5CAZA

Crystallographic structure of apo human rotavirus k8 vp8*
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
b'TLDGPYQPTSLNLPVDYWMLIAPTREGKVAEGTNTTDRWFACVLVEPNVQNTQRQYVLDGQNVQLHVSNDSSTSWKFILFIKLTPDGTYTQYSTLSTPHKLCAWMKRDNRVYWYQGATPNASESYYLTINNDNSNVSSDAEFYLIPQSQTAMCTQYINNGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer capsid protein VP4
molecule tags Viral protein, sugard binding protein
source organism Rotavirus a (strain human/japan/k8/1977 g1-p3a[9]-ix-rx-cx-mx-a1-nx-tx-ex-h3)
publication title Substantial Receptor-induced Structural Rearrangement of Rotavirus VP8*: Potential Implications for Cross-Species Infection.
pubmed doi rcsb
total genus 40
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2015-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cazA00
1W6QB 1N1TA 3AP9A 2CL2A 3D4KA 4LBQA 4UW4A 4LBJA 3FLTA 4YG3A 4M3CA 1AX1A 3ZSMA 1HDKA 4XJAA 5JDBA 1LHUA 3ZSKA 2C9AA 3N7KA 4AGVA 4FP2A 2YZ4A 1JBCA 3MW3A 1MVQA 3UJQA 4ATFA 4DPNA 1IOAA 1MS3A 2AREA 4XJ9A 2OVUA 3OY8B 1S0JA 3V0BA 1DQ2A 1JXNA 2UWCA 5GLZA 4BM8A 5KXCA 4LBNA 1G86A 1G7YA 4ZKTB 4Q8LA 3O0WA 2VW0A 2ES3A 3ASIA 3AYDA 4IQPA 5EYXA 1FATA 5CBLA 1HQWA 1WW6A 3RSJA 3M3QA 4FVVA 3NWKA 4GKYA 4M00A 2DVDA 2VW2A 1CESA 4P14A 1G8WA 2ARBA 3FUOA 5GZCA 3USUA 3W58A 1YI7A 2P3JA 1LOEA 1GYKA 2A3WA 4FQZA 4NOTA 4Y26A 5E88A 3MPPG 1UKGA 4AYUA 5F9TA 4DRVA 2R1BA 1BXHA 3AX4A 1FV2A 1YIFA 2NMOA 3A0NA 1APNA 4Y20B 1U0AA 1VIWB 1DGLA 1SLLA 2A71A 2C5DA 2ZGQA 4XMIA 2EXJA 1W6OA 1ENRA 3ILFA 1JUIA 4DRRA 2GNBA 3UK9A 5HCBA 4TZDA 1GNHA 1W0OA 2ARXA 3SH4A 1DFQA 2VXRA 5GZDA 2ZGMA 3FBYA 4PF5A 1F31A 3AP4A 2CY6A 1PZ8A 1V6LA 4GKXA 5DXDA 3WCSA 3WDYA 2DVFA 4XJZA 5GM0A 1V6KA 2PHTA 3FFZA 4BLJA 1ULFA 2DUOA 1QOOA 4W65A 3USUB 1N1VA 5T5OA 3INAA 4YFWA 2ZGTA 3QCWA 2EXHA 1IS6A 1GNZA 1Q8OA 3A0KA 3RQ0A 2D3SA 1FX5A 4LBKA 3WUCA 3B9CA 1SLIA 4GA9A 5FRAA 3V64A 4XIOA 1Z78A 3ENRA 4WZFA 3RG0A 2R16A 1J1TA 1I3HA 1W6PB 2A6YA 3AYEA 1LEMA 4JCKA 4YW2A 4YZ1A 4ASMB 3WLUA 1LOCA 1W6PA 1QKQA 3A4UA 5DUUA 1DYKA 2CYFA 2PHRA 4SLIA 2CWMA 4PBPA 1BYHA 1S0BA 3AZYA 2W68A 4CTEA 1BQPA 1SLBA 1VALA 1MZ5A 5CNAA 3VKFC 3SITA 3B00A 4PBOA 5T5PA 3TAYA 1A3KA 1C57A 1SCSA 2DUPA 1A8DA 1F5FA 3M3CA 4TYSA 1AX2A 1LECA 4XBQA 1JW6A 1IKQA 1IS3A 2UWAA 1GKBA 1CQ9A 3IMNA 3N7LA 1BJQA 5DUXA 5H9QA 1MS4A 4HANA 4Y1UA 2GALA 1KDMA 4FOVA 5KXEA 2WT0A 3AYCA 2CTVA 2ZAAA 1UL9A 1SACA 3R4SA 5EXOA 3WDWA 4FOQA 2KM2A 1NLSA 4KBBA 1OFSA 2GNDA 3RMXA 4FPHA 1S0EA 3WDVA 2A6ZA 1CONA 4XDQA 4Q1RA 5E89A 3PVNA 2ZZJA 3AZWA 3NV2A 1TEIA 1DQ0A 2A75A 4K1ZA 3MW2A 1S0FA 3BIWE 3HR9A 4FPCA 5DZEA 3PVEA 2JKBA 1LEDA 1LHNA 1N1YA 4FPYA 4YM1A 1R1ZA 2VY0A 3AJZA 3ZXKA 4Y22A 2A5ZA 2E51A 2GDFA 4FOYA 2DTYA 1UPSA 4ZXKA 5JVVA 1WW5A 2ZGUA 4R9AA 1HQLA 2VU9A 2D6KA 2D3PA 2E6VA 2ERFA 2ZKNA 2DVBA 3AXEA 1FAYA 1SBFA 1GSLA 4GWMA 4ISQA 4AVSA 4YFZA 1MR5A 