 B;  2DL3 A;  1X6B A;  2DE0 X;  3NTH A;  4A53 A;  4TVR A;  1WZO A;  1DJ7 B;  1M9S A;  3A8L B;  5LJ3 d;  2DER A;  2PVO B;  1VQP Q;  2HD0 A;  1KD1 U;  4J6W A;  2DXB A;  4PNO A;  2JM9 A;  2VVK A;  1K73 C;  3A5Z B;  5IHI A;  1KQ1 A;  1WIE A;  2X51 A;  4J9H A;  4QQG A;  1VQO A;  4L5G A;  1SSH A;  3JV3 A;  2JOY A;  3QUI A;  4M78 E;  3HL8 A;  1KC8 C;  1K9M U;  1NE8 A;  3OYL A;  1K73 R;  2JW4 A;  4JJD A;  2QA4 Q;  2ENM A;  4BI3 A;  3RBB B;  4GBQ A;  3EGD B;  4JRQ A;  5DY9 A;  3MP8 A;  2LCC A;  3M4Y A;  4OB1 B;  3G71 T;  3RMQ A;  1KHC A;  2QEX Q;  4M75 E;  2KE9 A;  2Y4X A;  1T3S A;  3OYG A;  3EG9 B;  3PIP A;  2QQB A;  4A4G A;  2K79 A;  2Z0W A;  3CC7 A;  2HL3 A;  3L2W A;  3VUB A;  4RTW A;  2ZPF B;  1VQ5 A;  2YRC A;  2RM4 A;  2XD0 A;  1D1A A;  3FC3 A;  4MDW A;  2BE9 B;  1J3T A;  3M0P A;  2RO0 A;  4DEX A;  2EYX A;  2HCK A;  2XIC A;  4F7U G;  4AFS C;  3VUZ A;  3HRT A;  4J6Y A;  3RKW A;  4CI0 C;  1GRI A;  5CKD A;  4Z02 A;  4J9E A;  2CP3 A;  2KRM A;  2O01 E;  3MET A;  4XTV A;  1YJ9 A;  5CKE A;  3SEM A;  4JJB A;  2HAX A;  1UFF A;  4M78 C;  2M02 A;  3GP8 A;  3CCL Q;  1VQP T;  3EGU A;  3PMT A;  3QJ6 A;  2OJ2 A;  2X35 A;  5GAN j;  4HCC A;  4A4E A;  2VUB A;  1N9S A;  3VYH B;  1FMK A;  1UHC A;  4PJN A;  2PVG B;  1QCF A;  1KFZ A;  2EBP A;  3M0U A;  4PJO E;  2HL5 C;  4M75 C;  1MV0 B;  1VYT A;  4OMF B;  1JO8 A;  1YIJ Q;  4BE0 A;  3CC2 Q;  3BY7 A;  4XU3 A;  2JM8 A;  5GMK i;  1ARK A;  2CZ7 B;  5GAN e;  4E47 A;  2RJC A;  3OYN A;  2QA4 T;  4EMK C;  1NG2 A;  1X75 C;  2ROT A;  1YJW A;  2VWF A;  4A4F A;  2PU9 B;  3MPU B;  5I11 A;  3GBQ A;  4EMH A;  4C0D B;  2MWP A;  1K8A C;  4QVC A;  1TUG B;  1M27 C;  3V8L A;  5I2S A;  1NBE B;  4XTW A;  2JZ2 A;  2QQS A;  4XK8 E;  1EFN A;  4KGV B;  1NYG A;  1TG0 A;  4BDY A;  2GQV A;  2HSE B;  1VQ6 A;  3JB9 F;  3MEW A;  2RI5 A;  2RMO A;  1KG1 A;  1YFN A;  1VQN T;  4ORZ A;  4JLI A;  3C12 A;  1S1N A;  2NYS A;  3VS3 A;  2AKK A; 
#chains in the Genus database with same CATH homology
