5CAZA

Crystallographic structure of apo human rotavirus k8 vp8*
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
TLDGPYQPTSLNLPVDYWMLIAPTREGKVAEGTNTTDRWFACVLVEPNVQNTQRQYVLDGQNVQLHVSNDSSTSWKFILFIKLTPDGTYTQYSTLSTPHKLCAWMKRDNRVYWYQGATPNASESYYLTINNDNSNVSSDAEFYLIPQSQTAMCTQYINNGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substantial Receptor-induced Structural Rearrangement of Rotavirus VP8*: Potential Implications for Cross-Species Infection.
pubmed doi rcsb
molecule keywords Outer capsid protein VP4
molecule tags Viral protein, sugard binding protein
source organism Rotavirus a (strain human/japan/k8/1977 g1-p3a[9]-ix-rx-cx-mx-a1-nx-tx-ex-h3)
total genus 40
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2015-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cazA00
3DGTA 4XJAA 1X50A 1NLSA 1CJPA 2A3XA 2CYFA 4LBQD 3WLUA 1V6LA 1JW6A 1GKBA 2CY6A 1LOEA 5HCFA 4AGGA 5JVVA 3APBA 2A71A 1ULCA 2YY1A 3OYWA 2A6YA 2VY0A 5E88A 2EXKA 4BOWA 3DUIA 4Y20A 3WG2A 4R9DA 1RITA 3A0KA 4WZFA 1LOCA 4LBNA 4Z8BA 2WKKA 4XILA 4K1ZA 2AUYA 4M3CE 1W6PA 2ZAAA 3AP9A 1V6NA 5F9TA 1D0HA 2WSUA 1AJKA 1DQ5A 4YG3A 2WLQA 3V0AA 1QDOA 4AVVA 1ZA4A 4FOWA 1LCLA 2W08A 1VAVA 3OJBA 1KRIA 1B09A 3LSEA 2FHRA 1LTEA 3LSDA 2DVAA 1BZWA 1S0JA 2CL2A 2ZGTA 3GALA 3LCPA 1QNWA 2ZGOA 4BLJA 2PHWA 3T1MA 1DIWA 3M3OA 1HQWA 2AREA 2E6VA 4Q8LA 1CVNA 3BOPA 1JYIA 3FFZA 4FOQA 4KBBA 1W6QA 3M3QA 3UJOA 4FPKA 1AXYA 2ZMNA 1QOSA 1GLHA 3FLTA 5CB7A 2A70A 2ARXA 4YZ1A 1N1VA 4C1WA 4XBQA 2DVFA 1APNA 3RS6A 5T52A 3SNMA 4FP2A 4XHBA 4DRRA 1WW6A 2H0BA 5EYXA 2YV8A 2DYCA 2ZGNA 1CPNA 1IOAA 3N7LA 2AR6A 1O4ZA 1UZZA 5DZEA 3FUOA 5GZDA 3WVJA 1VIWB 1ULFA 1YI7A 3T2TA 2EIGA 4YGCA 1G9AA 2W39A 2JECA 3RSJA 2OUJA 2P3KA 4YM0A 2DUPA 4XTMA 3V0BB 2ZGKA 4Y1UA 4XJZA 3SITA 3ZXLA 1LGCA 1DZQA 2D3RA 3WOGA 2A6ZA 1FNYA 2YROA 2I2SA 2YZ4A 5H9SA 4XE9A 4GKXA 1WW4A 3OYWB 4P9YA 1VALA 4Y20B 3ZXFA 5BYNA 3NV1A 4Y1YA 1CR7A 2GNBA 5T5OA 1AZDA 3B3QE 2D6LX 3AZYA 3FLRA 4Q27A 2JD4A 2ENRA 1I1EA 2DTWA 1W6PB 1AVBA 1SFYA 2DV9A 2VUAA 2PHRA 2D6NA 2SLIA 3V0AB 4JRAA 1DGLA 2CWSA 3WDUA 1EPWA 1MS0A 3ZSKA 1PZ8A 1RINA 1WLWA 2ZMLA 4YM3A 3UL2A 3W59A 1H30A 4FPOB 4YZ2A 4FQ4A 1G9CA 4BMBA 1SLAA 5IK8A 2EAKA 3AJYA 4P9WA 1KITA 1LU1A 2E7TA 1MACA 1W6OA 2D6OX 4DQAA 1JN2P 4FP3A 3PVOA 4RA0A 1QOOA 2ZHNA 2DUOA 1WW5A 1Q8QA 5EYYA 5H9RA 4IQPA 3RMYA 3SH5A 5DUUA 3OBTA 2CWMA 3MW4A 4YW2A 1HKDA 2ZABA 2CNAA 1G7YA 3O12A 1W6QB 3MPPG 4XJ9A 4XJ8A 1ULEA 5CBLA 4YZ3A 3WUCA 5GZGA 3B01A 1GNHA 5T5JA 3AYDA 4SLIA 2PHXA 1G8WA 3ZSMA 1LJ7A 2KM2A 3AP4A 1LHUA 4ITCA 2WJSA 2LTNA 3WUDA 4GWMA 1C4RA 2BQPA 2NM1A 1WBFA 3WDTA 5GLVA 4U36A 3U4XA 2W52A 1LOFA 2P2KA 4FOVA 4YM1A 2G4IA 1QMJA 2WSVA 4Y24A 4XMAA 3RMXA 4H55A 1H9WA 1YO8A 3NV4A 1FATA 2Z42A 4JCKA 1MVEA 2ES3A 1V6IA 4DPNA 1GNZA 2VW1A 1JHNA 1SLLA 2WT0A 3HMYA 2AENA 1SLCA 2E53A 4XTPA 1JUIA 1S0GA 4TYSA 2Q5TA 4FOYA 3M3CA 2DUQA 3ATGA 2P3JA 3AP6A 1V6JA 1SBFA 5KXDA 2EALA 2HYKA 2R1BA 3ZVXA 4ISQA 5DZGA 4BMEA 1IS3A 3R05A 1ENRA 5GJ6A 1C57A 4UW4A 5T5PA 4C1XA 2DVBA 5H9PA 3ENRA 4LBJA 2D6KA 4YZ4A 1FYUA 1S0IA 4YW4A 5DZFA 3QLQA 2PHTA 4YG6A 4MYEA 4XIOA 1LESA 2LALA 1GANA 1LOGA 1KQRA 1YYNA 1CPMA 1LECA 3AFKA 3VV1A 2GN3A 3INAA 1QU0A 1H9PA 1YXWA 1PZ7A 3B9CA 3I8TA 3WDYA 1DHKB 1JBCA 1OKQA 5GLZA 1BXHA 1ENSA 1QOTA 4Q2FA 5CNAA 1QKQA 1GYKA 1N3PA 1W6OB 3FUQA 1N1YA 4FPHA 5JOZA 4YW5A 1IKQA 2E51A 2R1DA 4XZPA 4LBQA 1W6NA 1MR5A 5H9QA 4XBNA 3POYA 4PCRA 3ZSLA 1GBGA 3ILRA 1DBNA 1V6OA 2P37A 1GZWA 5GALA 2YXSA 2V5YA 2NMNA 5CA6A 4LBKA 3WCRA 4YGEA 1DYKA 3HN1A 1HQLA 3BODA 3AXDA 4OZXA 5GZEA 3VKLA 3VUOA 1ONAA 3UK9A 3VKOA 4DFSA 3AZVA 4FPGA 4M3CF 3WG1A 5FREA 5IK4A 3WDWA 1V6KA 4ISRA 3B69A 3N35A 3AK0A 1U0AA 2WT1A 1SBDA 1SCRA 2ZZJA 3ZSJA 1G9BA 1ULDA 2ZGQA 1LENA 4NO4A 1LODA 3PMEA 4HANA 3JUUA 1KJRA 4XBLA 4AVSA 3ASIA 1GICA 4ZKTB 5IK5A 1N3OA 4XMIA 2WT2A 1WD3A 3N36A 1WLDA 4LBLA 1SCSA 3NV2A 5GZCA 3ZPYA 2AYHA 4YW3A 1SLBA 2B7YA 2VU9A 5E89A 1PZ9A 2NMOA 3ZXKA 1F9KA 1W0OA 2ZKNA 4Q26A 4XXAA 1SBEA 3OPZA 1UMZA 3PVEA 3VKFC 2VW0A 1S1AA 2A5ZA 4K20A 1MS1A 3N7JA 4AVTA 1HLCA 1A3KA 3D4KA 2ZGUA 4YLZA 1WCSA 3KM5A 2P34A 5HCAA 4GA9A 2ZBJA 1ULGA 2D3PA 1DQ4A 1S0EA 1AF9A 2DWRA 1WD4A 4Q8KA 1BYHA 1DQ1A 1VAMA 2OVUA 3AP5A 2P3IA 1IS5A 1IKPA 4GWNA 1N1SA 3L2YA 3IKWA 3RG0A 3N7KA 4AWDA 2GMEA 3BTAA 3N3HA 3SISA 2ZGSA 1UKGA 1LOFC 1UZYA 1DQ0A 3AYCA 2FMDA 3B00A 1AX0A 2C9AA 3ILFA 2ZGMA 4R9CA 4XXPA 5DUXA 5KXBA 1AXZA 3WG3A 3QCWA 1Q56A 1KDKA 1DFQA 1OFSA 3O0WA 2C5DA 1XQNA 3PVNA 4LBQB 4YFWA 1W6NB 5DG1A 2RHPA 2WQZC 1Z0HA 4NOTA 1CESA 2DURA 1GZWB 1WBLA 4GXLA 2GDFA 3FLPA 2OUHA 4BPZA 4YM2A 5KXCA 4RL7A 1W0PA 1GZ9A 3AZWA 5GLTA 3USUA 1MS9A 1VLNA 5T54A 1A8DA 5JMCA 3AJZA 5JLVA 1FAYA 2DVDA 1JYCA 5CAZA 1UX6A 1LEMA 1KDMA 3WG4A 2UURA 4M3CA 4Y26A 2GNMA 1WLCA 1C1FA 3AYEA 2A75A 1N1TA 1S0CA 1JOJA 5GM0A 4FPYA 3TB0A 3WCSA 3WDVA 1IS6A 1LHNA 1OQ1A 2A3WA 4FPLA 1Q8VA 1A78A 2SBAA 3AZXA 3O0XA 2NN8A 4TZDA 3WV6A 4LBOA 3AZZA 1UN1A 4YG0A 4W65A 3SH3A 5IK7A 3BIWE 2AGSA 2JKBA 2A7AA 3IM0A 1QF3A 4R9AA 3RRDA 3SH4A 1W6MA 3W58A 4F83A 3WZ1A 1UPSA 2EXHA 1BQPA 2DTYA 3AP7A 1R1ZA 4DS0A 1Z78A 5KXEA 2A6VA 2D6PA 4LBMA 1TEIA 2UWAA 3V65A 1ZM1A 