1QGLA 1GZCA 2AUYA 2WNEA 3VKLA 1QOSA 3BOPA 1QNYA 1QDOA 4XJUA 1LCLA 1WLDA 1CVNA 1KRIA 3N3HA 4UW6A 3ZVXA 1GV9A 3ZXJA 5BYNA 2B7YA 4U2AA 3V0BB 3O12A 1FYUA 1G9DA 4XXPA 1W6NB 2D43A 2R0FA 3WCRA 1LOBA 2D44A 5JOXA 2ZHNA 2GN3A 3B69A 3IPVA 4H55A 5HCFA 3ZSJA 1PZ9A 1N3QA 2WT1A 2YV8A 1Q8QA 2GMMA 5CA6A 5DG2A 3AFKA 2ZGLA 1YRZA 3AP7A 3NV3A 3WDTA 1WW4A 5SV8A 1VAVA 3POYA 5T5LA 3I8TA 2GN7A 3LSEA 4LBQB 5EYYA 1S0GA 2EF6A 1AXYA 1SBEA 3WG4A 1LENA 2OW4A 1SLTA 3WVJA 5IK5A 2GMPA 1JN2P 4YZ3A 3C2UA 3DUIA 4GXLA 5H9PA 3ILNA 3VKNA 4Y24A 1LOGA 3O5SA 4XBNA 2D6PA 2AENA 4P9WA 1W6OB 5DZFA 3ZPYA 1LGBA 4AWDA 1GZWA 3OJBA 2JECA 1LULA 1CPMA 1MACA 3MW4A 4UW5A 1CIWA 2FHRA 3D6EA 4K1YA 1XQNA 1GBGA 2ZGRA 4Y20A 2AGSA 1QU0A 2NZ9A 3GALA 3N7JA 4M3CE 3OYWA 3V0AB 3AYAA 4GALA 1ONAA 1D2SA 3U4XA 2FMDA 4BMEA 2H0BA 4Q26A 3SH5A 4K20A 2OUHA 1AJKA 1ULCA 1CJPA 1EPWA 2PHUA 4AGRA 5JMCA 5DUWA 1JOJA 2GMEA 4M3CB 3ZXLA 4Q8KA 2PHFA 5KXDA 1LHOA 4Q2FA 2P2KA 4BLIA 4XE9A 1W6QA 3AP6A 1AXZA 2WSVA 3R05A 4XHXA 3WDXA 5IK8A 2D6NA 1RITA 2DV9A 4Q1PA 2D6MA 3M3OA 2E53A 4FQ4A 3WG2A 4BQ1A 2A7AA 3HN1A 4LBQD 2R49A 1BZWA 2I2SA 1LGCA 1O4YA 3PVOA 4ATEA 2BQPA 4XYXA 2DYCA 1G9BA 5E8AA 1Z0HA 2ZGOA 3ILRA 5DZGA 4OZXA 2YY1A 5GLWA 1WBFA 1QOTA 2YXSA 4LBMA 1N1SA 1N3PA 1H9WA 2NP0A 2XG3A 2SBAA 4CZSA 2V5YA 5JOWA 4YG0A 5H9RA 4AVTA 1PZ7A 1Q8PA 4XZPA 1WW7A 1KITA 1JHNA 3AP5A 1QNWA 3UJOA 1UAIA 2W39A 2ZMLA 3WUDA 3OBRA 3OBTA 2DUQA 4UW3A 4C1WA 4YGDA 5GLVA 3GNEA 2ZHLA 2WSUA 3PMEA 5LK5A 5JOYA 3UL2A 1W0PA 1QDCA 1LOFC 2CNAA 4YLZA 5FREA 1ENQA 4YW1A 1ENSA 3POSA 1C1LA 3AJYA 1DBNA 3WZ1A 3ATGA 2A3YA 2ZABA 2ZGSA 4XTPA 2XB6C 2ZGPA 4YW3A 4F83A 1DLLA 1SFYA 5JLVA 4CRQA 1UZYA 2EXIA 4XIKA 2LTNA 1N3OA 2AH2A 4P9YA 1LOFA 1UMZA 4L8QA 4P9XA 1G9AA 2W08A 1WLCA 5IT6A 1F9KA 3ZXEA 5IUQA 2D7FA 3WG1A 4YM3A 2Q5TA 5T50A 3WDUA 1KQRA 3WNXA 5GLUA 1LODA 1V00A 1QF3A 1LHVA 1V6JA 2JE9A 1JYIA 2VW1A 1NXD1 1DZQA 3V0AA 1AXKA 2P37A 2WLQA 1Q8VA 2DVGA 4R9BA 1DIWA 3O0XA 1Q56A 1MS8A 1VLNA 4YZ2A 3KM5A 1KJLA 1KDKA 2SLIA 5DUVA 4YM2A 1LOAA 1VAMA 3W59A 5CAZA 3CNAA 5L73A 1C4RA 5CB7A 3BTAA 2P34A 2D3RA 1AJOA 3V65A 5HCAA 4XOGA 3M3EA 1SCRA 3Q9OA 1MZ6A 1WBLA 1V6OA 2R0HA 3AZZA 2OUJA 3T1LA 5T55A 4LBOA 1AX0A 1OKQA 1CR7A 2R1DA 1C1FA 4JC1A 5T54A 4FPOB 1W6MB 5JOZA 3IN9A 3ZSLA 4DS0A 1S1AA 2ZMKA 3I4IA 3B3QE 3VKMA 2A3XA 3FLPA 2DVAA 4I30A 2A6VA 2ZBJA 4XTMA 4YGBA 4YZ5A 1MS5A 2JDZA 2EALA 4XXAA 4YZ4A 2EIGA 4DFSA 2ENRA 5GZFA 2NM1A 2NMNA 3WHTA 4XHBA 4Z8BA 2UWBA 3AZVA 4YM0A 4YGEA 2WJSA 1DQ1A 1CPNA 2RHPA 3M1HA 2VH9A 1LTEA 2PELA 4XMAA 1MS9A 4PQ9A 5DG1A 1WD3A 1YXWA 4U36A 5GALA 2ZHMA 4LBLA 4PCRA 3OY8A 3WHUA 3APBA 1RIRA 1WUVA 3MEPA 1S0IA 1FNYA 2EXKA 1WLWA 4NO4A 4AGGA 1O4ZA 4ISRA 2ZACA 2A6XA 3HMYA 1DQ6A 3B01A 3AXDA 1IS5A 4YGCA 1GANA 2PHXA 4HL0A 1LGNA 1GZ9A 1HLCA 3KQRA 4Q27A 1S0DA 2DU1A 2DURA 3NV4A 3LCPA 1DQ4A 2D6OX 1MS0A 3SNMA 4FPLA 4FPFA 4R9DA 