 1YJW T;  5FU6 B;  4BI4 A;  3M54 A;  2M1H A;  3LH0 A;  4ELZ C;  4RKU E;  1QVF S;  4EMG A;  3QYH B;  2OTL T;  4OP0 A;  4N0A A;  3OSS C;  4LDW A;  1FWZ A;  5HK3 A;  2K3X A;  2NLU A;  3JCM V;  1M90 C;  2CKK A;  4M77 F;  1UGQ B;  4PLI A;  2EYQ A;  3E9F A;  1G3T A;  3E19 A;  3OYH A;  3DLL A;  4IUP A;  4F7U F;  1Q82 U;  3L2Z A;  2BUD A;  2P0K A;  5LL6 S;  1V29 B;  3LGF A;  2X4J A;  2RA2 A;  4PJO C;  3PFS A;  1PSE A;  1WQW A;  5GMK j;  2CGH A;  3M56 A;  2XDP A;  4P5N A;  4C8Q A;  3CC2 A;  3OBY A;  4M7A A;  4M78 A;  3G6E T;  3QII A;  3QKJ A;  4C92 C;  4R56 A;  3CBO A;  2HQX A;  4RG2 A;  2ZPG B;  4RMO A;  2RK1 A;  3OA6 A;  4M77 B;  4M78 G;  3LX7 A;  5CVI A;  2E5Q A;  4M77 E;  1VIF A;  3CPW S;  1QVG S;  3S3N A;  1S72 T;  3JCM X;  3VV0 A;  4F7U B;  3H6Z A;  2E1H A;  2RJD A;  4XTU A;  3QSU A;  4E7K A;  1SSF A;  3M59 A;  2E10 A;  3OMC A;  3QJY A;  3CD6 A;  1WQ7 A;  1IZ6 A;  5GAN g;  5GMK e;  1UGS B;  5GAO q;  2ZPE B;  4XU0 A;  1VQL A;  3CCR A;  1XOV A;  4HCB A;  2RHY A;  3L2U A;  3LW5 E;  5GAO p;  4DQ2 A;  1TH7 A;  2LRQ A;  3G4S A;  4YTL A;  3JAM E;  2LVM A;  2DJZ A;  4E7H A;  4OGE A;  3SDZ A;  1Q82 C;  1YIJ T;  2R57 A;  2DXC A;  4M75 G;  4VUB A;  4LD9 K;  4QVZ A;  2MAM A;  4IUQ A;  4MDX A;  3I56 A;  3CC2 T;  3FEO A;  3PNW C;  1MGQ A;  4JRI A;  4Y91 A;  3KUF A;  3BDU A;  5C0M A;  4WF2 A;  5FRO A;  3J80 E;  1M4Z A;  2LNV A;  2R58 A;  5FRN A;  4X34 A;  3PT9 A;  4IUT A;  4C8Q C;  3F70 A;  5CKF A;  1M5Q 1;  3AHU A;  4M7A C;  3CCS A;  2X4Y A;  2Y90 A;  3CD6 T;  4C0G A;  4JJN K;  5GAN 4;  1QW1 A;  4BAC A;  4FM4 B;  1I8F A;  2QQR A;  2E12 A;  4BY6 C;  2GFA A;  3CCR T;  3M55 A;  4M7D F;  4J7F A;  2GFU A;  1WJR A;  2LCL A;  2ZPI B;  3OS1 A;  3SB2 A;  3G4S T;  4E7J A;  1VQ4 T;  1YI2 A;  3BFM A;  1W4S A;  1UGR B;  2ZCF B;  1BIB A;  3RKX A;  3QDR B;  4O5V A;  5D6X A;  4QVD A;  3I56 T;  2QEX A;  4BE1 A;  4XU1 A;  3HFN A;  1QP2 A;  4OF1 A;  1I4K 1;  5A0D A;  5GAO l;  5CCA A;  3OYF A;  2DZ9 A;  5I21 A;  4BD3 A;  3C95 A;  4M7D B;  1R8O B;  3BDL A;  3C4S A;  3CPF A;  2YRV A;  3DB3 A;  3T9N A;  4ZGD B;  3CCS T;  4C5G A;  4E7I