5CAZA

Crystallographic structure of apo human rotavirus k8 vp8*
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
TLDGPYQPTSLNLPVDYWMLIAPTREGKVAEGTNTTDRWFACVLVEPNVQNTQRQYVLDGQNVQLHVSNDSSTSWKFILFIKLTPDGTYTQYSTLSTPHKLCAWMKRDNRVYWYQGATPNASESYYLTINNDNSNVSSDAEFYLIPQSQTAMCTQYINNGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substantial Receptor-induced Structural Rearrangement of Rotavirus VP8*: Potential Implications for Cross-Species Infection.
pubmed doi rcsb
source organism Rotavirus a (strain human/japan/k8/1977 g1-p3a[9]-ix-rx-cx-mx-a1-nx-tx-ex-h3)
molecule tags Viral protein, sugard binding protein
molecule keywords Outer capsid protein VP4
total genus 40
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2015-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cazA00
1MS5A 2DWRA 1LOEA 4GKYA 3D4KA 2A6ZA 1V00A 2D3RA 2EXKA 3AP5A 1IS4A 3WG2A 1FX5A 2W68A 2P34A 1PZ7A 2ZKNA 5GM0A 2CNAA 3WDUA 4AWDA 1O4YA 2D44A 2VY0A 4M3CE 4FPJA 4AYUA 2R49A 4ISQA 2EXIA 1AX0A 3SISA 2UURA 3WNXA 1PZ9A 2D6NA 3B3QE 1AXZA 4FOQA 1Q8PA 1GNZA 3D6EA 1LOFA 4YW1A 5L73A 1UL9A 2DTYA 1V6NA 5T52A 2R0HA 1FYUA 3IPVA 4M3CB 5GZEA 1S0DA 2A7AA 2OUJA 1PZ8A 4XE9A 1WLDA 2NM1A 2A71A 1DLLA 3I8TA 4YW2A 3ZYPA 4AGGA 3POWA 5JOYA 3N7MA 1A3KA 1BJQA 4XJUA 5GZDA 1LEMA 5T55A 1G9BA 3N7KA 4P9WA 3BOPA 2HYKA 2NMNA 4GKXA 4XOGA 2WKKA 1W6OA 2YY1A 3ASIA 4PBOA 3WG4A 4FPOB 1IS3A 2PHXA 2WLQA 1LECA 4M00A 5GZCA 1G86A 2DU1A 3BIWE 3N35A 2E6VA 2ERFA 3WG3A 4HANA 2NMOA 1W6MB 1IS6A 1ENSA 4HL0A 4BOWA 2GNBA 3LSEA 1SBEA 1V6IA 2ZACA 1LHWA 5HCAA 4BPZA 3AZVA 2PHFA 4YGCA 1H9WA 1N47A 1SLBA 1GZCA 1OKQA 3FLRA 2A6VA 1UX6A 3SNMA 3V0AA 2SLIA 4U2AA 1MS8A 4DPNA 2AR6A 1S0GA 1V6LA 2RHPA 1CIWA 1MZ5A 4DFSA 3WCSA 2PELA 2ZABA 1FV2A 3FBYA 1W6NB 4XIOA 1LGCA 1LHVA 1S1AA 1SLLA 2CY6A 1DQ6A 2CWMA 2G4IA 4YZ4A 4XBNA 1WW6A 3RMXA 1UKGA 2ZMNA 3USUA 2EALA 4LBOA 3OY8A 1Q8VA 1QNYA 4Y26A 3O12A 3FFZA 2YMZA 1H9PA 1AX1A 2ZHMA 5GLWA 2R0FA 3ATGA 5EWSA 2WT2A 3MW3A 4BMBA 1CR7A 4LBNA 1C1LA 4YZ2A 2LTNA 5DUXA 2P37A 2ZHNA 1DBNA 4XBLA 4Q2FA 3WLUA 2ZHKA 1A78A 5E89A 4Y24A 1W6QA 2VU9A 4Q1PA 1LHNA 2AUYA 2ZHLA 3OGGA 1URXA 4UW4A 1YI7A 2R16A 3WG1A 4W65A 3AXDA 1NXD1 3V64A 3O0WA 4AVVA 1QMJA 1O4ZA 3O0XA 5CBLA 1LTEA 1AJOA 3AX4A 5T54A 4Q1RA 1MS0A 4AGVA 5DG2A 1SFYA 1APNA 2JDZA 4ATEA 2PHRA 2W39A 4BLJA 5JOXA 2AGSA 2VXRA 5EXOA 4XZPA 5DZFA 4YZ1A 1QDOA 1QF3A 2EIGA 2ZZJA 2D43A 2D3SA 2JD4A 1H30A 1KQRA 1V6MA 3BODA 2WQZC 1UPSA 4Q8LA 4FOVA 4YG6A 4CZSA 3C2UA 2CTVA 2E53A 1ONAA 1KJLA 2W52A 4K1YA 4WV8A 1KITA 4H55A 1Z78A 1WW4A 2P3JA 2VW0A 3B69A 4M3CA 1UN1A 3IM0A 3VKMA 1S0BA 4RA0A 1CVNA 4MYEA 1QOOA 4ATFA 2ZGMA 1JOJA 2OW4A 3POYA 1N3OA 5BYNA 2P3IA 1BYHA 1VLNA 3O0VA 4UW6A 2A3XA 1WBLA 2UWCA 1S0JA 3AYAA 1WD4A 2ZGPA 2ES3A 1Q56A 2JKBA 1W0PA 3A0NA 1QOSA 4P9XA 1FAYA 1W6OB 2DUQA 4ITCA 1V6KA 4Q26A 1G9FA 4JC1A 4XTMA 1LJ7A 1JYCA 1C1FA 3AYEA 4P9YA 3MPPG 1QNWA 1BKZA 3WDYA 3DGTA 1HKDA 2R1DA 5E88A 2AYHA 5F9TA 1ULEA 3SH4A 4YFWA 3ZXJA 2DUPA 3HMYA 1VIWB 1MS1A 2DUOA 2VH9A 1N1TA 2YXSA 3KQRA 1QU0A 4FVVA 3AZZA 4GWNA 3UK9A 2AENA 1LODA 3AYDA 2FHRA 1LOGA 3WUDA 5CAZA 3A4UA 4LBLA 3M3CA 3PJQA 4PBPA 3WDXA 4ASMB 4F83A 3ZSJA 3M3QA 3OBTA 4NOTA 1GZWA 1VALA 3NV3A 5IK8A 1DQ1A 3N7LA 1WW5A 2JE9A 2P2KA 1SLTA 3OPZA 4R9AA 4XHBA 5EYYA 3VKNA 3ZVXA 3ZPYA 1DQ4A 3VUOA 2V5YA 4XHXA 1QDCA 1QGLA 1WD3A 3B01A 3PVEA 5SV8A 3AFKA 4JRAA 1KDKA 1VAMA 4PQ9A 4YZ5A 4FPKA 3OY8B 1LHUA 2D6LX 4TYSA 3WVJA 3JU9A 3N36A 3ZXEA 5DUVA 2D6PA 5GLTA 1JXNA 1GICA 1B09A 3V0BB 1V6OA 4OZXA 2DVBA 1DZQA 4YGDA 3O5SA 5DZGA 2UWBA 2E7QA 2A3YA 1MS4A 3R4SA 1LCLA 2FMDA 4FPHA 5JLVA 1DQ2A 1X50A 2D6KA 4YM1A 5KXDA 1F5FA 5IUQA 1DGLA 1N3QA 4FOYA 5LK5A 1LGBA 1AF9A 1SBFA 2A75A 3I4IA 1CPMA 1N3PA 1JW6A 2ARXA 1UZZA 4GXLA 5AVAA 4U36A 1JYIA 2GNTA 2ZGSA 3OYWB 4GA9A 2D6OX 2WSUA 1LENA 2NYYA 3JUUA 1RITA 3INAA 2WSVA 3POSA 5GLVA 2DYCA 4YG0A 1UMZA 4Z8BA 1AZDA 4XIKA 3ZXKA 1OQ1A 1TEIA 2ZGKA 3L2YA 3OBRA 4YZ3A 2DU0A 5H9RA 2E51A 4UW5A 1W6PA 1GKBA 5JOZA 1G9CA 1WLCA 5DUUA 2GNMA 4LBQD 1W0OA 1Q8QA 1CONA 3WDWA 3SLIA 2EAKA 3LCPA 1D0HA 2R1BA 2C9AA 3APBA 2EF6A 2DV9A 2GMEA 2D3PA 3V0AB 1I1EA 2Z42A 4BLIA 1G7YA 2CL2A 4C1XA 2DVAA 1NLSA 4XJZA 5IK4A 5KXCA 1CJPA 2GMPA 3B00A 5CNAA 1KRIA 3NV1A 3M3EA 3NWKA 4R9DA 3R4UA 1W6NA 4BMEA 1SLCA 1RINA 1GZ9A 2Q5TA 4YW4A 4FP3A 2UWAA 1JBCA 4XJAA 4YM3A 1G9AA 1IKQA 4LBQA 4IQPA 1IS5A 1ULFA 1GLHA 3AYCA 3B9CA 4YM2A 3RG0A 3WCRA 4P14A 5IT6A 3WV6A 4Y20A 2ZBJA 1ULDA 2GN7A 2P3KA 1LOAA 3M2MA 4YGBA 3MEPA 3RRDA 1JHNA 1W6QB 1MACA 3FUQA 5JOWA 1BXHA 4Y1UA 3QLQA 3T1MA 3A0KA 5T5LA 4YM0A 5IK7A 5GZFA 2VW1A 5T5PA 1GSLA 1DYKA 2A6YA 1FNYA 1R1ZA 1YRZA 4DS0A 2NZ9A 2XB6C 1GV9A 1ULCA 5T5OA 1J1TA 1EPWA 3AJZA 5KXEA 1HQLA 1MR5A 1LGNA 1U0AA 2GMMA 1F9KA 1SLIA 1DFQA 3M1HA 4YFZA 1I3HA 2PHTA 2VUAA 3SH5A 3GALA 2EXHA 4R9CA 1AXKA 4GALA 1GNHA 3UJOA 4CTEA 2JE7A 1DQ0A 3IPVB 3AZWA 3BTAA 4FPYA 4JCKA 3VKOA 2WNEA 2GNDA 2JECA 3ZSMA 1D2SA 1G8WA 2EXJA 1RIRA 4C1WA 2ZGTA 1CPNA 1KJRA 1Q8SA 2ZGUA 2UU8A 3ILNA 4LBKA 4M01A 4R9BA 4XYXA 4Q8KA 2VW2A 5JDBA 3MW4A 1LEDA 2AH2A 1XQNA 4XBQA 3RQ0A 5HCBA 3AP7A 3NV4A 3AXEA 4AVSA 5F5QA 4ZKTB 2A6WA 1LESA 4XDQA 3DUIA 1QKQA 