4RA0A 1W6MA 4Y22B 1ZM1A 3WG3A 3OYWB 3JUUA 1YO8A 3RMYA 5IK4A 2UU8A 2WT2A 4RL7A 4GWNA 4WVWA 5KXBA 1H9PA 4BMBA 1MVEA 1OQ1A 3LSDA 1I1EA 1GZWB 1WD4A 3R4UA 5T52A 1DHKB 1MS1A 2WQZC 3FLRA 2CWSA 4YW4A 5IK7A 1ULEA 1HKDA 3L2YA 4D69A 1A78A 1CN1A 3RS6A 1G9FA 2AR6A 4R9CA 1V6NA 3ZYPA 4MYEA 2TEPA 2JJ6A 4WV8A 2EAKA 1IS4A 4FOWA 2AYHA 1AZDA 5AVAA 3SH3A 1ULDA 2DWRA 1YYNA 5F5QA 1LU1A 1AF9A 3POWA 3WV6A 3OGGA 4XBLA 4Y1VA 2JE7A 2ZHKA 1LESA 1ZA4A 1URXA 3T2TA 3ZXFA 4FPGA 4Y1XA 5GZEA 2LALA 4BPZA 2E7TA 1Q8SA 3AZXA 4Y1YA 2P3IA 2DU0A 2ZGNA 3QLQA 4XJWA 3DGTA 3NV1A 1Y7BA 2HYKA 2PHWA 2VUAA 4BOWA 1BKZA 4M3CF 3PJQA 2ZMNA 2DTWA 1D0HA 1FV3A 3O0VA 1LJ7A 2Z42A 5EWSA 1V6MA 4AVVA 3OPZA 3FUQA 5GZGA 3T1MA 2GNTA 3TB0A 1UZZA 2JD4A 3N36A 4XJ8A 3BODA 1SLAA 2UURA 2YROA 3N7MA 2NN8A 3N35A 3D5OA 5GLTA 3SISA 2ZA9A 1DQ5A 1ULGA 3H0OA 3IM0A 4K21A 2V73A 5T5JA 3VKOA 1V6IA 1N47A 3ZYRA 1KJRA 1WCSA 1SBDA 1LU2A 1UN1A 3RRDA 2D6LX 3SLIA 4C1XA 1H30A 4ITCA 1GLHA 1FNZA 1GICA 4XILA 3VUOA 1UX6A 4JRAA 4DQAA 2A70A 2G4IA 1G9CA 1SLCA 3VV1A 4YW5A 1B09A 2E7QA 5GJ6A 2ZGKA 4WVVA 3AK0A 2GNMA 2W52A 3JU9A 4FPEA 1DYPA 1AVBA 3IPVB 4M01A 1RINA 4FP3A 1W6NA 3M2MA 1X50A 4FPKA 2A6WA 3WOGA 1JYCA 1S0CA 3IKWA 5H9SA 4FPJA 2WKKA 1IKPA 2NYYA 1LHWA 2P3KA 4YG6A 4Y1ZA 2YMZA 1QMJA
chains in the Genus database with same CATH superfamily
2J1VA 3AP9A 1NY72 2CL2A 2ARAA 2F6BA 4JAAA 4XVHA 4AI3A 1H8TA 4LBJA 3OGJA 4CDXB 4YG3A 4M3CA 1AX1A 5FUPA 1HDKA 3ZFGB 2ET7A 4DZGA 1WLTA 4FCAA 3VD7A 4XETA 4IGOA 4O7XA 1W8HA 2C9AA 3JCIA 4LO5B 4LIVA 1UD1A 4AQ2A 2QQKA 4AGVA 4FP2A 3NJZA 1H2KA 1JBCA 2WNUA 3MW3A 1MVQA 3PUQA 5FQ0A 4DPNA 5KHGA 3AMMA 3E5QA 1MS3A 2AREA 1COV2 3OY8B 1S0JA 3V0BA 4Y3OA 3LE0A 1DQ2A 2UWCA 3DYOA 4P9GA 4BM8A 3C7EA 4BQ5A 3BTXA 3ACFA 5CFCA 5AFEA 4NPMA 3ASIA 3VBUC 1GOFA 1HQWA 3DPRB 3I2HA 1RUH1 2PLV3 1WW6A 5CYYA 4GKYA 5FP4A 2Q8OA 1QJU1 4JKKA 2DVDA 1GOHA 4HVOA 5L9BA 2XLFA 5A80A 3J8F2 3ZLIA 1OPOA 5A33A 4Q4W3 3W58A 1YI7A 3FWEA 4IEYA 2OA2A 4E2QA 5F9TA 5L36A 5F3EA 5AC93 2F17A 4YW7A 3LAGA 1FV2A 2XPJA 3OPWA 4EZ4A 4CP9A 3A0NA 4Y20B 3POGA 1DGLA 1RUD2 2C5DA 4NPLA 1WKYA 2RS31 5FMBA 1JYWA 1CAWA 2BVBA 1ZRDA 4HKWA 2GH2A 4Y4YA 2QZ2A 2Z79A 1W39A 1GNHA 1X82A 2HYXA 2JIGA 2ARXA 1XYOA 2VE1A 5IVEA 5LBFA 3O1OA 1CAXA 2ZGMA 3FBYA 5C9AB 2IZWA 2VL4A 3ZYGA 5IVCA 2VR4A 4OQ8A 4EN7B 1DCSA 3VZOA 2VZPA 1W8OA 1V6KA 3MDPA 3KCXA 1ULFA 3QACA 4JZRA 1RB8G 3USUB 4CDXC 2P1BA 4MGYE 4LO7A 4M0NA 1H6XA 2J22A 3SXWA 3T2OA 1HXS3 1GNZA 2CGNA 1Q43A 4LBKA 4CP0A 4Y5TA 5J3UA 3KD4A 5FRAA 3KGZA 3V64A 2CGPA 4Z2AA 4Q0SA 4QAWA 3K2OA 4QXBA 3RG0A 2R16A 5J7MA 4AR2A 5K0UC 4FXGB 2QQNA 3WLUA 5ISLA 5LRSA 2V4VA 3D0SA 3R6SA 1E5RA 3IDCB 4YVWC 1DYKA 2V72A 4SLIA 2W95A 4XF0A 5J09A 5J96B 4DUVA 1LAJA 1BYHA 1QJEA 1S0BA 2KD7A 3AZYA 2Y6JA 1HB1A 3KWVA 4HONA 1BQPA 2VUDA 1SLBA 2NQYA 5L7OB 1YFXA 4IV3C 4RS5B 5CNAA 3B00A 3VGIA 1CAUB 4QPWA 3I2OA 