A;  4ZGE B;  3FIF A;  3JCM J;  3V8J A;  5DLO A;  4LDX A;  3OYC A;  3KBG A;  5HY6 A;  4V2S A;  3CC4 A;  2L89 A;  3FRN A;  2DTH A;  2LC4 A;  2OTJ T;  5GMK l;  2I2L A;  1N9R A;  3L1A A;  2LT4 A;  1Y96 A;  2JVV A;  4KUL A;  5C6S A;  2MF2 A;  4BE2 A;  1YI2 T;  1LOJ A;  4UC4 A;  3I55 A;  4J8O A;  3LWH A;  4XU2 A;  3L2V A;  2OTL A;  3M9Q A;  4II1 A;  2QEX T;  1VQ8 T;  2WSC E;  3L42 A;  2M9U A;  2RJE A;  4KT0 E;  4MZP A;  2H3J A;  3INZ A;  3OYB A;  5FLX E;  3OYA A;  3TU4 K;  4LDV A;  1KQS A;  3GF5 A;  2X4X A;  4QW2 A;  1KQ2 A;  4PJO G;  3WXM B;  3E1S A;  4OB3 B;  2M16 A;  4CRI A;  2EQM A;  3OYM A;  1YIT A;  5HK0 A;  1Y71 A;  2M0O A;  3GNF B;  4FL6 A;  1WPY A;  4Q5W A;  4LDU A;  3QO3 A;  1X01 A;  3FDR A;  4KUI A;  4D6W A;  5KCH A;  4C92 G;  4C0Z A;  3CCM A;  1AHJ B;  2XDB A;  2EQU A;  2EQK A;  2KVQ G;  2KMT A;  2MWO A;  1VQ9 A;  2D9T A;  2DEQ A;  3G6E A;  4A4K A;  4OVA A;  5GAN 7;  4JS5 A;  2F5T X;  2CZ0 B;  2K5F A;  3EAE A;  1O9S A;  1G3S A;  1HXD A;  5KE3 A;  4ZTF A;  1QVF A;  2YLC A;  3X20 B;  3CCL A;  3FJP A;  1M1G A;  2P4T A;  1VIE A;  1IRE B;  2AHJ B;  1WJS A;  2DZC A;  3I55 T;  3CMA A;  3MHX A;  3P8H A;  1S72 A;  3QXE B;  2KQW A;  1YCY A;  2DD5 A;  4GY5 A;  3MEA A;  3OS0 A;  4N4I A;  1VUB A;  1XNI A;  4J5Y A;  4FU6 A;  3HHT B;  3ZFJ A;  2RB6 A;  3UDC A;  4B9W A;  3L2Q A;  5AYF A;  4BUG A;  5GAN d;  1WJQ A;  5J26 A;  3L2R A;  1N8R U;  3FLG A;  3SWN A;  4M75 F;  5DM7 R;  1YIT T;  1D3B B;  2VXF A;  3O8V A;  4OGC A;  2CZ1 B;  2G3R A;  2HNI A;  5GAN f;  3J7A F;  5GAN 3;  3CCM T;  1LJO A;  3GOX A;  1YIJ A;  4FIB A;  2F69 A;  3OW2 S;  1VQ9 T;  2O4X B;  3A8H B;  1LNX A;  1QP3 A;  2KK4 A;  2CZ6 B;  2K2V A;  2VGN A;  4C8Q G;  3CXC S;  3CCU A;  4M7A G;  4NOY A;  3CCL T;  1UGP B;  5CR2 A;  2E6N A;  3CPW A;  2QI2 A;  1QVG A;  1GXI E;  3PTA A;  5D6Y A;  5GMK h;  3CMA T;  3RIR A;  2KY9 A;  5J3B A;  4M75 B;  2DTO A;  1ZHI A;  1U1T A;  3M5A A;  5IT9 E;  4F7U E;  2LX9 A;  3CME A;  1XQH A;  4N4H A;  1P92 A;  4OB2 B;  3Q1J A;  5GAM j;  3WVE B;  3DKM A;  4XTY A;  