3O0VA 4U2AA 3A0NA 4ZXKA 4PQ9A 2TEPA 2W68A 3ZYRA 1QGLA 2GNTA 3MW2A 3I4IA 4XOGA 2UWCA 3O5SA 3SLIA 2CTVA 1CN1A 5AVAA 2E7QA 1LULA 4Y1ZA 5E8AA 2PELA 1CIWA 2D7FA 3VKMA 4D69A 1AX2A 5GLUA 1J1TA 1FV3A 1UAIA 2JDZA 4UW6A 2ZHMA 4Y1VA 5SV8A 2VXRA 2PHFA 1DYPA 1QDCA 3IN9A 4M00A 4M01A 3RQ0A 4K21A 2OW4A 1RIRA 4XIKA 4AGRA 4CZSA 2DVGA 4FPCA 2GMMA 2JE9A 1F31A 2R16A 3HR9A 5GZFA 3V64A 1WUVA 4R9BA 1D2SA 1LEDA 3M3EA 1MZ6A 1SACA 2PHUA 3ZXEA 2ARBA 2NYYA 1UL9A 4ATFA 3KQRA 3C2UA 3IPVA 3POSA 4XJUA 5F5QA 4YZ5A 2ZHKA 1MS5A 2ERFA 3GNEA 2XG3A 4YFZA 5JOWA 1LHOA 1GZCA 3VKNA 4DRVA 4UW3A 3AX4A 2JJ6A 1O4YA 1G86A 1Q8SA 2D44A 2ZGPA 1CONA 4PBPA 4PF5A 1LU2A 4WVWA 4YGDA 1I3HA 3USUB 4ASMB 3NWKA 1MS4A 3ZXJA 3ILNA 2EXIA 2D43A 4GALA 1F5FA 1MS3A 2D6MA 4AGVA 1S0DA 3OY8A 5JOXA 4M3CB 1Y7BA 2R0HA 3WNXA 4Y22A 2ZHLA 5JOYA 1JXNA 4Y1XA 4P14A 4XYXA 2A6WA 2ZGLA 4FPJA 3UJQA 1BKZA 2ZACA 1DLLA 3PJQA 1GSLA 2GALA 2UU8A 1DQ6A 3H0OA 3NV3A 1NXD1 4ATEA 2AH2A 4GKYA 1WW7A 1AX1A 1YRZA 2VH9A 2VW2A 3CNAA 1SLIA 1LHVA 1W6MB 4JC1A 5L73A 4CRQA 5FRAA 2GN7A 1FV2A 1AXKA 3OBRA 1Q8PA 1G9FA 4FVVA 3AXEA 2YMZA 4UW5A 1MVQA 4HL0A 3D5OA 1BJQA 3N7MA 4FPFA 1S0FA 1S0BA 2D3SA 5T5LA 1AJOA 3WHUA 1CQ9A 1MS8A 4PBOA 5EWSA 5T55A 2ZMKA 1IS4A 3WHTA 2A6XA 1Q8OA 1FX5A 3D6EA 3ZYPA 4BM8A 2R0FA 4I30A 4YGBA 4BQ1A 3M1HA 2UWBA 1GV9A 5EXOA 4YW1A 1MZ5A 2GMPA 5HCBA 3IMNA 3MEPA 3MW3A 4AYUA 4CTEA 4WVVA 1QNYA 1LHWA 2DU0A 1LGBA 5DXDA 3WDXA 3JU9A 3TAYA 2V73A 3R4UA 3AYAA 3IPVB 1N47A 5DUVA 2EXJA 3R4SA 4Q1RA 1FNZA 5IT6A 3M2MA 3POWA 4FQZA 1LOBA 1DQ2A 2WNEA 3OGGA 4Q1PA 5GLWA 3T1LA 2NP0A 2EF6A 1URXA 4L8QA 4XJWA 5JDBA 1KJLA 5DG2A 5T50A 2XB6C 5LK5A 1LOAA 4P9XA 1LGNA 5IUQA 1V6MA 4XHXA 3Q9OA 4WV8A 1C1LA 1HDKA 2ZA9A 3OY8B 1YIFA 5DUWA 1SLTA 4K1YA 2DU1A 1N3QA 1ENQA 2R49A 2ZGRA 2A3YA 4XDQA 4Y22B 1V00A 4BLIA 3V0BA 3FBYA 2GNDA 1G9DA 2NZ9A 2JE7A 3A4UA 4FPEA
chains in the Genus database with same CATH superfamily
3E6CC 5APAA 3I2IA 3A23A 3IDBB 3B5LB 1GUIA 3WLUA 5KHKA 1JW6A 1GKBA 3ACFA 5JR7B 3C8XA 5A3NA 3SHRA 4LO5B 4ZS3A 1MQTA 4L9BA 2J1UA 2VY0A 3QH6A 4CDWC 2VUCA 1ASJ3 4HK8A 3A0KA 2I74A 1VRH3 4XFAA 3ZYBA 4G4FA 1AL23 1YQ6A 2L9LA 4K1ZA 2EIDA 4AQ2A 4W6YA 2J1AA 2ZAAA 4K7JA 4DY3A 5C3SA 1XE8A 4LKDA 5FXXA 2XWBB 4I3GA 3BVCA 4N9IA 4YG3A 3TN93 1QWRA 2WLQA 4GD4A 3VBFB 3V0AA 5C9AA 4OMCA 2VOWA 2ZXQA 4WVMA 4M0HA 2V5DA 3BGAA 4FOWA 4LHLA 4BH9A 3OB8A 2RS13 3WXPA 1RVF2 4HKOA 4NR1A 2ORZA 2RR13 5JIAA 5FZ1A 1TME3 4CUAA 2WWSA 3OPWA 4DINB 4NRPA 4IERA 1POV1 1VBB1 4CEWA 2VG9A 4Q4V3 3MIBA 5A3OA 4COYA 1PO21 1R093 3KVAA 2ZGOA 4HG6B 4N90A 4PIYA 3T4VA 3ZR6A 1DIWA 2IFWA 3WNMA 1CAVB 2PA7A 5FP9A 3VZOA 1CVNA 3NO8A 5FMDA 3UJOA 5CB7A 1OA2A 1TVGA 2HWB1 3L2HA 1HRI2 4LLOA 1ZYBA 1F4HA 4YYOA 4XDOA 4LKFA 2H0BA 5T3NA 3ZM8A 2WZEA 4O9EA 2YV8A 5EYXA 1IOAA 1ZRDA 2AR6A 4FBFA 4IL7A 2FDGA 1O4ZA 1UZZA 1HQNA 4QHBA 4RS5B 5DZEA 5FZDA 3VHOA 1ASJ1 1VIWB 1YI7A 3VZMA 4XUPA 3VBFC 3C7FA 1G9AA 2JIJA 1YQ2A 4BQXA 4FFFA 5GKAC 5I0SA 4INDA 3TYJA 5KHIA 3WD5A 2XL9A 2ZGKA 3HIFA 2RS31 1DG6A 1DZQA 5A33A 3D82A 3TN91 1PIV3 1WMFA 2YROA 2GH2A 1BBT2 3FZ3A 2YZ4A 4Y3OA 3I97A 2QJVA 2GC2A 2C6SA 2B9VA 2EVXA 3OYWB 5FXVA 5BYNA 3NV1A 1NCQB 4RQPA 1CR7A 3VLBB 5LWBA 1AZDA 4X8NA 4E4SA 3P5BA 1EV12 1KD7A 3DN7A 3VBHB 2ARAA 3IMMA 4MGYE 3DKQA 2DTWA 4QMAA 5ACA2 1AVBA 3CO2A 5LBBA 2C1FA 2RVAA 3G6JB 2VCCA 2HWD3 4MGZE 4Y5Z0 4OI2A 2CWSA 2C4XA 3WP3A 1SG3A 1XYPA 1TE1B 1IG3A 2ZEXA 2VZ3A 4YZ2A 3W59A 4RS5C 1D4M2 4IE6A 4OMDA 4AG4A 3AJYA 3OBAA 4P9WA 1LU1A 3E6DA 1AYN2 2PFWA 1WA6X 2FD8A 2XMLA 4XAAA 2JDYA 5BV6A 4B29A 4JHZA 4Z2AA 2R061 1JN2P 2B45X 4RA0A 3RPQA 1EP0A 1H6XA 3S0MA 2B4KA 5JPMB 1JTZX 2DUOA 4EE2A 3KD4A 4HN1A 4L2NA 5EYYA 5H9RA 4AW7A 3SH5A 4EWDA 3OBTA 2CWMA 5JCTA 3ZFFB 2IC1A 1VBA2 1W6QB 1T6GC 1X82A 3OUJA 4I3PA 1UWWA 5FY8A 2UYAA 5A7WB 3OOXA 3WEZA 3ZOIA 1NCQC 5FZOB 3UESA 3B01A 2BBAA 5AC93 1UU5A 2XWJB 4SLIA 5FO9B 4LK6A 2H0VA 5FMCA 2O1QA 2VVDA 1C4RA 3ZN4A 2BQPA 3U11A 1O3QA 3HJRA 4A7YA 5DAXA 2FZ2A 1T2XA 4NN0A 3ZYIB 1WLTA 3LFMA 2G4IA 3DV8A 4O61A 1YO8A 1Y3TA 2HWF3 2OX0A 1OUSA 2W91A 1MVEA 2ES3A 4AE2A 3AKPA 1US3A 1GNZA 2IXCA 2Y33A 1JHNA 1H2KA 3WP4A 3IWZA 4OHXA 3DYPA 2AENA 3SCGA 2ADDA 4XTPA 4PDWB 1JZ4A 4QHOA 4HPKA 2JE8A 1W04A 3I2KA 2XVLA 4FOYA 5EQUA 5IVEA 2DUQA 3VD7A 3ATGA 3K75B 2IWGB 1BEV1 2JICA 3EBRA 4GIQA 3PTRB 4XFCA 2X53S 3I59A 5DZGA 3ZFFC 2IVJA 3JCIA 4GULA 4LOTA 4UW4A 4Y4RA 5LRRA 3RYPA 1CAXA 2D6KA 4YZ4A 1FYUA 1S0IA 2DCKA 2F6BA 3FHAA 4NAOA 4QXBA 4R52A 3DEMA 4YG6A 2Q4SA 4BB3A 4XIOA 3NNFA 5J48A 2YBKA 1L3JA 2LALA 1ZX5A 1KQRA 1CPMA 1ND3B 4N7UA 5A1FA 1NA1A 2WO7A 4RGKA 5IAXA 2LW8A 3C7GA 2RDQA 4CCCA 1UYZA 3AFGA 5GLZA 1ODNA 4O65A 1IPKA 3H50A 5KHGA 2FDHA 1W6OB 3CDZB 4NPLA 2VPVA 4YW5A 1IKQA 4XZPA 2JEMA 3OD0A 5H9QA 5C5TA 1XNTA 4PDWC 2QCSB 2NQYA 5F39A 5FZCA 1C3HA 4O9GA 4DUWA 1DBNA 1V6OA 2P37A 1GZWA 5GALA 1Z7S2 3VD9A 2JDHA 3VD4A 2AC1A 1AR91 4NHKA 4AQSA 3BUCA 5ABJA 2WR9A 2WA3A 4RFT0 1HRI3 1FI2A 1U5IA 4NWVA 4QQHA 3HEIA 1RUJ2 3I3EA 3CHXA 4FPGA 3UGFA 3WG1A 2BBVA 2BW8A 3S30A 1QXRA 4ISRA 5JAXA 5LBFA 1REFA 2W94A 4QD2A 5FK8A 4FTBA 3FJSA 1LENA 2PMWB 4NO4A 4QX7A 3PMEA 4D6SA 4XBLA 1ND3C 3ASIA 1IHMA 2ARCA 3PU8A 4ZKTB 3G7DA 1K5MB 