4BQ1A 2ARBA 4K21A 5DZEA 3UL2A 4AGRA 5FREA 3RSJA 2I2SA 3ILFA 2JJ6A 2GALA 5E8AA 3N3HA 3OYWA 1OFSA 3WHTA 3QCWA 1UZYA 2B7YA 4PF5A 5JVVA 3V65A 1Q8OA 3WUCA 5GLZA 3ZSLA 1MZ6A 3T1LA 1AVBA 3ENRA 4FPLA 2PHWA 3IMNA 4YG3A 1GYKA 1DYPA 3TAYA 4K20A 3ZSKA 1JN2P 3HN1A 3FLTA 5JMCA 2YROA 1W6PB 3HR9A 1DIWA 3AK0A 2E7TA 1MS9A 2SBAA 4I30A 1AXYA 1MVQA 4FPGA 1SCRA 1QOTA 1YYNA 4LBJA 4Y22A 3VV1A 4BM8A 1SLAA 2ENRA 3W58A 1FNZA 1DQ5A 4GWMA 1S0FA 2DVFA 5GLUA 4DRRA 2ZMLA 1F31A 4XILA 1Z0HA 2ZMKA 2A5ZA 1YXWA 2GN3A 3WOGA 1YIFA 5EYXA 1DHKB 2NN8A 3PMEA 1N1VA 1WUVA 4SLIA 1LOBA 4FPFA 4XMIA 4WZFA 5GALA 2WT0A 1SBDA 1WBFA 4L8QA 2A70A 1ZM1A 3ILRA 1AX2A 4FQZA 1LOFC 2OVUA 3RS6A 4RL7A 4K1ZA 5H9PA 2BQPA 3VKFC 5KXBA 3V0BA 3NV2A 2DVDA 1C4RA 2CWSA 5GJ6A 4FPCA 1N1YA 5DUWA 2XG3A 4Y20B 1ZA4A 4Y1XA 3Q9OA 3PVNA 1Y7BA 1GANA 1GBGA 4FPEA 1ULGA 2KM2A 4AVTA 4WVVA 1CESA 2ZGLA 2ZGNA 3LSDA 4ISRA 3GNEA 5DXDA 4XMAA 2TEPA 1V6JA 4XXAA 4XJ9A 2A6XA 4YLZA 3VKLA 4XXPA 1S0IA 3AZYA 1AJKA 4YW3A 3SITA 3TB0A 3ZYRA 4TZDA 4FP2A 4M3CF 3WDTA 1MVEA 2ZA9A 5FRAA 4Y1YA 2ZAAA 2PHUA 1N1SA 3M3OA 3AP6A 3OJBA 3IKWA 4FQ4A 3U4XA 1BZWA 1MS3A 3PVOA 4XJWA 1W6MA 1SACA 2DVGA 2ZGRA 4DRVA 3FUOA 1HDKA 2ZGOA 4PCRA 3D5OA 4XTPA 1LU2A 2D6MA 1LULA 1IOAA 4NO4A 2LALA 3WHUA 2YV8A 2CYFA 4Y1ZA 1S0CA 5T50A 4WVWA 4ZXKA 1C57A 4Y1VA 3AJYA 4FOWA 5H9QA 1A8DA 1FV3A 1VAVA 3ZXLA 2H0BA 5H9SA 2WT1A 1IKPA 1CQ9A 1SCSA 2YZ4A 3KM5A 3FLPA 1S0EA 3AP4A 1JUIA 3N7JA 1KDMA 3SH3A 1HLCA 2DURA 3USUB 1BQPA 5T5JA 3R05A 1WW7A 3IN9A 4YW5A 3UJQA 1LOCA 3RMYA 4Q27A 2W08A 5CA6A 3AZXA 1G9DA 4YGEA 3H0OA 1FATA 2A3WA 3CNAA 4LBMA 5GZGA 1LU1A 4XJ8A 2NP0A 2V73A 2WJSA 5CB7A 3T2TA 1HQWA 4LBQB 1LHOA 1YO8A 2OUHA 4KBBA 4CRQA 5IK5A 5DG1A 1ENQA 4UW3A 3MW2A 3ZXFA 4DQAA 1WCSA 2D7FA 1ENRA 3WDVA 1GZWB 3AP9A 2GDFA 1WLWA 4Y22B 1UAIA 2C5DA 1CN1A 5HCFA 2ZGQA 3W59A 4D69A 2DTWA 3WZ1A 2AREA
chains in the Genus database with same CATH superfamily
3AVSA 4RHV3 2YU1A 1XSQA 3SMHA 1UU4A 1FMD3 2DFCA 5A3MA 4CP0A 3S6PA 1IS4A 1QQP2 2CNAA 4QM9A 2VBBA 3EMRA 4RGAA 5FPBA 4QQLA 4A42A 1NCRA 4META 2ZAHA 4OI4A 4UF0B 4WVMA 2R49A 5FYUA 3S30A 1H2LA 5FJKA 3ORJA 2VMGA 5CVRA 5F5IA 3S0MA 3ZN6A 1AXZA 1RUG3 5BV6A 4LUKA 4HPKB 4LKFA 5FXWA 2ZPXA 5HPOA 2DTYA 4J6GA 3KHCA 1CAVA 3FWEA 4OLLA 4OULA 5FKCA 5GZEA 2OUJA 3LEKA 4NUBA 5FZKA 1CGPA 1DLLA 3AKTA 1JH5A 4AGGA 5C4WB 1NLQA 3PTYA 1ZZ8A 4ASKA 2FBEA 5T55A 1FT9A 2Q8EA 2O8QA 1IPSA 3KF5A 5FY9A 4ASLA 4N53B 2WKKA 4PBOA 1QJU1 2XVLA 3VBUB 2VZ1A 5EQUA 4AE2A 3IZOA 4OYUA 5KBFA 2AZ5A 3IIIA 2VPVA 3K51A 2WLQA 1RUH3 1G86A 4A3ZA 1BVP1 2VOKA 2E6VA 1YFUA 3WG3A 5HCHA 4HANA 1UYXA 3KV6A 4XUPA 1HJGA 4AQSA 5BUVA 1UOBA 1QXPA 2GNBA 3IDBB 4XCBA 4UOJA 1ZA7A 4Z1VA 1WMEA 3ITQA 2JE8A 3VDBA 2W95A 4S2FA 2XQXA 3LWCA 1N47A 1VMHA 2RS51 4QB2A 5FJHA 3OGVA 4HETA 4OI1A 3ZXAC 4DPNA 4XDOA 1J84A 2EIEA 3ZYGA 5I0RA 2PLV3 3FX3A 1DDLA 3ZLIA 4MX3A 2WYFA 4RQPA 3FBYA 3SEPA 1S1AA 4YZ4A 5ABJA 2XGXA 3DKQA 4JKKA 4IERA 5CISA 4XBNA 3USUA 3H9AA 4DUXA 3VD9A 4LBOA 1K5MC 3O12A 5I93A 4KMQA 1FOD1 2L9LA 4FCAA 4QHOA 2R0FA 3H1MA 2EAAA 2JWPA 5C6CA 1W2TA 4LBNA 2J22A 1C1LA 1AR93 1XRUA 3CEWA 3LD8A 4GB31 1AYM1 4JGYA 4KQ7A 4M0HA 5DUXA 3OF1A 4XF1A 1K42A 2CU5A 3PL0A 5J48A 2X5IA 2WFF3 2D93A 4XBLA 3HEIA 1UOGA 2F4PA 2ZHKA 1R091 5E89A 2ZTNA 2V5DA 5CYYA 5FXZA 3WQ0A 2Y64A 5ACA2 4FSJA 3EBRA 2HWC3 5C8CB 4K8FA 4OI0A 1YI7A 4V2WA 1VBC1 2ORXA 1AHSA 4B3NA 3AXDA 1CZTA 5DAQA 1ODMA 1H2MA 3O1OA 3J7NA 4AVVA 4RFRB 1T6BX 3BGAA 1BMV2 1VBE2 3H3LA 1PGW1 2JG8C 2MPFA 2XJQA 2YC2A 4UBGA 4Y5SA 3AKQA 3VL8A 2GC1A 4QB6A 3SC7X 3K3OA 3JBG3 5J1XA 3MFAA 4Z2AA 4Y5Z0 4OHVA 4L11A 4XZPA 1UY4A 2XQRA 4Z82A 1RMU3 1R64A 1QF3A 1SPPA 4IGOA 1H30A 2QQOA 5E6HA 2VXJA 3OUJA 2FCVA 5CFCA 1LNSA 3E6DA 1HQNA 2WQZC 4FOVA 1ONAA 5FV3A 2Q8CA 4K1YA 1PMHX 2Y33A 3RPQA 2BVBA 4MGSA 1ND2B 4EN0A 4M3CA 1JYXA 4RA0A 1JOJA 4NHYA 5L7OC 2ZX3A 3LDKA 5FPLA 3KV5A 2WNOA 1PO11 4PLMA 1D2QA 1SDDB 1VE0A 1Q56A 2ET7A 4WM8C 3O1PA 2GP3A 1DP0A 5CFDC 4A6OA 1G9FA 1YNAA 3P3NA 1TME2 1UIKA 1X8EA 4CEWB 2UYAA 3WD5A 1A6CA 1HB4A 5A3PA 4NRMA 5FZOA 2IC1A 1UOFA 1W05A 1DLCA 1ULEA 2YBPA 3H3UA 3ZXJA 2DUPA 1NY72 1VIWB 2DUOA 4FVVA 1QU0A 4UI9L 4MZUA 1UXZA 2BRTA 3WEZA 3BTXA 4LBLA 4PBPA 4EE2A 4QKFA 2JDHA 3LDBA 5IVFA 4D8MA 5IAXA 3HQRA 1GZTA 4QT6A 3E5XA 4D94A 1JODA 1VALA 4QX0A 4RS5A 3KB5A 5IK8A 5LRSA 3N7LA 3OPZA 1WW5A 3HN3A 4GH4C 3WP4A 5EYYA 5F2SA 4RHV2 3T4VA 3NNJA 2VMCA 1CZSA 1RUOA 3B01A 1ALYA 3AFKA 3ZYHA 1BK1A 3MIDA 4PQ9A 4YZ5A 1U5IA 3MICA 2O0OA 4XF0A 3VBHB 4CE8A 5LBFA 3FBMA 1L3JA 3JU9A 3N36A 4INDA 1NA1A 1ZBE1 5GLTA 1UOJA 4A41A 1RUG2 2VTXA 3TN93 1H1IA 4OZXA 4AVAA 1O91A 2OQ7A 3ACHA 3M3IA 2UWBA 4YVWC 2Z4FA 3CZUA 3HNBM 5FZCA 2WZPP 1VRH3 5LA0A 1RJ8A 1DQ2A 1RYYA 2D6KA 3T09A 3BVCA 4CCOA 5C4WC 2CHHA 5JLVA 1EV12 3MIEA 1VBB2 2F4LA 1W28A 4LK7A 4LK6A 1N3QA 4PI0A 4B4RA 1LGBA 1AL0G 1AF9A 2Q1FA 3DCQA 4MH0E 2BW8A 1POQA 3VB9A 2A75A 1UZ0A 4UFJA 1HRV3 1Q5OA 2X5IC 2MEV2 1O3TA 4AQTA 4QQ2A 4O9EA 3S5QA 1BHGA 5EFUA 5AVAA 3SXWA 2D5HA 5JCTA 3OGJA 1BEV1 4Z07A 2BP6A 3MUZ1 4JTNA 1WMDA 4ONUA 3OYWB 5A3UA 1W90A 4GA9A 2Q8DA 1PGSA 2D6OX 4O9GA 4DMIA 1UPIA 3MPBA 1RITA 1OF4A 4LIVA 4YPJA 2WSVA 1VB2A 4Y5TA 3Q8AA 4DXRA 1O8SA 1HN1A 