3V7C A;  2E65 A;  2EJF A;  4C0F A;  1KHI A;  3GIB A;  3OYD A;  2EAY A;  4ELY C;  4ATO A;  3MCA B;  4JRK A;  5LJ3 j;  2DAQ A;  2E6Z A;  1N8R C;  2XU8 A;  1VQ4 A;  1Q81 U;  2XK0 A;  2B8A A;  3UT1 A;  3A8O B;  3VKI A;  2GCX A;  4C0D C;  4EMK B;  4GLK A;  5LJ5 j;  3CCE A;  4PL6 A;  4NL3 A;  2WSF E;  2FYK A;  3M4G A;  3HKS A;  3SWN C;  3MO8 A;  2DD4 A;  2L5Q A;  3QPH A;  1B34 B;  3QZ5 B;  4FSX A;  1RL2 A;  2ZPH B;  3OY9 A;  3CCU T;  2V8K A;  1H3Z A;  4KBM B;  4A54 A;  4HT9 A;  1G3W A;  3X24 B;  4J6X A;  4M7D D;  2V8J A;  5GAM e;  3V7S A;  4M77 A;  3S6W A;  2LQ8 A;  3M53 A;  3JCM e;  2RK2 A;  1Q86 U;  2RHI A;  5CK9 A;  1I5L A;  2DO3 A;  3CME T;  4BI8 B;  3OYJ A;  5LJ3 e;  4M77 G;  2LDM A;  2FVU A;  1N27 A;  3OS5 A;  2VGM A;  3PGG A;  4F7U A;  2RH2 A;  3HFO A;  3ASK A;  5A0L A;  4XTX A;  2OTJ A;  4C5I A;  1MHN A;  5LJ5 e;  5CO7 A;  5FU6 C;  1M1K U;  1NZ9 A;  1ZBX A;  3V8K A;  1BKB A;  5FRM A;  2C06 A;  5CKB A;  2YLB A;  4HKE A;  3JRZ A;  4DOV A;  3URG A;  2QTX A;  4X9D A;  3CC7 T;  3RKY A;  1BI0 A;  5CQX A;  2K3Y A;  1JJ2 S;  3WVD B;  4FT4 A;  5CAI A;  3CCE T;  1VQ8 A;  4PJO F;  3GNG A;  3LWI A;  1Q81 C;  1VQ5 T;  3HSB A;  2CYZ B;  2PUO B;  5GAO m;  4ZGJ B;  5GAN h;  4IUR A;  3RER A;  3FB9 A;  4QQ6 A;  4MML A;  2BIV A;  2DIQ A;  3NFC A;  2XKO C;  2EIF A;  4C92 F;  3SD4 A;  4N4G A;  3CBP A;  2R5M A;  2ZGW A;  3LGL A;  2RD1 A;  2JNG A;  1BIA A;  4M7D E;  2RJF A;  2XI9 A;  4BDZ A;  2PQW A;  2EJ9 A;  1YJN T;  2ZPB B;  1K73 U;  3CEY A;  4PLL A;  2JTF A;  3P8B B;  1Q86 C;  3QHS A;  3ER0 A;  5GMK m;  2XG8 D;  4JUV A;  1Q7Y U;  4M77 C;  1M1K C;  3OYE A;  2CS7 A;  4PJO B;  3JB9 H;  2QQA A;  2RI2 A;  4MZT A;  1JB0 E;  4HCZ A;  4XQ3 A;  4XTZ A;  2IG0 A;  4HA8 A;  1M1F A;  3QYG B;  1QVP A;  4QQD A;  4C92 B;  4EDU A;  5KH6 A;  3JB9 J;  1BI2 A;  3OQ5 A;  5KCO A;  3OMG A;  4LDY A;  3PIO A;  1YHQ T;  5FU7 B;  1YJ9 T;  1W2B S;  1NJI U;  2HQE A;  3BW1 A;  5GAM d;  2DPP B;  4JLG A;  3CBM A;  3NTH A;  4M78 D;  4A53 A;  4TVR A;  1KC8 U;  4BB7 A;  1OYX A;  3JCM d;  