1PGSA 1HRI1 1JU3A 4XURA 4TYSA 1AX2A 2JDKA 4XBQA 2E31A 3SKJE 1IS3A 1EV11 5LZ6A 2IXHA 5C3QA 4XQWA 4G3YC 1CQ9A 5FUNA 1Q5OA 1BJQA 4B4QA 3VDAA 3TN93 4QPIC 1HJGA 3W9AA 2DCJA 4COVA 2Y6FA 2QUOA 5KXEA 5DAPA 3AYCA 4MXVA 5I0UA 2CTVA 2WYFA 3LEIA 5FLIA 1NCRC 4LTAA 5KHHA 2XWBB 4YPJA 2GNDA 5A6YA 3CF6E 2A6ZA 4XDQA 4Q1RA 3J7NA 5JXGA 2EVXA 2Y8KA 1MEC2 3GZTB 1LEDA 1N1YA 1NT0A 5FMOS 1R1ZA 1WZXA 3AJZA 3KVBA 4BXFA 2A5ZA 2GDFA 2QTWB 3HQRA 4FOYA 4ZXEA 4AEDB 1PK6B 2QE3A 5FIXA 4AQSA 5A6QA 1UPSA 1X9TA 3HNYM 3POFA 4JRLA 2ADDA 2HWB2 3HWJA 4R9AA 5IVVA 1HQLA 2VU9A 3VZLA 2D3PA 4XPVA 4AI1A 1SBFA 1GOGA 1V9U2 3RZLA 4YFZA 1EV13 4UYBA 1O59A 5C8CA 2RJ2A 3DYMA 2WNEA 3WW1A 2OXBA 4N43C 3J26N 1AR72 3S30A 1CVNA 4YVSA 4S2HA 1KRIA 1PGL1 2YG0A 3I2GA 4NHXA 3ZIXA 2W47A 3LQCA 1K5MC 3O12A 4NMIA 2BBVA 2W0XA 4QGMA 3OG2A 4XXPA 1ASJ3 2D44A 1CAXB 1GFF2 2WQ8A 3AL5A 3B69A 1O3RA 4AEJA 1BVP1 3TNPB 3VHNA 2ZCWA 4ZZ5A 2RDRA 1T6BX 4D6SA 1RVF1 2GMMA 3THPA 5CA6A 1OBNA 4FAGA 4B3NA 3CJXA 3AP7A 3B9IA 1WW4A 3POYA 3I8TA 1K5JA 4L92A 4YWAA 2ZX0A 4LBQB 2BTVC 2EF6A 3NNMA 2RMU1 5FPZA 1XNTA 3H3UA 2E32A 1QJU2 3CIHA 2JDMA 2ZX3A 5LBBA 5F3GA 2DCZA 4YZ3A 4CCJA 5BNPB 2W3JA 4PDWC 3ILNA 3O5SA 4NVPA 4JKLA 4NRMA 5A6XA 1UOFA 2AENA 1W6OB 3NO8A 4MLOA 3ZPYA 5FWJA 2ZEXA 4GMP0 3K4ZA 2HWD2 2K2SA 4GQ7A 1BEV2 4K1YA 2BFUL 2YU1A 1RUF1 3VHRA 4AVCA 1XQNA 4TLFA 2XBO1 4MX3A 2AGSA 2NZ9A 4M3CE 3POEA 3TOJA 3T3YA 4AW7A 3AYAA 1ONAA 4YVWB 3SMHA 3U4XA 4D7SA 2XH6A 3BU7A 2H0BA 4Q26A 1QQP1 4MGSA 4XF9A 1AJKA 3TWIA 3O1TA 1EPWA 2MHFA 4CXWA 1AHSA 2RDNA 3E1F1 3UT0A 5LEKA 5JMCA 1W2NA 1YQ5A 3LWCA 4M3CB 3TNQA 2RJKA 4XFHA 4D6RA 1I6XA 5LWBA 1YEWA 3ZFFB 4Q2FA 5E1RA 4J1XA 5A3WA 1GP4A 5IK8A 1UKRA 3WP4A 4QX5A 1STMA 4IGPA 2A7AA 2I2SA 3ST7A 3U37A 1UXZA 2PQQA 1RMU1 4O65A 1RYYA 3CLPA 3ES1A 5GLWA 5A3NA 1RUE3 4OMDA 1IGOA 5F5CA 4M0HA 2XG3A 3DECA 1FPN2 4Q4V3 2K46A 2W1WA 2GU9A 2QJVA 4AVTA 5JOWA 1PZ7A 3GBGA 4AI2A 1GZTA 3I7DA 1RUJ1 4XZPA 4W6XA 1KITA 1R1A1 1QXRA 3AP5A 3LFMA 3PMSA 4O9EA 4HPKB 1QH7A 2HWC2 3JBG1 5IATA 1C8M2 3OBTA 2Q1FA 5GLVA 2VNOA 1PGW1 2Y6HA 4IEXA 2HBTA 2JDUA 3K48A 5FZDA 3MIEA 4RFRB 1TMF3 4YLZA 4CDUC 3JZVA 1DBNA 3WZ1A 1RXGA 3A22A 1BMV2 3RZMA 4XTPA 3A21A 4LKFA 4DXSA 4YW3A 1DLLA 4MHRA 3Q8CA 2GP5A 4CRQA 1S2BA 4BYYA 5JLVA 1JZ5A 1J59A 3V56A 1HB4A 3ZYIB 4P9YA 1UMZA 4L8QA 2OYZA 1O6UA 3J9SA 2VC9A 5IT6A 2LM3A 4CDQA 4XAAA 4YM3A 3WDUA 3WNXA 1OH3A 1QJY1 1LHVA 4AFMA 1V6JA 4MADA 4AFAA 3VDBA 1PX4A 1POV1 2VW1A 5KWRA 3V0AA 2P37A 3CDZB 4GJZA 4QPIB 2UY8A 1W9SA 4CDQB 4KGGA 1Q56A 2Y33A 4NE9A 4CCLA 1ODMA 5JXHA 1CZVA 5HV4A 3SC7X 1KJLA 2BGPA 2XJTA 3H1WA 4A6OA 4DUWA 1KDKA 3AL6A 3DL3A 3HVDA 3A7QA 4XACA 4LA2A 2ETEA 3MFAA 1MEC3 1Z7S2 4Q4X1 5FDBA 3U10A 5DAWA 2P34A 4AOCA 3MLLA 5LA0A 1GP6A 2QQPA 1GWMA 3THDA 3I3MA 5A3TA 5FZGA 4XW3A 5A3UA 3AZZA 2OUJA 4BQWA 4LBOA 1E57A 3ZYHA 1OKQA 3M4FA 4JC1A 1C1FA 3BI3A 4UFLA 