5CAZA

Crystallographic structure of apo human rotavirus k8 vp8*
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
TLDGPYQPTSLNLPVDYWMLIAPTREGKVAEGTNTTDRWFACVLVEPNVQNTQRQYVLDGQNVQLHVSNDSSTSWKFILFIKLTPDGTYTQYSTLSTPHKLCAWMKRDNRVYWYQGATPNASESYYLTINNDNSNVSSDAEFYLIPQSQTAMCTQYINNGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substantial Receptor-induced Structural Rearrangement of Rotavirus VP8*: Potential Implications for Cross-Species Infection.
pubmed doi rcsb
source organism Rotavirus a (strain human/japan/k8/1977 g1-p3a[9]-ix-rx-cx-mx-a1-nx-tx-ex-h3)
molecule tags Viral protein, sugard binding protein
molecule keywords Outer capsid protein VP4
total genus 40
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2015-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cazA00
3M3EA 2JD4A 2P37A 5CAZA 4NO4A 4H55A 1SFYA 3WVJA 2VY0A 2UURA 4K21A 5JOXA 1W6NB 3OY8A 3N7LA 4FP3A 1ULDA 1GICA 1SACA 4RL7A 4U36A 4XJWA 3ZXJA 1HKDA 2AREA 1LESA 1S0EA 2JE9A 2VUAA 1BXHA 1W6NA 4P14A 1ONAA 2DURA 2EAKA 3INAA 3GNEA 3C2UA 3RG0A 2PHFA 2JE7A 4YG6A 3AYEA 1G9DA 5DG2A 1LHUA 1QOOA 1SCSA 5CB7A 2E7QA 3RS6A 1CIWA 1S0CA 3AZWA 1QNYA 2D44A 2XB6C 4Y26A 4ASMB 5GZCA 2Z42A 1CESA 5IUQA 2WQZC 1WW7A 1S1AA 2DVFA 4XJZA 5KXBA 4XJUA 1UMZA 3ILFA 4BLIA 5DUXA 3FLPA 2ZGOA 3R4UA 1V6LA 2DUQA 5E8AA 1FAYA 3N35A 2GDFA 2WSUA 1IS4A 1ENQA 1BQPA 2NP0A 1GANA 2SLIA 3FLTA 4HL0A 1V00A 1W6OB 2CY6A 4XMIA 3WLUA 1R1ZA 4YGDA 1DGLA 3MW2A 3VUOA 4AWDA 4BM8A 5H9PA 2ZHLA 4Y24A 2TEPA 5KXCA 4XE9A 4LBKA 3ZPYA 3DUIA 2ZGPA 4YG0A 1G8WA 2W08A 4GXLA 4Y20B 1C57A 3B9CA 2EALA 3JU9A 3PVEA 1CR7A 3ZSLA 2OVUA 1H9WA 2UWAA 3LCPA 3O0WA 5T5PA 4GWMA 1W6PA 3MPPG 1FNYA 5GLWA 3W58A 3WNXA 4LBQA 5EXOA 3T2TA 1LGNA 2CNAA 3WG3A 1WLWA 4XHBA 3AYCA 2A3XA 2VH9A 3WOGA 2WNEA 3ZSMA 4DFSA 2W39A 4YM3A 2NMOA 2P3IA 1KDMA 4Y1UA 2JDZA 1F31A 1KJRA 1WBLA 2W52A 3WCSA 3IPVB 4W65A 1CJPA 1S0BA 3V64A 2A71A 2LALA 4F83A 5GZDA 3AXDA 2D3SA 2D7FA 3KQRA 4FPFA 4P9XA 4FPHA 3LSEA 3CNAA 2ZGNA 2PHUA 4CTEA 4XIOA 5T5LA 1U0AA 3R4SA 5FREA 2E53A 2JECA 4ITCA 4YZ4A 1MS5A 2ZHKA 3AP7A 1BZWA 3N7JA 1Q8OA 5GZFA 2D6KA 3RQ0A 1W6PB 1KITA 1YYNA 4HANA 1BYHA 4AGGA 1FV3A 4GA9A 4XXAA 1XQNA 2OUHA 5T52A 2ZGTA 4BPZA 3AP4A 1ENRA 1YXWA 1V6IA 1IKQA 2YY1A 4GWNA 4Y22B 3UK9A 5F5QA 3WUDA 1SLCA 1IS6A 2GMMA 4L8QA 3TAYA 5JLVA 2NYYA 4U2AA 3U4XA 1QOTA 1MZ6A 2OUJA 3NV2A 1LU1A 4AYUA 1S0JA 3WG4A 1A78A 1C1FA 1N1YA 1V6NA 4XBNA 1YI7A 4XYXA 2ZHMA 1MS4A 3W59A 2DWRA 2AUYA 2AR6A 1DZQA 3UJOA 2C5DA 1SLTA 2EXIA 5KXEA 1I3HA 1LGBA 4TZDA 3Q9OA 1MS1A 4K1YA 3N7KA 4Y1XA 1JHNA 4FPEA 3UJQA 4Y1YA 2FMDA 4YGEA 4YM2A 3N36A 1LOGA 1N3QA 3M3CA 4AGRA 1S0FA 1YRZA 5GZGA 4XZPA 4NOTA 1WBFA 2DTYA 5JOYA 3M3OA 1G9AA 4FPCA 1HQWA 1RITA 1LOFA 3R05A 3V0AB 1JYCA 3IPVA 1HDKA 5EWSA 2ZGRA 3D6EA 5LK5A 5FRAA 5T5JA 1UZZA 4LBMA 4JCKA 4WVVA 4CZSA 4BLJA 1A8DA 1APNA 1GNZA 1UPSA 2CTVA 4R9AA 5IK5A 4XMAA 2CWMA 1ZM1A 3M3QA 1NXD1 1KJLA 2A7AA 2D6LX 3GALA 3WG2A 2ZA9A 1C1LA 4C1XA 1LTEA 1N3PA 2OW4A 1YO8A 3POYA 1JUIA 2GN3A 5GLVA 5HCBA 3A4UA 4XIKA 2WT2A 1N1TA 1DLLA 1VLNA 1GBGA 2ZGSA 3QCWA 4I30A 4Q26A 5GALA 4Q1PA 1UL9A 3SNMA 3ZXFA 1DBNA 1CPNA 2UU8A 3JUUA 4DS0A 1OFSA 2DUPA 2GMPA 2P3JA 2A3YA 3D5OA 2A3WA 4LBLA 4YFWA 4YW4A 3RSJA 2YMZA 4YW1A 2ZGUA 1DQ2A 1LOEA 2A5ZA 1IS3A 2D3PA 1AF9A 2NM1A 1WUVA 3ATGA 5SV8A 2R16A 4FVVA 1CN1A 2I2SA 2W68A 3QLQA 5DZFA 4M3CF 4LBOA 3AFKA 3V65A 2VW1A 4DRVA 3BOPA 2GALA 1AX0A 2GNDA 4Q8LA 4YG3A 2WKKA 1DQ5A 2RHPA 3IN9A 3I4IA 4FOVA 1QOSA 1W6QB 2G4IA 2ZAAA 5IK8A 2DU0A 3VKOA 1ULCA 1LOCA 3ZXLA 4BOWA 5HCAA 5GLUA 3RMXA 4FPYA 1MS0A 4UW3A 4YW3A 3WZ1A 1QDCA 5KXDA 1G9CA 3IKWA 3RRDA 4Q2FA 5T55A 1JN2P 4FPKA 1AXKA 1ZA4A 4DRRA 4XILA 2AH2A 3AK0A 3O0VA 2JJ6A 4Q1RA 1V6MA 1MZ5A 2PELA 2R1DA 2D6OX 3PVNA 4FOQA 2DVGA 2EXHA 1LOAA 2ZZJA 3WDVA 3UL2A 5GJ6A 5IT6A 4LBJA 3AP5A 1B09A 1A3KA 3NV3A 2A6YA 4GKXA 4WZFA 1DQ6A 1MVQA 2VW2A 2ZGQA 3AYAA 1N1VA 5H9QA 3ILNA 4R9BA 4Y22A 1Q8QA 1IOAA 2WT0A 3WDYA 1MS8A 1UAIA 3BTAA 1UKGA 1GV9A 2R0FA 1W6QA 3RMYA 1HLCA 4R9DA 1QMJA 1G7YA 4ZKTB 1GZCA 4TYSA 2WLQA 3IMNA 3PVOA 1LGCA 2GNTA 2Q5TA 4FPLA 4CRQA 1AX1A 1GYKA 3HMYA 2E51A 4YM0A 4Y20A 3WCRA 4JRAA 1HQLA 1MVEA 5CNAA 1VALA 3VKMA 1PZ9A 4P9WA 4BMEA 3PJQA 1SBDA 3ENRA 2FHRA 4ISRA 2PHXA 2AYHA 4XHXA 1V6JA 5H9RA 1GSLA 3OYWB 4BMBA 1LENA 5EYXA 3T1LA 3B69A 4ATFA 4SLIA 2GMEA 3AZZA 3OYWA 4AVVA 1ULFA 2UWCA 1S0DA 2KM2A 2ERFA 2ZBJA 3SH5A 3WDXA 3AZVA 3T1MA 5JOZA 4YGCA 4Q8KA 3TB0A 3H0OA 4XTMA 4PBPA 3B01A 3WHUA 5E89A 3AJYA 2R49A 4RA0A 1LU2A 3USUA 2D43A 3ZXKA 1G9BA 2AGSA 2P2KA 1LHNA 4YFZA 4FPJA 1VIWB 4KBBA 5JOWA 2ARXA 2CWSA 2ENRA 1IKPA 1W0OA 3FLRA 1Z0HA 2ZGMA 4YZ3A 5DUUA 1FNZA 3D4KA 1LULA 2GNBA 3OJBA 2NZ9A 2YROA 5IK4A 1UX6A 1LODA 3ZVXA 5DZEA 2EF6A 4YW5A 4Y1ZA 5DG1A 1VAMA 1JXNA 4GALA 3AP6A 4WVWA 4XTPA 3LSDA 1WCSA 2NN8A 4M3CB 2CL2A 1LECA 4YGBA 5GZEA 4D69A 1LEMA 1ULEA 1AJOA 1AJKA 2D3RA 3NV4A 1MR5A 4XJAA 4AVSA 3V0BA 3AYDA 1KDKA 4YZ2A 2H0BA 3M2MA 1WW6A 1AVBA 2ZGLA 3N3HA 1FYUA 3VKFC 3WDTA 3SH4A 1LOFC 1J1TA 1GZWA 4FQZA 1CONA 1O4YA 2ZMLA 4FOYA 2D6PA 1AXYA 2DVBA 3HR9A 4DPNA 5AVAA 5DUVA 2UWBA 1GKBA 1Z78A 1JBCA 2ZABA 1C4RA 1LCLA 1Q8PA 3VKNA 2ZGKA 3M1HA 