3UPU A;  2JN0 A;  5GAM f;  1DJ7 B;  1M9S A;  2RHZ A;  3A8L B;  5LJ3 d;  2DKG A;  2XDD A;  2PVO B;  3JCM f;  4M7D A;  5LJ5 d;  2P0Q A;  2HD0 A;  4C8Q F;  5LJ3 f;  4J6W A;  1KD1 U;  2DXB A;  3LLR A;  4PNO A;  2A7Y A;  4M7A F;  5KE2 A;  4M78 F;  2MI6 A;  4LD6 A;  1U8R A;  4C5H A;  1K73 C;  5LJ5 f;  3A5Z B;  4Y28 E;  2JUF A;  4KUD K;  1XTD A;  1BI3 A;  4DOW A;  1G3Y A;  2QQ9 A;  5D6W A;  1H64 1;  1KQ1 A;  1Q7Y C;  3JSC A;  4M75 D;  3G71 A;  1VQM T;  2P0P A;  2EKO A;  5GAM g;  2PUK B;  3HPW A;  2VXE A;  3CCV A;  1JBM A;  1RI0 A;  2RI3 A;  4QQG A;  3JCM g;  1VQO A;  1FX7 A;  4L5G A;  4C8Q B;  4L59 A;  4DA4 A;  1NJI C;  4M7A B;  5LJ3 g;  4M78 B;  2JOY A;  3QUI A;  4IUV A;  2DTI A;  2EFI A;  2LTO A;  2ZZD A;  3HL8 A;  4M78 E;  3CCJ A;  1KC8 C;  4RCB A;  5LJ5 g;  3DLM A;  5CIU A;  1K9M U;  3OW2 A;  4BY6 B;  1NE8 A;  2DK3 A;  2DXU A;  2IVW A;  1PSF A;  4IUU A;  3ZEH A;  5GAN 8;  3OYL A;  4L6V 5;  1NPR A;  1EIF A;  2KDS A;  5GAO n;  2LT1 A;  3CXC A;  4IKF A;  1KD1 C;  2VV5 A;  3JB9 I;  4BI3 A;  2K57 A;  4X9C A;  4XAX B;  4JRQ A;  4M7D C;  4ZTJ A;  5DY9 A;  3MP8 A;  3KXT A;  1UB4 A;  2LCC A;  3M4Y A;  3MEU A;  4OB1 B;  2RHU A;  4RCC A;  3RMQ A;  4OB0 B;  5M9O A;  2EQJ A;  3G71 T;  5GAO r;  1KHC A;  3OB9 A;  4M75 E;  1G5V A;  3CCV T;  1VQO T;  2VC8 A;  3QBY A;  2Y4X A;  2EWN A;  1HK9 A;  2OAU A;  2FHD A;  3NTK A;  3OYG A;  3VU3 C;  5GAN 5;  3LYI A;  3PIP A;  2QQB A;  4A4G A;  3RUX A;  1VQ6 T;  1BI1 A;  2L3R A;  2A3L A;  5GAN 6;  4JDS A;  5A0G A;  3CCQ A;  4O6J A;  4J7I A;  3CC7 A;  3DB4 A;  1WNL A;  1D3B A;  2L8D A;  1YBY A;  3OSV A;  3EFR A;  3L2W A;  5CKH A;  5FU7 C;  3VUB A;  3JB9 G;  5GAM h;  5EG2 A;  5A2Q E;  1K9M C;  4ME7 A;  2ZPF B;  1VQ5 A;  2O4X A;  4R55 A;  5I2M A;  3JCM h;  4ZN3 A;  5IAY A;  2RM4 A;  3RMS A;  2E70 A;  5LJ3 h;  2FB7 A;  1VQP A;  2XD0 A;  3MP1 A;  3OS2 A;  4HT8 A;  4ZN1 A;  3A8G B;  1VQK A;  5LJ5 h;  3GPL A;  2F5K A;  3FC3 A;  4MDW A;  1YJN A;  2XID A;  3M57 A;  4N0A C;  5IN1 A;  4M75 A;  2HBP A;  2RO0 A;  3M58 A;  5GAN 2;  3ME9 