5B2GB 4NHYA 3IN9A 5ERLA 5FZ4A 2YU2A 2X05A 2NLRA 2A3XA 4BDVB 2VECA 3KV4A 2BBAA 2VTFA 2ZBJA 3B5LB 2B9VA 3HPNA 1OKOA 2WWSA 4CCCA 4A44A 5IAXA 4DFSA 5JZGA 1QJX1 1NG0A 4ZS2A 1ASJ2 3AZVA 4YM0A 3PL0A 3X29B 4RR3A 2VZTA 5DG1A 4LOSA 1VMHA 2XQXA 1DLCA 2B9UA 3JBG3 4DIQA 2VQ0A 5GALA 1VBC1 2WNOA 2MNGA 2RS32 2VZ1A 2G1MA 3I59B 3OSDA 4IE5A 4IEUA 4RGKA 2PHDA 2CAUA 5C9AC 1UU5A 3ITQA 4AAXA 1W9TA 2VUJA 2J1EA 3U78A 3K3NA 3EQEA 4S2DA 4CCOA 3BTYA 3NKGA 1YFUA 3MICA 2PHXA 4A7YA 4OHVA 1GZ9A 3KQRA 4QQPA 1CZTA 1KGYA 4RN5A 3LCPA 3SNMA 4O61A 1XPWA 3ORJA 2O8OA 2RM22 1HB2A 3D82A 2WNVA 3I2JA 4LORA 5EJZB 3RMYA 2V4AA 4YSFA 1W2TA 1OA2A 1B35A 1RUH2 4QD2A 1U5YA 5D1IA 2Q8EA 4BMBA 2VULA 1K12A 3LSDA 1F4HA 1HN0A 3JD71 1I1EA 2RVAA 1WD4A 3T30A 3NAPB 1LB2A 1OQEA 1FOD3 2JXAA 4CDWC 1BK1A 3UNPA 2WWJA 5IK7A 1EUTA 4I0WB 1CN1A 4NN0A 4P9LA 5FZCA 1VBE3 4UFJA 3UGHA 4MYEA 5FKBA 2TEPA 1KD7A 1F35A 5LCWL 1ODNA 3RYRA 4EV0A 3JB4C 2AYHA 2IFRA 4N53C 5ABJC 2IFWA 3JB8A 1ULDA 3CJIC 5FY5A 4ZU7A 3NW4A 3AC0A 5JSOA 1LU1A 3R4DB 1HN1A 4IUGA 2W87A 1FI2A 5A3MA 3TN91 4JGZC 2ZHKA 2QZ3A 1JZ3A 4H7LA 4X8PA 4FPGA 4BPZA 2E7TA 4ASKA 2FZ1A 5BPXA 2ZGNA 3DXTA 1D4M2 4Q4W2 3NV1A 4CUGA 1W8ZA 3ZYFA 2RS53 4PI0A 1BKZA 2HWE2 2YFZA 4EJRA 1D4M1 2ZMNA 2DTWA 2R061 3WQ7A 1V6MA 3IMMA 4FBFA 3K51A 4UFHA 3OPZA 4JKMA 5A32B 2JDPA 3T1MA 4A41A 3TB0A 3T2QA 2JD4A 4HVQA 3BODA 4E8DA 2OS2A 1SLAA 2K9ZA 1ZZ9A 2UURA 1EPZA 5E16A 4I02A 2YROA 4D7TA 4HN0A 4N90A 2FCVA 5TSWA 4BQYA 1CIYA 3ZR6A 2ZJCA 4W8JA 3IM0A 5T5JA 4GB33 3ZFGC 5FY7A 2O8QA 5ACA3 1N47A 4NHLA 4DXZA 3SHRA 1UN1A 5BNPC 3HBZA 2ZZQA 4QHZA 5IVYA 5FUIA 5FYYA 1FNZA 5HPOA 1YFYA 2MEV2 1UX6A 4BIOA 1PMIA 2AACA 2G4IA 2XMLA 4NWWA 2JDNA 2VNVA 2R063 3PLQA 5FZMA 3VV1A 1B09A 2E7QA 3FHIB 2ZGKA 3AK0A 3WNNA 1PO13 5BNOA 1PVC2 1VRH2 4B4PA 1SMVA 2XVLA 1YLLA 5FP9A 4PHZA 3IPVB 4Q5OA 3M7AA 4FP3A 5LATA 1W6NA 5K7PA 2RM21 1X50A 2A6WA 1OLME 5FY8A 4FPJA 1LRHA 4LHSA 2P3KA 5HXVA 4ONUA 1UOJA 3FN9A 3BB6A 2R041 2YBKA 3AVRA 3D4KA 2VM9A 3AMNA 4Q4Y2 5FZOA 3O1VA 1VBD2 1X8MA 1VJ2A 2FDGA 2VBBA 4UXAA 5L7OA 4QM9A 2YZ4A 1MQTA 5BNOB 2VOTA 1IOAA 3VBFC 4XJ9A 3I59A 1SFNA 5GLZA 5KC6A 4MG2A 3WF1A 3KHBA 5AFBA 4LBNA 1G86A 2VBDA 4OQ9A 3H1MA 4HN1A 4E2SA 4Q8LA 3O0WA 2VW0A 1OD3A 4IQPA 4OCTA 5EYXA 4QX2A 4AQTA 1OOPA 4CEWA 1HXS1 2XXZA 3M3QA 3NWKA 1C8NA 2VW2A 2VTXA 2GC1A 1XU1A 5FO7B 1G8WA 2W5FA 3USUA 1OI6A 2IXLA 4XZUG 4LO6B 1LOEA 4FQZA 4Y26A 5E88A 3ZPOA 3MPPG 3N9MA 3CU7A 4DRVA 2R1BA 2JDHA 2A1XA 1FPN3 4Q4V2 2BWCA 3MIDA 2BP6A 2XL7A 3GXUA 4MSVA 4OI4A 1VIWB 2D93A 5FMOL 1H2NA 1W05A 4DUXA 5FYMA 2XWJB 2ZGQA 4XMIA 3WW3A 2ZAHA 4CEWC 1CJDA 3RFRA 1ENRA 3RWNA 3H3LA 5FWEA 5A7QA 5FPLA 2GNBA 1PM7A 5FZ6A 3UETA 5FPUA 2C26A 2PFWA 3J7HA 3ZXAC 4XF4A 3SH4A 1W2OA 1RUE1 2YC2A 4IGQA 2W2IA 1VE0A 1V6LA 3BVCA 3ZM8A 2R043 5DXDA 3WCSA 5C71A 3JD73 3ME2A 2WFF2 3CHXA 5EHDA 2B5HA 1RUC2 2PHTA 5JXJA 3FFZA 