3ZYRA 1JOJA 1KQRA 5HCFA 1LHVA 2D6NA 1UN1A 3ASIA 2VU9A 1WD3A 3ILRA 2B7YA 5JVVA 3WV6A 1FX5A 2D6MA 3SLIA 3ZYPA 4YZ5A 3DGTA 3O0XA 2NMNA 1QDOA 4XOGA 4UW5A 1UZYA 3USUB 1WLDA 1V6OA 1GNHA 4Y1VA 1IS5A 4M01A 3SITA 1SLBA 2DVDA 3IM0A 4XJ8A 3I8TA 1TEIA 2C9AA 2E6VA 3FUQA 5BYNA 1Q8SA 1JYIA 1FV2A 5CA6A 2A75A 3A0KA 5CBLA 5H9SA 2GNMA 1OQ1A 2BQPA 3WG1A 1F9KA 2DTWA 4BQ1A 4Z8BA 3HN1A 5EYYA 4PBOA 1NLSA 3O12A 4K1ZA 2EIGA 4M3CA 4OZXA 2AENA 3WHTA 1Q8VA 1RIRA 2PHTA 2ZHNA 1Q56A 3B00A 5L73A 1X50A 2ES3A 1QNWA 2WT1A 4XBLA 3NWKA 1DHKB 3KM5A 1DYKA 2A6ZA 2HYKA 3N7MA 3OGGA 4Q27A 3ZSJA 1WW4A 3ZXEA 3O5SA 1LJ7A 1QGLA 1G86A 5T50A 4DQAA 3MW3A 1Y7BA 3A0NA 3MEPA 4R9CA 1DQ4A 5E88A 4FQ4A 1DIWA 3WDWA 1WD4A 1W6MA 2V73A 4LBNA 2DUOA 4XDQA 3AZXA 4XJ9A 5IK7A 3AZYA 1DQ0A 1S0IA 3BIWE 1DFQA 5JMCA 4YM1A 5GM0A 4FPOB 1SCRA 1OKQA 3BODA 1BKZA 3VV1A 1G9FA 2DU1A 1F5FA 3VKLA 2WSVA 4PCRA 1WW5A 3AXEA 5T5OA 1O4ZA 1LHOA 2ZKNA 3ZSKA 1WLCA 3FBYA 3SISA 2CYFA 3OBRA 1H30A 1LOBA 4LBQB 3B3QE 5DXDA 1N1SA 3POSA 2YZ4A 4ISQA 3AJZA 5T54A 2ZMNA 4XXPA 2A6XA 2R0HA 4IQPA 4ATEA 3V0BB 1GLHA 1H9PA 3AP9A 5DUWA 2JKBA 4GKYA 1AXZA 2PHRA 3POWA 4YW2A 2YXSA 1AZDA 2DYCA 1MS3A 4UW4A 2E7TA 4XBQA 4MYEA 5GLZA 2R1BA 2EXJA 1QU0A 4PF5A 1AX2A 1MACA 1LEDA 3FUOA 1QKQA 4FOWA 4WV8A 1KRIA 1PZ8A 3NV1A 3OPZA 1EPWA 2A6VA 1SBFA 4P9YA 4JC1A 4ZXKA 1MS9A 5F9TA 1RINA 1SBEA 3FFZA 5GLTA 1CVNA 2LTNA 2ZACA 1ENSA 1I1EA 1S0GA 4C1WA 2VW0A 2XG3A 3V0AA 1N3OA 3L2YA 1V6KA 2ZMKA 1URXA 2ARBA 1SLLA 1CPMA 3MW4A 3OY8B 3SH3A 1FATA 1VAVA 1CQ9A 1GZWB 3AX4A 4M3CE 2YV8A 1W6MB 4YLZA 5DZGA 4K20A 1SLIA 2DV9A 1W6OA 1ULGA 3PMEA 4AGVA 2WJSA 2SBAA 4LBQD 1QF3A 4FP2A 3WUCA 1BJQA 1D2SA 1SLAA 3OBTA 2A6WA 4PQ9A 1JW6A 1GZ9A 2P3KA 1DQ1A 4M00A 3WDUA 2V5YA 4FPGA 4YZ1A 2VXRA 4AVTA 1N47A 1D0HA 2A70A 1PZ7A 3APBA 2GN7A 1W0PA 1YIFA 1LHWA 2P34A 2EXKA 1DYPA 4UW6A 2PHWA 5JDBA 2DVAA
chains in the Genus database with same CATH superfamily
1VB2A 1OOPC 5CG9A 3KT1A 3WNPA 5CAZA 3VDBA 3PDQA 1PNFA 3CKHA 1UD1A 4H55A 3ACHA 3WVJA 4YSFA 1XPWA 2UURA 4K21A 4BDVB 3OY8A 2HLEA 1SACA 1QXRA 1W2TA 3HPNA 5CKMA 5FYCA 3OPTA 5DAVA 1S0EA 3UKNA 2R071 1QJZA 2VZSA 4AR2A 1ONAA 1QJY2 4UF0A 2PHFA 4AI8A 4RS5B 1CJDA 3RGBA 3JD71 3L2HA 5FYMA 5DG2A 4PT6A 3TWIA 2PFWA 2E7QA 2VG9A 5ANQA 1PK6B 2YFZA 3AZWA 2QQWA 2VUDA 2D44A 5FPLA 2DCKA 3LDBA 4Y26A 1CESA 2VQ0A 1TVGA 2WQZC 3S6PA 1S1AA 5A3PA 1UMZA 2J1SA 3IIAA 1JYVA 1EUTA 4X8PA 5DUXA 2W95A 1PX3A 1UYZA 5E8AA 4CEYC 4LTAA 1GP4A 4I01A 4LHKA 5FZKA 1RHI3 1DZRA 1BQPA 2NP0A 4KWLA 4BQ5A 3SKVA 4GB31 4XMIA 1E5RA 3VUOA 1Q43A 2XUEA 4AWDA 1OUSA 1E5IA 1NA1C 5H9PA 1OBNA 3GM8A 5I8YA 1RUE2 4Y24A 4IEYA 4ES8A 3USSA 2NQYA 5EV7A 2PA7A 2QVSB 3ZYJB 2YU2A 3ELNA 3UT0A 3PHMA 3CIHA 1WCDJ 1EP0A 4GXLA 2RG4A 4Y20B 1EAH3 1W2NA 3B9CA 2EALA 2WUHA 4M4RA 2RJ2A 1CR7A 3ZIWA 4E8DA 4CXXA 3IIIA 2VCBA 1AL22 4CUCA 1H9WA 1GMMA 1VBD2 4AXOA 3LDKA 2F4PA 1BEV1 4CP2A 4ZZ8A 1FNYA 2R30A 2YC0A 4K7JA 4LBQA 3W58A 3WNXA 4LMFA 3RZLA 1FI2A 2CNAA 4MV2A 4YYOA 1R082 3WG3A 2VOVA 3U1XA 5JCTA 2BWCA 2TNFA 4IXLA 1PGW2 4NUBA 2WNEA 2W39A 4Z92B 4FAHA 2DCJA 5K0UC 1KJRA 4XDPA 1TMF1 1RUJ3 1WBLA 2W52A 5EP9A 5FTTC 4W65A 3LEMA 2FMYA 2QQOA 3JXSA 1K3IA 3V64A 1I9RA 2JG9A 3JBG1 4F83A 4FPFA 1OLRA 2XJRA 3CNAA 3DPRA 4OVEA 3QD6A 5T5LA 5JSPA 3OF1A 5DDJ1 3R4SA 4CDXB 5C4WB 2JECA 2ZHKA 3TRSB 5L9RA 1Q8OA 1NCQB 4MHUA 3WF2A 2R073 2WS92 3KSCA 3LE0A 4AGGA 1ZBE2 3NNGA 3I2JA 5C7GA 1XXNA 1BK0A 5IYYA 4GA9A 4LO6B 2R063 5L36A 2ZGTA 4BPZA 1PX4A 4AHYA 2RS51 4LKDA 5F5AA 1Q3EA 5FLHA 4LNVA 1IKQA 4N53A 2IFWA 1X9TA 1IS6A 1SLCA 3E6DA 4L8QA 4LUKA 2W94A 5FUPA 4U2AA 5FYIA 2HEYF 4NIGA 4AYUA 2CDOA 4DXTA 1A78A 1N1YA 5FZAA 4XBNA 5A1FA 2NLRA 3UETA 4XYXA 3OPWA 2C1FA 1QQP3 1NQDA 3Q8CA 2UYAA 5F1RA 5FYBA 4AAXA 3UJOA 4NAOA 2C5DA 2XQXA 2WN2A 3ECQA 3Q9OA 4GH4C 2RS31 2KA3A 2VO5A 3N7KA 5JPMB 4XQWA 1OOPB 1ZBA3 3KVBA 4Y1YA 4YGEA 3N36A 1LOGA 2BYVE 3IDEA 1I6XA 4R4XA 5KHGA 3LB9A 2Y6FA 2DTYA 1IQAA 4HG6B 1W99A 4O9GA 2RR11 3ZYIB 2PAMA 3M3OA 1BK1A 1VBE1 3ZIXA 5A70A 5FZ7A 5I8SA 4QQOA 1IQDC 1X82A 1XC6A 1JYCA 5EWSA 1O7FA 2ZGRA 1E5SA 4GMP0 4P5YA 1WMXA 4LLOA 3TEZA 4WVVA 1W8WA 2CTVA 1PVC3 1IZ3A 1OF4A 4IEZA 3VBOC 2WIIB 4Q0PA 2CWMA 3KGZA 3M3QA 4IW3A 5FYZA 4XACA 1HRI1 1UOBA 5L7OA 4S2HA 4OUMA 4BYYA 1CAVA 4C1XA 2OW4A 3RYRA 1EV13 3VL8A 5A1AA 1JUIA 2GN3A 4NJ4A 3ZN4A 5HCBA 5AC92 5BNNC 3ETQA 1D4VB 1GOFA 1O4TA 5ISLA 2WT2A 5FYYA 4I30A 1TME2 4PIZA 3H1WA 5I0TA 2HWF2 2X5IA 2B8MA 2PHDA 2UU8A 3JUUA 4PLOA 4Q1PA 3WNLA 3U75A 1OFSA 4XABA 4COVA 2GMPA 4B4PA 3RSJA 4FSJA 4LHSA 4LBLA 3VB9A 2YYOA 5SV8A 1LOEA 3PL0A 5A7WA 2DCTA 2BW8A 2NM1A 1S2EA 2VMCA 4J6GA 3K51A 3UKVA 3AMHA 2DF7A 1V9U2 4YWAA 2QFEA 2XVKA 1UWWA 3KQ4B 3MLKA 2W1UA 3WNNA 3V65A 1JZ2A 4DRVA 5A32A 4Q8LA 2GALA 1AX0A 1P8JA 2HWD3 2X5IC 3I2FA 4GWJA 4YG3A 3VHPA 5IVVA 1PGL1 1VRH1 1Q5OA 1YC61 2Q1ZB 1GUIA 1WWYA 2C9KA 2DU0A 2WZR1 3VKOA 1LOCA 4BOWA 3MUZ1 5KXDA 1MS0A 1G9CA 4AF9A 2L9LA 5ACA2 4J1WA 4D6RA 2BFUL 4AI3A 4LIUA 3NKTA 4KL1A 1JTZX 1ZA4A 1C8NA 3BI3A 3OEBA 2JJ6A 2ORZA 4Q1RA 5CG8A 1V6MA 3HNYM 2HJIA 4Q0QA 3H50A 3H8UA 5KHHA 1RUJ1 2EXHA 2VZTA 3ACLA 2XJTA 4CU6A 1PHMA 4UT5A 1WMDA 2FD8A 4DXRA 5JR7B 5IT6A 3UESA 4LBJA 3NV3A 1A3KA 2RV9A 