2CAUA 5IVBA 2OT7A 4LITA 1VAKA 1J1LA 3POJA 5H9RA 1RMU2 1YFYA 5LBCA 5JOZA 4YYOA 1WLCA 5DUUA 1W0OA 1Q8QA 4IEQA 2PAEA 4P9JA 3WDWA 2EAKA 3LCPA 2HBUA 4DUVA 2GH8A 1MZFA 3APBA 2R1BA 5FPZA 1QJEA 1X8MA 2WC2A 2EF6A 3ON7A 2GMEA 1PVC1 2RR12 4RHV1 1R1A1 5A70A 3I3EA 3V0AB 5LK7B 1G7YA 1GUIA 1I6XA 3VBSB 4ORFA 4R9DA 1NKGA 5K0UC 2BEOA 2JDMA 2CDPA 3RWNA 1W6NA 3KHBA 1SLCA 3TOJA 3VHOA 1H2KA 2Q5TA 2WRAA 3WP5A 1XNDA 2RDQA 4YW4A 2HWB2 4OQ8A 4JX0A 2BJSA 4XC9A 2WL1A 1GR3A 4LBQA 2DF7A 3RZGA 3RZLA 3KVAA 1GLHA 1QH7A 3B9CA 5FZOB 5IAVA 3D82A 2WFF2 4E4DX 3VBRA 1UZVA 1FPN1 4R4ZA 1XYNA 5G05L 5EIYB 5IT6A 4HZFA 2ET1A 4Y20A 2VM9A 5EJZB 4I09A 1TZOA 1LOAA 3M2MA 4YGBA 3MEPA 3T1MA 1JHNA 1W6QB 1AYM3 4QHZA 4AOCA 1BXHA 2WAAA 3LAGA 1W8TA 3GGLA 1F15A 1XNAA 4IDZA 5T5LA 1VBE3 3LFIA 5IVJA 2WNUC 4YM0A 2JG8B 3KSCA 5GZFA 5HBAA 5FLHA 5T5PA 2BGOA 3CBNA 5CADA 2VUDA 4MGIE 2A6YA 4CP9A 2RM21 1YRZA 5BNPB 4EZHA 1RUJ2 3W20A 2O14A 1FMD2 2ZEXA 4N7UA 4CUAA 4KGQA 5FAXA 5FMCA 4RS5C 2VL4A 2CDOA 4EWAA 5ISLA 3I2GA 4DOUA 3PURA 4YFZA 4K8RB 2LROA 4ET7A 5EV7A 3ZN6B 2OQ6A 4CCNA 5HV0A 4O61A 2W87A 3LGRA 3AMNA 1V0AA 2AACA 5HI0A 5IFPA 4BXFA 1U5XA 2B9UA 2GAUA 3JB4C 4JDNA 4MADA 4AI9A 4D6SA 1M06G 1TME1 3I54A 4TXWA 1ZZBA 2ZGTA 4S2DA 2JG9B 4XVHA 4XYXA 3ILNA 4HLTA 4M01A 3ZIWA 3ES1A 4GMP0 1UCXA 3CF6E 1UO9A 1VBB3 1LEDA 1XQNA 3ZN4A 5IATA 1C5IA 4N53A 5FYMA 4V1PA 5F5QA 4ZKTB 3DUIA 4IL7A 1TME3 2JD9A 4BU2A 2WFPA 4CEYA 1ZREA 2I2SA 3ILFA 5E8AA 2GALA 2FDFA 5DAWA 4XURA 3QCWA 3BUCA 4PF5A 1GQHA 3ZSLA 4AHZA 3WUCA 4LXLA 5CFDB 3MO4A 3T1LA 3ENRA 4QDQA 4QKNA 2VD7A 2PHWA 3C7GA 5EP9A 3VDDA 4DXSA 1WMXA 2D5FA 3ZMNA 4A4AA 3HN1A 4XFIA 4CYDA 3GCXA 4ZU7A 5JMCA 4AFDA 1O59A 3D0SA 3KZ4C 3THTA 1VBC3 2J1SA 4JKMA 1DIWA 2RE9A 4MHUA 2E7TA 2WDBA 4Q4W3 4UFLA 4E4SA 4I30A 1C3HA 2XHKA 4Y22A 1YYNA 1QOTA 5LWBA 2EIDA 2Y34A 4KG8A 4QDSA 4BA6A 5JAXA 3TRSB 4LE4A 1KFXL 2WN2A 3W58A 5J36A 1DQ5A 1WCUA 5A1AA 2ZMLA 4AZZA 1MZEA 2A5ZA 1LR5A 1DYOA 3MUY1 4QB1A 3ZR5A 3GXUA 2GC0A 2BU9A 4DIQA 1YIFA 5A6YA 1DGWX 1XU1A 4NJ4A 4AEDA 2B4KA 4IGQA 5FLIA 1ZYBA 4KL1A 4SLIA 3I49A 3DXUA 4CDWA 1C8NA 2WO7A 4XFBA 1ZM1A 2JDPA 2QVSB 4FQZA 1LOFC 1ZVFA 2JB8A 1F4HA 5H9PA 5FYCA 5LY1A 3T3YA 2XUMA 1C4RA 2CWSA 1RUNA 4RYDA 3J8F2 5F39A 4FPCA 3VBRB 4FXKB 2RMU2 2XG3A 1ZA4A 1F4AA 4Y20B 4XFGA 3THCA 1A34A 3PIJA 3PVNA 1H1MA 3RZHA 1GOHA 1ULGA 3AC0A 2KM2A 3B7MA 3MF9A 4WVVA 4KU7A 4R4XA 2QQVA 1AYM2 4L2NA 4Q4V1 1O8PA 4XMAA 5DXDA 3JB8A 1EUUA 1RUI2 3KT4A 1OLRA 2J42A 1OPOA 4KWKA 1S0IA 2Z79A 1AJKA 4XXPA 3SITA 2WIIB 4YVSC 5KHIA 2Y0OA 2JICA 2OA2A 1NCQC 2LM3A 2JIJA 4OUSA 1W2AX 2PHUA 4SBVA 2VOWA 3RDIA 2KXLA 3OJBA 4NHKA 5A3WA 4X6RB 1ZZ7A 2W1SA 2W91A 4FQ4A 1ZX5A 5LBEA 3U4XA 3H8UA 1W6MA 2ZGRA 3ZPOA 5FZ6A 4MXWA 1HDKA 3P3PA 4PCRA 2ILMA 3D5OA 3I97A 5CKMA 3U37A 1LB2A 3D3AA 4K40A 1V9U1 1LULA 3NAPB 2B39A 4OI2A 2YV8A 2RV9A 3U14A 2W1WA 1IQAA 2Y6FA 5A3LA 1Y4WA 3ME2A 5T50A 3VBFC 4ZXKA 1C57A 2ZKLA 3GZUC 4QX8A 3UETA 4Y1VA 3ZXLA 1F8VA 1VR3A 2JG9A 2QQKA 3CL1A 3WNPA 3SKVA 1IKPA 1CQ9A 1EUTA 4CDXA 4YARA 1SCSA 2Y6KA 3KM5A 5BNNB 2QDRA 4AQ6A 1JZ4A 1S2KA 1BQPA 3R05A 1D4M1 4DEQA 4YW5A 3CJIC 2GC3A 4LHLA 1RUD3 3CO2A 4Q27A 3UJQA 4KNCA 5CU1A 4QPGA 1H8TA 2KD7A 3FMGA 4QHBA 3H0OA 3UGGA 3BKZA 4BK4A 5CKNA 2HWD3 2BV4A 3OTFA 2W1QA 1ZRRA 4LBMA 4MGZE 1LU1A 4XJ8A 2ZEZA 4UWDA 3POBA 2AEZA 2V73A 3GHMA 3KCXA 5CB7A 3T2TA 3LOBA 1HQWA 3OEBA 3RWKX 4IEPA 3H50A 4IV3B 1YO8A 4MHRA 1X7NA 5IK5A 1ENQA 1SZBA 4UW3A 5FWJA 2ZXQA 2R061 4XAAA 1ZBA1 4NN0A 1WCSA 1AR62 3C7OA 1OUXA 3ACLA 1P8JA 1GZWB 3AP9A 2YHJA 5KC6A 4TTGA 2WFF1 1WA6X 1CN1A 3DV8A 4AW7A 4D69A 2HKXA 3WZ1A 1XE8A 3RZMA 1I9RA 4N43B 3KT7A 4CP1A 4GKYA 3WT3A 3D4KA 2OIIA 2D3RA 3GYDA 2EXKA 5FCCA 4XF9A 4HVOA 3KS7A 4Q0VA 2ZKNA 3WG2A 3RVHA 4CA9A 5A7WA 1PK6B 2VY0A 1LKNA 3KVBA 4X6QB 4M3CE 4FPJA 2W3JA 4K6BA 2JB4A 4ISQA 2EXIA 1AX0A 4QXCA 4YNIA 5C3PA 3EHKA 3SISA 2D6NA 3B3QE 4S2GA 2MNGA 4DXTA 3D6EA 5JXGA 5FR3A 4R52A 1PHMA 1UL9A 1CAWA 2XONA 2W47A 3K75B 2R0HA 3W9AA 3IPVA 3DECA 1S0DA 4CDWC 2X05A 2X09A 2QQJA 4WM7B 1KFUL 3I8TA 3ZFEA 2PQQA 4AHXA 2H6BA 2WZR1 3POWA 4E4ZA 4EWEA 2DFBA 4CDQB 2NQYA 3N7MA 3DL3A 1A3KA 3Q8FA 5GZDA 1LEMA 2WA4A 2CAVA 4AI1A 2VNRA 2G1MA 4P9WA 4AK3A 1OOPB 4PHZA 4DEVA 3T0DA 2MEV3 2X8KA 2XVKA 2NMNA 4NVPA 1GWMA 4GKXA 4XOGA 3M4FA 1W6OA 2VG9A 3R0RA 4LPLA 3WG4A 4FPOB 1CAXA 1VBB1 2A1XA 2HH9A 4YW6A 4M00A 1HB3A 3MIHA 1VRH1 4KI5M 4LA2A 2DU1A 1FPN3 3MDPA 1AYN3 1U5YA 2MEV1 3Q8BA 4QQPA 1VBC2 1W6MB 1IS6A 3I3BA 1NCQA 1CAUB 2ZACA 5KHKA 2VZPA 1LHWA 3AZVA 4UFMA 3W5NA 2JIGA 1H9WA 2VVFA 4MG2A 2QDNA 3TNPB 1W2NA 2Y60A 3VBOB 3FLRA 3LA7A 4HN0A 4PLOA 3VZLA 2QNKA 2VECA 1OH3A 5JMOA 2HBTA 2AR6A 2PTMA 2LUWA 5CEHA 1CIWA 2IXJA 4Q4W1 2VQTA 4C0HA 4DY5A 4HONA 3LA3A 4WM7C 4XIOA 1W6NB 2QE3A 1LGCA 5DPNA 2CY6A 5BNNA 3LFMA 1DQ6A 1U5ZA 2XLAA 2HWF3 1QNYA 5ABJC 5FPXA 5IVCA 3WP6A 3FFZA 5J09A 4BXSV 1XU2A 1UY1A 3CKHA 1AR71 1CR7A 5F5CA 4AEKA 4URAA 3GBWA 3S5AA 3TBDA 1HRI1 2P37A 1WA4A 3G6JB 2VO5A 1ODNA 4XQWA 1ULOA 1W8NA 4JGZB 4XACA 3VLBB 4Q2FA 2RJ2A 5FZBA 4QPGC 1A78A 1UIJA 3HWJA 1W6QA 2VCBA 5DQ0A 5ERLA 1HRV2 2Y6GA 1OH4A 5I8YA 4NWVA 1GQGA 3HT2A 4BB3A 1NXD1 1PVXA 1RUF3 1X82A 3O0WA 1AL23 1QMJA 4AI3A 3U78A 