1OF3A 4CUBA 2BPA2 5AFEA 4LMFA 1H2MA 3VDCA 1NCRA 3NV2A 3ZPYA 5FYHA 2EAAA 1HN0A 1OD3A 4JKLA 4YW3A 5IVFA 2QFEA 5LCWL 3MFCA 1XSQA 1F9KA 1W0OA 3ST7A 2IZWA 3KQ4B 4MUVA 4FCAA 1FMD3 3FN9A 2J1VA 4K20A 1MS1A 1RVF1 1C8NA 4J1XA 5LEJA 3KM5A 3GCWA 2P34A 3DXUA 4IGPA 4ZY9A 2OA2A 5CG9A 3MLKA 2QBXA 2VCBA 1RHI3 2WDBA 5DDJ2 3O1OA 1STMA 4DMIA 4R8HA 1WD4A 4NHXA 5LA0A 4QAWA 4AOCA 4Q29A 3LDRA 3S6PA 3L2YA 2WN2A 3HPNA 3MLLA 3N7KA 3O7OA 5F1RA 1W03A 2QKDA 3BTAA 4I0WB 2OKXA 1UKGA 5EIYB 5I8YA 2WUHA 1D4M3 4TN7A 1UZYA 4QHZA 3AYCA 2FMDA 2OYZA 1AX0A 4LA3A 5KXBA 4ZONA 1JZ8A 3T2PA 1RYYA 3QCWA 1R1A2 2DF7A 5I91A 1CAUB 3NKTA 1O5UA 2C5DA 1IQDC 2W0XA 4YW6A 5DG1A 5FQ0B 2VO5A 3EMRA 4TXWA 2XONA 3VBUB 1CESA 1QJX2 1Q3EA 2DURA 3ECQA 4XCAA 5JUVA 3FLPA 2O14A 4BPZA 3GDBA 2Q1FA 1NQJA 2IVIB 1VR3A 4LQRA 1BBT1 1JH5A 1VLNA 3K77A 3MV11 1A8DA 4EN0A 5JMCA 1K12A 4OZOA 3D0JA 4Q4X3 1KDMA 2RMU2 4EROA 2PAMA 3EJKA 4Y26A 1XYNA 3AYEA 3EB7A 1UQXA 2A75A 1N1TA 3FE5A 4P9GA 1LRHA 4EWAA 4JRLA 4Z92B 1IS6A 1LHNA 1OQ1A 4KQ7A 2HJIA 1EV11 1OI6A 3CBNA 3ACGA 3O0XA 3B94A 2FZ1A 3LPGA 3WV6A 5ACA1 3GM8A 4W65A 3FHQA 5IK7A 3BIWE 5JI7A 5IATA 2AGSA 3PUHA 4R9AA 3SH4A 1OPOA 1W6MA 4HKWA 1HB4A 4E2QA 1H8TB 1US2A 1RB8G 4YPJA 2JG9B 1GFF2 4OUMA 1ZREA 2ZEYA 1D4M1 4AI9A 1F15A 1YIPA 1VP6A 3NAPB 5LBCA 1GMMA 5LA1A 3NJXA 2A6VA 1UOJA 5A3WA 2HBTA 1RUG2 1XNAA 1AYN1 3VBUC 4AI0A 3O0VA 2C24A 3ACLA 3ZDSA 4ZXKA 1WA4A 4QX3A 5SV5A 4OHYA 3MV01 1S2KA 1NLQA 4UI9L 5EFUA 3O5SA 1OMIA 2LROA 2B42B 3Q8CA 4LORA 5E1RA 2W87A 4D69A 1AX2A 1AYM2 1J1TA 5FY4A 1VBA1 5A3MA 4XPVA 1RUOA 3GBFA 1BK0A 2BGCA 1OHFA 2PHFA 4G9SB 3RQ0A 3VHNA 4D6RA 4LO4B 1IZ3A 5FYCA 4AGRA 3MHZA 4G3YC 4FPCA 2F4PA 2JE9A 5LASA 3V64A 2R16A 4AAXA 4CDWA 4CEYB 2JXAA 5FLHA 2PHUA 5FPAA 2NYYA 5FYUA 1UY1A 3LPFA 3IPVA 3POSA 4AVBA 4YZ5A 5FMOL 1BK1A 2ZHKA 4JKKA 5FZAA 2XG3A 4QKBA 3CQOA 5K4LA 1H8TC 4AVAA 5JR2A 2JG9C 1GZCA 1VBC3 3VKNA 4DRVA 4IDZA 5FYMA 2WO2A 1KGYA 3NAPC 4PBPA 4HLTA 2JDKA 2ZGPA 2XQXA 2QZ2A 4AFMA 3H7YA 2BFUS 3USUB 1UMHA 2J7MA 3OSDA 1O8PA 2YPJA 3ZXJA 3SKJE 5FP4A 1F5FA 2DFBA 1S2EA 2OZJA 5IVCA 1K45A 5JOXA 2VZSA 1OFNA 2R0HA 3WNXA 1W05A 4NHLA 2A6WA 3WW1A 3LEKA 3WF2A 4CDQB 2ZACA 2P5BA 3PJQA 3PVBB 4Y33A 5KC6A 1GWMA 5FJKA 3NV3A 2QQNA 3WINE 4RFRB 4AHWA 2WZPP 2BV4A 4C8DA 1RUC3 1R64A 4AI8A 3WW2A 1WW7A 1AX1A 1XU1A 2XJVA 2VH9A 1ND2B 3H7JA 5L73A 2YU1A 4B3NA 4X6QB 2QDRA 4QKNA 2OPWA 2Q8OA 4CEYC 1JYXA 2PAEA 2QQLA 2WNVB 4MHRA 5LBEA 1J3RA 4HK9A 2WQ8A 4EWEA 5A1LA 1CJDA 1MVQA 1OH4A 1ZRIA 3D5OA 3I54A 1BJQA 3VBFA 4FO9A 5BNOB 5T5LA 2D3SA 3BU7A 3HD8B 1CQ9A 1PX4A 3O1PA 2IFRA 2ZMKA 4HMZA 5ABJB 1ZBA2 3WHTA 1J1LA 4GB32 1Z7S1 3WP6A 2A6XA 1EUUA 2VZRA 3OGRA 3THTA 1UZVA 5HV0A 2WZ8A 2PLV3 4IGQA 2HH9A 4LHNA 3DCQA 4LJHA 4I30A 4OUSA 1PVXA 1TZOA 1YQ8A 1RUJ1 4CDQC 2UWBA 4YW1A 3A21A 1MZ5A 2GMPA 3J8F2 2OPKA 5HCBA 3MEPA 4B1LA 1R1A3 3HBKA 5CISA 3JU9A 4BZ4A 2V73A 4O7XA 3K51A 1XRUA 2XJSA 4ORFA 1TQ5A 3VBSB 2VNRA 4COWA 1R083 1ND2C 4XUTA 3ZO0B 3OGGA 4Q1PA 1QJX3 3SQOA 3T1LA 2TUNA 1URXA 1KJLA 1I9RA 2JX9A 2WNVC 3VGIA 3J7NA 4KI5M 3S7IA 4RS5A 1OLME 5IUQA 1F35A 3KCYA 2Y0OA 1C1LA 2CAUA 4OI4A 2ZA9A 5BNOC 3CLPA 4X6RB 4AHYA 1KEXA 2RMU3 2R49A 2ZGRA 2A3YA 1QH6A 4Y22B 4OCTA 1RUNA 2DCYA 4B4PA 3R4DB 3AMQA 5ABJC 1EUTA 3A4UA 2VBBA 1UF2C 1WCUA 1FT9A 1W8UA 4TLGA 1YUDA 3DF0A 1VRH2 3QACA 4LBQD 1OLRA 1AL22 5DDJ1 2CY6A 1LOEA 5FXWA 2VNOA 2QQOA 1UY0A 1OPMA 3OYWA 1JZ7A 4L97A 1RJ7A 4MHUA 4XF4A 3DUIA 4BOWA 4SBVA 4R9DA 4FFIA 1NCQA 2ZKLA 4UAPA 2GAUA 3ZX7A 4LBNA 4Z8BA 4XILA 2AUYA 2XVKA 1VBE2 3VBSC 2BRTA 1CAWB 4M3CE 3AP9A 3NKGA 1E5HA 1V6NA 2RS12 4P08A 1RUG3 5A6ZA 2G9GA 3AKQA 2RR12 1DQ5A 5D8AB 1VE0A 2AACA 4J1WA 2DBIA 1PHMA 1ZA4A 4Q4V2 3T0DA 1YLLA 2W08A 3E5XA 1JU4A 1R092 1VAVA 2ZX3A 5FYYA 1QJX1 3PTYA 3WNLA 2FCTA 1E5RA 5A3LA 3S5AA 3CJXA 2VCAA 4K3UA 4IE4A 3LSDA 4XAEA 1BZWA 1S0JA 2HWC3 1TNFA 3K4DA 4RR3B 3LCPA 4JKMA 1QNWA 1OXCA 2PHWA 4MGIE 3JQWA 3M3OA 2RMU1 3SCHA 2FBEA 2LM3A 4CXXA 2YBSA 4CXYA 3ZFFA 3CMGA 2VOVA 4KBBA 1W6QA 2VMGA 4QM9A 4D7TA 1AXYA 2ZEZA 1GLHA 1AR83 1GNYA 2W46A 5A7WA 4C1WA 2DVFA 2GSYA 5FZOA 5BPXA 3RNSA 3KZ4C 3SNMA 1GWKA 4XHBA 3IIAA 2CGPA 3TEWA 2WC2A 4YVWB 5I8TA 1W8NA 2DYCA 2Y0IA 4XUNA 2CV6A 3P3NA 1KS5A 2HEVF 3B93A 4Q4W3 3FUOA 5LW9A 3ETQA 1MZEA 4COVA 1ULFA 5CIRA 4YGCA 3UETA 2YC2A 4KWJA 4ZU4A 3DL3A 3I3DA 1VBD3 4YM0A 1O4TA 5D8AC 5B4XA 5AVPA 3U14A 3T0AA 4AI1A 4ARYA 2WAOA 4NIHA 4PI0A 1RUG1 4XJZA 3U37A 2A6ZA 4PDWA 3U1XA 3MO4A 2Y6HA 3PUSA 5H9SA 1A34A 4GKXA 1WW4A 2YB7A 2IUWA 4RR3C 4UYBA 2JG8B 3J7MA 1IPSA 4LKSA 1AYM1 3SCFA 4A42A 1RJ8A 5T5OA 1ST8A 2HWD2 1L7LA 3AZYA 2JDAA 3FLRA 5A3UA 1QQP3 1JYTA 5KHHA 3QD6A 2Y38A 4QWNA 5CFDB 1B35B 5FIXA 1W6PB 3S57A 1SFYA 2DV9A 4GMP1 2SLIA 1GOFA 4S2DA 2IXHA 4YVWC 1AR71 1YFWA 3WDUA 4FXGB 4JQTA 5A70A 4LHKA 3ZSKA 1ND3A 1VB4A 3N9PA 1RINA 3GBWA 1UY3A 1G9CA 3E6BA 1H30A 4FPOB 4D6QA 1QJY2 1AR62 5DAWA 4BMBA 1SLAA 5K7PA 1XYOA 3T2QA 2OZ6A 2Y6JA 2EAKA 2ZX0A 4KWLA 4Z1VA 5K9YA 3C7OA 1JOBA 1NUKA 1W6OA 2WNUB 4JDMA 4IGOA 4DQAA 3NNGA 4FP3A 3PVOA 1HB3A 4S2FA 2ZHNA 1WW5A 5FR3A 5AC92 4DOUA 5DUUA 2BFUL 3MW4A 3KHCA 3KGLA 3RJRA 3CL1A 4QQLA 3O12A 4CVUA 1TG7A 2JG8C 3MPPG 1Y43B 2Q1ZB 2IXKA 4XJ8A 4F3JA 