4CCLA 4AVCA 1DQ6A 1MVQA 3AYAA 5F39A 1RVF3 2IVIB 2RMU2 2X10A 1IOAA 2OPWA 3JQWA 4UFMA 3WDYA 2YPJA 1BBT2 1BEV3 3BTAA 2R0FA 2G19A 1W6QA 1YJLA 3SCGA 1HLCA 2PLV3 5IFTA 5JXJA 3BVCA 2HWE2 1GOGA 1G7YA 5EFUA 1AYN3 2PQSA 4A3XA 4EWEA 1O8SA 2Z2SB 4CRQA 4L11A 4FPLA 3WP3A 3UNPA 4IE7A 3HMYA 1C8M3 4UBHA 3OB8A 4AI9A 1MZFA 3NNJA 4SBVA 3D0JA 1R1A1 2HBTA 1VALA 2EAAA 2WO7A 1CAWB 1W3VA 3ENRA 2FHRA 1JYTA 3EJKA 1J84A 2ZPXA 4ISRA 4NWVA 4QQPA 3ZOIA 2VZPA 1SFPA 4BQ2A 5J36A 1UOJA 3I59A 1GSLA 3DCQA 3OYWB 3POGA 4JGZB 4N7IA 2Q8EA 1PO21 4ATFA 5A33A 1HN1A 4AVVA 2GMEA 3AZZA 3BB6A 3A7QA 3POEA 3SH5A 4AI2A 3S0MA 3AZVA 3T1MA 5I0DA 2QQJA 3H3LA 3KCXA 2P4EA 1QH6A 2X05A 3K48A 5A32B 1YCIA 4CP0A 4N9IA 2V72A 4CDQB 3X29B 2HWE1 2D43A 4V2WA 4PF1A 1K42A 1HJFA 1H8VA 2RS11 2RS13 5FPBA 4FPJA 4EZ4A 5L7OB 3JD73 1HRV3 1KFXL 2ARXA 1I5PA 2CWSA 4HK9A 4HETA 2G9ZA 4JRLA 3HVDA 1OMIA 1Z0HA 2ZGMA 2E33A 3OJBA 5CZKA 3SKJE 1TNRA 2HBUA 3LIGA 2MEV1 5LY1A 2IUWA 3IAPA 4ZU5A 5IWFA 1VAMA 1JXNA 4P5HA 2P3YA 4XTPA 1WCSA 5FOBB 2CL2A 1R091 2BGOA 4XEZA 1VR3A 5GZEA 1AJKA 2ZEZA 3VBOA 2FZ2A 3NKGA 1MR5A 1YEWA 2JDMA 3HQRA 1RUI3 3WW4A 3AYDA 4XW3A 5ANNA 2H0BA 2ZX2A 1SDDB 3DXTA 1AVBA 1FYUA 2PAEA 3VKFC 5F5IA 4MXVA 3VD7A 1GZWA 4FQZA 4MH0E 3H3ZA 5FCCA 1O4YA 3E5QA 2ZMLA 3H7JA 2PTMA 5EJZB 3VZMA 5HCHA 1VP6A 1AXYA 2DVBA 1NZCA 3C7HA 4DPNA 3KF5A 2Y0OA 3DXUA 4ORFA 5C8CA 1JHJA 3WEZA 3VZJA 2UWBA 1XYPA 5LY2A 4WM8C 2Q8OA 3DKQA 5FZ8A 4GULA 3WR0A 5HV4A 1V0AA 1ND3C 3FHAA 2CHHA 2XBO1 4HONA 2RS12 3RWKX 5I8TA 4AQ2A 1M4WA 3S7IA 3ASIA 1COV3 2GU9A 3U4SA 5BV6A 3WV6A 5C9AA 2P17A 2VZ3A 3SLIA 1S4CA 1PGL2 2W1WA 4YZ5A 4IEUA 3O0XA 2NMNA 4B7KA 1XNAA 3E97A 4QGLA 1ZYBA 1AR73 2J1EA 5C3RA 3IDAA 1D2QA 3SITA 4C91A 4F8AA 4XJ8A 1IPSA 3URFA 1TEIA 2C9AA 2EIBA 2WWUA 3FUQA 5BYNA 1Q8SA 3PUAA 4FT8A 3I49A 1DLCA 1J3PA 5KC6A 2BGCA 3A0KA 3GDBA 3LQCA 4LEJA 5CBLA 3AM2A 4L2NA 3TN92 3U14A 1OQ1A 2BQPA 3AMNA 5FV3A 4QX2A 5EHDA 4Z8BA 1H8TB 5LB6A 3HN1A 4MGSA 4BH9A 3FX3A 3K46A 1U5XA 1DF0A 2RJLA 4P02B 3CJIB 3HQXA 1Q8VA 1RIRA 2PHTA 4RGGA 3MI8A 5A80A 2R061 2WT1A 4QXHA 3I59B 3NWKA 3OGGA 1EPZA 1B35C 1NXMA 3KCCA 1XE8A 5K9YA 2NPIA 4PDWA 4MGYE 1G86A 4GD4A 1I5ZA 3JB8A 3IT8A 4EWDA 4CEYA 3OCPA 4N43B 2XJSA 3BALA 1NCRA 1LNSA 1Y7BA 2TBVA 3ZFGB 4DIQA 2WAOA 3CQOA 1EY2A 4EJRA 2FCVA 4H14A 4NVPA 5I0UA 2JE8A 4I0BA 3AVSA 4LBNA 2X09A 5FXXA 5HBAA 4PQQA 3H7YA 4B3NA 1HRI3 1RJ7A 2VNVA 4JKMA 1AUYA 4XDQA 4GWIA 5FZLA 3T0DA 1DQ0A 1BHGA 3CLPA 1W39A 2RS32 3VDDA 1W06A 5GM0A 1RUI1 3BODA 5BY5A 2JDAA 5FZ9A 3A21A 1BKZA 4CSWA 2Q8DA 1HIXA 5FAXA 1WW5A 1HQNA 5T5OA 1RUH3 5JSOA 2DBIA 5LA1A 1VBE3 2VOWA 1RUD3 1LOBA 3ALQA 4LBQB 1XYOA 3B3QE 2GH8A 2OT7A 1N1SA 1QH7A 4QMAA 5A3LA 1MQTC 1TMF2 3VBSC 4DY3A 1UXXX 2ZMNA 2R0HA 4IQPA 2JEMA 4AHZA 1ZRDA 1ASJ3 1POV0 2VTXJ 4FTBA 1UF2C 1YNAA 3AL6A 1NZIA 4Z82A 5FMOL 2VZUA 3MIFA 4GQ7A 5FKBA 2ORXA 2RE9A 4LORA 3MIBA 2EXJA 1YFUA 1QU0A 1K5MA 4Z1VA 4PF5A 2WYSA 1HXS2 5A3UA 4L92A 3OUJA 1SFNA 4JTOA 4Q4X1 2K0GA 2QE3A 1OXCA 5C8CB 2QJVA 1F15A 4XF4A 4I0AA 3P3PA 2TUNA 3IBMA 3B02A 4CDWA 4CDUA 5A3MA 3AKPA 3CO2A 1ND2A 3TNPB 1SBEA 4E9KA 4KGGA 4KQ7A 1UZ0A 3POJA 2ZACA 1I1EA 2G1MA 3U07A 4C1WA 4G4FA 2RS53 2VW0A 5FUNA 4XFHA 3LA2A 2AZ5A 4HPKA 5FP8A 4K8RB 3ZFGC 1VBA1 1FOD3 3HAGA 2RM23 4NE9A 5KWRA 2XONA 3OY8B 2QQPA 3RZJA 3RDIA 4BK4A 1VAVA 3KV4A 1FXZA 5CFCA 2WWSA 2Y6GA 5FQ0A 3AMMA 4IE6A 1SLIA 4QGMA 4EN0A 1B35B 2ZX0A 4MXWB 4AGVA 4RS5A 3UKTA 4JAAA 2GP3A 2HWE3 2BP6A 1H2KA 2JB4A 2PLV1 4ET7A 4DUXA 3OBTA 1BBT3 1BEV2 2RMU1 3WDUA 1ND3A 5FO9B 5J1XA 5LRSA 3LOBA 1RVF2 1NCRC 1LKNA 4MGIE 1D0HA 2DDUA 4B4QA 1QXJA 5BNOC 1CZSA 1YIFA 1LHWA 4Y3OA 5D1IA 5FIXA 4RQPC 3VD9A 3IB3A 5J48A 3K4DA 1DYPA 1SG3A 3VBSB 1RUF3 1W2UA 5JDBA 3H8XA 2QUOA 1YFYA 3M3EA 1ZRRA 3AC0A 1H6YA 1GU3A 4LQRA 4JHTA 5JXGA 2IC1A 4A44A 4CA9A 2VY0A 3VLBB 5JR2A 5LK7B 3S57A 1ST8A 2AC1A 1R64A 3CJXA 4U36A 4MOAA 2XQRA 3ETPA 3VBHB 5AFBA 3ZKYA 1LESA 2GSYA 4BXSV 1BXHA 4P14A 2BGPA 5FZ0A 2W47A 5G04L 3INAA 3SMHA 2CDPA 3M7AA 1OKOA 1RUH2 2ADEA 4IGOA 4LULA 4M0NA 4NAMA 4YG6A 2R072 2WS93 3W5MA 1O3TA 4Y4RA 5CB7A 4MHRA 1CIWA 1D4M3 3FL7A 1QNYA 2OA2A 4W6WA 3WW2A 3VBUB 1C8M2 5LEKA 1WW7A 2BOJA 2DVFA 4AFAA 3W21A 4BLIA 5JSRA 2IXLA 3FLPA 1AYN2 1X8EA 2QQIA 3R4UA 4ES9A 2PLV2 2R32A 1UCXA 4YVSC 3LFIA 3HBKA 1TME1 1IS4A 1HB1A 4NRPA 1ENQA 4HL0A 2SLIA 3FLTA 1V00A 3VZKA 2UYBA 1R1ZA 4MG2A 4BM8A 5FPXA 1ODNA 3EBRA 3RJRA 3O1SA 1POQA 2TEPA 1FPN2 3VHOA 2QTWB 1WKYA 1OD5A 4LBKA 2YGMA 3DUIA 2ZGPA 3O1TA 2XL7A 1OI6A 3DKWA 3DPRB 2GC2A 1ENXA 2V4VA 1G8WA 4E4SA 2OZJA 3UGFA 4XFIA 1J3QA 5C4WA 4CDXA 4HMZA 3JU9A 3HD8B 4I09A 1YFXA 1E57A 4HBNA 4JDOA 5JXIA 5GLWA 4Q4Y3 5EXOA 2JKXA 3T2TA 4AFDA 2ZTNA 4QX7A 2IFRA 2EVXA 4XHBA 3AYCA 4OFGA 2A3XA 4LA2A 2YBKA 4LOSA 1OH4A 2QQUA 1J59A 1VBB1 2HEVF 2VL4A 2HWD2 4IV1B 2WZPP 1KS5A 4YM3A 3T09A 4Y1UA 2JG9B 2XLFA 2Q4SA 1IPJA 1YIPA 3RJ2X 1AR62 1AR61 1ZRCA 3EO6A 1VE0A 5ERLA 4WM7B 5TSWA 5FLJA 2OX0A 5KC5A 1OPOA 2D3SA 3KQRA 1O3QA 2BUKA 5DAQA 3GHNA 3LSEA 4L97A 4LR4A 3PUHA 3SCFA 5EJ1B 4LUMA 3MGUA 1TQ5A 4AK3A 5FREA 3PTRB 4PI2A 4CUAA 1GQGA 3ZYBA 3RQ0A 5A6XA 4DUVA 1QHDA 3WNOA 1RMU1 1YYNA 4EYUA 2VOXA 1FV3A 2VULA 2JIGA 1XQNA 2XGXA 4MADA 4NROA 