A;  2WSE E;  2XHC A;  4PJO D;  2XIC A;  4F7U G;  3JCM P;  3HRS A;  3X25 B;  3VUZ A;  3EFS A;  1JRI A;  3HRT A;  4J6Y A;  3RKW A;  4C92 D;  2K5I A;  4CI0 C;  3CCQ T;  1JJ2 A;  5CKD A;  4Z02 A;  1Y07 A;  2V8I A;  3OYY A;  2O01 E;  3MET A;  4XTV A;  4EMK A;  5CKE A;  2DVE A;  1YJ9 A;  1YHQ A;  2HAX A;  4A4H A;  4M78 C;  2Y4Y A;  2X4W A;  3MEV A;  3TEE A;  3VYG A;  3GP8 A;  1B34 A;  1VQP T;  3TCJ A;  3PMT A;  1VQK T;  1Y96 B;  2K5L A;  3N5B B;  2KSS A;  1VQL T;  3QJ6 A;  2QA4 A;  4JRP A;  2X35 A;  2WAC A;  1Y7X A;  5GAN j;  4HCC A;  2VYT A;  4JS4 A;  4FT2 A;  4A4E A;  2VUB A;  1N9S A;  2PVD B;  4J83 A;  3VYH B;  2PVG B;  3JCM c;  2K4Y A;  3R6O A;  1K8A U;  2GF7 A;  1OI1 A;  5DLQ E;  2QXF A;  4PJO E;  3SFM A;  3QG1 A;  1VQ7 A;  4M75 C;  4OMF B;  3TRE A;  1U1S A;  3H8Z A;  3MP6 A;  3S3O A;  4RG8 A;  1VQM A;  1OZ3 A;  5CQY A;  4C92 E;  4BE0 A;  1W2B A;  3BY7 A;  4XU3 A;  3RES A;  2D0Q B;  4C8Q D;  5GMK i;  1O75 A;  2BKD N;  2KAF A;  3NTI A;  2CZ7 B;  4M7A D;  5GAN e;  1M8V A;  1BYM A;  4E47 A;  3JCM Q;  2QDY B;  3X26 B;  4MMK A;  3J81 E;  3OYK A;  2RJC A;  4C5E A;  3JCM W;  3OYN A;  3VJP A;  3GLX A;  4EMK C;  2QA4 T;  5J39 A;  2DXT A;  1N6A A;  1VQN A;  2LQK A;  1NPP A;  1X75 C;  1YJW A;  1I81 A;  2YHT A;  4A4F A;  4B9X A;  2PU9 B;  1WGS A;  4E7L A;  4PKC C;  4EPC A;  4M7D G;  1FXX A;  2MMP A;  3HP9 A;  1M90 U;  3CCJ T;  3A8M B;  3X28 B;  3JCM b;  2RHX A;  4EMH A;  4C0D B;  2MWP A;  1X6O A;  1VQ7 T;  4PJO A;  2JTM A;  1K8A C;  3UWN A;  4QVC A;  5HKC A;  3JB9 D;  2D6F A;  3V8L A;  3SWN B;  1OZ2 A;  4XTW A;  2JZ2 A;  5I2S A;  2QQS A;  3QZ9 B;  3ZBD A;  3PMI A;  4XK8 E;  1KQS S;  3V7R A;  4C92 A;  2E41 A;  4NS5 A;  2R5A A;  3G7Z A;  2E64 A;  3E9G A;  5L8R E;  2DIG A;  4BDY A;  3C94 A;  3S3M A;  4C8Q E;  2GQV A;  1ZQ1 A;  2FL7 A;  3CC4 T;  4M7A E;  3JB9 F;  3OBW A;  1VQ6 A;  4NL2 A;  2EJG A;  1UEB A;  2RI5 A;  3MEW A;  1KG1 A;  1VQN T;  4JLI A;  3C12 A;  4M77 D;  3OYI A;  3HRU A;  4MZM A;  3P8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...