1AJOA 3WNNA 4EN7B 4AFAA 3JBG2 4YWAA 4Q1RA 4AGVA 3I59A 3P6BA 3VZNA 5IYYA 4BLJA 3J26N 2PHRA 2W39A 3T08A 1W9FA 4GIQA 3BALA 2EIGA 3IB3A 2JD4A 2XVGA 3IDEA 4BZ4A 4E8DA 3GHNA 1KQRA 2GP5A 4XABA 4CU6A 4Q8LA 1VBE1 1OC1A 4H55A 4QGLA 2RR13 2WN3A 2P3JA 3VBHC 3S57A 2V4AA 4W6WA 1UN1A 4ATFA 1JHJA 2DBIA 5DAXA 2ADEA 3OPWA 4C90A 1W04A 1N3OA 1YIPA 2Y6HA 3DF0A 1XNCA 3H7YA 1VLNA 2OYZA 4BQ5A 2DBNA 2A3XA 4UW6A 4Z92B 2UWCA 4Q0PA 1RUD2 3CJIB 4M4PA 5L7OA 5CKQA 1OOPA 3IT8A 1XYPA 1ZZCA 4P9XA 4CXXA 4LO8A 5DDJ1 1W6OB 2DUQA 4ITCA 2R7EB 5FZMA 1IZ3A 2WWJA 3ZFEC 4GQ7A 3M8LA 4NPLA 4XTMA 1CAXB 2QUOA 1UYZA 1JZ3A 2QQLA 5CFDA 5G04L 3PUAA 2R1DA 2GH2A 2AYHA 2OKXA 3N9OA 3VBUC 1JZ2A 3SH4A 1AR82 3LEMA 3WQ1A 1WCDJ 3KQRA 4GB32 1MS1A 5LATA 4CXWA 4GWNA 3AZZA 3WUDA 1NCQB 3AYDA 2FHRA 1LOGA 3GZAA 3MFCA 4BQ3A 5CAZA 1XNKA 1R092 3AMQA 4C0BA 4PJYA 1C5HA 1PK6C 3HT1A 3OBTA 4RSUA 4QWNA 3NV3A 1RGSA 3PUHA 5A32A 3HBZA 2R32A 3UV9A 1DQ1A 4PF1A 4EJRA 2JE9A 2P2KA 1SLTA 1UXXX 4XHBA 2EVXA 1DQ4A 4N90A 2WBKA 5FZLA 2J1AA 1WD3A 1DZRA 1QGLA 3PVEA 1JZ6A 2VTFA 2YU2A 3H7JA 1VBA3 3TEYA 4D6QA 4CDWB 3K48A 4CUGA 4FPKA 3OY8B 4R8HA 4AHYA 1ND2C 4DO0A 2VQ0A 4OVEA 5FLJA 3WVJA 2RM23 4UF0A 5FK8A 2E32A 3KD4A 1PX4A 1B09A 3V0BB 1V6OA 2XMLA 4QXHA 1UMHA 1ZRCA 4COZA 1DZQA 1QJZA 4UFKA 5FMOS 3PUIA 5JI7A 3N9NA 1MS4A 2RS52 1PVC3 5FZ3A 1W39A 4JGZA 3J8F3 3RJRA 3ZKYA 4YM1A 2YG0A 5JZGB 3OCPA 3MF6A 3RI8A 4NIGA 1CWPA 1W2UA 2QKDA 3MI8A 1RUE1 2BZDA 1G6NA 4FI9A 3I4IA 1N3PA 3VD7A 2C4XA 1JW6A 2ARXA 1ZBE3 2BGCA 4GXLA 3IDAA 2VTXJ 3J8F1 3PMSA 4JAAA 1PO12 3MZHA 1JYIA 3W21A 2WZR3 3FC0A 1PO13 1AR72 2WYSA 2PXJA 4AQ2A 1KXGA 4AFMA 2WSUA 2NYYA 4JHTA 4QPWA 3POSA 1IPKA 2XLFA 5FK7A 2DYCA 3B02A 3BPZA 3EB7A 3NAPA 5F3GA 3L2YA 1HV1A 4L92A 4IEZA 4Q4W2 4QX1A 1B35A 1GKBA 1G9CA 4LLOA 1TMF1 2BYVE 2GNMA 4LHNA 4Y4YA 1CONA 2JDUA 1NAEA 1HB1A 4BQYA 2PLV2 4PIXA 5J98B 1FMD1 1E5HA 1MEC2 2FD8A 1YWKA 3M70A 4P9IA 4LR4A 4CDXB 1OBNA 1RTVA 2PMWB 2Z42A 3BPSA 3ETQA 2XOMA 2O1QA 1NLSA 3KT1A 4XFAA 3K4ZA 2ZCWA 4XJZA 5A7QA 5IK4A 3O1VA 2GMPA 3B00A 5L7OB 1RMU1 3NWKA 1JZ8A 2GZWA 3UYJA 1H8TB 1RJ7A 2BFUL 4MV2A 4XJAA 4FXGB 4IEOA 4LORA 2G19A 4HVQA 1IKQA 3EQEA 1IG0A 3WCRA 3FL7A 2RMU3 4IV3A 1SG3A 1UU5A 4JGYB 1W03A 4QX5A 4DINB 4PDWC 3WW3A 2FCUA 2X5IB 1ULDA 1ZZ9A 2D98A 2ZBJA 3B9IA 5IW0A 1HRI2 2P3KA 4GB33 4CCJA 2WZEA 1MACA 4UXAA 3WP3A 1AR63 4EZ4A 3QLQA 2LRPA 2B9VA 2VBDA 5DAVA 2O8OA 1HJFA 1PGL1 1V70A 1XE7A 4Q4Y2 3M7AA 4JQTA 3ZOIA 2WNUA 1GSLA 2C26A 1RUJ3 3PIGA 4WVZA 4DS0A 1Y43B 3NNFA 3OPTA 1W9WA 3POGA 5CG8A 2NZ9A 4GZ9A 2XB6C 4Y3OA 2QQPA 2WS92 3K2OA 5T5OA 1PK6A 1XE0A 3AJZA 4JZRA 4B7EA 3BU0A 1HQLA 4NWWA 2GMMA 1F9KA 1DFQA 2R041 2PHTA 3RI9A 3JBG1 1GNHA 1Y9GA 3BCWA 5D21A 5A7SA 4QXKA 3BTAA 3VKOA 5FOJB 1GU3A 5FBJA 2JECA 1X33A 3PUQA 5A7NA 1K5MB 3VBSC 2WNVA 1RIRA 1KJRA 3OD4A 4R9BA 2VW2A 4MSVA 2ARCA 1ASJ2 4OUEA 3MIFA 5JDBA 2AH2A 3RQ0A 2DCTA 1S55A 1AR81 3AXEA 3LOIA 4AVSA 2RS31 1PIV1 5FYTA 5K0UB 2A6WA 1LESA 5IWFA 1L7RA 5FOBB 2ARBA 1ZBE2 5FZFA 5C33A 2BVVA 4I0WB 2HEVF 3RSJA 5KC5A 2JXAA 5KHHA 4AI8A 4YW7A 3J4UH 1BBT1 5LA2A 3ZFFC 1UZYA 1OVPA 2B7YA 2CGOA 3V65A 1Q8OA 4Z2WA 1D0GA 1MZ6A 2G9FA 4IV1B 4XW3A 3JZVA 3PU3A 5AVPA 1ZRIA 3UGFA 4XQ4A 2VZOA 2VZUA 3TYJA 4A7ZA 5C5UA 3J7LA 3ALQA 1Z7S1 4K20A 3ZSKA 3WNKA 1PMIA 5LA1A 3FLTA 3HR9A 1W6PB 5LB6A 5FYZA 2DCYA 1GOFA 1UMIA 2W9XA 5M0TA 1X9TA 1AXYA 4FPGA 4ZONA 2QQIA 1X36A 2HEWF 4IUGA 5BNOC 4KGGA 3VHRA 1D4VB 5CFCC 4K7JA 3RYKA 1WMFA 4GWMA 4CU7A 1S0FA 3O1RA 2QTWB 1VBA2 1E57A 4Q4X1 4I2OA 2ZMKA 3GZTB 1COV2 1COV3 1RVF1 2JDAA 1VJ2A 5J7MA 5JSOA 5L19A 3ECQA 4M4RA 1N1VA 1WUVA 2QJVA 1LOBA 4JTOA 2WT0A 5HXVA 4TN7A 2RS53 1NQJA 2X10A 3RS6A 1AX2A 5DABA 4A7YA 4RL7A 4XPVA 4K1ZA 2P3YA 4N9IA 1RXFA 4Q0UA 4F7ZA 4COVA 3VD3A 1YQCA 2OZ6A 4KWJA 1N1YA 3ZXDA 3EJKA 2DCZA 4HVRA 4Y1XA 3Q9OA 5FYIA 5K4LA 4I0AA 3WX5A 4BK5A 4FPEA 1IPJA 3G7DA 4HT1T 1CESA 4RD7A 4FFIA 3WF1A 3GNEA 3O1SA 5FY5A 2TEPA 2WAOA 3I2KA 1A8MA 1W0NA 4LTAA 4XJ9A 4YLZA 3ZYRA 4YW3A 3BTZA 2WNUB 4HK9A 3IMMA 4E2SA 3WDTA 2CGNA 3AVRA 2Q1ZB 4TLFA 2E26A 1DZTA 3N9QA 3EYPA 2B42B 1LAJA 3IKWA 3PVOA 4XJWA 1ZRDA 1SACA 5C8WA 3FUOA 3HJRA 5IVYA 1GP6A 1HXS2 1W3XA 2D6MA 1IOAA 1ZZ6A 3DPRC 3WF4A 3ACFA 4AI2A 4Y1ZA 1NLRA 1S0CA 5F8PA 5CA6A 2UY9A 4HMZA 4ARXA 4WVWA 4Q0SA 5FY0A 5FYYA 4QPYA 2X29A 1A8DA 1FV3A 4RR3A 4XFFA 3VBFA 2BERA 2WT1A 2FDHA 3ZMOA 4LKEA 2VCAA 3AP4A 3CU7A 5ABJB 2JG9C 2DURA 1HLCA 1GQPA 5T5JA 3USUB 4EYUA 1WW7A 3VBSA 3RMYA 2W08A 4LLFA 3T0AA 2XWBB 2CGPA 3AKPA 4NHXA 5EZWA 3HBKA 4B1LA 3POEA 4DZGA 2A3WA 5GZGA 5I8TA 2NP0A 5FO8B 3UESA 4MXVA 4X8PA 3OOXA 5C3SA 5FXVA 5F6KA 2WA3A 1AR91 3C8XA 5FTTC 3SEEA 4CRQA 5A3OA 3MW2A 2Q30A 1JU3A 1DG6A 2EICA 4LHSA 5FZ4A 4DQAA 2I07B 2PHLA 2YYOA 4FBFA 2D7FA 3AL6A 4D0QA 1ENRA 3WDVA 1R093 3VGIA 3GDBA 2GDFA 1WLWA 3KLSA 3I2DA 5F6LB 3VBOC 4DXZA 4P5HA 4RGKA 4COWA 4FFHA 2WS93 2JG8A 2DTWA 3LF7A 2AREA 1WBLA 4Q4V2 1EY2A 1LOEA 4YVSB 4AXOA 1W3VA 2A6ZA 1V00A 3VHNA 1OXCA 4GH4B 1QJY2 3AP5A 3EXUA 5GM0A 4XCAA 1ACCA 5SV5A 3S7IA 3WDUA 1POV3 3HAGA 4XFHA 5JSPA 1SMVA 2VMHA 3U75A 4GAZA 1TQ5A 5CG9A 3LB9A 1K12A 3E5QA 4OHYA 1F2NA 2UURA 3WNXA 2WWUA 1PZ9A 1Q8PA 1GNZA 3NJZA 4LO4B 4A44A 5A6ZA 2VCMA 