3J4UH 5SV5A 5T52A 1VPHA 2HWB1 3AP4A 1YXWA 3VBOB 1HN0A 1FMD2 1FOD1 2BVVA 2JXAA 5DABA 3UK9A 1W03A 3WUDA 2RS33 4BHPA 5JLVA 1OPMA 3CZJA 3NNFA 4XFFA 5KBFA 2IXCA 1QOTA 3NV2A 5FZ1A 1LU1A 4E4DX 1F4HA 1R092 1C1FA 1U5YA 3WG4A 2CAUA 3WNKA 2LUWA 5EPAA 2MEV3 2ZHMA 3LEGA 2EIDA 4ZZ5A 4URAA 4DMIA 3HIFA 3HOBA 1DZQA 1XRUA 1XU1A 1SLTA 1YQ2A 3I2IA 4XFGA 2RMU3 1I3HA 3B94A 3EHKA 5BNPB 4Y1XA 1GP5A 2ET7A 4FPEA 3GZEA 5HXVA 4NPRA 4YM2A 1AR93 4AGRA 1UMIA 5DAXA 1UXZA 3JZVA 2B42B 5FY0A 4E4ZA 1G9AA 3MPBA 3BUCA 1D0GA 4I02A 2VCCA 3V0AB 1DGWX 2WNUA 4QU1A 1QJU1 1HDKA 2BBVA 1RVF1 3D6EA 3MFCA 5LK5A 3NVCA 5T5JA 5FMCA 4LBMA 1ZZ9A 3D3AA 4Y5TA 2WO1A 4R9AA 1RJ8A 5KHJA 1RYYA 1RUF1 2WNUC 5JXHA 4MO3M 5J3UA 3AKSA 2D6LX 2A7AA 4IEXA 3JBG3 4FXKB 5IFPA 2EICA 4CPBA 1NY72 4OI1A 4DB5A 3NO8A 3VGIA 1NKGA 2FQPA 4XIKA 4HT1T 5IVJA 2CSGA 1VJ2A 1VLNA 3QCWA 5GALA 4XETA 3ZXFA 4EN6B 4BIOA 1UL9A 4DS0A 1DBNA 4UBGA 2DUPA 5FZMA 2V5DA 2P3JA 1U5ZA 2A3YA 2A3WA 2LS6A 4KI5M 1AYN1 2CU5A 4H7LA 4YFWA 4FBFA 5FDBA 1UZVA 2ZGUA 3RI9A 3JQXA 1UY3A 1IS3A 1PMIA 2D3PA 4LHLA 4CP9B 2CV6A 2R16A 3GBWA 4J25A 2W68A 2I2SA 4PDWB 4LPLA 1CX1A 2VQAA 4LBOA 2Y38A 4K9SA 2VW1A 1OC1A 3BOPA 5FXVA 5FYTA 2Y60A 2RHPA 2E31A 3NNLA 4FOVA 3VBFB 5AC93 3ORJA 1W6QB 5IK8A 3D82A 4MX3A 3NRUA 4YNIA 3WSOA 3ZXLA 1C3HA 5FZFA 4AG4A 5BNPC 3ES1A 5GLUA 3RMXA 3B9IA 4FPYA 4UW3A 1POV1 1QDCA 4BQWA 1EUUA 2BWAA 4NMIA 4Q2FA 5T55A 4CP1A 4WM8B 4Q4V2 5FY7A 1VBD3 1WZXA 1NOVA 4A41A 5C3OA 1MZ5A 3PVNA 4FOQA 3HEIA 2FDGA 3PTYA 2BRTA 3N9LA 5I0RA 1AR63 4OI0A 2DVGA 2QDNA 1OA2A 1F4AA 2ZZJA 5FPAA 4P9IA 5D8AC 1H2MA 4IEWA 1NYWA 4AEDB 2J1RA 2X8KA 3ZR5A 4E8CA 5FZ6A 2A6YA 5A7WB 1NA1B 2VW2A 1VRH2 2BEOA 2EA7A 1ZA7A 3ILNA 4R9BA 4Y22A 1Q8QA 4DO0A 1HRV2 1AHSA 1MS8A 1OVPA 3NJVA 5FZCA 4ARXA 1GV9A 5B4NA 1QQP2 1ZZ7A 4MXWA 4RR3C 3ZR6A 4QKNA 1QJX3 1QJX1 3OEAA 3ZLIA 5I93A 3LDRA 4N8MA 1O59A 2E51A 4YM0A 5FFOC 2JIJA 4Y20A 2XHKA 3R6SA 4CDWB 1MVEA 5L7OC 3Q8BA 4BMEA 4CCDA 4D7TA 1RUD2 2AYHA 5ABJC 4A7YA 5KR7A 4JGYC 2DBNA 3PNAA 3ES4A 3TEWA 3E5XA 1LENA 3ITQA 4Y5Z0 5JIUA 3B69A 3GGLA 1BVP1 3OBAA 4N90A 4SLIA 2C26A 1CAXB 3THCA 3WDXA 4CDQA 1O3RA 5JOZA 2Y6LA 3TBDA 4TN7A 3ZN6B 2Q8CA 3WHUA 3GBGA 4HFSA 3CL1A 1XYNA 3AJYA 2QQVA 4RA0A 2FDFA 1XNBA 3H1MA 4PI0A 4XQDA 3USUA 3NAPA 2AGSA 1LHNA 4Y33A 1WLTA 2E63A 3WP4A 1VIWB 1SDWA 2AEZA 2V4AA 1JZ6A 5DDJ3 4HN1A 1ZZ8A 3FLRA 1TNFA 4W4ZA 2FDHA 2F4LA 4ZS2A 5FOJB 2YROA 5IK4A 1UX6A 3V56A 5J96B 2C6SA 5DZEA 3FBMA 1GZTA 5F6LB 2EF6A 4C90A 4ZY9A 2JDYA 4Y1ZA 3GZAA 4WVWA 4GALA 4CDUB 2NN8A 4M3CB 1LECA 1LEMA 1ULEA 2QQLA 1H2NA 4AEDA 1PO12 4GJZA 4YZ2A 1WA6X 2H6BA 3KT4A 3M2MA 1OURA 4GZ9A 1V9U1 4F7ZA 4LT5A 2BNMA 1LOFC 3SH4A 3IMMA 5FZ3A 4EE2A 1CONA 5EIYB 3B5LB 4HVOA 3BTYA 5IHRA 3BGAA 2Y64A 4XF3A 4KU7A 4QQLA 3WF3A 2VVFA 5BNQA 5LBCA 3R4DB 2JB8A 1JBCA 2ZABA 5FP7A 1CD3G 1WMEA 1C5IA 3VKNA 2VZVA 3M1HA 2R6QA 3AKQA 3Q8AA 1RGSA 3L9JT 1JOJA 1IG0A 1KQRA 5HCFA 4FFIA 3S7EA 1LHVA 1UN1A 2VU9A 2A73B 3ILRA 5JVVA 5BNOA 1VBA3 1GQHA 2D6MA 4TLGA 2XLGA 1CAUA 4FFFA 3D8CA 4XPVA 1RXGA 2YUEA 4WVMB 3ST7A 2JX9A 1QDOA 3ZM8A 5CFCC 3KHBA 1L7LA 2F17A 3CJIC 4QWNA 5LASA 1WLDA 3ZDSA 4Y1VA 4M01A 4UFKA 4AEJA 2N7GA 1XSRA 3I8TA 3KCYA 2E6VA 1SQ4A 2RR12 5IATA 4UYBA 3VN4A 1OF3A 4ASLA 1BBT1 2B5HA 1JYIA 3VBRB 4FCAA 3ZDVA 2H6CA 1T2XA 3VDDB 1OH3A 1PNGA 1ND2C 4RFRB 3FJSA 3WG1A 2PAKA 3O14A 5AC91 2VNGA 3POIA 3OGSA 5I0SA 4COZA 3PVBB 5A7QA 2G9FA 4BA6A 2WZR3 4GAZA 4M3CA 2VJXA 4OHVA 1KEXA 3J7NA 4DINB 3MO4A 5L73A 1X50A 2OS2A 2Y6KA 2HWC2 2JG9C 3ZSJA 4Q27A 4HXCA 2A6ZA 2HYKA 3IDCB 3ZFEB 1J58A 3ZXEA 2VZRA 1ACCA 4JKKA 3RYKA 1QGLA 2JDUA 4NHXA 4GB33 1HX6A 5T50A 1AYM1 1L3JA 4LJHA 3NAPC 4QB1A 3K3NA 4R9CA 3H9AA 4FQ4A 5L9BA 3U37A 5C6CA 1DIWA 5FO8B 3T08A 1J1LA 2VBBA 2V73A 5F8PA 4Z07A 2WZR2 3VHNA 2VMDA 2DUOA 3DN7A 1UYYA 4IERA 3QACA 4KWJA 4CDQC 3O1OA 4BISA 3AZXA 5IK7A 1H8TC 5FY1A 1EV11 4CYDA 2VTXA 1HB4A 1SCRA 5FBZA 4RYDA 3VV1A 4QHOA 1RUOA 2VUCA 1F5FA 3MIEA 2VC9A 5F3CA 1KGYA 3B93A 1H8TA 4A7ZA 2D93A 4KWUA 1LHOA 4ZS3A 2ZKNA 4A42A 1OQEA 1QJY3 3P5BA 5FZEA 4AAPA 3ZSKA 5FJKA 3FBYA 2IWGB 2LROA 3K2OA 1FPN3 3H3UA 1XJAA 2JDPA 5DXDA 5K8SA 2ET1A 3POSA 1GNYA 2Y6HA 3PMSA 4B29A 3HQUA 5T54A 4CE8A 3ZXGA 1XE7A 3VBRC 1H9PA 1W9FA 5DQ0A 1DGRN 3AL5A 2JKBA 5BNNB 1AXZA 4NPMA 5FK8A 4YW2A 4EROA 1AZDA 2J42A 2JG8B 1MS3A 1VBC1 3KZ4C 4R52A 4MYEA 5DN2A 4HK8A 1JH5A 1KRIA 1ND3B 4IV3C 1ZZBA 1BMV2 4UF0B 3RWNA 4EQVA 3NV1A 3OPZA 1EPWA 4OZOA 4E4HA 4P9YA 2VCAA 1UU5A 1D4M2 4ZXKA 1MS9A 5F9TA 2XPJA 4RS5C 3OSDA 3C7OA 4QPWA 3FFZA 4Q0SA 5GLTA 1CVNA 2Q1FA 5D8AA 2ARCA 4FTSA 2ZEYA 3AKRA 3LA7A 2H0VA 4QHZA 2HWB3 4MVTA 3I2OA 3H8OA 3BTZA 3DECA 2WFPA 4COUA 1URXA 1SLLA 3SHRA 3BIEA 1VMFA 1AL23 4Y5SA 1W05A 2AACA 1QXPA 3ME2A 4EN9B 4MGTA 1GZWB 4JGZC 2O0OA 1DZTA 3ZO0B 1VMHA 1QJU2 4UOJA 5DZGA 4XF9A 4BU2A 4QX0A 3QOPA 3FFQA 1REFA 1W6OA 1ULGA 4PHZA 2WWJA 4P08A 2WJSA 2SBAA 1QF3A 1R081 1X9PA 1UU4A 3FE5A 1RUF2 2JD9A 4K40A 3H8RA 1SLAA 2DFCA 1HRV1 1O6UA 1RUE3 1NUKA 2A6WA 2VZOA 3M8LA 1AR92 3OD4A 3THTA 4M00A 4DXSA 4RFT0 1DP0A 2WYFA 1W8ZA 2XJPA 4YZ1A 3WF4A 1N47A 4RR3B 5GZFA 1W0PA 1F2NA 1X7NA 3WP5A 1RHI2 3CMGA 4Q4X2 2XDVA 4CCMA 4K8FA 2EXKA 4PDWC 3J7HA 4QDQA 1L7QA 