5CBLA 1FXZA 1NY71 3WUCA 1HIXA 3ZSMA 2PHXA 1G8WA 4ARXA 3KHBA 4ITCA 3LIHA 2LTNA 4XUQA 5A7NA 2HWF2 2WZR1 1B35C 5CFDC 3MIGA 3EYPA 1DP0A 1WBFA 1RUI3 4B1MA 4CCKA 1ULPA 1ENXA 2W52A 4QM8A 2R072 2P2KA 2O8QA 4P9IA 4FOVA 4YM1A 1QMJA 4Y24A 3RMXA 4JDOA 1H9WA 3LF7A 4KWKA 1FATA 3ACIA 5L7OB 1BVP1 1JUHA 4V1PA 2WT0A 3HMYA 5JSOA 3KVBA 3LEIA 1QY4A 5EJ1B 4EN8B 1S0GA 4MZUA 2WNUC 3KMHA 5A7QA 5C4WB 3BTZA 3AMMA 1ZBA1 2CHHA 3L9JT 3H3ZA 5DAVA 2JIGA 3H8XA 3BTXA 1SBFA 1DZTA 1PVC3 2EALA 1ULOA 3BB6A 4GB31 4WVZA 1YNAA 2IXLA 4LUMA 3UV9A 1REDA 3FL7A 5GJ6A 1VBE3 3ENRA 5CKNA 4QPGB 3TWIA 3J8F1 4YW4A 3D3AA 4IESA 5DZFA 2JDPA 2P6HA 4LO6B 1RUF1 1GANA 1I5PA 1LOGA 3AFKA 1LECA 1OF4A 5FLIA 2GN3A 1Q43A 2CGOA 2CGNA 1YXWA 1HB2A 1JMUB 2VTFA 3J7LA 3TNQA 3I8TA 3WDYA 1JBCA 2PAKA 4Q2FA 3NJZA 2VL4A 5L7OC 1CAUA 1DU3D 2UY9A 1N1YA 3RWNA 3MPBA 1ZBE3 3MICA 4XBNA 4PCRA 4UF0B 3ZSLA 5FQ0A 3VBUA 3MF9A 4LNVA 5C4WC 4CCNA 3VBOB 2LS6A 4JAAA 1PK6B 4W4ZA 4BK4A 3K4AA 1XNCA 4JGZB 1GZTA 3RZMA 3Q8BA 1J3PA 1HXS2 3AXDA 1UU4A 1VRH1 2BJSA 2W1WA 4OZXA 3UK9A 1AL21 1YHFA 3AZVA 3GHNA 4HZFA 5EZWA 4AFDA 5IK4A 1V6KA 1Y9QA 1GQHA 4QPGC 3VHRA 1PGL2 3V56A 4XUOA 5FZKA 1NG0A 3ZSJA 4XVHA 1ULDA 2ZGQA 2QQUA 4K9SA 4BIFA 3ZDVA 1AHSA 2VMDA 2E32A 4HANA 3JUUA 1KJRA 4NIGA 4RGGA 2RM22 1FMD2 2WFF3 2WT2A 2J1SA 2RS11 3N36A 1WLDA 2K9ZA 5E16A 5F3GA 1OVPA 1SHWB 1SCSA 2RR11 4RYDA 4BU2A 2AYHA 4HOOA 1SLBA 1TME1 3KCCA 3CIHA 5C5UA 1RUH2 3T30A 5E89A 1PZ9A 3VL9A 3ZXKA 1JZ5A 4XXAA 1H8TA 2Q30A 3MYXA 1SBEA 2JG9A 1UMZA 4Q4V1 2VW0A 2A5ZA 1RHI2 2AZ5A 4I02A 2QUOA 1R091 3NAPA 3WP5A 3N7JA 4EN9B 3J4UH 1HLCA 4AL9A 4FTEA 2ZGUA 2V72A 1WCSA 2BERA 3PJYA 5FLJA 2C9KA 3VBOC 1PK6C 2D3PA 2OQ7A 3KGZA 4PIZA 3RZZA 4JGZC 2VOXA 4PLOA 5A32B 1AF9A 2OS2A 3BKZA 3THPA 2OVUA 1X33A 2P3IA 3MBWA 3MUY1 4GWNA 3ZIWA 3U4SA 2D5HA 2DCZA 1V9U3 2E26A 2WL1A 2GMEA 3GGLA 3N3HA 3H1MA 4DXRA 3M7AA 1QJY3 1VMJA 1AR63 1LOFC 4QPWA 5FYIA 1SZBA 2C9AA 2GC3A 2QQKA 2W92A 1RL3A 1BVVA 1NXMA 2BU9A 3B02A 3WG3A 4BCUA 3DPRB 2BOIA 3OUIA 4CEYA 5FZHA 5BNPB 3BCWA 1KDKA 1UX7A 3FX3A 4AEDB 3PVNA 3EXUA 1PIV1 4LBQB 4ASKA 5F7UA 1V70A 5FY1A 2ZCWA 5DPNA 3RYKA 1K5JA 1W9WA 5JXHA 2WQZC 3KS7A 5A1AA 5FMOS 3VBHC 1WBLA 4XQWA 4LA2A 4Q4X2 2OUHA 3DECA 2YUEA 4S2GA 5FKCA 4A6SA 5LZ6A 3USUA 1MS9A 1SQ4A 4E8DA 3RI9A 5FXZA 5JLVA 2P4EA 1CGPA 1W9FA 2VQ0A 3IDEA 1LEMA 3I3QA 4LO8A 5J96B 2WYSA 2PN5A 5HV4A 1WLCA 4LOSA 4UWDA 2ZS6B 1S0CA 1JOJA 3TB0A 4QPIB 2R073 2HWD1 1KXGA 4CDQA 5L19A 3H8RA 2VUJA 2TNFA 2YYOA 4CXWA 2SBAA 1F4AA 2VMEA 2ZX2A 2NN8A 1UYXA 5F5IA 3H42B 1UN1A 4YG0A 3MDPA 4KGGA 4N53B 1OSGA 4GWIA 4CDXB 4WM7B 1FOD2 4DY5A 2ET7A 4CU8A 4ASLA 1QF3A 4Q4Y3 2QQJA 2WIIB 1ND2A 3DPRC 3RRDA 3TOJA 1GP5A 1MPXA 5BNPC 3WZ1A 4BQ5A 1R1ZA 1AR61 2OIIA 3IDAA 1Z78A 4AEDC 2XGXA 4XACA 2WNVA 1RUD2 1PNFA 3PUAA 1W2TA 4U2AA 1XE7A 2BUKA 3ES4A 4OHZA 2X29A 4PQ9A 5BNOA 2TEPA 1MEC2 5LA9A 5C7GA 3GJAA 1QGLA 3MW2A 4M0NA 2VJXA 4IV1B 3SLIA 2XH6A 4E2GA 5AC91 2CTVA 1CN1A 4JV4A 2E7QA 5F5AA 5AVAA 2XUEA 4R4XA 1NZCA 1CIWA 2D7FA 3Q8EA 5E8AA 4QQPA 3VKMA 4F8AA 5JXGA 5FO8B 3IBMA 2XKOA 3GYDA 2C26A 4LTAA 5IW0A 4Y1VA 4OHWA 4QKDA 1DYPA 4QPIC 1RC6A 4K21A 3UKTA 1RIRA 3NQHA 4XIKA 3KV9A 3USSA 1WGPA 4N9HA 1IQAA 1VAKA 4DXSA 3UGGA 1WUVA 2VQUA 2WWUA 2HWF1 1VBC2 1LEDA 3ROUA 3VZJA 4UFKA 1VMHA 1MZ6A 3M3EA 1O91A 2K46A 2ARBA 3GZAA 4N53C 2FCVA 4AQTA 4CDXC 3KQRA 4WM7C 2R071 4XJUA 2JDUA 2VR4A 4MXWA 2RJKA 3H3LA 5DAPA 5FYBA 1MS5A 3GNEA 3VBSA 4COZA 1J83A 5FOBB 3AX4A 5J1XA 2GC1A 2JJ6A 2VQTA 1J58A 4WVWA 5K0UB 2VMHA 1I3HA 4XFFA 3ZMOA 4ASMB 2VVFA 2XXZA 3RI8A 1DDLA 1HXS3 1AL0G 3ILNA 4GAZA 3VDDA 4GALA 1W28A 3B9IA 5C3OA 1MS3A 1S0DA 2WABA 3WNKA 2QVSB 4IE0A 3TRSB 3D0SA 4IV1C 1RUC2 2YC0A 4Y22A 4FXKB 1S4CA 4KL1A 1UIJA 2JD9A 2ZGLA 2XHKA 3DYOA 5LY2A 1DLLA 1GSLA 2UU8A 1COV2 1UMIA 2X5IB 2RM23 4ATEA 3BOWA 2AH2A 4R4ZA 5FFOC 4JX0A 3WNOA 3I3MA 4LIVA 1W2NA 4PT6A 2VW2A 3CNAA 4D7SA 1C5IA 1LHVA 1RUH3 2ZOEB 3LQCA 3I7DA 1FPN3 5FRAA 3UT0A 4YVSB 1AXKA 3OBRA 4JVAA 5JSPA 2ILMA 2XJRA 5DQ0A 1UXZA 1CAWA 3AVSA 3MIFA 2BWCA 4HL0A 5FY9A 4FPFA 1S0BA 1H6YA 2PLV2 1AJOA 5K0UC 5D8AA 3WHUA 1MS8A 1HRI1 3NSTA 3WF4A 5D2AA 2QZ3A 4KH9A 3GHMA 1OOPB 1K5MC 3ZYPA 3QOPA 2YGMA 1F8VA 1R082 5F6KA 4RR3A 1IGOA 2ETEA 2X5IC 3IMNA 3MW3A 3EHKA 2DU0A 2Z4FA 1LGBA 5FBJA 1PGL1 3R4UA 1YI9A 2BZDA 3LGRA 1W3XA 4Q1RA 4NJ4A 2WLPA 1OBNA 3M2MA 4MX3A 2B9UA 5FZEA 2WNEA 1W39A 4YVSC 2EF6A 4QDRA 1FMD1 4B7KA 3RZKA 1UYYA 4ZZ5A 2HYXA 3ES1A 4YVWA 4FSJA 2VVEA 5DG2A 5T50A 3ZXAC 2YFUA 4NIDA 4NRQA 4P9XA 1ALYA 2RG4A 3K46A 3GCXA 1V6MA 5DMYA 4HVRA 2DCTA 2XJTA 3OGSA 4UBHA 2IXIA 3WW4A 1JZ6A 4QQ2A 1OD5A 4Z07A 1VRBA 1RHI1 3FHIB 3K3NA 5DUWA 4D7YA 2DU1A 1N3QA 4DB5A 3POGA 3VB9A 3H8OA 2E31A 1T6BX 1PGW2 1G9DA 2NZ9A 3H1YA 4IEVA 4BQ1A 4HSJA 3MIEA 1X50A 1NLSA 1OOPC 2QQMA 3IT8A 1CJPA 3AB0A 5BNNB 5IYYA 2CYFA 1EAH2 1V6LA 2P6CA 4LULA 4X8PA 5HCFA 1DLCA 4AGGA 5JVVA 3WQ7A 3APBA 4N43B 2A71A 2YY1A 3BYWA 1RMU3 3HT1A 2R6QA 3U78A 2JG8A 1FOD3 2RS52 5F5CA 5FCCA 4GH4B 3AKTA 5FUPA 4BXSV 3JBG2 5B2GB 3CZJA 5J36A 3X29B 1RITA 4BQYA 4WZFA 3TNPB 1LOCA 3ZXGA 4DEVA 2WKKA 3ZFGB 1PMIA 1QXPA 4NIAA 3PUIA 2WYFA 3KT7A 5CFDA 1B35A 4FAGA 1W6PA 4NWWA 1RUD3 1D0HA 1QJEA 4AAPA 