4OQ9A 2R042 5FPVA 5T52A 2C9KA 5JZGA 4GJYA 4M3CB 2GC2A 1W8OA 2RJLA 3A23A 1UYYA 4JHZA 4YVWB 3ZYIB 2NM1A 4ZZ8A 1R083 2XKOA 3ZDVA 2WO3A 3PDQA 5JOYA 2YFUA 4A3XA 3VBRC 3SCHA 1BJQA 4XJUA 1BMV1 1UKRA 3IWZA 3N7KA 5FYSA 1YC61 3PTRB 2HYKA 5JUVA 3JD72 2VOXA 2VAUA 2YY1A 3GM8A 3JD73 3WINE 1M4WA 5BNQA 4QQHA 2C1FA 2CSGA 4IESA 1IS3A 5ANQA 4CEYB 1D4M3 4CCKA 5GZCA 1KS4A 2VE1A 4XUQA 3N35A 4P9GA 2VQUA 4MGQA 4OMDA 5JXIA 5CIRA 1FXZA 2XBO1 4HL0A 4BOWA 3LSEA 1UY3A 1W9SA 5FZ7A 5AFBA 1SBEA 1V6IA 4N43C 4QDRA 1OA4A 2ZX4A 3PLQA 1HW5A 1QH6A 2NPIA 2J1UA 3ZXGA 2JEMA 2PHFA 2HWE1 3KMHA 4YGCA 4BPZA 1PO23 1SLBA 1GZCA 5FP8A 2YBSA 2A6VA 1UX6A 3SNMA 1MEC3 1SDWA 4L97A 5A6XA 1Z7S2 4ZXEA 4DB5A 5I91A 3DPRA 4QX3A 4DFSA 1MZ5A 3WCSA 5LRRA 2ZJCA 3MIGA 1FV2A 1NG0A 3T0BA 1SLLA 2G4IA 2W0XA 1WW6A 2HWF2 1HN0A 3RMXA 3FJSA 3BOWA 3GBGA 4BISA 1Q8VA 5BNNC 4Q4X3 4Y26A 3VZOA 5JI9A 2YMZA 2PFWA 1H6XA 2ZHMA 4N9HA 5GLWA 3WW1A 5EWSA 5FY7A 4PT6A 2WT2A 3MV01 2RS11 1JUHA 2R073 2LTNA 5EJ1B 2BPA2 1O4TA 2ZHNA 4CCDA 1H2NA 3ZFFB 5FY8A 5L9RA 5F1RA 4HFSA 4CEYC 1F35A 4CXYA 3HNMA 2PHDA 2VNGA 1RXGA 3WLUA 2IVIB 3LPGA 4HOOA 1YI9A 4FAHA 4AFCA 2OS2A 3VZKA 1HRI3 1LHNA 1STMA 2ZHLA 3OGGA 2JDNA 4LE3A 4BH9A 4ZU4A 2RS13 2J1TA 4NAMA 4WZCA 3ZFGB 1S2BA 3EO6A 4PIYA 1CX1A 3F95A 1O4ZA 3O0XA 4D7TA 1LTEA 5CBLA 3AX4A 4JDMA 5T54A 1MS0A 5DG2A 3SKJE 1APNA 2JDZA 2FCTA 4P5YA 2V09A 4MO3M 5JOXA 2AGSA 3O1MA 5EXOA 3I2IA 1QDOA 2XBO2 5FUPA 2RDSA 5F2WA 3FFQA 1QWRA 3BODA 2TBVA 4QD2A 2VJXA 4QPIB 3ZKUA 1NYWA 3DKWA 4YG6A 1EV11 3C2UA 2CTVA 2W52A 4HPKA 1KITA 1CAVB 2ZEYA 5JPNB 1XB9A 1UF2C 1Z78A 3VKMA 1UW8A 3E97A 1S0BA 3P5BA 4MYEA 1QOOA 2W1UA 2ZGMA 4KH9A 3O0VA 2XPJA 1ASJ3 1S0JA 3N9LA 2EIBA 5K0UA 1WD4A 2OPKA 2ES3A 5EHDA 1XC6A 4NIDA 1W0PA 4CSWA 1XPWA 1QOSA 2HWD2 4FO9A 3URFA 4EROA 4Q26A 1V6KA 1OLMA 1GOGA 4JC1A 3V56A 3WY6A 3I3DA 1NE4A 1RHI3 3GJBA 3F2ZA 3KGLA 5DAPA 1JYCA 3NJYA 3AYEA 4P9YA 3TEWA 3K3NA 2P4EA 5F37A 3H42B 5EPAA 1UWWA 1BKZA 3LA2A 3WDYA 1AR83 3DGTA 5J96B 4GJZA 2IXIA 1QEXA 5E88A 3ZIXA 5F9TA 1IGOA 1D4M2 2J7MA 1S2EA 3A7QA 5HXMA 4BQ4A 2ORZA 3HMYA 1JU4A 2VH9A 3Q8CA 2YXSA 5JXHA 3UK9A 4PDWB 3GF6A 4QX7A 3A4UA 3M3CA 2VMDA 3WDXA 1ULPA 4ASMB 2BOJA 1SHWB 4Q4Y3 1F5JA 2PAMA 1WWYA 1GZWA 4E27A 4LKDA 1QJY3 4R9AA 4ZY9A 4QKDA 3VKNA 1ST8A 3ZPYA 4XHXA 1QDCA 5J37A 2WLPA 5FZHA 4RQPB 4B7KA 4RQPC 2HWB1 1VAMA 1UX7A 5LEKA 4CCEA 4CDXC 1H1AA 4CPBA 3S7EA 4TYSA 3ZXEA 4LUMA 1H4GA 5DUVA 4Q4X2 3PVBB 4AAPA 2DVBA 2IXLA 2TNFA 1SEFA 3GCWA 3QBQA 4CDUB 1PVC2 2RR11 3O5SA 4JGYC 4NHLA 4IEWA 4TWTA 5DZGA 1E5IA 1R082 3R4SA 3U11A 2FMDA 4HKOA 2YPDA 2K9ZA 2YGMA 4GMP3 3IIAA 1AUYA 2PAKA 1F5FA 1W06A 3KQ4B 5FZ9A 3KCYA 1DGLA 5IUQA 1JS9A 4JGZC 4FOYA 4NR1A 2XUEA 4RN5A 5LK5A 1Y3TA 1YHFA 1SBFA 2BUKA 2WQ8A 1BLZA 1UY0A 2HWF1 2QQWA 1UZWA 1NQDA 3A21A 2WZR2 4U36A 1QIQA 2ZS6B 4IGPA 1AR73 4H2AA 5LBBA 4MLOA 4LT5A 1FPN2 1LENA 5DDJ3 4XDPA 2XJUA 1PIV3 2F17A 4N7IA 5L36A 3VDDB 1UMZA 4Z8BA 1AZDA 5JXJA 3ZXKA 1OQ1A 2ZGKA 3OBRA 1VBD1 2FDJA 5FP7A 2E51A 3CLPA 4UW5A 4EN8B 3WQ7A 4EQVA 4QPIA 4UYBA 2BGPA 3NQHA 1UD1A 4EWDA 2RJKA 4RR3B 1DGRN 1D0HA 3N9PA 2C9AA 4LEJA 2Y6JA 3C7EA 3UGHA 3J7MA 2D3PA 4BLIA 1O3SA 2XXZA 1NCRC 2F6BA 5FZIA 5KXCA 1XNBA 1QJFA 3CIHA 4AEDB 4QGNA 4LO5B 4CUBA 1VPHA 4LOSA 5HV4A 4HK8A 4BMEA 4WM8A 1RINA 3H1YA 1GZ9A 2VMIA 5E16A 1YFWA 4FP3A 2UWAA 3D0JA 3ROUA 4J1XA 2WUHA 1C28A 3ZSEA 5KWRA 4YM3A 1Q43A 2ETEA 4P08A 3QACA 1RHI2 2XH6A 4IQPA 1IS5A 4IE7A 3RG0A 3AYCA 4PIZA 3VHPA 4BJ0A 4ZZ5A 3T2QA 1J59A 2Q8OA 1SQ4A 2Y6LA 5FXXA 4IEYA 4PI2A 1RUH1 5FKBA 2GN7A 4PDWA 2VOTA 3NRUA 3FUQA 5JOWA 1OPMA 1RUD1 5LY2A 3A0KA 4Y33A 5FY4A 3VDAA 1QHDA 1QQP1 3MYXA 1HX6A 5FUIA 4COYA 2HWD1 2VUJA 5IK7A 1RUE2 2ID4A 3KCCA 4YVSA 2WABA 5AC93 3U0ZA 3LEGA 3U10A 4GH4A 4Q4V3 1R1ZA 4UFIA 4UFHA 4EV0A 1GV9A 5FWEA 1ULCA 3ZYBA 1J1TA 1RL3A 1J3PA 1MR5A 4L0PA 1LGNA 3OBZA 5F3EA 4NAOA 3TN91 3I7DA 1SLIA 2BNOA 1O6UA 2WINB 3M1HA 5JWPA 3LDRA 3SH5A 1QY4A 3GALA 3ACIA 1NA1B 5FMDA 5A33B 4R9CA 3UJOA 4W6XA 4JVAA 1DQ0A 4CDUA 3OUHA 3AZWA 5C9AA 2R043 2WNEA 1RUJ1 2GNDA 4YVWA 1V9U3 3UKVA 3WF0A 1W2OA 1TMF2 5C4WA 1I5ZA 3IAQA 3LZZA 3MLLA 2HLEA 4C1WA 4CEWC 1TMF3 1CPNA 2ZGUA 3ZO0B 1L7QA 2UU8A 3AM2A 2BOIA 1QJX1 4LBKA 5F3CA 1RUI1 3J7HA 1SFNA 2WNVC 4ES9A 3LQCA 4XBQA 5EJ3A 5HCBA 2VOVA 1POV1 3AP7A 5F7UA 1RUC2 1EAH1 3CJIA 4XUTA 3UKNA 3VDCA 3E5UA 4H14A 4XDQA 1QKQA 1XSRA 2AC1A 1OLME 3WR0A 4QPGB 4OHZA 4OZOA 1DCSA 2JJ6A 1US3A 1PX3A 2QFEA 1OFSA 3OYWA 2A73B 4HKWA 4NE9A 1LRHA 5CZKA 3JQWA 1TNFA 1JYNA 3OBAA 1AVBA 4CU9A 5DDJ2 1GYKA 1JOBA 1DU3D 4QM8A 3TAYA 4XUOA 1C8M3 1VMJA 3IBMA 1OQDA 2QQMA 3AK0A 3DN7A 1O5UA 1C8M2 2R6QA 4BIFA 1MVQA 4LBJA 2H6CA 4AHWA 3SQOA 1D7PM 5FP9A 4BM8A 1SLAA 4B29A 2ENRA 1OURA 1L7LA 5GLUA 1UY2A 2DVFA 2PYTA 4DRRA 1F31A 4XILA 1Z0HA 4QPIC 1JYWA 1YXWA 5D2AA 3TNQA 3WOGA 4MGYE 1HIXA 4XZUG 1Y9MA 3H1WA 2RM22 5FZDA 3LIHA 2IVJA 4WM8B 2K0GA 1YQ8A 2WS91 4FPFA 2YC0A 1CJDA 4Q0QA 4A45A 5L9BA 1OQEA 1SBDA 1OVSA 1XNTA 5D8AB 2A70A 2DCJA 2PA7A 2ZEWA 3X29B 5DMYA 2OVUA 4GWJA 2JDKA 3I2HA 2BBVA 3V0BA 2VQAA 5F32A 1BEV3 2DVDA 4IE4A 4OUMA 1VRBA 1OI6A 4BYYA 2C0ZA 1MEC1 4Q29A 5DUWA 4G3YC 3O7OA 5C8CA 4G4FA 3OGRA 3ZFEB 1GANA 1GBGA 4L99A 4TSVA 