1ND2B 4CE8A 3D3AA 4P5HA 3TEYA 2DUOA 3KGLA 1QOOA 4CU9A 1N1VA 4H2AA 4YFWA 3VBRC 3GBWA 3HEIA 2EXHA 3MLKA 1IS6A 1Q8OA 1UYYA 1VBB3 3A0KA 1NA1C 5FXWA 2D3SA 4YYOA 4CVUA 2WA4A 1UY3A 4TXWA 2X5IB 1J58A 2OPWA 3ENRA 1J3RA 2R071 1UU6A 5LY1A 4XFBA 1J1TA 3AYEA 3ZIWA 1LEMA 4UT5A 4YW2A 3ZDVA 1D2QA 2C0ZA 2VZVA 2DFCA 1UIJA 3J7MA 4CUBA 4TWTA 2CYFA 2CWMA 3IAPA 1AYN1 5BNQA 3HAGA 1MZ5A 1W9FA 5DAVA 3SITA 3NJVA 3TYJA 4PBOA 5C5UA 1A3KA 1C57A 4QPGC 5BNPA 2DUPA 2QCSB 1ZZ8A 2VZOA 3M3CA 1FPN1 4OMCA 3RWKX 3VZMA 3ZFGA 1GP5A 2XLAA 4WM8C 1IKQA 1ND3A 3E5XA 3IMNA 3N7LA 2ZTNA 2GH8A 3RZHA 1UX7A 1XBFA 3PUHA 4AI0A 1R082 3TRSB 5JI7A 1NCQC 2PMWB 2WFF1 1RJ8A 3GCWA 3ACGA 2ORZA 1Y3TA 3A23A 1OC1A 1SACA 1G6NA 2JEMA 2OZJA 4FOQA 1RUI2 1LNSA 1RUE2 2VZQA 2ID4A 2VOKA 2J1RA 4BQXA 1S0EA 5E89A 2VTXJ 4HKOA 4J1WA 3AZWA 4Q4X3 4P9IA 2A75A 4UI9L 3MW2A 5EZWA 1XNAA 2BNNA 4DOUA 3OOXA 1JZ4A 1QJX2 2Z5WA 4EZHA 5DZEA 1LHNA 4MHUA 4YM1A 4EYUA 1HV0A 4P08A 4WM8A 4Y4RA 3Q8EA 4LUKA 4ZXKA 5APAA 2BUKA 2ZGUA 3LOIA 5DABA 2E6VA 1EAH3 3KV6A 4PLOA 3ZX7A 4AVSA 1GSLA 4ISQA 3J8F3 5L9VA 3CJIA 3RPQA 4AHWA 1S2KA 4LHNA 4ARXA 3RVHA 5FPBA 4V2VA 3MO4A 1K3IA 1PK6A 4XJUA 2FDJA 4L99A 4N9IA 3OBZA 4LULA 1F2NA 1DYOA 1GV9A 1UCXA 1AR61 3CL1A 4ES9A 5BYNA 4OULA 2BV4A 1G9DA 1H2LA 5A1AA 5JOXA 3WCRA 2RG4A 3KCCA 2XHNA 3EJKA 3MIGA 1GQPA 2ZEZA 1N3QA 1O5LA 2UYBA 4LE3A 4RQPA 2JG9C 5CKMA 1B35C 1AYM1 3GBFA 1NA1A 2RR12 3AFKA 3ALQA 1YRZA 2CU5A 3NV3A 4LR4A 1ZRFA 3K46A 5SV8A 2WNVC 4UBGA 4IESA 5FYHA 1H6YA 2GN7A 5KHIA 4COYA 4D94A 1KS4A 4MUVA 4QDRA 1TZOA 4Q4Y1 2IXJA 2Y0IA 3W5NA 2WO2A 2Q0AA 4IEQA 5H9PA 3VKNA 5CFDB 1GQHA 1O5UA 2D6PA 4XF3A 5LEJA 4P9WA 3GYDA 3OJBA 2JECA 3PNAA 3U07A 2E33A 3MW4A 3HT1A 2LROA 1CIWA 2FHRA 4OHXA 1ZBE2 4EWDA 4PF1A 1GBGA 1ZZCA 5A3OA 1UPIA 5FZ8A 1UY2A 3T2PA 1QU0A 4HPKA 2Q4SA 3N7JA 1PK6C 4XUQA 3PTRB 4MGZE 2ZEYA 2WINB 3CBNA 5GKAC 1PMHX 2XJVA 4HVRA 4D8MA 2DCYA 4Z2WA 1ZRIA 3AKRA 2VQTA 2OUHA 1R1A2 4NHKA 2WIIB 3HQXA 4AGRA 2JX9A 4CU7A 2XGXA 1MEC1 1A34A 1ZBA3 4DINB 5KXDA 4BB3A 1ACCA 2PTMA 2P2KA 5A32A 4BLIA 2VMHA 1W6QA 3AP6A 1AXZA 3RJRA 2D6NA 1RITA 2HJIA 2JIJA 3ABZA 3BALA 4E2GA 2D6MA 2VVFA 4Z92B 3WG2A 4EWAA 4KG8A 2BGOA 3VL9A 1I9RA 1X7NA 4FI9A 3U14A 1BZWA 1L3JA 3MFCA 5FOJB 1CWPA 4ATEA 3WNKA 4XYXA 2DYCA 4MZUA 2R062 4EN8B 2KXLA 3S7IA 2ZGOA 3ILRA 4CUAA 4OZXA 4IE0A 1WBFA 1NCQA 1SEFA 4LBMA 1N1SA 1N3PA 2DF7A 3VHOA 3E5UA 1WA4A 2NP0A 4IV3B 2SBAA 3OD4A 5H9RA 3EMRA 1AR73 3PIJA 3NNGA 3I3DA 1JYXA 4KI5M 1J3PA 1ND3C 3G6JB 1JHNA 1IZ3A 4PQQA 1UAIA 2W39A 3BPSA 3UKVA 5JWPA 1ENXA 3N9PA 3OBRA 3Q8FA 2GC2A 4FFFA 1NYWA 5JSRA 1OUSA 4UF0A 5EFUA 2HBUA 2VVEA 5BUVA 5LK5A 1W8FA 1W0PA 5A7WA 4NRQA 2XBO2 4LXLA 1V9U3 3BYWA 4YW1A 3POSA 3IDAA 1C1LA 3AJYA 3MHZA 4L0PA 1YJLA 2A3YA 2ZGSA 2RM23 1D7PM 1VBB1 1OF3A 2R30A 1YUDA 4F83A 1UZYA 2V5DA 4CDUA 1O7FA 3MIFA 1SG3A 1N3OA 4XIKA 5FMCA 4JDOA 4CXYA 4CXXA 