1XU2A 2WSUA 1PO13 2Z69A 2ZAHA 1YJLA 2ZX4A 4PIXA 3SMHA 4DNYA 3AL5A 3VZLA 1V0AA 1MEC3 1QDOA 1W8ZA 4AVVA 1LAJA 2HWC2 1LCLA 3LAGA 4N7IA 2WA4A 4V2VA 1KRIA 4Q4X1 4A6OA 3LSEA 3E97A 4A7ZA 5FPLA 4L99A 1LTEA 2YPDA 3ZPOA 2VBDA 2WNUA 2DVAA 3URFA 5J98B 2CL2A 1AUYA 1AR82 3E1F1 3GALA 1I5ZA 3ZKUA 2ZZQA 1REEA 4BLJA 5BNNC 4OQ8A 3T1MA 1W2AX 3FWEA 4D0QA 3OPTA 2E6VA 3RZGA 4Q8LA 3BOPA 1JYIA 1JHJA 4N43C 4FOQA 4BJ0A 2VOKA 3M3QA 1HRV3 3C7HA 2ZMNA 1ZZ9A 1QOSA 4FPKA 3FLTA 4GH4C 2ARXA 4Q0SA 4Q4W2 1N1VA 5I0TA 2OQ6A 1APNA 3RS6A 4QT6A 3KV5A 5T52A 3ZYGA 3FBMA 4FP2A 4NUBA 3ZFGC 4DRRA 1VBD2 1WW6A 2D98A 3K3OA 1FOD1 4RSUA 5GZDA 3S5QA 3T2TA 1ZZ6A 4CUGA 2EIGA 3BALA 2W39A 2ZTNA 3RSJA 3JB4C 2ATFA 1UCXA 4XTMA 5F2WA 2YFZA 1NT0A 5L7OA 1RUD1 2YHJA 3ZXLA 1LGCA 3POBA 5FWEA 2I2SA 1WCQA 3O1TA 1COV3 3K4ZA 3HBZA 1QQP2 4CZSA 4LHSA 4BE3A 3W5NA 4E4DX 5C4WA 4P9YA 2VECA 2VM9A 2PYTA 3PL0A 4Y20B 3ZXFA 3ON7A 4Y1YA 2GNBA 1G6NA 5G05L 2D93A 5C8CB 4A7KA 2W1SA 4AHZA 4QPGA 1S2BA 2VUAA 2B8MA 1VBC1 2D6NA 2WS93 4LKEA 2XBO3 3ZYFA 4JRAA 5LA2A 1PZ8A 2G19A 4Q0QA 4CYDA 2ZMLA 4FI9A 3MGUA 4C91A 4B7EA 5DAQA 4YM3A 4FQ4A 5FPUA 2RDRA 2Q8DA 4HSLA 5D1IA 3LOBA 3UKVA 1OVSA 2E7TA 2ORXA 3OG2A 1CAVA 2DBNA 3WY6A 2CDPA 2UYBA 1D7PM 4AZZA 5ANQA 1LKNA 4PI2A 5IFPA 1QOOA 2XHNA 3RZHA 3N9NA 5FBZA 4IQPA 4UF0A 3RMYA 2TBVA 5CG8A 3I2GA 1RUC1 4Q0PA 5FUIA 4A3XA 2CNAA 3VBOA 1PK6A 3U75A 2FCUA 4HFSA 1RUI2 4PF1A 4XJ9A 4JGZA 1ULEA 4YZ3A 1DYOA 4NAMA 4CP0A 5GZGA 1GNHA 5T5JA 1COV1 1YFUA 5HCHA 3WT3A 5C8CC 4KG8A 1LHUA 4E8CA 2WJSA 4L0PA 5JZGB 3WUDA 1KS4A 4GWMA 3NVCA 2NM1A 5ISLA 4L11A 2HWE2 5C70A 5FWJA 1W8FA 2DFCA 4U36A 4AI3A 3U4XA 4M4RA 1LOFA 4AEMA 1WMXA 4IEWA 3THCA 4ZU7A 3UNPA 2WSVA 1OH3A 4XMAA 2RJ2A 2RE9A 4H55A 3LD8A 4H2AA 4I0AA 1W9YA 2BVBA 4LLFA 2BDRA 4JCKA 1WCKA 2VW1A 1W06A 2VZVA 1SLLA 1PVC2 2BNNA 3POFA 4META 5IVVA 5KC5A 4CCLA 4XFHA 4IE5A 1JUIA 2PLV1 4YWAA 1EAH3 1HV0A 5BY5A 4TYSA 2Q5TA 3HQXA 3VBHA 2HLEA 5F3IA 4AEJA 3M3CA 1H2LA 2P17A 2VGDA 3JB8A 3DYMA 4IV3B 5FZIA 5ERLA 3ZMNA 2V09A 3AP6A 1V6JA 3MIHA 4IEYA 3ABZA 2RS53 5CADA 3ZFEB 1CZSA 1OA4A 1R1A1 3JBG3 1C8M3 1ZZBA 2XPJA 3ZVXA 4BMEA 5TSWA 1QIQA 2Y60A 3VD5A 1IS3A 1LR5A 1Y4WA 1ENRA 3R05A 4GJZA 2F17A 3EQEA 5L9RA 1H2NA 3F2ZA 1R081 3DKWA 3KLSA 4QB2A 2DVBA 2FDIA 4RD7A 5A32A 3WR0A 2LRPA 3QLQA 4HKLA 1NE6A 2PHTA 4MVTA 2EIEA 3FMGA 2WBKA 4RN5A 5JZGC 2R043 3HT2A 3GJBA 1H9PA 1ZBE2 2ID4A 2VTXA 4OI0A 2DDUA 1PZ7A 3B9CA 1H4HA 3RDIA 4LO7A 1DHKB 1W0NA 2J1EA 1ENSA 4QXHA 4UFHA 3N4MA 5CNAA 1QKQA 1N3PA 3DPRA 1IG0A 2R32A 4V2WA 1O3TA 3WNPA 5BNPA 5JOZA 2E51A 4AEDA 2VZ1A 4GJYA 4LBQA 1D4VB 1MR5A 2D97A 1QH7A 4CP9B 1DGRA 3J9SA 3JD73 2V5YA 3K48A 4IV3C 1PGW1 2Q8CA 2YGLA 4RHV3 1TMF3 2RV9A 4OYUA 3WCRA 1UIKA 3ZFEC 5KHJA 4UXAA 4I01A 2VCMA 1WMDA 5ANNA 4DFSA 2VMIA 4M3CF 3WW3A 3WDWA 2VE1A 5D21A 2WFF2 3N35A 2RS51 3OBZA 2Y8KA 1SCRA 4LXLA 1G9BA 4QPIA 4BISA 1SDWA 1LODA 4AVSA 4CPBD 1O5LA 2VD7A 2W1UA 1GICA 1U12A 5IK5A 1N3OA 4NRMA 1WD3A 2WQ4A 4N53A 2V4AA 3M70A 4IXLA 4JZRA 4LBLA 5F32A 4CDXA 5GZCA 4WM7A 3RYRA 2B7YA 2VU9A 4JHTA 1OQEA 1L7RA 2ZKNA 5FZ9A 2HWC1 3OPZA 2VMCA 3GXUA 3VKFC 1W9TA 3T08A 2GP3A 4BYYA 4CP2A 4WM8B 1UZWA 4AVTA 4QXKA 5L36A 1A3KA 1GQGA 3ZSEA 3D4KA 4YLZA 3H3UA 1OA3A 3PLQA 3LKJA 5HCAA 1V9U2 1RGSA 4GA9A 1M4WA 1EPZA 2ZBJA 5IWFA 1ULGA 4E4ZA 2P1BA 2BGOA 1POQA 1AR81 1DQ4A 4OHVA 3ZN6B 4JQRA 4XZUG 1O59A 2DWRA 5FYVA 1UW8A 3I2OA 4IV1A 1BYHA 1DQ1A 1VAMA 3SXWA 2VTXJ 1CD3G 4P00B 1N1SA 3IKWA 1X8MA 3RG0A 4N8MA 4LITA 4RHV1 2I45A 3SISA 4Q4W1 2ZGSA 3LIGA 1DQ0A 4R9CA 3CZUA 2ZGMA 4IEPA 5CZKA 1VBD1 5DUXA 1JZ2A 3N9LA 4ZS2A 3HNMA 5C3QA 1BEV2 1LB2A 4ET7A 3HNYM 1UOBA 1OFSA 2BWAA 3O0WA 4ONUA 1W8TA 5FTTC 4ZPIA 1W6NB 4QGNA 5EHDA 2BTVC 2RHPA 2J1RA 1Z0HA 4NHYA 5FYZA 4GXLA 2WN3A 5A80A 5KXCA 4YM2A 3EO6A 4RL7A 3AL6A 1UPIA 4WM8C 5K0UA 1XSRA 1O6UA 1QJU2 1UZ0A 2WO3A 3AZWA 1W2OA 3O1VA 4GQ7A 4UOJA 2A1XA 1CIYA 2O0OA 3IZOA 5FPXA 1QQP1 1FAYA 4E4HA 1JYCA 2AEYA 4Q0UA 3UGHA 5I0DA 5K8SA 1SPPB 5FMBA 4AK3A 5EPAA 1K5MA 5F3EA 4KU8A 4BHPA 2XLFA 2GNMA 3CF6E 2HWE3 1C1FA 2J22A 4JGYB 4EQVA 3RZJA 3VDBA 4FPYA 3PUQA 3WDVA 1QXJA 1POV3 1PM7A 1VBB3 3KWVA 4QX2A 4Q4Y2 4NHMA 5BNQA 1Q8VA 1PO23 4E2SA 4MH0E 3IB3A 1A78A 4IEUA 2YU2A 4ZU5A 4P9LA 2X5IA 5LATA 4TZDA 3AZZA 4IEXA 1EYBA 2MEV2 2W5FA 2KXLA 3GZTB 4MLOA 5JWPA 5FP3A 4BK5A 5LEKA 3LDBA 2JKBA 3IAQA 2A7AA 3IM0A 5CKQA 3THDA 2HWB3 1F2NA 3W58A 2QQWA 3T0BA 1UPSA 2UY8A 1BQPA 4YVSA 5C6CA 2DTYA 2D40A 3RVHA 4DS0A 5KXEA 3NNJA 5FZ4A 2D6PA 3KB5A 1W2UA 3V65A 2OXBA 1GQPA 4CCDA 2GP5A 1KFUL 3BN6A 3A0NA 2OT7A 5I8SA 2VBPA 2MNGA 2W68A 4H14A 2VNVA 1H8VA 2UWCA 3NJVA 4D8MA 3F95A 5FO7B 4NVPA 1A6CA 4OVEA 4MV2A 5EP9A 1LULA 3WQBA 5FZ0A 1NX9A 2RS33 4CDUB 1SEFA 3VUOA 1OOPA 4C0BA 5AFBA 1UAIA 1RUI1 2JDZA 4JGYC 3O1UA 4IEOA 5SV8A 2IXJA 2W95A 4M00A 1QDCA 3IN9A 5A3TA 4M01A 2Y6FA 3CEWA 3UYJA 3PMSA 5GZFA 1JODA 3HR9A 3OTFA 4KMQA 3I2FA 1SACA 2HWE1 3TBDA 3BPSA 2XQRA 3LEGA 4DXZA 1C28A 1UL9A 4ATFA 3J26N 3CJIB 3C2UA 2WWJA 3PIJA 4HVQA 3D8CA 2JB8A 4JDNA 5F37A 2X09A 5JOWA 1LHOA 3AKRA 2P3YA 3QBQA 1L7QA 4UW3A 1O4YA 2D44A 1UKRA 3LE0A 3OF1A 1CONA 3SEPA 1PVC1 1LU2A 4Q8KA 5A6YA 2LUWA 3MLJA 1H1AA 2FDJA 3ZN5A 4DEQA 5J3UA 1MS4A 