4CDQA 5I0SA 3P1IA 4AVTA 4DNYA 3K77A 1DGRA 2RS33 2ZGNA 3BB6A 4ISRA 4ZS3A 2Q0AA 4GMP1 5FMBA 2IFWA 3NW4A 1ND3B 2XJPA 4QU1A 3VKLA 3LEIA 3AZYA 3TB0A 4IV1C 4J25A 2P6CA 4FP2A 1TNRA 4GULA 1RUE3 1VMFA 2ZA9A 4ZPIA 4CP9B 1PIV2 5BNPA 5KHJA 4A6SA 4Y1YA 1OF3A 5AC92 1N1SA 3BYWA 2JDYA 2W2IA 2WR9A 1R1A3 2XJTA 4B1MA 1BZWA 1MS3A 1SPPB 2XLGA 3SCGA 4CVUA 4IEUA 1HXS3 4DRVA 3Q8EA 4MOAA 1JYTA 2ARAA 1ENXA 1GNYA 3J9SA 3MIBA 2D40A 4I0BA 4IE0A 5I8SA 3JCIA 5CFCB 2VZ3A 4LNVA 4W6YA 2LALA 1JI6A 3WHUA 4EN6B 3U07A 3I2OA 1BCXA 4D7SA 1ND2A 3VZMA 2XDVA 1CZVA 1RC6A 1QJY1 1HV0A 2BTVC 2ZX2A 3AJYA 1MQTC 1VBA1 4UAPA 4FTSA 5FP4A 3H8XA 1OA2A 5FDBA 1O5LA 3H8RA 3FE5A 4LMFA 2YZ4A 4XEZA 3FLPA 5JR2A 4E8CA 1T6GC 3N7JA 1NA1C 3DYPA 4A2UA 3SH3A 2HJIA 2Y38A 4XETA 5IJRA 2R062 1J3RA 1J58A 1EYBA 3IN9A 1MQTB 3H3ZA 4KBZA 1NOVA 1TVGA 3LIGA 4BWOA 4CEWA 1RVF2 2E7AA 3NL1A 3B94A 3HPNA 1YFXA 4YGEA 4OHWA 5BPXA 4HSJA 4OCTA 5FMOL 2LW8A 1QXJA 3POIA 2KR2A 4H3WA 2FDIA 5FFOC 2WJSA 3MGUA 3NVCA 2OXBA 4XAEA 2B46X 3IDCB 5A3NA 2OUHA 4KBBA 4OMCA 4BCUA 2Y26A 4LKSA 2J1VA 1Y9QA 3ZXFA 3NNLA 1ASJ1 2XR4A 4W50A 3O1TA 1SFPA 3DYOA 2MHFA 2RMU1 1NX9A 4E9KA 4D6RA 4E2GA 3WSOA 5FZ8A 4Y22B 4ZU5A 2WQ4A 1B35C 5FZEA 1O3QA 2DDUA 1MS5A 2DWRA 2UYBA 2ZOEB 3OGSA 4CCMA 4NIHA 2FZ2A 4B4QA 3I59B 3T2OA 4Q4Y1 1REDA 1FOD2 1FX5A 2W68A 2P34A 1PZ7A 2VZTA 1RUG1 2OZJA 1O4YA 3C7HA 2D44A 3L2HA 4AWDA 3AL5A 4CCCA 2YPJA 4AYUA 2HWE2 2G9GA 4XF4A 1VBD3 3KGZA 4NPRA 5D8AA 3PUSA 4FOQA 1ZNPA 3GJAA 4URTA 5FYBA 4B8EA 1LOFA 2DCKA 5B4XA 4YW1A 5L73A 3ETPA 1V6NA 1YJKA 2RDNA 3NKTA 1V9U2 4AEMA 1FYUA 3POFA 3TN92 4LQRA 3FN9A 1NZCA 2A7AA 2XL7A 2E31A 4DUWA 1PZ8A 4XE9A 1WLDA 3BTYA 4QGMA 2A71A 4YW2A 1JOPA 3ZYPA 5JZGC 1RUC3 4IV3C 4LJHA 3MV11 2D97A 1XXNA 1G9BA 2K46A 2VCCA 3L9JT 1OOPC 1WCKA 3BOPA 3I3MA 2IXHA 2XJVA 5FYHA 3FZ3A 1CX4A 3ZM8A 5FPAA 5C8CC 3JXSA 3ASIA 3O1UA 1E5RA 4XFCA 1QJX2 2OX0A 2WZ8A 3MLJA 3DYMA 4HBNA 5K9YA 1PNGA 2PHXA 3AB0A 1LECA 1K3IA 3BIWE 1EAH2 2ERFA 2IFRA 2Y0IA 4AFBA 4KWLA 2NMOA 4IV1A 1UNBA 4AF9A 1CIYA 1ENSA 5BNPC 3WNLA 2BWAA 3K4DA 4AVCA 4LO7A 3NJVA 5HCAA 5C70A 1RB8G 1PO22 4CU8A 1OKQA 2B45X 4GWIA 1OHFA 1Z7S3 3V0AA 1REFA 2SLIA 4U2AA 1MS8A 4JRLA 4CP2A 3RZKA 4HN1A 4I01A 1YUDA 2V72A 1S0GA 3WNMA 1V6LA 2RHPA 2PELA 2ZABA 2VGDA 2LS6A 3B5LB 4BQ2A 1LHVA 3NKGA 4F3JA 4UBHA 2CWMA 5LZ6A 4J1WA 3KV4A 1UKGA 2ZMNA 4F8AA 5A3TA 2EALA 3OY8A 1MQTA 3ZX7A 1HRV1 2VNVA 5KHGA 2XJRA 4OFGA 1H9PA 1AX1A 1OD3A 1BEV2 3ATGA 1W9YA 4IW3A 4O7XA 1COV1 1RVF3 3MW3A 4BMBA 2Q1MA 3HNYM 4YZ2A 4BIOA 1WCQA 1YJLA 2HWC1 4NPMA 1XJAA 1DBNA 1ND3C 3BI3A 3HVDA 3MLKA 1W8ZA 4Y24A 2VU9A 4FFFA 4Q1PA 1YLLA 2I74A 4I3PA 2AUYA 1K45A 4UW4A 1URXA 4NIAA 3RZJA 3WF2A 3LPFA 2R16A 2WWSA 3WG1A 2ZX0A 1XBFA 5KR7A 5JR7B 3CHXA 4W65A 5A80A 2ZZQA 3V64A 1OUSA 4PLNA 5LCWL 2P1BA 1GMMA 1TE1B 3NNMA 4Y4RA 1H8VA 4H7LA 1R1A2 2W94A 3C7FA 2VZVA 4E2QA 3K4AA 4BHPA 1SFYA 1JZ5A 3UT0A 4W8JA 4FTEA 4LULA 4NRPA 4ATEA 3WW4A 2VXRA 4KG0A 4WBBA 4XQDA 5DZFA 2XBO3 4YZ1A 2ZZJA 3NAPC 5A33A 5AC91 2D43A 2D3SA 1W9TA 1EPZA 4P02B 5C3RA 2C24A 2HWE3 1OMIA 1V6MA 2RG4A 2FDGA 5C9AB 3WW2A 1UPSA 5B2GB 1I5PA 4CZSA 2E53A 1KJLA 4LO6B 4WV8A 2H0VA 5BNOB 1WW4A 2VW0A 3B69A 3IM0A 3RZZA 4Q5OA 5KXBA 1CVNA 5JPMB 5BYNA 2OW4A 3POYA 3HD8B 2P3IA 1CD3G 5D8AC 2I45A 3RNSA 1BYHA 3AYAA 5GKAC 2BBAA 4P00B 2ZGPA 2JKBA 1NXMA 2R063 3VD5A 4ARYA 3A0NA 1PNFA 4N8MA 2BFUS 1FAYA 1OKOA 3ES4A 1UQXA 3NSTA 1S4CA 1LJ7A 4W4ZA 1VB4A 1C1FA 4BQXA 3VL9A 3NNGA 3MPPG 4L9BA 4AI0A 1QNWA 3UNPA 1VP6A 2NLRA 1HKDA 3THPA 3W5MA 4YFWA 5JIUA 2P17A 2PN5A 4LA3A 3U1XA 1N1TA 3ZFGC 3U4SA 3ZYJB 2AENA 1LODA 2W46A 1CAUA 4HXCA 3PJQA 4F83A 3ZSJA 3OD0A 3WQBA 3M3QA 2BNNA 4NOTA 3JD71 2N7GA 3VZJA 3ZVXA 2GU9A 5FQ0A 3VUOA 2E63A 1FOD3 4KWUA 5JIAA 2JX9A 3CMGA 4AAXA 2BNMA 2V5YA 5FZ1A 5SV8A 5K7PA 1DF0A 1HB2A 2B8MA 2XKPA 1YQ6A 1KDKA 2IXKA 4JRAA 5ANNA 4B4PA 3TWIA 1W8WA 3KWVA 2X53S 3CDZB 1LHUA 3HQUA 2D6LX 1NCRB 5IVEA 3I3QA 4DY3A 2D6PA 1JXNA 1GICA 2RVAA 1PO21 2YB7A 5LEJA 1H6YA 4YGDA 4AL9A 2E7QA 2A3YA 2JENA 4NROA 1LCLA 2BWCA 4FPHA 1X50A 3FHQA 4M0NA 2VVEA 4XF3A 4HSLA 2OPWA 3RGBA 2WNVB 5KXDA 3QOPA 2WO2A 2XL9A 1TG7A 1QJU3 3PU8A 5C71A 2PQSA 2W5FA 1AYN1 3R4DB 2V4VA 3H8OA 1PGL2 5K8SA 1NY71 1H4HA 1CPMA 2VR4A 1ND3A 5F3IA 5LASA 4X8NA 2QZ2A 2VULA 1UZZA 3ZN5A 2Z69A 2QZ3A 3RJ2X 1DGWA 1GP4A 2GNTA 2ZGSA 2QCSB 2HEYF 3WF3A 2PLV1 3T30A 1RUH2 1WGPA 4CPBD 3VN4A 2YUEA 3JUUA 5FP3A 2FDKA 3DXTA 3INAA 4MXWB 4IEVA 5FZ0A 5GLVA 4YG0A 4XIKA 1GWKA 1PM4A 1TEIA 4YZ3A 3C3VA 4BE3A 5AFEA 1O3RA 2DU0A 1NT0A 3N4MA 4YRDA 1WKYA 1W6PA 3TEXA 1ZRFA 1KEXA 1KD7A 3T4HB 4LBQD 1KS5A 4C91A 4JV4A 3SLIA 5IFTA 4H7MA 3TEZA 5BNOA 1W8UA 4QXBA 3ELNA 3AMPA 2DV9A 1I1EA 2VNOA 1GFF2 2VMEA 2CL2A 5FBZA 2DVAA 1Q3EA 4C1XA 4HKLA 1OSGA 1CJPA 3AKRA 3DPRB 5CNAA 5FO9B 1KRIA 3NV1A 3M3EA 3OUIA 5FUNA 3R4UA 4ZHNA 2GSYA 1BBT2 2XHNA 2R072 4MGKE 1JZ7A 1JYVA 3QD6A 1JBCA 1QXRA 4NHMA 3PNAA 4C8DA 2HWB3 1J83A 1G9AA 4MUVA 4A7KA 2IUWA 1AL21 3NO8A 1ULFA 4BQWA 3E6CC 4YM2A 5C7GA 4P14A 1YQ2A 2ZX1A 2YC4A 3WV6A 2RS12 1RUC1 3BU7A 4FFGA 4JQRA 3THDA 2HWC2 3RRDA 2RS32 2P6HA 4Y1UA 3WXPA 4FT8A 4QQOA 1IG3A 1BK0A 3SHRA 1X9PA 1YQ5A 3BIEA 4COUA 2KA3A 5A32B 2VW1A 4IEXA 4N43A 