2DVAA 1ZBE1 3OTFA 4UFJA 3VZOA 2JD4A 1Z7S1 2P37A 2VTFA 1R093 4NO4A 1AR82 3HBZA 3WW1A 2WINB 1SFYA 3HT1A 1W6NB 4XF0A 3N7LA 4KGQA 3GBFA 2G9GA 3VBFA 3ZXJA 5IVFA 4IV3B 3KV6A 2JE9A 3KHCA 1POV3 1YQ8A 1QJY1 2CGPA 3Q8FA 2JE7A 2WS91 1QIQA 1RXFA 3AYEA 4DEVA 4I3GA 3RS6A 4CDUC 5D8AB 4OHXA 3T4HB 4ASMB 5I91A 3UGGA 3QBQA 4QXBA 5IUQA 2B9UA 3BTXA 3CBNA 2Y6JA 1HXS3 3ILFA 5LWBA 3WF0A 2ZGOA 1GWLA 3LWCA 1ODMA 4OMDA 2P6HA 1FAYA 1CX4A 1OVSA 5CIRA 4NHLA 2ATFA 1UY1A 5C3PA 1D7PM 2WSUA 2RDQA 1PM4A 1GANA 3WLUA 5C9AB 4I3PA 1W6OB 2XJVA 2MNGA 3MW2A 2V09A 4KWKA 4AVAA 2BV4A 4A4AA 5LA2A 2ZHLA 4LOTA 5KXCA 4QM9A 4A6SA 3HNBM 5C8CC 1WCUA 3ZFFB 2WA3A 2ZKLA 1QJEA 2BBAA 2JG8A 2J22A 4MLOA 4Q4Y2 3NAPB 4YG0A 2W08A 4XFBA 4ZONA 4TWTA 2VVDA 2W1QA 2Y0IA 3O1UA 3ZSLA 2OVUA 2XH6A 4QPGC 3LCPA 1W9YA 5T5PA 4Q4V3 3T0BA 1W6PA 1JYXA 4TTGA 3RZGA 4BQYA 4YVWA 3OUHA 3FHQA 3NJXA 3I2KA 5C5UA 3HNMA 1A34A 2VH9A 4RD7A 3WOGA 3CHXA 4LK7A 3ZSMA 3I54A 4DFSA 3TEXA 4MGQA 2NMOA 3THPA 5A6QA 2P3IA 1KDMA 1KFUL 2JDZA 2XR4A 1F31A 1VBA2 4DOUA 4GH4A 5A3WA 2QQMA 1S0BA 4BE3A 2VGDA 4K6BA 2B4KA 5GZDA 3VZNA 2K9ZA 3AXDA 3I3MA 4P9XA 4FPHA 2LRPA 2IXHA 2J1VA 2PHUA 4CTEA 3JB4C 2QCSB 1CWPA 1U0AA 2E53A 2WABA 4ITCA 1VRBA 4YZ4A 1MS5A 5FP9A 3N7JA 1JZ8A 2QNKA 4IV1C 2VMHA 2D6KA 5JZGA 3LIHA 4AFBA 1BYHA 4KG8A 3WNMA 3N4MA 4MGZE 1RMU3 4XXAA 5FZOB 4YARA 5FQ0B 4Z2WA 4GMP3 4DXZA 5FZHA 1PO23 4AE2A 2YY1A 5FYUA 4GWNA 1AYM2 5CFDA 5ABJA 5KHKA 1VMJA 3TAYA 2GMMA 3IZOA 2O14A 3I2DA 3U4XA 1EAH2 3P1IA 3D0SA 1S0JA 2EIEA 1JZ3A 2ZCWA 4CXWA 5B4XA 2VBPA 1V6NA 1T6GC 3T30A 4E2QA 5FY8A 4I0WB 4HSLA 4LE4A 5A7OA 3K75B 1GFF2 1MS4A 1UIJA 1GWMA 2DWRA 3W59A 4W50A 2AR6A 4TSVA 3MLJA 2EXIA 2WC2A 4IEQA 3GCXA 5FWJA 1CAWA 1BCXA 3O1MA 1JU3A 3UJQA 4Q29A 1RC6A 1YUDA 5LZ6A 1DDLA 1PVC1 3WW3A 1GQPA 3M3CA 5GZGA 1S0FA 1YRZA 3O1VA 1CZVA 4XZPA 4NOTA 5LA0A 1WBFA 2FCTA 5K0UB 4CP9A 1QJFA 2YBPA 1HQWA 1LOFA 3WX5A 3R05A 3ZFEA 4QM8A 4WVMA 1EYBA 4N53C 5FRAA 2XVLA 1C28A 1FMD3 5F37A 4JCKA 1NX9A 5JIAA 4IGPA 4N7UA 4CZSA 1APNA 4QX1A 5IK5A 4XMAA 1JS9A 1ZM1A 2PN5A 1US2A 5J37A 4E2SA 2ZEXA 4MGKE 3WG2A 4AHWA 4XC9A 3GZTB 4QDRA 1N3PA 3T2PA 3ACFA 4FTEA 1YO8A 5GLVA 3VBFC 1S55A 3A4UA 1QWRA 3DPRC 1DGWA 4IGQA 2Q30A 2Y34A 1DLLA 2ZGSA 1GBGA 2VE1A 4NIAA 2PQQA 4AW7A 5FYVA 2ZS6B 4JQRA 2JENA 1X36A 4RN5A 4ONUA 4YW4A 3D5OA 2Q1MA 1VBC2 4IE5A 5CISA 1ALYA 5FMDA 1DQ2A 3LPGA 2AEYA 3PLQA 3POBA 1AF9A 4JTNA 4XAEA 3DV8A 5JZGB 4FVVA 5FR3A 1DCSA 5BPXA 1XOYA 2WNVC 5DZFA 2BJSA 3GCWA 4AEKA 4M3CF 3AFKA 2R041 4AL9A 4NIIA 2WKKA 4LKEA 4QKBA 4R4ZA 1CAUB 1QOSA 4YVWC 3TYJA 2R7EB 2ZAAA 4KBZA 5CFDB 1C5HA 4DUWA 1ULCA 5E1RA 5BNNA 2YBSA 5IVCA 1IHMA 4YW3A 3WZ1A 1UY2A 2ARAA 2XWJB 4HOOA 3IKWA 1NE6A 3RRDA 5E16A 1RUG2 2VMGA 3FWEA 3OD0A 1YHFA 3TNQA 3WP6A 4CPBD 3I3DA 3DYMA 5A3NA 1RTVA 1AXKA 3N9MA 4DRRA 1W2OA 4XILA 3AK0A 2PHLA 3O0VA 4RHV2 3PUQA 2OQ6A 5FWEA 2WFF2 4EV0A 3KB5A 1US3A 1ZVFA 1U5IA 2HWC1 1LOAA 3BN6A 3MBWA 3WDVA 3LFMA 4CCKA 4IEVA 4QU2A 5ACA1 2QZ2A 3I97A 1IPKA 2XLAA 1RHI1 1B09A 1CIYA 4WZFA 4GKXA 4D6SA 2E9QA 5H9QA 3THDA 2WZEA 3N9PA 2PXJA 2A1XA 5ABJB 3MYXA 2WT0A 1UAIA 1UKGA 1VAKA 3FN9A 4QX3A 5FPVA 4BQXA 3RMYA 1OQDA 1QMJA 4GIQA 1GZCA 4TYSA 3O1RA 3IMNA 3PVOA 3O7OA 1GYKA 4JX0A 5HI0A 5JMOA 3WCRA 1MQTA 2HWF1 4JRAA 1J3RA 1HQLA 4EN7B 1PZ9A 1W8FA 4OUEA 4P9WA 2BFUS 1SBDA 3PJQA 4Q5OA 2VD7A 4DZGA 4PIXA 3N9QA 1YQCA 1V6JA 5FZBA 5H9RA 3KVAA 3LEKA 2J7MA 4QQHA 4BMBA 3RZMA 1H2LA 1OLME 3BCWA 3CF6E 3K4AA 3KLSA 4RQPB 2OZ6A 1NA1A 2W46A 1S0DA 1WCQA 2KM2A 2ERFA 4IV1A 1SPPB 2ZBJA 1HXS1 3MIHA 5CADA 1QY4A 3RI8A 3H0OA 1H4HA 3B01A 5E89A 1QJX2 4OLLA 2R49A 3MF6A 4QPIB 4TLFA 2FDIA 4P9GA 1L7RA 4P9LA 4QAWA 4LIVA 4X8NA 2VOTA 1G6NA 3ZXKA 3DEMA 4D3WA 3MIGA 4YFZA 2ZJCA 4OCTA 4KBBA 1Y3TA 4DY5A 5JI9A 2ENRA 4QPYA 1W0OA 4YZ3A 1VRH3 3D4KA 4CEWC 2NZ9A 4Q4W2 4S2GA 1XNTA 4BQ4A 1W8NA 5G05L 3U10A 2K46A 2XKOA 3AFGA 1UOFA 4N9HA 3KS7A 4D8MA 3ON7A 5DG1A 4S2FA 2VMEA 3AP6A 1F5JA 4D69A 3H42B 4IEPA 2D3RA 3NV4A 3W9AA 5IW0A 4AVSA 3ZFGA 1KDKA 4AI0A 3KWVA 4OQ9A 2Y26A 3T3YA 1FOD2 1WW6A 4NHMA 4URTA 4D94A 3VDDC 4CDXC 5C4WC 2RS52 2Z69A 1J1TA 2W9XA 3UV9A 2FDJA 3U78A 1MZEA 1NCRB 2BNOA 2XKPA 1MPXA 4KG0A 2D97A 3HR9A 5AVAA 1HW5A 2RVAA 4O61A 2R042 5FYHA 1NQJA 1JOPA 1K5MC 4NRQA 3AMPA 1Q8PA 2YG0A 4P00B 2JDNA 4XUTA 2ZGKA 1MQTB 3CEWA 4QT6A 1DU3D 4RQPA 2D6NA 1WD3A 2B7YA 4OI2A 3CU7A 1FX5A 2K2SA 1FT9A 3PJYA 2YC2A 2ETEA 2XXZA 3ZYPA 2B9VA 2WNUB 3DGTA 1R1A2 3TN91 1AR71 4XOGA 5IAVA 4QX5A 1UZYA 3NJZA 1H0BA 4LA3A 4D0QA 1GOHA 2VVEA 1V6OA 3EXUA 1GNHA 1PO22 3FC0A 5FXWA 1GR3A 2BU9A 1SLBA 4GH4B 2YDEA 3IM0A 1W9TA 4QPGA 2WAAA 1QQP1 1COV1 3S5QA 1XU2A 3ZYHA 1J83A 2FBEA 1PIV3 2GAUA 2A75A 4HKOA 1AR72 4BK5A 3E5UA 4NIDA 5H9SA 2ZAHA 2GNMA 1O91A 4CCNA 1F9KA 1RL3A 4NHKA 4BQ1A 2VOKA 4O65A 2D98A 5BUVA 4HN0A 1ZREA 4YRDA 4PBOA 5FY4A 2EIGA 2AENA 4Q4Y1 3E6BA 3WHTA 2ZHNA 3B00A 4F3JA 2KD7A 1QNWA 4XBLA 1DHKB 3KM5A 1DYKA 4CDWC 3DF0A 1FPN1 2HKXA 3BYWA 2O1QA 3RNSA 3ACIA 4JDNA 4UWDA 3PIJA 4ZXEA 3WD5A 3J7MA 1BLZA 1ZBA1 4LXLA 4AQ6A 4HVRA 5E88A 4CCEA 3LOIA 1OHFA 1WD4A 2VQUA 5F3EA 2QBXA 4K3UA 4CXYA 4ASKA 4XJ9A 3AZYA 1H1AA 5JMCA 3TOJA 3ZKUA 4FPOB 1OKQA 5E6HA 3TN93 3GXUA 4BCUA 1G9FA 4I2OA 