4MXVA 4OULA 4AFCA 4AGVA 1OC1A 1VBE1 4M3CB 2EICA 4XF1A 1HN1A 1Y7BA 3LEMA 3P6BA 1JXNA 5JOYA 4Y1XA 4P14A 2R063 3UJQA 4CDUC 1BKZA 2XDVA 4LUKA 5BNNA 1NZIA 1FPN2 1UU6A 3LA3A 4TTGA 3LZZA 2D5FA 1CX1A 1NXD1 4QXCA 2YDEA 4GKYA 3LA2A 4N43A 4XEZA 5FZ3A 5FZGA 4AVCA 3P3PA 5JXIA 1PX3A 4GH4A 5CFCB 5I0UA 2GN7A 2I07B 4LE3A 3ZFGA 1ZBE1 3OGVA 1G9FA 1YFYA 3CJIC 4MADA 5IHRA 2Q0AA 4FVVA 4DXTA 2JDMA 3AXEA 4DZGA 5EJZB 4MGTA 3AMHA 3VZKA 2WRAA 4MGKE 2JDNA 3N9OA 4PBOA 4RHV2 5CKMA 5EWSA 2QQIA 5T55A 1X8EA 2JB4A 4CCEA 5BUVA 3I2JA 4W6XA 1U5ZA 5IVBA 3ALQA 3PNAA 5FAXA 1FX5A 2QQVA 3D6EA 3RZLA 4BM8A 4LT5A 1RXFA 1W90A 1BHGA 4AR2A 3M1HA 4KNCA 2W47A 1GV9A 3WSOA 1BEV3 5HXMA 1H1IA 4Z2WA 3LWCA 2WFF1 4AYUA 4CTEA 4UBGA 1YFXA 3TAYA 2VULA 2FDFA 3AYAA 1OUXA 1N47A 4HBNA 1Q5OA 2VZTA 5DABA 3R4SA 4ZXEA 4KBZA 3VD3A 1A8MA 1HB1A 4GMP0 4DIQA 5IT6A 3POWA 4FQZA 3VBRB 1LOBA 1XNBA 1DQ2A 3MI8A 5CFCC 3K2OA 5HPOA 3MZHA 4AXOA 2W3JA 1XJAA 1HJFA 4NMIA 4L8QA 1K3IA 4LR4A 5FKBA 5JDBA 2JKXA 3T2OA 4A3ZA 1QJU3 2X10A 3JXSA 1I6XA 3PDQA 1LGNA 3B7MA 2N7GA 4BWOA 2Y6LA 4K6BA 3OY8B 4NIIA 4KWUA 1YIFA 2XLAA 4XF0A 4K1YA 2W1QA 1UNBA 1V00A 4I0BA 4QB6A 1JYWA 2XUMA 1RMU2 2GNDA 3NRUA 2K2SA 2JE7A 2K0GA 4FPEA 3DGTA 4XJAA 5FP8A 1PNGA 1PMHX 1V9U1 3OEAA 3HWJA 2A3XA 2Z5WA 3W20A 4YRDA 1QJY1 1OQDA 2HEYF 2MEV3 1CZTA 4QU2A 1ULCA 4XCBA 2A6YA 5E88A 2WINB 1AR93 2EXKA 3WG2A 1PO12 4Y20A 4E27A 1HW5A 4QX0A 4QB1A 4QX8A 1JZ3A 2BOJA 4HT1T 5C8CA 2KR2A 5HXVA 4COUA 1WWYA 4XQ4A 2B46X 4KGQA 5F9TA 5J7MA 3VBRC 4E9KA 1AJKA 4PHZA 1ZRFA 2VQAA 3FC0A 2WNOA 3VDAA 1DCSA 3GZEA 4EJRA 5C3PA 3SEEA 3I3BA 3I2DA 4A4AA 4Z82A 4CCMA 3OJBA 1GP6A 1B09A 5A7PA 1JS9A 1J3QA 1YCIA 4XDPA 2FHRA 3VHPA 4LE4A 5A7OA 4Q5OA 1QJU1 1GR3A 5C33A 2VZQA 1HRV2 2VUDA 2ZGTA 4OFGA 5JIUA 1RVF3 4D3WA 2G9ZA 1HQWA 1PMJX 1HX6A 5JMOA 3PIGA 2AREA 2J1TA 3NNLA 3OD4A 3POIA 4XFGA 4BXFA 3AMNA 3FFZA 4I2OA 2WFPA 4YZ1A 4Q4Y1 2A70A 2BYVE 4XBQA 1GU3A 3A22A 3HNBM 3ELNA 4MGSA 5J37A 1JYNA 3AC0A 4D94A 4AQ6A 2MEV1 5JZGA 2ZGNA 1CPNA 3KT1A 2PTMA 3N7LA 4UFIA 1POV0 5FYTA 4HVOA 3WVJA 2R30A 3BU0A 1WMEA 1H1MA 2XJPA 4LEJA 4CU7A 2JECA 3E5UA 2OUJA 2P3KA 4UFLA 5E6HA 1DGWX 3BI3A 2DUPA 1O7FA 1XNDA 3R0RA 3V0BB 1UY2A 1ZNPA 4Y1UA 3SITA 2Y6GA 4W50A 5J09A 4KG0A 2QE3A 2D3RA 3WOGA 1FNYA 3WQ0A 2CAVA 4UFMA 5KBFA 4XURA 4FTSA 2QTWB 4IETA 5M0TA 4JTOA 2G9FA 2W2IA 4XE9A 4P5YA 2HKXA 1X36A 1MQTB 1DF0A 1NE4A 4IUGA 4IV3A 4WBBA 2VXJA 1VALA 4QKFA 4BQ4A 4DUXA 1K42A 2WS92 2VC9A 3MIDA 2XBO2 4QU1A 4RGAA 1BBT3 3ZFEA 3B3QE 2D6LX 4Q27A 2JD4A 3M3IA 4PLMA 2ENRA 1I1EA 1WCDJ 1UOGA 4Y5TA 1NLRA 4YNIA 4BA6A 3UKNA 2PHRA 4ES9A 1X9PA 3O1SA 2VMFA 3V0AB 5C9AB 1DGLA 1EV13 5A6QA 1EPWA 1MS0A 5IFTA 1RUE2 3JZVA 4WVMB 1WLWA 1HXS1 3UL2A 5ACA3 5JXJA 4B4RA 3O1RA 4FFGA 5JPNB 5IK8A 3WX5A 1KITA 1JOPA 1XB9A 1XNKA 4XF9A 1MACA 1NAEA 2D6OX 4CEWB 4FFHA 1SDDB 3IIIA 1ZVFA 3T4HB 5KR7A 1Q8QA 4F7ZA 4WZCA 2RM21 4CP9A 2GZWA 1AYN3 4YW2A 1HKDA 2ZABA 1MQTC 1G7YA 2FQPA 1VPHA 3KF3A 2YG0A 1X9TA 1DGRN 2E63A 3LDKA 3ZXDA 1BMV2 1NOVA 1RUH1 5EJ3A 1ZRCA 1FPN1 1QEXA 1RTVA 3RJ2X 3SC7X 3AYDA 3H9AA 1LJ7A 2CU5A 2KM2A 3AP4A 4KU7A 1YWKA 5FZ7A 5A6XA 1VBA3 3TEYA 2MPFA 3WDTA 5GLVA 2QDNA 3ZYJB 1F5JA 5C9AC 4AI2A 5CU1A 2HEWF 4HETA 3WQ1A 4H7MA 1NKGA 3NV4A 5FPBA 5I0RA 2Z42A 2C0ZA 1V6IA 4H7LA 4CE8A 4DPNA 5A33B 2JENA 3WF0A 3ACHA 3HAGA 1W3VA 1EY2A 2ZX1A 5HBAA 1C8M2 1SLCA 2W9XA 2E53A 5CVRA 4EN6B 3IDCB 4PJYA 3MFAA 3NL1A 4CEWC 2R7EB 3BTYA 2P3JA 1VJ2A 4WM8A 1W8HA 2BGPA 5F8PA 5KXDA 1DGWA 1IPJA 2HYKA 3KV4A 4RQPB 2R1BA 3Q8AA 5F2SA 5HI0A 4ISQA 2R042 5DN2A 4CCJA 1W9SA 4J25A 4EZHA 1C57A 1KFXL 2ADEA 3HN3A 3ZN6A 5T5PA 5FZBA 4C1XA 5H9PA 5B4NA 4I09A 4LBJA 1UOFA 3TEZA 1UD1A 3H8UA 3N9QA 4AEKA 5LB6A 4MYEA 1LESA 3NNMA 4CA9A 1QJFA 1YYNA 4TWTA 3VV1A 4CCOA 3O1MA 3INAA 1QU0A 3IAPA 3ITQA 5IJRA 4BIOA 5L9VA 2E33A 4EYUA 1OKQA 3P1IA 1BXHA 4CU9A 4ZHNA 1QOTA 1QHDA 4PQQA 1QJZA 3JD72 4QDQA 1GYKA 3BIEA 4XQDA 3FUQA 5FPZA 3HQUA 4FPHA 1JU3A 5FOJB 1SFNA 2R1DA 1TMF2 1E5SA 2CSGA 2H6BA 1UYPA 1W6NA 3NMBA 3POYA 5FY7A 2Z2SB 1GBGA 2JWPA 4MGQA 3ILRA 3POEA 3OCPA 4FT8A 4XABA 2YXSA 2GH8A 2NMNA 3C7EA 1RMU1 4LBKA 5CA6A 1AR72 4JTNA 2EIBA 4YGEA 1DYKA 4W6WA 3HN1A 1HQLA 1ODMA 3BODA 3M8LA 4RQPC 5FYSA 5GZEA 3VKLA 4URAA 1ONAA 3VKOA 5I93A 2O8OA 4Y5SA 5FREA 5G04L 1SPPA 1Z7S3 3I49A 2B5HA 1MZFA 1RXGA 3AK0A 3B69A 4JGYA 1U0AA 5BXXA 1NQDA 1PO11 1SBDA 1XE0A 2WT1A 2ZZJA 1YJKA 4P02B 2KA3A 1MEC1 1RUJ3 1XBFA 2V4VA 1U5XA 4M4PA 3LA7A 4XMIA 5FP7A 3KF5A 4J6GA 2WO1A 4QGLA 3GF6A 3MF6A 2A73B 3WF3A 2RDNA 2NPIA 1NY72 2BNOA 2NMOA 4HPKB 4Q26A 4B4QA 2VZOA 3PVEA 3ORJA 1S1AA 4HXCA 4BQ2A 3LOIA 1W8OA 2WZR2 1W99A 1S55A 1E57A 3I59B 3HVDA 2XKPA 4IW3A 4UT5A 4YSFA 3CU7A 2F4LA 5C8WA 2QQPA 3RWKX 1HRV1 2XJUA 1OLQA 2PHLA 2XVGA 1CAXB 1S0EA 3ZKYA 3AP5A 1IS5A 1IKPA 4OI1A 4CDUA 2YBPA 1VB2A 4AHXA 1ZZCA 4PLNA 3KT4A 1NA1B 1RUE3 4W8JA 4AWDA 2VZUA 4XF3A 5DDJ3 1OLMA 5IAVA 1OKOA 3HQRA 3B00A 4XXPA 5F6LB 3ILFA 3VL8A 3LB9A 3R6SA 1AXZA 4ZZ8A 1Q56A 3U10A 5FDBA 5FUNA 2YC4A 4XFBA 3S7EA 3TEXA 1DFQA 5FZ6A 4S2HA 4A44A 1XQNA 2E7AA 4YFWA 3CJIA 2Y6KA 1UO9A 2DCJA 4NOTA 2NLRA 5LY1A 1GZWB 4CP1A 4NE9A 2GDFA 1RUF2 5FZ8A 1H4GA 2ZJCA 1W0PA 3AMPA 4MSVA 1UY4A 1GZ9A 5GLTA 4C90A 