1WLCA 2WN3A 4QGLA 1F9KA 4NAOA 1CGPA 1FOD2 1OA4A 3FZ3A 3K3OA 1LODA 5M0TA 2IXCA 2J7MA 4JVAA 4QQHA 4A42A 3ZYBA 1NXD1 1DZQA 2O1QA 4AFCA 1Q8VA 3IDBB 4LKEA 3U11A 1AR91 1VLNA 5FXXA 3KM5A 4F3JA 1GWLA 2SLIA 1X9PA 4YM2A 1LOAA 4YW6A 4IEZA 5CAZA 3CNAA 1VBC2 1US2A 3I2DA 5L73A 4BISA 3OEBA 1S2EA 4Q0VA 4FFHA 2KR2A 4CPBA 2D3RA 3I2IA 3V65A 3VZKA 3W21A 1JTZX 1SCRA 1WBLA 1HB3A 1V6OA 4MO3M 5IVFA 5FZBA 1AX0A 1UF2C 4XAEA 4CCNA 3DCQA 3D0JA 1POV0 1U5ZA 1YC61 1W6MB 4BQ3A 4ZPIA 3GZUC 1FMD2 2HWB1 3I4IA 5C7GA 5HXMA 1XE7A 5IYYA 3FLPA 2FDIA 1TMF1 4YGBA 1W90A 3SISA 1MS5A 4XXAA 1AUYA 3GF6A 2EIGA 5AC92 3FHQA 2ENRA 3GGLA 3POJA 2IC1A 2VOXA 1K5MB 3HBKA 4BHPA 4XHBA 4DXRA 1OOPC 4CDWA 2WZR1 4CYDA 2D97A 2WJSA 4YGEA 5LY2A 5J1XA 3WNOA 4EROA 1CPNA 3M1HA 1LTEA 3S6PA 5BY5A 1MS9A 2C9KA 3MUZ1 1YXWA 3JXSA 4FXKB 4PCRA 2ATFA 3DKQA 3ACIA 2OX0A 3OY8A 5DAXA 4P00B 5K8SA 1S0IA 2HWC3 2YFUA 1BCXA 3LF7A 1WLWA 4QT6A 4AGGA 2FBEA 1J1LA 2PXJA 3HMYA 1PNFA 1VB4A 4Q0UA 5L7OC 5K9YA 4ZHNA 4JGYB 5BNNB 2BRTA 3B01A 1NY71 5FZ0A 1IS5A 1RUC1 4H7MA 4LKSA 4UBHA 4HL0A 2WFPA 4LKDA 2Y26A 4LHLA 1JS9A 4Q27A 2X53S 1HRI2 2DU1A 3OEAA 3NV4A 1W8WA 4Y5SA 1ULPA 1MS0A 4ZONA 2NPIA 2ET1A 4FPFA 4ASLA 1HW5A 2JG9A 4RQPC 4XFAA 4Y22B 1TG7A 3OCPA 3OYWB 5KHJA 1JUHA 2WT2A 4RL7A 5HCHA 3ELNA 4FFIA 4META 1XOYA 5A7PA 1NCRB 2AEYA 4A7KA 3S7EA 2VZRA 2BYVE 1R091 1GZWB 1NOVA 4LO8A 1MS1A 1VAKA 2YYOA 2CWSA 1K5MA 2GZWA 5BNOC 5J48A 3L2YA 5JXIA 4YNIA 4QX0A 2N7GA 5D21A 3RZJA 4GULA 3KLSA 3TBDA 4R9CA 1V6NA 1PIV1 2HWF1 2QQIA 4HLTA 3ZYPA 5LA1A 1YCIA 3K75B 1NZIA 2YBPA 2YGMA 5L19A 5AVAA 4N43A 5FYBA 1AZDA 3SH3A 4J6GA 4QX3A 4QXCA 2DWRA 4S2FA 5DQ0A 5IJRA 4XEZA 5F5QA 4XQ4A 2YUEA 1QJX3 1I5PA 4XBLA 3U75A 1KXGA 5IVBA 3BOWA 1ZA4A 4QB6A 5E6HA 5LBCA 5GZEA 2LALA 1Q8SA 2Y6LA 3CKHA 2P3IA 3WW4A 2BWAA 3DGTA 2B8MA 1C5IA 1ZBE1 3LIHA 3URFA 3LEMA 3HT2A 3FL7A 2HWF3 1QHDA 3PJQA 1REEA 4M3CF 4NIIA 1D0HA 3O0VA 5DDJ2 1LJ7A 5FP3A 2Z42A 3AKSA 3T0AA 3WX5A 2DCKA 1RUNA 1RUC3 1GWKA 5GZGA 1RXFA 2ZX4A 3ECQA 3WF2A 2VGDA 2VAUA 4AVAA 3U4SA 1Z7S3 1QJZA 5FLHA 3D5OA 2WS91 3L9JT 4JGZA 3FJSA 4QPGA 1DG6A 2PQSA 1ULGA 2VCAA 3H0OA 1H4HA 5AVPA 2V73A 3VKOA 3PVBB 1KFUL 3WQBA 3ZYRA 2WZ8A 4CDQC 3SLIA 4AFDA 2D6LX 4N53A 5ABJA 5I8TA 1GLHA 1YQCA 1FOD1 1US3A 2XUEA 4JX0A 4DQAA 3VUOA 4I09A 1EUUA 1PVC1 1VRH1 4LO4B 4K7JA 1REFA 2KA3A 4PIXA 1WGPA 4YW5A 4BH9A 4FAHA 2CDOA 5JIUA 3PUSA 3O14A 3Q8AA 3C7FA 1G9CA 3FX3A 1DYPA 1VBB2 1NKGA 4OHZA 5F3CA 5C5TA 1WCQA 4M01A 4RYDA 4COZA 1UO9A 1EP0A 2HWD1 5BNNA 2WLPA 5FYTA 3T09A 1W28A 4JQTA 2WABA 1OD5A 1JYCA 5FXVA 1UY4A 5F6LB 4YG6A 2EIEA 4KWLA 5FBZA 3VBRA 1XSQA 1QMJA 3N9LA 4LIUA 3ZMNA 1ZREA 5FZ7A 2D5HA 4LBQA 1ZYBA 3H50A 3RYPA 5CISA 1NQDA 1V70A 4BXSV 2RMU2 3ZSKA 1UYPA 5FBJA 1BHGA 2B4KA 1PIV3 5A3PA 4Q4Y3 3O7OA 1RC6A 3WINE 1WWYA 2WYSA 3S5QA 5KBFA 4A3XA 2VQAA 3IB3A 4AFBA 2HWE1 3E6CC 3EXUA 2WA3A 1YWKA 4Z07A 