4MZUA 3AXEA 1RUG3 4EN8B 5C33A 1UIKA 2WO2A 5CVRA 3SISA 4A3ZA 1YI9A 1CAXA 3OBRA 4OQ8A 1W04A 2WFF1 3M3IA 3VHRA 3ZYFA 2GH2A 4ISQA 3VDCA 3AJZA 4WM7C 1UMHA 3WQ0A 4XXPA 2IXKA 4ATEA 3VZLA 3F95A 1OLQA 4ZU7A 2F6BA 3AP9A 1JYNA 2PHRA 3ZXAC 3POWA 4QB6A 5EQUA 1DG6A 3PURA 2YXSA 4UW4A 2E7TA 2BDRA 4XBQA 2R1BA 1V70A 2I74A 2WQ8A 4H2AA 4WM8A 2QQNA 1AX2A 1MACA 1LEDA 2D5HA 3FUOA 4FOWA 5C71A 5BXXA 1O8PA 1VBD1 2OPKA 2GC1A 2A6VA 3FZ3A 1TMF3 3RFRA 1PGSA 4JC1A 2JDKA 2CGNA 1CZTA 4XUPA 1F35A 4AI1A 1VBE2 3RZHA 3RZKA 1ENSA 1UYXA 1S0GA 2XG3A 4GMP1 3ZX7A 1N3OA 3EYPA 5FP3A 1YQ6A 1PVC2 2ZMKA 1X33A 1CPMA 1NG0A 2VXJA 2VBDA 3MW4A 5JUVA 4G3YC 5FLIA 1CQ9A 3ZYGA 5CEHA 5HPOA 1ZX5A 3AX4A 1NY71 4M3CE 2X53S 3T0AA 4XURA 3QH7A 4BJ0A 4K20A 5J7MA 1HRI2 3W20A 4C0BA 2VUJA 5F6KA 1UY0A 4XUQA 2IXIA 4AFCA 2ILMA 2JICA 1BJQA 1D2SA 1O5LA 2VAUA 4QXCA 4COWA 3BPZA 5FPUA 1JW6A 1GZ9A 4N43C 4FO9A 2P3KA 4Q4W3 1JZ7A 3F2ZA 5KHIA 4XFCA 4EWAA 2VXRA 4AVTA 3OBZA 1PZ7A 2GN7A 2P34A 4OI4A 4A7KA 4QKDA 5LEJA 4C0HA 5LBEA 2WZ8A 5EJ3A 5FKCA 3C3VA 4UW6A 3IAQA 3WY6A 1WA4A 2RJKA 3C7EA 4LBQD 3ZMNA 1Z7S3 2XOMA 4MSVA 1JU4A 5T3NA 3NL1A 2VPVA 1UW8A 5JOXA 1QJU3 4OYUA 3GJBA 4FP3A 1ULDA 1GICA 4RL7A 3LKJA 4JHZA 4Q4V1 4XJWA 1RUC2 3BU7A 1HKDA 1UO9A 2AREA 5FP4A 4CEYB 4Q0UA 2VUAA 1W6NA 1LRHA 5DPNA 3PUIA 2DURA 2EAKA 4W6YA 3GNEA 3C2UA 3RG0A 1PK6A 3EB7A 5DAPA 1G9DA 4DNYA 1LHUA 1QOOA 1SCSA 2IVJA 4IDZA 2O8QA 1S0CA 3I3EA 2XB6C 2CAVA 4CEWA 3H1YA 5GZCA 2Z42A 1CAVB 3RVHA 1V9U3 4RR3A 4D6QA 1GWKA 4XJZA 4O7XA 4XJUA 5KXBA 5AVPA 1Z7S2 1K12A 1V6LA 2DUQA 3AKTA 3N35A 3VBUC 5F5CA 3W5NA 4XQ4A 2GDFA 5CFCB 1HV1A 1OA4A 2J1AA 1TME3 2CY6A 1B35A 3LD8A 4OHZA 4YGDA 4M0HA 2MPFA 1DGLA 1PGW1 4L9BA 2B46X 1H1IA 4RGKA 1HB3A 2WN3A 4PLNA 4QX8A 5C70A 2YFUA 4OHWA 4XE9A 3K3OA 4KU8A 3ZPYA 1YFWA 4B4RA 1TE1B 3GHMA 4E27A 5JAXA 2OQ7A 2BERA 5CYYA 1GP6A 1C57A 4QD2A 1HJGA 5LCWL 2BPA2 2HWD1 3PVEA 3LAGA 2UWAA 3BPSA 3O0WA 3T4VA 3KV5A 3MPPG 4GWMA 5AFEA 1BMV1 1PVXA 5BNPA 1LGNA 1WLWA 3JCIA 3AMQA 3MLLA 3IDBB 4CVUA 1A6CA 2WDBA 4HPKB 4LE3A 2WNVA 4YVWB 1NCQC 2O8OA 3MV01 2Y33A 4ZPIA 3ROUA 4NHYA 4W8JA 3SQOA 1LB2A 2C4XA 3LEIA 3WCSA 3IPVB 3JD72 1JI6A 1CJPA 4IETA 3KMHA 3WQ7A 1YJKA 2HYXA 2YGLA 3GYDA 5A7SA 2A71A 3AVRA 3EQEA 2LALA 5FXZA 1RUE1 2D7FA 2ZOEB 4IUGA 4CEWB 3MDPA 1F8VA 1O3SA 5CU1A 1ASJ2 5IJRA 2ZGNA 1D4M1 1NCQA 4OUSA 4QB2A 1FMD1 4XIOA 4UFIA 2JDHA 3Q8EA 4IEOA 5F2WA 3AP7A 1BVVA 1BZWA 1EV12 2IXJA 4IL7A 5F32A 1AR81 1CGPA 2ZX3A 4JKLA 5FY5A 3ACGA 4IE0A 1W6PB 1KITA 1PMHX 2BVBA 1RMU2 4HANA 5L9VA 2RR13 2W5FA 2RDNA 4XUOA 2Z5WA 3T2OA 3VL9A 2OUHA 4LLFA 2P5BA 4KNCA 1ENRA 3KV9A 1V6IA 3I3QA 2VZQA 1WGPA 4Y22B 1RUI2 5F5QA 3ZPOA 3I2GA 3O1PA 2NYYA 5CKQA 1MZ6A 2OUJA 1AR91 4N53B 4LK6A 1UQXA 1XSQA 4V2VA 1YI7A 4FFHA 1HV0A 4INDA 1MEC2 4BQ3A 1XBFA 2DCYA 4JQTA 1JZ4A 3S5AA 3TEYA 4FAGA 2AUYA 4XFAA 4UFLA 2B39A 4XAAA 5KXEA 4Q4W1 1LGBA 4TZDA 1MS1A 4K1YA 1JHNA 1QEXA 2CGOA 1DGRA 1XE0A 1XNCA 2FMDA 2GC0A 4YVSA 1JUHA 4M4PA 1N3QA 2QKDA 3VBUA 1UYPA 2VNRA 3GJAA 4R8HA 1K45A 4AOCA 1JZ5A 4AEMA 3OGVA 5DMYA 5APAA 4JDMA 5GKAC 5JOYA 1RB8G 1PM7A 3LA3A 4FPCA 1RITA 1OT5A 2I07B 5CFDC 4NPLA 3IPVA 1KD7A 1U12A 3OG2A 1YWKA 4UXAA 1UZZA 5LBFA 4B1LA 1UOGA 3QH6A 3SC7X 1PIV2 5HXMA 4AEDC 2WNVB 1A8DA 1GNZA 1UPSA 3I2HA 5F3GA 4BLJA 3NQHA 2R062 5JZGC 1H1MA 5ACA3 1S2BA 1NXD1 1KJLA 2E7AA 4KH9A 3GALA 2WQ4A 2ZA9A 5LW9A 4XUNA 1C1LA 1WMFA 1LTEA 2X5IB 1RUC3 3POYA 2J1UA 2W91A 2W87A 2D40A 1R1A3 4YW6A 3P6BA 1N1TA 3UGHA 1NLQA 4J1XA 3NW4A 4Q26A 3SNMA 3ZFFC 1A8MA 1CPNA 1VB4A 1NE4A 2Q0AA 5D2AA 4A45A 1JMUB 1COV2 2I45A 5B2GB 4COYA 2YMZA 4MUVA 4YW1A 5CKNA 1HB2A 2QZ3A 2A5ZA 5D21A 1LAJA 3N9NA 1WUVA 3ATGA 5JPNB 3FMGA 1M06G 1CN1A 4D7YA 2HWF3 3K4ZA 1JYWA 3QLQA 1TG7A 1UX7A 2R043 3CZUA 2GNDA 4WBBA 3ZFFA 1DQ5A 3IN9A 3I4IA 1W8OA 5LRRA 1REEA 4AQTA 2VM9A 2G4IA 2XWBB 1SEFA 3P3NA 1RUH1 4NN0A 4AFMA 2OIIA 5FPZA 2FDKA 5HCAA 3LZZA 2W92A 4B1MA 3T2QA 2YPDA 1JN2P 4JGYA 1RUC1 1K5MB 3ABZA 2ZX1A 4FFGA 3HT2A 4FPKA 4NR1A 1XNKA 2AH2A 2JWPA 2YC4A 2PELA 2R1DA 2JG8C 1Y9MA 2D6OX 2RM22 3MICA 3M70A 3LF7A 1XNDA 1ND2B 2XMLA 4YPJA 3KGLA 4CU8A 3VD4A 1UNBA 5IVYA 3A22A 5GJ6A 1UY4A 4Y4YA 3UL2A 5HV0A 3AP5A 4L0PA 2HEWF 5FZGA 1ZBA2 2ZGQA 1N1VA 1OFNA 5F7UA 2WA4A 3DL3A 4OMCA 1ULPA 4QXKA 3PUSA 2BOIA 4XF1A 4R9DA 2Z4FA 3WXPA 5FMBA 4X6RB 4N43A 3ZMOA 4ZKTB 2WLQA 1W3XA 1LGCA 2GNTA 2PMWB 2Q5TA 3PIGA 1AX1A 4HKLA 5FZIA 3SEEA 3M4FA 3BKZA 3S30A 5CNAA 3VKMA 3MFAA 3SEPA 3KD4A 4JGZA 1W8UA 2PHXA 4XHXA 2YHJA 4AZZA 3MZHA 4RSUA 4LITA 4H3WA 5A33B 3B7MA 3NJYA 1ZBE3 3EMRA 2ADDA 4XVHA 4D7SA 2YB7A 5JWPA 2X29A 5EYXA 1VBB3 3T1LA 3HJRA 4YW7A 3IWZA 2WLPA 3OYWA 1ULFA 2UWCA 2XJQA 2ZZQA 3J8F1 4LKFA 3ZXDA 3E1F1 4META 4QPIA 4BIFA 4CCOA 3OGJA 4XZUG 4YGCA 4B8EA 5K4LA 4Q8KA 3PU3A 4V1PA 3TB0A 1AR83 2PYTA 3G6JB 1W90A 4PBPA 4XTMA 1REDA 2WBKA 2E32A 1SPPA 1UZWA 4ZU4A 3VD3A 1LU2A 4C8DA 1G9BA 5F3IA 4FI9A 2P2KA 2ZEWA 4LO5B 1IG3A 3J26N 5DAWA 1RUJ2 5JOWA 1IKPA 1KS4A 4XCBA 4JV4A 1PO11 1TZOA 5DUUA 1FNZA 2ZX4A 3HWJA 1LULA 5FJHA 5K0UA 2GNBA 3VBRA 1ZZ6A 2Z79A 4CU7A 1LODA 4IE4A 2ZXQA 2P6CA 3FHIB 3ZVXA 1Y9QA 4H7MA 1E5HA 4QHBA 4YW5A 2XBO2 1PK6C 4AHXA 2BNNA 1ZNPA 2P1BA 1PMJX 3I3BA 3LSDA 4YGBA 