4AF9A 2BVVA 4MXWB 4A45A 1VBB2 5T54A 3AJZA 1PO22 3ZIXA 2DVDA 5CAZA 1UX6A 3WG4A 2UURA 4M3CA 3DXTA 2H6CA 4HONA 4A2UA 5C71A 2WS91 5GM0A 1HV1A 2XBO1 1XC6A 3WCSA 3CKHA 2FMYA 2A3WA 5FY5A 4FPLA 3T3YA 4URTA 2HWB2 2XJQA 3VDDB 2BP6A 2Q1MA 4GZ9A 4MOAA 3AZXA 1NA1C 4TSVA 4IE7A 3AM2A 4LBOA 4NPMA 5CEHA 5FPVA 1NCRB 3AVRA 3SH3A 4NPRA 1YQ5A 1XOYA 1ZZ7A 2PXJA 1YC61 3W21A 2AEZA 1D0GA 4OLLA 1ASJ2 1RUE1 4DO0A 4F83A 5CFCA 4AFAA 1JYVA 2EXHA 4MO3M 5A3PA 3AP7A 4QX5A 4FAHA 4EN7B 1W8WA 1WKYA 1M06G 3E5QA 4LBMA 5A7SA 1TEIA 2UWAA 2VZPA 2VOTA 3KCXA 1ZM1A 2RS32 2B39A 4Y4YA 5FZLA 4B8EA 5LRSA 3TN92 4YARA 1J59A 3O14A 3KSCA 3ZYRA 2GNTA 2J42A 3I4IA 1OT5A 1YQCA 4XOGA 3VN4A 2Z79A 4BQ3A 2ZEWA 2ZPXA 4A41A 4Y1ZA 4YW7A 2PELA 1PGSA 4Q0VA 4XC9A 5FJHA 4C0HA 2G1MA 5FV3A 5GLUA 3RFRA 1O3RA 1FV3A 1TME2 1O8SA 2GU9A 1O3SA 4UW6A 1BMV1 2ZHMA 2QNKA 3ETPA 4K40A 2VXRA 4UFJA 2OW4A 2PHDA 3VDDC 2VAUA 2DVGA 2GMMA 3MUZ1 1F31A 3WNNA 1SMVA 3KV6A 1AYM3 4R9BA 4QDSA 5JSRA 1D2SA 3C3VA 4EZ4A 3ZXEA 1ACCA 1NCRC 1PM4A 3J7HA 4K8FA 5FZMA 1XPWA 5F5QA 4LK7A 1BLZA 5F3CA 2ERFA 1EAH1 3W9AA 4YFZA 2CDOA 1GP4A 3GBGA 4HN0A 3VBRA 4P9JA 4GMP3 3NW4A 5FK7A 3ME2A 4QGMA 2XL7A 3I2HA 1G86A 1Q8SA 4PF5A 4YGDA 1AR73 3RGBA 1ZZ8A 2EA7A 3JBG1 1C8M1 3NWKA 3POJA 4L92A 2R062 4BDVB 2EXIA 2D43A 1YEWA 3ZR5A 2BEOA 2D6MA 4NROA 3OY8A 1ZRRA 2XR4A 4MG2A 2HBUA 3OEBA 4XW3A 3H1WA 4CU6A 4EV0A 1J84A 1LNSA 2ZHLA 1WZXA 3JQXA 1UXXX 4XYXA 4FPJA 2RDSA 1PIV2 2R041 1BCXA 2PQSA 2GALA 4AFBA 1DQ6A 3H0OA 4K8RB 4P5HA 1CX4A 2Y64A 3ZYHA 1OURA 3BPZA 1YRZA 3PU3A 3T09A 4CUCA 1SLIA 1W6MB 4JC1A 4CRQA 5LK7B 4GWJA 3U0ZA 3W5MA 1FV2A 2ET1A 1X7NA 1Q8PA 3NJYA 2Y34A 3VZNA 1HJGA 2WZR3 5CYYA 2WAAA 2RJLA 1NYWA 5IVYA 1SFPA 2YMZA 4UW5A 2FDKA 3ZLIA 3PHMA 2PQQA 3JD71 3M4FA 2XOMA 5C3RA 3N7MA 5EV7A 1S0FA 1TMF1 1CZVA 4H3WA 1CWPA 1VMFA 1D2QA 1E5IA 1XXNA 4IEQA 1IS4A 1GOGA 1Q8OA 1U5YA 3A7QA 3PURA 1H0BA 1TNRA 3QH7A 2R0FA 4IEZA 5JI9A 4QX1A 4YGBA 4CPBA 1JI6A 1ZBA3 2XLGA 5EXOA 2Q8EA 4CDWB 2X05A 4GB33 5IVJA 4OUEA 1ZA7A 4WVVA 1QNYA 1LHWA 2MHFA 5DXDA 5FZFA 3WDXA 4ES8A 1GWLA 2X8KA 3HOBA 4TLFA 3IPVB 5DUVA 2EXJA 1FNZA 1Y9MA 3Q8FA 4XFIA 2BNMA 3J8F3 5GLWA 2NP0A 1Y9GA 4LIUA 1RUF3 3LFIA 4QPYA 4XJWA 5KWRA 3OGJA 2E9QA 3SKVA 4OQ9A 2XB6C 1GOHA 2VNGA 2KD7A 5LK5A 1LOAA 4DUVA 4QQOA 3N9MA 4XHXA 1C5HA 2GC0A 4LPLA 3Q9OA 4WV8A 5FY0A 1HDKA 4CSWA 3GZUC 1P8JA 1SLTA 5L9BA 4XETA 1DZRA 1ENQA 4XDQA 3U07A 4BLIA 3V0BA 3WF1A 3FBYA 3OUHA 4BQWA 2Y26A 3AKSA 3FFQA 1AR92
chains in the Genus database with same CATH topology
3E6CC 3IDBB 3WLUA 3B5LB 5KHKA 1JW6A 1GKBA 5JR7B 3SHRA 4LO5B 1MQTA 4L9BA 2VY0A 4CDWC 3QH6A 1ASJ3 4HK8A 3A0KA 2I74A 1VRH3 4XFAA 4G4FA 1AL23 4K1ZA 4AQ2A 4W6YA 2ZAAA 4K7JA 4DY3A 1XE8A 2XWBB 4I3GA 4N9IA 4YG3A 3TN93 3VBFB 1QWRA 2WLQA 3V0AA 5C9AA 2VOWA 4WVMA 4M0HA 4FOWA 4LHLA 4BH9A 2RS13 3WXPA 1RVF2 4HKOA 4NR1A 5JIAA 2RR13 1TME3 2WWSA 4DINB 4IERA 1POV1 1VBB1 4CEWA 2VG9A 4Q4V3 3MIBA 4COYA 1PO21 1R093 4N90A 2ZGOA 4PIYA 1DIWA 2IFWA 1CAVB 2PA7A 3VZOA 1CVNA 3NO8A 3UJOA 5CB7A 1OA2A 2HWB1 3L2HA 1HRI2 4LLOA 1ZYBA 4YYOA 5T3NA 2H0BA 4O9EA 5EYXA 2YV8A 1IOAA 1ZRDA 2AR6A 4FBFA 4IL7A 1O4ZA 1UZZA 1HQNA 4QHBA 4RS5B 5DZEA 3VHOA 3VGIA 1ASJ1 1VIWB 1YI7A 3VZMA 3VBFC 1G9AA 5GKAC 5I0SA 5KHIA 4INDA 3TYJA 3WD5A 2XL9A 2ZGKA 3HIFA 2RS31 1DG6A 1DZQA 5A33A 3D82A 3TN91 1PIV3 1WMFA 2YROA 2GH2A 1BBT2 3FZ3A 2YZ4A 2QJVA 2GC2A 2EVXA 3OYWB 5BYNA 3NV1A 1NCQB 4RQPA 1CR7A 3VLBB 1AZDA 4X8NA 4E4SA 1EV12 1KD7A 3DN7A 3VBHB 4MGYE 2DTWA 4QMAA 5ACA2 1AVBA 3CO2A 2C1FA 3G6JB 2HWD3 4MGZE 4Y5Z0 4OI2A 2CWSA 3WP3A 1XYPA 1TE1B 4YZ2A 3W59A 4RS5C 1D4M2 4AG4A 3AJYA 4P9WA 1LU1A 3E6DA 1AYN2 2PFWA 5BV6A 4B29A 2R061 1JN2P 2B45X 4RA0A 3RPQA 1EP0A 3S0MA 5JPMB 1JTZX 2DUOA 3KD4A 4HN1A 4L2NA 5EYYA 5H9RA 4AW7A 3SH5A 4EWDA 3OBTA 2CWMA 5JCTA 3ZFFB 2IC1A 1VBA2 1W6QB 1T6GC 1X82A 4I3PA 2UYAA 1NCQC 3B01A 5AC93 1UU5A 2XWJB 4SLIA 5FO9B 2H0VA 2O1QA 2VVDA 1C4RA 3ZN4A 2BQPA 3U11A 1O3QA 4A7YA 2FZ2A 4NN0A 3ZYIB 1WLTA 2G4IA 3DV8A 1YO8A 1Y3TA 2HWF3 4AE2A 5JWPA 1MVEA 2ES3A 3AKPA 2IXCA 1GNZA 1JHNA 1H2KA 3WP4A 3IWZA 4OHXA 2AENA 3SCGA 4XTPA 4PDWB 4HPKA 2XVLA 4FOYA 2DUQA 3ATGA 2IWGB 1BEV1 2JICA 3EBRA 4GIQA 4XFCA 2X53S 3I59A 5DZGA 3ZFFC 3JCIA 4GULA 4UW4A 5LRRA 3RYPA 1CAXA 2D6KA 4YZ4A 1FYUA 1S0IA 2DCKA 2F6BA 4R52A 4YG6A 2Q4SA 4XIOA 5J48A 1L3JA 2LALA 1ZX5A 1KQRA 1CPMA 1ND3B 4N7UA 1NA1A 3AFGA 5GLZA 1IPKA 3H50A 5KHGA 1W6OB 2VPVA 4YW5A 1IKQA 4XZPA 2JEMA 3OD0A 5H9QA 4PDWC 2QCSB 2NQYA 1C3HA 4O9GA 1DBNA 1V6OA 2P37A 1GZWA 5GALA 1Z7S2 4NHKA 1AR91 4AQSA 2WA3A 4RFT0 1HRI3 1FI2A 1U5IA 4NWVA 4QQHA 1RUJ2 4FPGA 3WG1A 2BBVA 2BW8A 3S30A 1QXRA 4ISRA 5JAXA 1REFA 4QD2A 4FTBA 3FJSA 1LENA 4NO4A 3PMEA 4XBLA 1ND3C 3ASIA 1IHMA 4ZKTB 3G7DA 1K5MB 2BPA2 5AFEA 1H2MA 1NCRA 3NV2A 3ZPYA 2EAAA 4YW3A 2QFEA 3MFCA 3ST7A 1F9KA 1W0OA 2IZWA 4MUVA 4FCAA 1FMD3 4K20A 1MS1A 1RVF1 1C8NA 4J1XA 5LEJA 3KM5A 2P34A 5CG9A 2OA2A 3MLKA 1RHI3 5DDJ2 4DMIA 4R8HA 1WD4A 4Q29A 3S6PA 3L2YA 3MLLA 3N7KA 3O7OA 5F1RA 2QKDA 3BTAA 4I0WB 5I8YA 1UKGA 1D4M3 1UZYA 2OYZA 3AYCA 2FMDA 1AX0A 4LA3A 5KXBA 3QCWA 1R1A2 2DF7A 5I91A 1CAUB 3NKTA 1O5UA 2C5DA 2W0XA 5DG1A 5FQ0B 3VBUB 1CESA 1QJX2 1Q3EA 2DURA 3ECQA 