4IETA 3ZFGA 5FPUA 5E1RA 1JMUB 4K9SA 1DYKA 3CZJA 5FQ0B 1T2XA 1FNYA 4TLGA 3NJXA 4AG4A 5BXXA 4PQQA 4FAGA 3NMBA 5A7WB 1IQDC 5LW9A 1EPWA 2FMYA 5KXEA 2VC9A 3VD4A 2J1EA 3RYPA 2HYXA 5LA9A 3R6SA 1U0AA 5FY1A 2AEYA 2YFZA 4AVBA 1OD5A 1I3HA 2VUAA 1VBD2 3GZEA 2EXHA 1AXKA 4GALA 4P9LA 4CTEA 1BVVA 1CAWB 2JE7A 3OSDA 3LKJA 3QH6A 4UT5A 5A6QA 3IPVB 1UU6A 2QQUA 4FPYA 4JCKA 3AKSA 2RDRA 5TSWA 2Z2SB 3N9MA 4WM7A 1D2SA 1G8WA 2Y8KA 2EXJA 3AFGA 4RR3C 3ZSMA 4CDUC 4ES8A 1KGYA 1YEWA 3VBFB 5A7PA 3D8CA 4OHXA 5C9AC 1Q8SA 3ZR6A 4N53C 4Q8KA 1ZBA2 1EV13 4QKBA 1QJU2 3MW4A 5T3NA 3FHAA 2YGLA 3NV4A 3ACGA 1E5SA 3USSA 5IHRA 2YBKA 3KV9A 5I0UA 4BQ1A 5A1FA 2K2SA 4K21A 5DZEA 2XJSA 3UL2A 4AGRA 4QX2A 5FREA 1RUF1 5J3UA 3RYRA 4RFT0 3N3HA 2UY8A 3WHTA 5JVVA 3VDDC 1R081 2VZRA 1H0BA 5GLZA 2TUNA 4GD4A 1WLTA 4FPLA 1RHI1 3IMNA 4YG3A 4V2VA 2XWJB 1DYPA 3ZDSA 4BDVB 4D7YA 4QMAA 5C3QA 1JN2P 1AYN2 2YROA 1B35B 4LIUA 3I2FA 4FTBA 4MGTA 5APAA 3VBOA 1MS9A 2SBAA 3BN6A 1SCRA 3VV1A 2VVDA 2IZWA 4G9SB 2IXCA 4MVTA 5A1LA 3OG2A 4RGGA 3ST7A 1FNZA 1NE6A 4RS5B 3B93A 4AEDC 1OA3A 3AMHA 2QBXA 3E6BA 1QQP3 1POV0 1EP0A 3OEAA 2GN3A 2VZQA 5EYXA 2FZ1A 1DHKB 4LOTA 2NN8A 4QU2A 3PMEA 4CUCA 4I02A 4WVMB 2FQPA 1MPXA 3QH7A 3PJYA 4WZFA 4XMIA 5FZGA 3JQXA 5GALA 5B4NA 5C3OA 1WBFA 3VBHA 4L8QA 4HG6B 4AEJA 3ILRA 5F5AA 2E9QA 1AR92 4YSFA 1O7FA 2BQPA 2Q4SA 3VKFC 3NV2A 4S2HA 1VRH2 4NIIA 5GJ6A 3AMMA 1K5JA 4NMIA 2JKXA 4JDOA 1U12A 3MBWA 4NRQA 3GBFA 1Y7BA 5ACA3 4QAWA 3I2JA 5D1IA 1PGW2 3UKTA 2ZGLA 1JTZX 1OT5A 3LSDA 4D3WA 4CDQC 3E1F1 1V6JA 4XUNA 3O14A 4IE5A 4XXAA 2R071 2A6XA 2YDEA 1QJX3 3MHZA 5A7OA 1RUI3 3RFRA 4TZDA 3ABZA 3VBUA 3CQOA 4M3CF 1RUF2 1MVEA 1W8HA 2VUCA 5FRAA 2E33A 5ACA1 2ZAAA 1EAH3 2B5HA 3M3OA 1AL22 5JSRA 5FO7B 3AP6A 1PMJX 4KU8A 1XYOA 2BDRA 3A22A 2J1RA 1YCIA 3FHIB 3SCFA 2DVGA 2W92A 4K3UA 2ZGOA 4XTPA 1LU2A 2C6SA 5C5TA 5FZAA 5I0TA 2Z5WA 1GWLA 2VMFA 4NO4A 4JKLA 3HQXA 2G9ZA 2CYFA 4EN9B 1FI2A 1PM7A 5DN2A 1UYPA 4FOWA 1K5MA 5H9QA 1C8M1 1VAVA 3HOBA 2H0BA 5H9SA 5FYVA 1XOYA 3DEMA 3IAPA 1OFNA 1WZXA 1S0EA 5L9VA 1JUIA 3ZYFA 1HXS1 1ZBA3 1KDMA 1H8TC 2ADDA 5IVVA 4E4HA 1BBT3 5FIXA 1AR61 1LOCA 1REEA 4I3GA 3AZXA 1G9DA 2ATFA 1US2A 1W8FA 2P5BA 1FATA 1NZIA 2VZSA 3CNAA 3PHMA 3WNOA 1NUKA 5BY5A 3ZFFA 2VBPA 1IHMA 4LBQB 1LHOA 5I0DA 3K46A 1J3QA 4IE6A 4O65A 2IWGB 3T2PA 5DG1A 2QQNA 1OLQA 1W99A 4IXLA 3LE0A 1GP5A 3CJXA 2EA7A 4CCLA 4LHKA 3OB8A 3HIFA 2WO1A 3KF3A 1UAIA 2C5DA 5HCFA 4AR2A 2ZGQA 2CV6A 2R30A 3W59A 4ZS2A
chains in the Genus database with same CATH topology
4RHV3 3SMHA 1UU4A 1FMD3 2DFCA 5A3MA 4CP0A 3S6PA 1IS4A 1QQP2 2CNAA 4QM9A 4RGAA 4QQLA 1NCRA 4META 2ZAHA 4OI4A 4WVMA 2R49A 3S30A 1H2LA 2VMGA 5CVRA 3S0MA 3ZN6A 1AXZA 1RUG3 5BV6A 4LUKA 4HPKB 2ZPXA 2DTYA 4J6GA 1CAVA 3FWEA 4OLLA 4OULA 5GZEA 2OUJA 1CGPA 1DLLA 3AKTA 1JH5A 4AGGA 5C4WB 3PTYA 1ZZ8A 2FBEA 5T55A 1FT9A 2O8QA 4ASLA 4N53B 2WKKA 4PBOA 1QJU1 2XVLA 3VBUB 4AE2A 5KBFA 2AZ5A 2VPVA 3K51A 2WLQA 1RUH3 1G86A 1BVP1 2VOKA 2E6VA 1YFUA 3WG3A 4HANA 4AQSA 5BUVA 2GNBA 1QXPA 3IDBB 4Z1VA 1WMEA 4S2FA 3LWCA 1N47A 2RS51 4HETA 4OI1A 3ZXAC 4DPNA 3ZYGA 5I0RA 2PLV3 3FX3A 1DDLA 4MX3A 4RQPA 3FBYA 1S1AA 4YZ4A 5ABJA 2XGXA 4IERA 4XBNA 3USUA 3H9AA 4LBOA 1K5MC 3O12A 5I93A 1FOD1 4FCAA 2R0FA 3H1MA 2EAAA 5C6CA 4LBNA 1C1LA 1AR93 1XRUA 3CEWA 4JGYA 4GB31 1AYM1 4KQ7A 4M0HA 5DUXA 3OF1A 4XF1A 5J48A 2X5IA 2WFF3 2D93A 4XBLA 2F4PA 2ZHKA 1R091 5E89A 2ZTNA 3WQ0A 5ACA2 4FSJA 3EBRA 2HWC3 5C8CB 4K8FA 4OI0A 1YI7A 1VBC1 1AHSA 4B3NA 3AXDA 1H2MA 4AVVA 1BMV2 1VBE2 1PGW1 2JG8C 2MPFA 2XJQA 4UBGA 3AKQA 3VL8A 2GC1A 3JBG3 3MFAA 4Y5Z0 4OHVA 4L11A 4XZPA 4Z82A 1RMU3 1QF3A 1H30A 5CFCA 3E6DA 1HQNA 2WQZC 4FOVA 1ONAA 4K1YA 3RPQA 2BVBA 1ND2B 4EN0A 4M3CA 4RA0A 1JOJA 5L7OC 2ZX3A 1PO11 4PLMA 1D2QA 2ET7A 1Q56A 4WM8C 5CFDC 1G9FA 1YNAA 3P3NA 1TME2 1UIKA 1X8EA 4CEWB 2UYAA 3WD5A 1A6CA 2IC1A 1ULEA 3H3UA 3ZXJA 2DUPA 1NY72 1VIWB 2DUOA 4FVVA 1QU0A 4MZUA 4LBLA 4PBPA 4QT6A 3E5XA 4D94A 1VALA 5IK8A 4RS5A 3KB5A 5LRSA 3N7LA 3OPZA 1WW5A 4GH4C 3WP4A 5EYYA 4RHV2 1RUOA 3B01A 1ALYA 3AFKA 1BK1A 3MIDA 4PQ9A 4YZ5A 1U5IA 3MICA 2O0OA 4XF0A 3VBHB 3FBMA 1L3JA 3JU9A 3N36A 4INDA 1NA1A 1ZBE1 5GLTA 1RUG2 3TN93 1H1IA 4OZXA 4AVAA 1O91A 3M3IA 2WZPP 2UWBA 4YVWC 1VRH3 1RJ8A 1DQ2A 5JLVA 2D6KA 5C4WC 1EV12 3MIEA 1VBB2 4B4RA 1N3QA 1LGBA 1AL0G 1AF9A 4MH0E 2BW8A 2A75A 1HRV3 1Q5OA 2X5IC 2MEV2 1O3TA 4AQTA 4QQ2A 4O9EA 5AVAA 5EFUA 3SXWA 5JCTA 2D5HA 3OGJA 1BEV1 4Z07A 4JTNA 1WMDA 4ONUA 3OYWB 4GA9A 1PGSA 2D6OX 4O9GA 4DMIA 1UPIA 3MPBA 1RITA 2WSVA 1VB2A 2CAUA 1VAKA 1J1LA 5H9RA 1RMU2 1YFYA 5JOZA 4YYOA 1WLCA 5DUUA 1W0OA 1Q8QA 4IEQA 2PAEA 4P9JA 3WDWA 2EAKA 3LCPA 1MZFA 2GH8A 3APBA 2R1BA 5FPZA 1X8MA 2WC2A 2EF6A 2GMEA 1PVC1 2RR12 4RHV1 1R1A1 3V0AB 5LK7B 1G7YA 1I6XA 3VBSB 4ORFA 4R9DA 5K0UC 2BEOA 3RWNA 3TOJA 1W6NA 3VHOA 1SLCA 1H2KA 2Q5TA 3WP5A 1XNDA 4YW4A 2HWB2 2WL1A 1GR3A 4LBQA 2DF7A 1GLHA 1QH7A 3B9CA 3D82A 2WFF2 4E4DX 3VBRA 5IT6A 1FPN1 4R4ZA 1XYNA 4HZFA 2ET1A 4Y20A 4I09A 3T1MA 1LOAA 3M2MA 4YGBA 3MEPA 1JHNA 1W6QB 1AYM3 1BXHA 3LAGA 5T5LA 1VBE3 2WNUC 4YM0A 2JG8B 3KSCA 5GZFA 5HBAA 5FLHA 5T5PA 5CADA 4MGIE 2A6YA 5BNPB 2RM21 1YRZA 1RUJ2 1FMD2 4N7UA 4KGQA 5FAXA 4RS5C 4EWAA 4DOUA 