4BB3A 4NWWA 3N9OA 1AJOA 2BZDA 4XJAA 3V0BA 4RHV3 2FCUA 1AYM3 2VECA 1OUXA 3VBHA 2VQTA 2DCZA 1SHWB 2WL1A 3PU8A 3N3HA 2ZGLA 4NIHA 1K5JA 3WDTA 3ZFEC 4CU9A 2HWB2 2XBO3 2XJUA 3C7FA 3LPFA 1JODA 4FOYA 2D6PA 2C0ZA 3GF6A 3POFA 2VZ1A 4Z2AA 4PJYA 1W28A 4JGYB 2B45X 4DEQA 5DUVA 3J8F2 5FK7A 1GKBA 1Z78A 5FZDA 3VDAA 5DDJ2 4ZHNA 1C4RA 1LCLA 3VD5A 5J98B 1OOPA 3WQ1A 2DFBA 2RDRA 3ZYRA 4XCAA 2MEV2 3HN3A 5FY9A 5JI7A 1ULOA 4HZFA 5FZOA 5LA9A 5A7PA 5A1LA 2W1SA 2KXLA 1YQ5A 4IESA 2VCMA 1RUD1 4CCCA 2WR9A 3WF1A 2GP5A 2W0XA 4LKSA 2QQKA 4UI9L 1AL0G 4UW5A 3USUB 3K77A 4E2GA 4CUBA 5LBBA 1IS5A 1VBB2 1NT0A 2DVDA 2WO3A 3GZUC 5FBJA 1OLMA 2C24A 3UYJA 2J1TA 2XUMA 5FYSA 2VMIA 4BZ4A 1JOBA 1FV2A 2OXBA 3KT7A 3R0RA 2DTWA 3DYPA 4TXWA 3RPQA 4QGNA 2IZWA 5EYYA 2XVGA 3BU0A 1NLSA 3O12A 4K1ZA 1W8TA 1LR5A 4OZXA 5A7NA 4OHYA 2W2IA 4FXGB 3BOWA 5C9AC 1Q56A 2ES3A 2GC3A 3J7LA 2XHNA 4W6XA 2Y8KA 5CA6A 3N7MA 4LO7A 1T6BX 4X6QB 1WW4A 3U0ZA 5FO7B 3ZN5A 3O5SA 1LJ7A 3KF3A 1EAH1 1OA3A 4IV3A 1UU6A 3MUY1 1YLLA 4UAPA 3E6CC 4LHNA 3DYOA 1WCKA 4DQAA 3LGRA 3MW3A 4WM7A 3RZZA 3A0NA 3MEPA 1ZRFA 1W9SA 1DQ4A 2HWC3 2OKXA 3ZN6A 3WDWA 1MEC1 1W6MA 2UY8A 4HVQA 1X8MA 4HSJA 4QDSA 4QPGB 4PIYA 5A3OA 4QPIC 3OUIA 4CUGA 2E26A 4GJYA 1S0IA 3BIWE 3J9SA 1C8M1 2YU1A 3WINE 1DFQA 4RHV1 4YM1A 3OGRA 5A6ZA 4OULA 3MIDA 2DU1A 4LO4B 3VKLA 2WSVA 2HH9A 4PCRA 1ASJ1 4P9JA 4YVSB 4NRMA 1XB9A 1O4ZA 1KXGA 1Y4WA 4HLTA 4AQSA 5IAXA 5IVEA 3NSTA 1WLCA 3CJIA 2CYFA 3MHZA 1H30A 5EZWA 2RM21 4O9EA 1H6XA 5FZ4A 1UKRA 3AB0A 2YZ4A 4A2UA 5A6YA 4JVAA 1W9WA 3A23A 3V0BB 2A6XA 4QQ2A 4WZCA 3NMBA 1IGOA 1RUG1 2FZ1A 1GLHA 3MF9A 3U11A 5DUWA 2WNOA 4GKYA 3SCHA 3I7DA 2ID4A 1OD3A 1Y9GA 2MHFA 2DYCA 4JZRA 1S2KA 3C7GA 5GLZA 2BTVC 1ZRIA 2GZWA 4WVZA 4Q4X3 5FMOS 3WQBA 4WV8A 5C5TA 1QKQA 3NNMA 1DYOA 4BXFA 1PZ8A 3ZSEA 5C3QA 5L19A 3J8F3 4KMQA 2D5FA 2UY9A 1SBFA 4AVBA 2QDRA 3RYPA 4A6OA 5J09A 1NAEA 4UFHA 1RINA 4Q0VA 1NLRA 1SMVA 3VBSA 2LM3A 5FUIA 1W2AX 4S2DA 4EZHA 2LTNA 2RDSA 4RGAA 5K7PA 1R083 3JBG2 4LO8A 3VBHC 3V0AA 3L2YA 1V6KA 3WT3A 2ARBA 2WFF3 2WRAA 3G7DA 5BNOB 3SH3A 1FATA 1STMA 1Y43B 1PO13 4CCJA 2VNOA 4BWOA 2YV8A 1W6MB 3MV11 4YLZA 4B7EA 1H4GA 1W0NA 2DV9A 4QKFA 2XL9A 2KR2A 3PMEA 4G9SB 2VR4A 4XDOA 4ARYA 4FP2A 1ZZCA 3WUCA 3C8XA 1W8HA 5C8WA 1RUNA 3SXWA 4PLMA 5LATA 5A3TA 1PIV1 4PQ9A 5IVBA 1DQ1A 3OOXA 2OYZA 4L99A 1AL21 2V5YA 2LW8A 5C3SA 1UPIA 4FPGA 4GB32 2VMFA 3CDZB 2A70A 3APBA 2W3JA 5F2SA 5M0TA 1OSGA 4HKWA 1SZBA 2PHWA 1VBC3 1MEC3 1O5UA
chains in the Genus database with same CATH topology
1VB2A 1OOPC 5CG9A 3KT1A 5CAZA 1PNFA 1UD1A 4H55A 3WVJA 4YSFA 2UURA 4K21A 3OY8A 1SACA 1QXRA 1S0EA 3UKNA 2R071 1QJZA 1ONAA 1QJY2 2PHFA 4AI8A 4RS5B 1CJDA 3JD71 3L2HA 5DG2A 3TWIA 2PFWA 2E7QA 2VG9A 1PK6B 3AZWA 2D44A 2DCKA 4Y26A 1CESA 2VQ0A 3S6PA 2WQZC 1S1AA 1UMZA 3IIAA 4X8PA 5DUXA 5E8AA 4CEYC 4LTAA 4I01A 4LHKA 1RHI3 1DZRA 1BQPA 2NP0A 4KWLA 4GB31 4XMIA 3VUOA 1Q43A 4AWDA 1NA1C 5H9PA 5I8YA 1RUE2 4Y24A 4IEYA 4ES8A 3USSA 2NQYA 5EV7A 2PA7A 2QVSB 3ZYJB 3ELNA 3PHMA 1WCDJ 1EP0A 4GXLA 4Y20B 1EAH3 3B9CA 2EALA 1CR7A 3ZIWA 1AL22 1H9WA 1VBD2 4AXOA 4CP2A 2F4PA 1BEV1 1FNYA 2R30A 2YC0A 4K7JA 4LBQA 3W58A 3WNXA 1FI2A 2CNAA 4MV2A 4YYOA 1R082 3WG3A 2VOVA 5JCTA 2BWCA 2TNFA 4IXLA 1PGW2 2WNEA 2W39A 4Z92B 4FAHA 2DCJA 5K0UC 1KJRA 1TMF1 1RUJ3 1WBLA 2W52A 5FTTC 4W65A 2FMYA 3V64A 1I9RA 2JG9A 3JBG1 4F83A 4FPFA 1OLRA 2XJRA 3CNAA 3DPRA 4OVEA 3QD6A 5T5LA 5JSPA 3OF1A 5DDJ1 3R4SA 4CDXB 5C4WB 2JECA 2ZHKA 3TRSB 1Q8OA 1NCQB 2R073 2WS92 3KSCA 4AGGA 1ZBE2 1XXNA 5L36A 4GA9A 4LO6B 2R063 2ZGTA 4BPZA 4AHYA 2RS51 1Q3EA 5FLHA 4LNVA 1IKQA 4N53A 2IFWA 1IS6A 1SLCA 3E6DA 4L8QA 4LUKA 4U2AA 2HEYF 4AYUA 1A78A 1N1YA 4XBNA 2NLRA 4XYXA 2C1FA 1QQP3 1NQDA 2UYAA 5F1RA 3UJOA 2C5DA 3ECQA 3Q9OA 4GH4C 2RS31 2KA3A 3N7KA 5JPMB 4XQWA 1OOPB 1ZBA3 4Y1YA 4YGEA 3N36A 1LOGA 2BYVE 3IDEA 1I6XA 4R4XA 5KHGA 3LB9A 2DTYA 1IQAA 3ZYIB 4O9GA 2RR11 2PAMA 3M3OA 1BK1A 1VBE1 3ZIXA 5I8SA 4QQOA 1X82A 1JYCA 5EWSA 1O7FA 2ZGRA 4GMP0 4LLOA 4WVVA 2CTVA 1PVC3 1IZ3A 4IEZA 3VBOC 2WIIB 4Q0PA 2CWMA 3KGZA 3M3QA 1HRI1 5L7OA 4S2HA 4OUMA 4BYYA 1CAVA 4C1XA 2OW4A 3RYRA 1EV13 3VL8A 1JUIA 2GN3A 3ZN4A 5AC92 5HCBA 5BNNC 3ETQA 1D4VB 1O4TA 2WT2A 5I0TA 4I30A 1TME2 4PIZA 3H1WA 2HWF2 2X5IA 2B8MA 2PHDA 2UU8A 3JUUA 4PLOA 4Q1PA 4FSJA 1OFSA 4COVA 2GMPA 4B4PA 3RSJA 4LBLA 2YYOA 5SV8A 1LOEA 3X29B 3UKVA 2BW8A 2DCTA 2NM1A 4J6GA 3K51A 3AMHA 2DF7A 1V9U2 2QFEA 2XVKA 3MLKA 3V65A 4DRVA 5A32A 4Q8LA 2GALA 1AX0A 2HWD3 3VHPA 2X5IC 4YG3A 1PGL1 1VRH1 1Q5OA 2Q1ZB 2DU0A 2WZR1 3VKOA 1LOCA 4BOWA 5KXDA 1MS0A 1G9CA 4AF9A 5ACA2 4J1WA 2BFUL 4AI3A 3NKTA 4KL1A 1JTZX 1ZA4A 1C8NA 4Q1RA 2JJ6A 5CG8A 1V6MA 2HJIA 4Q0QA 3H50A 3H8UA 5KHHA 1RUJ1 2EXHA 3ACLA 2XJTA 1PHMA 1WMDA 5JR7B 5IT6A 4LBJA 3NV3A 1A3KA 4AVCA 1DQ6A 1MVQA 3AYAA 1RVF3 2RMU2 3JQWA 1IOAA 3WDYA 2YPJA 1BBT2 1BEV3 3BTAA 2R0FA 1W6QA 1YJLA 3SCGA 1HLCA 2PLV3 4A3XA 2HWE2 1G7YA 5EFUA 1AYN3 4EWEA 2Z2SB 4CRQA 4L11A 4FPLA 3WP3A 3HMYA 1C8M3 4UBHA 1MZFA 4SBVA 3D0JA 1R1A1 1VALA 2EAAA 1CAWB 3ENRA 2FHRA 3EJKA 2ZPXA 4ISRA 4NWVA 4QQPA 5J36A 3I59A 1GSLA 3OYWB 4JGZB 4N7IA 1PO21 4ATFA 5A33A 4AVVA 2GMEA 3AZZA 3BB6A 3SH5A 4AI2A 3S0MA 3AZVA 3T1MA 3KCXA 1QH6A 