3FLPA 4BPZA 1NQJA 1VR3A 1BBT1 1JH5A 1VLNA 4EN0A 1A8DA 5JMCA 3D0JA 4Q4X3 1KDMA 2RMU2 4EROA 2PAMA 3EJKA 4Y26A 1XYNA 3AYEA 3FE5A 4P9GA 2A75A 1N1TA 4EWAA 1LRHA 4JRLA 4Z92B 1IS6A 1LHNA 1OQ1A 4KQ7A 2HJIA 1EV11 1OI6A 3O0XA 3B94A 2FZ1A 3WV6A 5ACA1 4W65A 5IK7A 3BIWE 5JI7A 2AGSA 4R9AA 3SH4A 1OPOA 1W6MA 4HKWA 4E2QA 1RB8G 1H8TB 2JG9B 1GFF2 4OUMA 1ZREA 1D4M1 1YIPA 3NAPB 1VP6A 2A6VA 1RUG2 3VBUC 1AYN1 4AI0A 3O0VA 3ACLA 3ZDSA 4ZXKA 1WA4A 5SV5A 4OHYA 1S2KA 5EFUA 3O5SA 1OMIA 2B42B 5E1RA 4D69A 1AX2A 1AYM2 1J1TA 1VBA1 5A3MA 4XPVA 3GBFA 2BGCA 1OHFA 2PHFA 4G9SB 3RQ0A 3VHNA 4LO4B 1IZ3A 4AGRA 4CZSA 4G3YC 4FPCA 2F4PA 2JE9A 3V64A 4CDWA 2R16A 4CEYB 2JXAA 5FLHA 2PHUA 2NYYA 3IPVA 3POSA 4AVBA 4YZ5A 5FMOL 1BK1A 2ZHKA 2XG3A 1H8TC 4AVAA 2JG9C 1GZCA 1VBC3 3VKNA 4DRVA 3NAPC 4PBPA 4HLTA 2ZGPA 2QZ2A 4AFMA 3H7YA 2BFUS 3USUB 3ZXJA 2YPJA 1F5FA 2DFBA 2OZJA 5JOXA 1OFNA 2R0HA 3WNXA 4NHLA 2A6WA 3WW1A 4CDQB 2ZACA 3PJQA 3PVBB 5KC6A 3NV3A 3WINE 4AHWA 2WZPP 1RUC3 4AI8A 3WW2A 1WW7A 1AX1A 1XU1A 2XJVA 2VH9A 1ND2B 3H7JA 5L73A 4CEYC 4B3NA 4X6QB 2QDRA 2Q8OA 2PAEA 2WNVB 1J3RA 4HK9A 4EWEA 1CJDA 1MVQA 3D5OA 3I54A 1BJQA 3VBFA 4FO9A 5BNOB 5T5LA 2D3SA 3BU7A 3HD8B 1CQ9A 2IFRA 2ZMKA 4HMZA 5ABJB 1ZBA2 3WHTA 1J1LA 4GB32 1Z7S1 3WP6A 2A6XA 3THTA 2PLV3 4LHNA 4I30A 4OUSA 1PVXA 1RUJ1 4CDQC 2UWBA 4YW1A 1MZ5A 2GMPA 3J8F2 2OPKA 5HCBA 3MEPA 1R1A3 3JU9A 4BZ4A 2V73A 3K51A 1XRUA 2XJSA 4ORFA 1TQ5A 3VBSB 2VNRA 4COWA 1R083 1ND2C 3ZO0B 3OGGA 4Q1PA 1QJX3 3T1LA 2TUNA 1URXA 1KJLA 1I9RA 2JX9A 2WNVC 3S7IA 4RS5A 5IUQA 3KCYA 2Y0OA 1C1LA 2CAUA 4OI4A 2ZA9A 5BNOC 3CLPA 4X6RB 4AHYA 2RMU3 2R49A 2ZGRA 2A3YA 1QH6A 4Y22B 1RUNA 2DCYA 4B4PA 3R4DB 3AMQA 5ABJC 3A4UA 1UF2C 1FT9A 1YUDA 3DF0A 1VRH2 3QACA 4LBQD 1OLRA 1AL22 5DDJ1 2CY6A 1LOEA 2VNOA 1OPMA 3OYWA 4L97A 1RJ7A 4BOWA 4XF4A 3DUIA 4SBVA 4R9DA 1NCQA 2ZKLA 2GAUA 3ZX7A 4LBNA 4Z8BA 4XILA 2AUYA 2XVKA 1VBE2 3VBSC 1CAWB 4M3CE 3AP9A 3NKGA 1V6NA 2RS12 1RUG3 2G9GA 3AKQA 2RR12 1DQ5A 5D8AB 4J1WA 1PHMA 1ZA4A 4Q4V2 1YLLA 2W08A 3E5XA 1R092 1VAVA 2ZX3A 1QJX1 3PTYA 5A3LA 3CJXA 4K3UA 3LSDA 1BZWA 1S0JA 2HWC3 1TNFA 4RR3B 3LCPA 1QNWA 2PHWA 4MGIE 3JQWA 3M3OA 2RMU1 3SCHA 2FBEA 2LM3A 3ZFFA 2VOVA 4KBBA 1W6QA 2VMGA 4QM9A 4D7TA 1AXYA 1GLHA 1AR83 4C1WA 2DVFA 2GSYA 5BPXA 3RNSA 3KZ4C 3SNMA 2CGPA 4XHBA 3IIAA 2WC2A 4YVWB 5I8TA 2DYCA 2Y0IA 2CV6A 3P3NA 1KS5A 2HEVF 3B93A 4Q4W3 3FUOA 3ETQA 1MZEA 4COVA 1ULFA 5CIRA 4YGCA 4KWJA 4ZU4A 3DL3A 1VBD3 4YM0A 1O4TA 5D8AC 5AVPA 4AI1A 1RUG1 4XJZA 2A6ZA 4PDWA 5H9SA 4GKXA 1WW4A 4RR3C 2JG8B 1AYM1 3SCFA 1RJ8A 5T5OA 2HWD2 3AZYA 3FLRA 1QQP3 5KHHA 3QD6A 2Y38A 5CFDB 1B35B 1W6PB 1SFYA 2DV9A 4GMP1 2SLIA 4S2DA 2IXHA 4YVWC 1AR71 1YFWA 3WDUA 4FXGB 4LHKA 3ZSKA 1ND3A 1VB4A 1RINA 3GBWA 1G9CA 3E6BA 1H30A 4FPOB 1QJY2 1AR62 4BMBA 1SLAA 5K7PA 1XYOA 2OZ6A 2EAKA 2ZX0A 4KWLA 4Z1VA 5K9YA 4JDMA 1W6OA 2WNUB 4DQAA 4FP3A 3PVOA 4S2FA 2ZHNA 1WW5A 5AC92 4DOUA 5DUUA 2BFUL 3MW4A 3KGLA 3RJRA 3CL1A 4QQLA 3O12A 2JG8C 3MPPG 1Y43B 2Q1ZB 2IXKA 4XJ8A 4F3JA 5CBLA 1FXZA 1NY71 3WUCA 1HIXA 3ZSMA 2PHXA 1G8WA 4ITCA 2LTNA 2HWF2 2WZR1 1B35C 5CFDC 3MIGA 1WBFA 1RUI3 4QM8A 1ENXA 2W52A 2R072 2P2KA 2O8QA 4P9IA 4FOVA 4YM1A 1QMJA 4Y24A 3RMXA 4JDOA 1H9WA 4KWKA 1FATA 5L7OB 1BVP1 1JUHA 4V1PA 2WT0A 3HMYA 5JSOA 1QY4A 4EN8B 1S0GA 4MZUA 2WNUC 3KMHA 5C4WB 3AMMA 1ZBA1 3L9JT 3H3ZA 1SBFA 1DZTA 1PVC3 2EALA 4GB31 3BB6A 4WVZA 1YNAA 2IXLA 4LUMA 3UV9A 1REDA 5GJ6A 1VBE3 3ENRA 4QPGB 3TWIA 3J8F1 4YW4A 4IESA 5DZFA 4LO6B 1RUF1 1GANA 1LOGA 3AFKA 1LECA 5FLIA 2GN3A 1Q43A 2CGOA 2CGNA 1YXWA 3TNQA 3I8TA 3WDYA 1JBCA 2PAKA 4Q2FA 3NJZA 5L7OC 1CAUA 1DU3D 2UY9A 1N1YA 3RWNA 3MPBA 1ZBE3 3MICA 4XBNA 4PCRA 3ZSLA 5FQ0A 3VBUA 3MF9A 4LNVA 5C4WC 3VBOB 4JAAA 1PK6B 1XNCA 4JGZB 1J3PA 1HXS2 3AXDA 1UU4A 1VRH1 4OZXA 3UK9A 3VUOA 1AL21 1YHFA 3AZVA 3GHNA 4HZFA 5EZWA 4AFDA 5IK4A 1V6KA 1Y9QA 1GQHA 4QPGC 3VHRA 1PGL2 3V56A 3ZSJA 1NG0A 1ULDA 2ZGQA 4K9SA 4BIFA 1AHSA 4HANA 3JUUA 1KJRA 4RGGA 2RM22 1FMD2 2WFF3 2WT2A 2RS11 3N36A 1WLDA 2K9ZA 5E16A 1SCSA 2RR11 2AYHA 1SLBA 1TME1 3KCCA 1RUH2 5E89A 1PZ9A 3VL9A 3ZXKA 4XXAA 1H8TA 2Q30A 3MYXA 1SBEA 2JG9A 1UMZA 4Q4V1 2VW0A 2A5ZA 1RHI2 2AZ5A 4I02A 2QUOA 1R091 3NAPA 3WP5A 3N7JA 4EN9B 3J4UH 1HLCA 4FTEA 2ZGUA 1WCSA 3PJYA 5FLJA 3VBOC 1PK6C 2D3PA 3KGZA 4PIZA 3RZZA 4JGZC 2VOXA 4PLOA 5A32B 1AF9A 3THPA 2OVUA 1X33A 2P3IA 4GWNA 3ZIWA 2D5HA 2DCZA 1V9U3 2WL1A 2GMEA 3N3HA 3H1MA 3M7AA 1QJY3 1AR63 1LOFC 2C9AA 2GC3A 1RL3A 1BVVA 1NXMA 3B02A 3WG3A 4BCUA 3DPRB 4CEYA 5BNPB 3BCWA 1KDKA 3FX3A 4AEDB 3PVNA 3EXUA 1PIV1 4LBQB 1V70A 3RYKA 2ZCWA 2WQZC 3KS7A 5FMOS 3VBHC 1WBLA 4XQWA 4LA2A 4Q4X2 2OUHA 4S2GA 2YUEA 3USUA 1MS9A 1SQ4A 3RI9A 5JLVA 1CGPA 2VQ0A 3IDEA 1LEMA 4LO8A 5J96B 2PN5A 1WLCA 2ZS6B 1S0CA 1JOJA 3TB0A 4QPIB 2R073 2HWD1 1KXGA 4CDQA 5L19A 2VUJA 2TNFA 2YYOA 2SBAA 2ZX2A 2NN8A 4YG0A 1UN1A 3MDPA 4KGGA 4N53B 1OSGA 4CDXB 4WM7B 1FOD2 4DY5A 2ET7A 4ASLA 1QF3A 4Q4Y3 3RRDA 2WIIB 1ND2A 3DPRC 3TOJA 5BNPC 3WZ1A 1R1ZA 1AR61 2OIIA 4AEDC 1Z78A 2XGXA 2WNVA 1RUD2 1PNFA 4U2AA 1XE7A 2BUKA 3ES4A 4OHZA 2X29A 4PQ9A 5BNOA 2TEPA 1MEC2 1QGLA 3MW2A 4M0NA 4IV1B 3SLIA 2XH6A 4E2GA 5AC91 2CTVA 1CN1A 4JV4A 2E7QA 5AVAA 5ABJA 4R4XA 5E8AA