4YFZA 5EV7A 3ZN6B 3LGRA 3AMNA 5HI0A 1U5XA 2B9UA 2GAUA 3JB4C 4JDNA 1M06G 1TME1 3I54A 1ZZBA 2ZGTA 4S2DA 2JG9B 4XYXA 3ILNA 4HLTA 4M01A 3ZIWA 3ES1A 4GMP0 1UCXA 3CF6E 1VBB3 1LEDA 1XQNA 3ZN4A 1C5IA 4N53A 4V1PA 5F5QA 4ZKTB 3DUIA 4IL7A 1TME3 2WFPA 4CEYA 1ZREA 2I2SA 3ILFA 5E8AA 2GALA 3QCWA 4PF5A 1GQHA 3ZSLA 4AHZA 3WUCA 5CFDB 3T1LA 3ENRA 2PHWA 3VDDA 2D5FA 3ZMNA 3HN1A 4XFIA 4CYDA 4ZU7A 5JMCA 4AFDA 3D0SA 3KZ4C 3THTA 1VBC3 1DIWA 2RE9A 2E7TA 4Q4W3 4E4SA 4I30A 1C3HA 2XHKA 4Y22A 1YYNA 1QOTA 4KG8A 4BA6A 5JAXA 3TRSB 4LE4A 1KFXL 3W58A 5J36A 1DQ5A 2ZMLA 1MZEA 2A5ZA 1LR5A 2GC0A 1YIFA 1DGWX 1XU1A 4AEDA 5FLIA 1ZYBA 4KL1A 4SLIA 4CDWA 1C8NA 4XFBA 1ZM1A 2QVSB 4FQZA 1LOFC 1ZVFA 5H9PA 2XUMA 1C4RA 2CWSA 1RUNA 3J8F2 3VBRB 4FPCA 4FXKB 2RMU2 2XG3A 1ZA4A 4Y20B 4XFGA 3PVNA 1H1MA 1ULGA 2KM2A 3B7MA 3MF9A 4WVVA 4KU7A 4R4XA 1AYM2 4L2NA 4Q4V1 5DXDA 4XMAA 3JB8A 1RUI2 3KT4A 1OLRA 1OPOA 4KWKA 1S0IA 2Z79A 1AJKA 4XXPA 3SITA 2WIIB 4YVSC 5KHIA 2Y0OA 2JICA 2OA2A 1NCQC 2LM3A 4OUSA 2PHUA 4SBVA 2VOWA 3RDIA 2KXLA 3OJBA 4NHKA 4X6RB 1ZZ7A 4FQ4A 1ZX5A 3U4XA 3H8UA 1W6MA 2ZGRA 4MXWA 1HDKA 3P3PA 4PCRA 2ILMA 3D5OA 1LB2A 4K40A 1V9U1 1LULA 3NAPB 2B39A 4OI2A 2YV8A 1IQAA 5A3LA 3ME2A 5T50A 3VBFC 4ZXKA 1C57A 2ZKLA 3GZUC 4Y1VA 3ZXLA 1F8VA 1VR3A 2JG9A 3CL1A 1IKPA 1CQ9A 4CDXA 4YARA 1SCSA 3KM5A 5BNNB 2QDRA 4AQ6A 1S2KA 1BQPA 3R05A 1D4M1 4YW5A 3CJIC 2GC3A 4LHLA 1RUD3 3CO2A 4Q27A 3UJQA 4KNCA 5CU1A 4QPGA 1H8TA 3FMGA 4QHBA 3H0OA 2HWD3 3OTFA 4LBMA 1ZRRA 4MGZE 1LU1A 4XJ8A 2V73A 3GHMA 3KCXA 5CB7A 3T2TA 3LOBA 1HQWA 4IEPA 3H50A 4IV3B 1YO8A 1X7NA 5IK5A 1ENQA 4UW3A 2R061 1ZBA1 4NN0A 1WCSA 1AR62 3ACLA 1GZWB 3AP9A 2YHJA 5KC6A 2WFF1 1CN1A 3DV8A 4AW7A 4D69A 2HKXA 3WZ1A 1XE8A 1I9RA 4N43B 3KT7A 4CP1A 4GKYA 3WT3A 3D4KA 2OIIA 2D3RA 3GYDA 2EXKA 5FCCA 4XF9A 4HVOA 3KS7A 4Q0VA 2ZKNA 3WG2A 1PK6B 2VY0A 1LKNA 4X6QB 4M3CE 4FPJA 4K6BA 4ISQA 2EXIA 1AX0A 4YNIA 3EHKA 3SISA 2D6NA 3B3QE 4S2GA 2MNGA 3D6EA 4R52A 1PHMA 1UL9A 1CAWA 3W9AA 2R0HA 3IPVA 1S0DA 4CDWC 4WM7B 1KFUL 3I8TA 3ZFEA 2PQQA 4AHXA 2H6BA 2WZR1 3POWA 4E4ZA 4EWEA 2DFBA 4CDQB 2NQYA 3N7MA 3DL3A 1A3KA 5GZDA 1LEMA 2WA4A 2CAVA 4AI1A 2VNRA 4P9WA 4AK3A 1OOPB 2MEV3 2X8KA 2XVKA 2NMNA 4NVPA 4GKXA 4XOGA 3M4FA 1W6OA 2VG9A 3R0RA 3WG4A 4FPOB 1CAXA 1VBB1 4M00A 3MIHA 1VRH1 4LA2A 2DU1A 1FPN3 3MDPA 1AYN3 1U5YA 2MEV1 4QQPA 1VBC2 1W6MB 1IS6A 1NCQA 1CAUB 2ZACA 5KHKA 1LHWA 3AZVA 1H9WA 2VVFA 2QDNA 3TNPB 3VBOB 3FLRA 3LA7A 4HN0A 4PLOA 3VZLA 2QNKA 2VECA 2AR6A 2PTMA 2LUWA 1CIWA 2IXJA 4Q4W1 4C0HA 4DY5A 4WM7C 3LA3A 4XIOA 1W6NB 2QE3A 1LGCA 5BNNA 2CY6A 1DQ6A 1U5ZA 2XLAA 2HWF3 1QNYA 5ABJC 5FPXA 3WP6A 3FFZA 5J09A 1XU2A 1AR71 1CR7A 4AEKA 3GBWA 3TBDA 1HRI1 2P37A 1WA4A 3G6JB 4XQWA 3VLBB 4JGZB 4Q2FA 4QPGC 1A78A 1UIJA 3HWJA 1W6QA 1HRV2 5I8YA 4NWVA 1GQGA 3HT2A 1NXD1 1PVXA 1RUF3 1X82A 3O0WA 1AL23 1QMJA 4AI3A 1AJOA 4EN7B 4AFAA 3JBG2 4Q1RA 4AGVA 3I59A 3VZNA 4BLJA 3J26N 2PHRA 2W39A 4GIQA 3BALA 2EIGA 2JD4A 2XVGA 3IDEA 4BZ4A 3GHNA 1KQRA 4Q8LA 1VBE1 4H55A 4QGLA 2RR13 3VBHC 2P3JA 4W6WA 1UN1A 4ATFA 4C90A 1N3OA 1YIPA 3DF0A 1XNCA 3H7YA 1VLNA 2OYZA 4UW6A 2A3XA 4Z92B 2UWCA 4Q0PA 1RUD2 3CJIB 5L7OA 1OOPA 3IT8A 1XYPA 1ZZCA 4P9XA 4LO8A 5DDJ1 1W6OB 2DUQA 4ITCA 1IZ3A 3ZFEC 4GQ7A 3M8LA 4XTMA 1CAXB 2QUOA 5CFDA 2R1DA 2GH2A 2AYHA 3VBUC 3SH4A 1AR82 3WQ1A 1WCDJ 3KQRA 4GB32 1MS1A 4GWNA 3AZZA 3WUDA 1NCQB 3AYDA 2FHRA 1LOGA 3GZAA 3MFCA 5CAZA 1XNKA 1R092 3AMQA 4C0BA 4PJYA 1C5HA 1PK6C 3HT1A 3OBTA 4RSUA 3NV3A 1RGSA 5A32A 3HBZA 2R32A 3UV9A 1DQ1A 4EJRA 2JE9A 2P2KA 1SLTA 4XHBA 2EVXA 1DQ4A 4N90A 1WD3A 1DZRA 1QGLA 3PVEA 3H7JA 1VBA3 4CDWB 3K48A 4FPKA 3OY8B 4R8HA 4AHYA 1ND2C 2VQ0A 4OVEA 5FLJA 3WVJA 2RM23 3KD4A 1B09A 3V0BB 1V6OA 1ZRCA 4COZA 1DZQA 1QJZA 5FMOS 5JI7A 1MS4A 2RS52 1PVC3 1W39A 4JGZA 3J8F3 3RJRA 4YM1A 5JZGB 3OCPA 3MF6A 3RI8A 1W2UA 2QKDA 3MI8A 1RUE1 1G6NA 3I4IA 1N3PA 1JW6A 2ARXA 1ZBE3 2BGCA 4GXLA 3PMSA 4JAAA 3J8F1 1JYIA 3MZHA 1PO12 2WZR3 3FC0A 1PO13 1AR72 4AQ2A 1KXGA 4AFMA 2WSUA 2NYYA 3POSA 1IPKA 2XLFA 2DYCA 3B02A 3BPZA 3NAPA 3L2YA 1HV1A 4L92A 4IEZA 4Q4W2 1B35A 1GKBA 1G9CA 4LLOA 1TMF1 2BYVE 2GNMA 4LHNA 4Y4YA 1CONA 2PLV2 4PIXA 5J98B 1FMD1 1MEC2 1YWKA 3M70A 4P9IA 4LR4A 4CDXB 1RTVA 2Z42A 3ETQA 4XJZA 1NLSA 2O1QA 3KT1A 4XFAA 5IK4A 2ZCWA 2GMPA 3B00A 5L7OB 1RMU1 3NWKA 2GZWA 1H8TB 1RJ7A 2BFUL 4MV2A 4XJAA 4FXGB 4IEOA 4HVQA 1IKQA 3EQEA 3WCRA 2RMU3 4IV3A 1UU5A 4JGYB 4QX5A 4DINB 4PDWC 3WW3A 2X5IB 2ZBJA 1ULDA 1ZZ9A 2D98A 3B9IA 1HRI2 2P3KA 4GB33 3WP3A 1MACA 4UXAA 1AR63 3QLQA 2O8OA 1PGL1 1V70A 1XE7A 4Q4Y2 3M7AA 2WNUA 1GSLA 1RUJ3 4WVZA 4DS0A 1Y43B 5CG8A 2NZ9A 2QQPA 2XB6C 2WS92 5T5OA 1PK6A 3AJZA 4B7EA 1HQLA 4NWWA 2GMMA 1F9KA 1DFQA 2R041 2PHTA 3RI9A 3JBG1 1GNHA 3BCWA 4QXKA 3BTAA 3VKOA 5FOJB 2JECA 1X33A 3VBSC 1K5MB 2WNVA 1RIRA 1KJRA 3OD4A 4R9BA 2VW2A 4MSVA 5JDBA 1ASJ2 3MIFA 2AH2A 3RQ0A 2DCTA 1S55A 1AR81 3AXEA 3LOIA 4AVSA 2RS31 1PIV1 5K0UB 2A6WA 1LESA 5FOBB 2ARBA 1ZBE2 5C33A 2BVVA 4I0WB 2HEVF 3RSJA 5KC5A 2JXAA 5KHHA 4AI8A 3J4UH 1BBT1 3ZFFC 1UZYA 2B7YA 2CGOA 4Z2WA 3V65A 1Q8OA 1D0GA 1MZ6A 2G9FA 4IV1B 4XW3A 3JZVA 5AVPA 4XQ4A 3TYJA 4A7ZA 3ALQA 1Z7S1 4K20A 3ZSKA 1PMIA 3FLTA 3HR9A 1W6PB 2DCYA 1AXYA 4FPGA