3K48A 5A32B 1YCIA 4CP0A 4N9IA 4CDQB 2HWE1 2D43A 1H8VA 2RS11 2RS13 4FPJA 5L7OB 3JD73 1HRV3 1KFXL 2ARXA 2CWSA 4HK9A 4HETA 4JRLA 1OMIA 1Z0HA 2ZGMA 3OJBA 1TNRA 2MEV1 4ZU5A 1VAMA 1JXNA 4P5HA 4XTPA 1WCSA 5FOBB 2CL2A 1R091 4XEZA 5GZEA 1VR3A 1AJKA 3VBOA 2FZ2A 3NKGA 1MR5A 1RUI3 3WW4A 3AYDA 4XW3A 2H0BA 2ZX2A 1AVBA 1FYUA 2PAEA 3VKFC 4MXVA 1GZWA 4FQZA 4MH0E 3H3ZA 5FCCA 1O4YA 3E5QA 2ZMLA 3H7JA 2PTMA 3VZMA 1VP6A 1AXYA 2DVBA 1NZCA 4DPNA 2Y0OA 4ORFA 5C8CA 3VZJA 2UWBA 1XYPA 4WM8C 2Q8OA 4GULA 3WR0A 1ND3C 2XBO1 2RS12 5I8TA 4AQ2A 1M4WA 3S7IA 3ASIA 1COV3 2GU9A 5BV6A 3WV6A 5C9AA 2P17A 3SLIA 1PGL2 4YZ5A 4IEUA 3O0XA 2NMNA 4B7KA 3E97A 4QGLA 1ZYBA 1AR73 1D2QA 3SITA 4C91A 4F8AA 4XJ8A 3URFA 1TEIA 2C9AA 3FUQA 5BYNA 1Q8SA 4FT8A 1J3PA 5KC6A 2BGCA 3A0KA 4LEJA 5CBLA 3AM2A 4L2NA 3TN92 1OQ1A 2BQPA 3AMNA 4Z8BA 1H8TB 3HN1A 4BH9A 3FX3A 1U5XA 1DF0A 2RJLA 3CJIB 3HQXA 1Q8VA 1RIRA 2PHTA 4RGGA 3MI8A 2R061 2WT1A 3I59B 3NWKA 3OGGA 1EPZA 1B35C 1NXMA 3KCCA 1XE8A 5K9YA 2NPIA 4PDWA 4MGYE 1G86A 1I5ZA 3JB8A 3IT8A 4EWDA 4CEYA 3OCPA 4N43B 2XJSA 3BALA 1NCRA 1Y7BA 2TBVA 3ZFGB 1EY2A 4EJRA 4H14A 5I0UA 4NVPA 4LBNA 4I0BA 5HBAA 1F8VA 3H7YA 4B3NA 1HRI3 1RJ7A 1AUYA 4XDQA 1DQ0A 3CLPA 1W39A 2RS32 3VDDA 5GM0A 1RUI1 3BODA 5BY5A 1BKZA 1HIXA 5FAXA 1WW5A 1HQNA 5T5OA 1RUH3 5JSOA 1VBE3 2VOWA 1RUD3 1LOBA 3ALQA 4LBQB 1XYOA 3B3QE 2GH8A 1N1SA 1QH7A 4QMAA 5A3LA 1MQTC 1TMF2 3VBSC 4DY3A 2ZMNA 4AHZA 2R0HA 4IQPA 2JEMA 1ZRDA 1ASJ3 1POV0 4FTBA 1UF2C 1YNAA 4Z82A 5FMOL 3MIFA 4GQ7A 2RE9A 3MIBA 1YFUA 2EXJA 1QU0A 1K5MA 4Z1VA 4PF5A 1HXS2 4L92A 1SFNA 4JTOA 4Q4X1 2K0GA 2QE3A 5C8CB 2QJVA 4XF4A 4I0AA 3P3PA 2TUNA 3IBMA 3B02A 4CDWA 4CDUA 5A3MA 3AKPA 3CO2A 1ND2A 3TNPB 1SBEA 4E9KA 4KGGA 4KQ7A 2ZACA 1I1EA 3U07A 4C1WA 4G4FA 2RS53 2VW0A 4XFHA 3LA2A 2AZ5A 4HPKA 3ZFGC 1AR62 1VBA1 1FOD3 3HAGA 2RM23 5KWRA 2QQPA 3OY8B 3RDIA 1VAVA 1FXZA 5CFCA 2WWSA 5FQ0A 3AMMA 1SLIA 4QGMA 4EN0A 1B35B 2ZX0A 4MXWB 4AGVA 4RS5A 3UKTA 4JAAA 1H2KA 2HWE3 2PLV1 3OBTA 1BBT3 1BEV2 2RMU1 3WDUA 1ND3A 5FO9B 5LRSA 3LOBA 1RVF2 1NCRC 1LKNA 4MGIE 1D0HA 4B4QA 1QXJA 5BNOC 5D1IA 1YIFA 1LHWA 4RQPC 5J48A 1DYPA 3VBSB 1RUF3 1W2UA 5JDBA 2QUOA 1YFYA 3M3EA 1ZRRA 2IC1A 5LK7B 2VY0A 3VLBB 3CJXA 4U36A 3VBHB 5AFBA 1LESA 2GSYA 1BXHA 4P14A 3INAA 3SMHA 3M7AA 1RUH2 4LULA 4M0NA 4YG6A 2R072 2WS93 1O3TA 5CB7A 1CIWA 1D4M3 1QNYA 2OA2A 4W6WA 3WW2A 3VBUB 1C8M2 5LEKA 1WW7A 2DVFA 4AFAA 4BLIA 5JSRA 2IXLA 3FLPA 1AYN2 1X8EA 3R4UA 4ES9A 2PLV2 2R32A 1UCXA 4YVSC 1TME1 1IS4A 1ENQA 4HL0A 2SLIA 3FLTA 1V00A 3VZKA 2UYBA 1R1ZA 4BM8A 5FPXA 3EBRA 3RJRA 2TEPA 1FPN2 3VHOA 4LBKA 1OD5A 2YGMA 3DUIA 2ZGPA 2XL7A 1OI6A 3DKWA 3DPRB 2GC2A 1ENXA 1G8WA 4E4SA 2OZJA 4XFIA 1J3QA 5C4WA 4CDXA 4HMZA 3JU9A 3HD8B 4I09A 1YFXA 1E57A 4HBNA 4JDOA 5GLWA 4Q4Y3 5EXOA 3T2TA 4AFDA 2ZTNA 2IFRA 2EVXA 4XHBA 3AYCA 4OFGA 2A3XA 4LA2A 1J59A 1VBB1 2HEVF 2HWD2 4IV1B 2WZPP 1KS5A 4YM3A 4Y1UA 2XLFA 2JG9B 2Q4SA 1IPJA 1YIPA 3RJ2X 1AR61 1ZRCA 3EO6A 4WM7B 5TSWA 5FLJA 5KC5A 1OPOA 2D3SA 3KQRA 1O3QA 2BUKA 3GHNA 3LSEA 4L97A 4LR4A 3SCFA 4LUMA 3MGUA 1TQ5A 4AK3A 5FREA 1GQGA 3RQ0A 1QHDA 1RMU1 1YYNA 2VOXA 1FV3A 2VULA 5SV5A 1XQNA 2XGXA 5T52A 3J4UH 2HWB1 3AP4A 1YXWA 3VBOB 1FMD2 1FOD1 2BVVA 2JXAA 3UK9A 3WUDA 2RS33 4BHPA 5JLVA 1OPMA 4XFFA 5KBFA 2IXCA 1QOTA 3NV2A 1LU1A 4E4DX 3WG4A 1R092 1C1FA 1U5YA 2CAUA 2LUWA 2MEV3 2ZHMA 4DMIA 3HIFA 1DZQA 1XRUA 1XU1A 1SLTA 4XFGA 2RMU3 1I3HA 3B94A 3EHKA 5BNPB 4Y1XA 2ET7A 4FPEA 5HXVA 4NPRA 4YM2A 1AR93 4AGRA 3JZVA 2B42B 4E4ZA 1G9AA 3MPBA 1D0GA 4I02A 3V0AB 2BBVA 1DGWX 2WNUA 1QJU1 1HDKA 1RVF1 3D6EA 3MFCA 5LK5A 3NVCA 5T5JA 4LBMA 1ZZ9A 4R9AA 1RJ8A 5KHJA 1RUF1 2WNUC 5J3UA 3AKSA 2D6LX 2A7AA 4IEXA 3JBG3 4FXKB 1NY72 4OI1A 4DB5A 3NO8A 3VGIA 2FQPA 4XIKA 4HT1T 1VJ2A 1VLNA 3QCWA 5GALA 4XETA 3ZXFA 4EN6B 4BIOA 1UL9A 4DS0A 1DBNA 4UBGA 2DUPA 2P3JA 1U5ZA 2A3YA 2A3WA 4YFWA 1AYN1 4FBFA 4H7LA 5FDBA 2ZGUA 3RI9A 3JQXA 1IS3A 1PMIA 2D3PA 4LHLA 2CV6A 2R16A 3GBWA 2W68A 2I2SA 4PDWB 2VQAA 4LBOA 2Y38A 4K9SA 2VW1A 3BOPA 2RHPA 3VBFB 5AC93 4FOVA 1W6QB 5IK8A 3D82A 4MX3A 4YNIA 3ZXLA 5BNPC 1C3HA 4AG4A 1ZREA 3ES1A 5GLUA 3RMXA 3B9IA 4FPYA 4UW3A 1POV1 1QDCA 2BWAA 4Q2FA 5T55A 4CP1A 4WM8B 4Q4V2 1VBD3 1NOVA 1MZ5A 3PVNA 4FOQA 3PTYA 5I0RA 4OI0A 1AR63 2DVGA 2QDNA 1OA2A 2ZZJA 4P9IA 5D8AC 1H2MA 4IEWA 1NYWA 4AEDB 2X8KA 2A6YA 1NA1B 2VW2A 1VRH2 2BEOA 2EA7A 3ILNA 4R9BA 4Y22A 1Q8QA 1HRV2 1AHSA 1MS8A 1GV9A 1QQP2 1ZZ7A 4MXWA 4RR3C 1QJX3 1QJX1 5I93A 2E51A 4YM0A 5FFOC 4Y20A 2XHKA 3R6SA 4CDWB 1MVEA 5L7OC 4BMEA 4D7TA 1RUD2 2AYHA 5ABJC 4A7YA 4JGYC 3PNAA 3ES4A 3E5XA 1LENA 4Y5Z0 5JIUA 3B69A 1BVP1 4N90A 4SLIA 1CAXB 3WDXA 4CDQA 1O3RA 5JOZA 3TBDA 3ZN6B 3WHUA 3GBGA 4HFSA 3CL1A 1XYNA 3AJYA 4RA0A 1XNBA 3H1MA 4XQDA 3USUA 3NAPA 2AGSA 1LHNA 1WLTA 2E63A 3WP4A 1VIWB 1SDWA 5DDJ3 4HN1A 1ZZ8A 3FLRA 1TNFA 5FOJB 2YROA 5IK4A 1UX6A 3V56A 5J96B 5DZEA 3FBMA 5F6LB 2EF6A 4C90A 4Y1ZA 3GZAA 4WVWA 4GALA 4CDUB 2NN8A 4M3CB 1LECA 1LEMA 1ULEA 1H2NA 4AEDA 1PO12 4YZ2A 2H6BA 3KT4A 3M2MA 1V9U1 4F7ZA 2BNMA 1LOFC 3SH4A 1CONA 3B5LB 4HVOA 4XF3A 4KU7A 4QQLA 5BNQA 2VVFA 3R4DB 1JBCA 2ZABA 1CD3G 1WMEA 1C5IA 3VKNA 3M1HA 2R6QA 3AKQA 1RGSA 3L9JT 1JOJA 1KQRA 5HCFA 3S7EA 1LHVA