3I2KA 2OVUA 4KNCA 1RVF2 3VB9A 1JXNA 2UY9A 2FDFA 1G7YA 4ZKTB 4RR3C 3T4HB 5KHKA 3NL1A 3PHMA 3RGBA 2QKDA 3RSJA 3KT1A 4NIDA 4R52A 3LA3A 1IQDC 2Q1ZB 5F6KA 4B4RA 4M00A 5F1RA 5JZGC 5FZLA 1CESA 3U0ZA 4KMQA 2B45X 2XJRA 2G9ZA 2ARBA 1FMD3 4W50A 5GZCA 1C5HA 2JICA 3POBA 2P3JA 1R083 2YGLA 3WP3A 2RS52 1ZZBA 1BXHA 3VBRB 1JZ8A 2GSYA 3OGVA 5FP7A 1VP6A 1GNYA 4IE6A 2GC0A 1V0AA 1X36A 1PNGA 4HZFA 1SLLA 3N4MA 4AE2A 2A71A 3M70A 3NSTA 1QQP3 4CCKA 1F15A 5FR3A 2EXJA 2WS93 1W6OA 3HQUA 3VBUB 4OI0A 1IHMA 3ILFA 1JUIA 2RR13 2JB4A 1CD3G 1SHWB 2J1SA 2RDQA 3GJAA 3KB5A 3VBFA 3WD5A 1W0OA 4TZDA 3KVAA 1MQTC 2VXRA 2WUHA 3ETQA 5GZDA 1RUG1 4PF5A 1F31A 4URTA 3AP4A 1PZ8A 1R64A 5LBEA 3DKWA 3LB9A 2WNUC 4N53B 5ABJB 1PVC3 1VRH3 4ZZ8A 5LA2A 1DGRN 3PUIA 1TNFA 5I0TA 1UU4A 3OGRA 4LA3A 5FV3A 3UYJA 2CV6A 4BLJA 4C8DA 1UXXX 4W65A 4LHKA 1OXCA 5T5OA 3INAA 5FTTC 3AMQA 4LLFA 3S5AA 5D8AB 1ST8A 4Q0PA 3QCWA 4FTBA 3UKNA 1C28A 3EB7A 4UAPA 2VO5A 3WUCA 1ZVFA 2VCBA 1SLIA 5F37A 5F2SA 3RZZA 5FYSA 4B7KA 3BGAA 4XIOA 5CU1A 1JYVA 2EA7A 3PURA 4QKNA 1I3HA 3VL8A 4YZ1A 4NUBA 4ASMB 5I8SA 2WO7A 1LOCA 2MEV3 3A4UA 5DUUA 4RR3B 5I93A 3H9AA 1HJFA 3N9OA 2X29A 4PBPA 5I91A 4CTEA 2Q30A 5C8CC 1PO12 3WF0A 2B46X 2IVJA 2XKOA 4Q4V1 1Q3EA 1R093 3Q8BA 1VBA1 2DFBA 1O3QA 1DP0A 1A8DA 1CX4A 1F5FA 2I45A 3MLJA 1LECA 4IEVA 4QB1A 4QKDA 2VD7A 1L7RA 2JD9A 1ZA7A 5FCCA 3MZHA 5DUXA 4NIHA 4G4FA 1MS4A 1SPPA 2YPJA 4HANA 2WO1A 1RTVA 3ZOIA 1UOGA 1KDMA 4FOVA 5F39A 2WT0A 3IT8A 2ZAAA 1UL9A 1BBT2 2F4LA 2WRAA 4IETA 3R4SA 4B8EA 3WDWA 2KM2A 3N9NA 1P8JA 1GMMA 5F8PA 4KBBA 1F4AA 1NCRA 2BNMA 2C24A 4FPHA 5FZEA 4HETA 2I74A 3RMXA 1Y43B 2PA7A 2ZZJA 4GIQA 1AR83 4IV1C 5KC5A 4UFMA 1QXJA 2BJSA 2JG9B 2PYTA 3HR9A 4N8MA 2Z4FA 3PVEA 2JKBA 2YDEA 3LEKA 3PJYA 5FPAA 3ZXKA 3TEWA 2VY0A 4GB31 4Y22A 5ACA1 1A8MA 1QJY2 1ND3B 2XDVA 1U12A 1RUD1 2DTYA 2YC4A 5F5IA 4XC9A 2A73B 5JVVA 2XR4A 4EE2A 5C3OA 4QX1A 2R042 3EO6A 3GHNA 4NROA 2QNKA 3LA2A 2DVBA 3AXEA 1FAYA 2XBO3 4GWMA 4JHZA 4XDOA 5FP8A 5JIAA 2WZPP 1MR5A 5K4LA 1RUF3 1QGLA 2FDKA 3AMPA 2WWUA 1NLQA 4CCDA 3VKLA 3BCWA 3BOPA 1QJFA 1QDOA 1VMFA 4WVMB 5EJ3A 4D6QA 3O1UA 2H6CA 4YVWA 5CFDC 1U5XA 1JZ6A 3N3HA 1HRI3 3ZVXA 5HBAA 3OUIA 2B7YA 1XNCA 3O1MA 3V0BB 1FYUA 1W8TA 5FZFA 2QDRA 4XFIA 1W6NB 5FJKA 1O3TA 1LOBA 3KV9A 2ZHNA 3IPVA 4H55A 2W94A 3ROUA 3ZSJA 5CEHA 4DY3A 3IWZA 5ANQA 3JBG2 4PJYA 4E4ZA 1Q8QA 1ZBA1 4AHZA 3IBMA 5FO9B 5DG2A 4CU8A 3GHMA 2ZGLA 2R072 2BOJA 1W0NA 1S4CA 1VAVA 5T5LA 4HSJA 4OHWA 4CDXA 2FCTA 5FYZA 3HNMA 5IFPA 1F8VA 5EYYA 1S0GA 3T4VA 1Y9QA 3KT4A 3F2ZA 1SBEA 4AHXA 4MGKE 4PLMA 1LENA 3ZN6B 3SCHA 1SLTA 1MZEA 1W2AX 1XYNA 2WFF3 3WVJA 5C9AA 1UZVA 4ZY9A 2ZS6B 2OT7A 3C2UA 2PN5A 3K4AA 4GXLA 3RZGA 4YARA 4KWJA 2HEVF 1QIQA 1JU4A 4WBBA 4QB2A 3ETPA 5DZFA 4AWDA 1LGBA 3DYPA 5DAQA 1CPMA 1MACA 2EIBA 4JDNA 5FMDA 4UW5A 2PLV2 3ZO0B 3D6EA 3I3QA 5EJ1B 1RL3A 4L9BA 4UFIA 4Q4W1 2ZGRA 4BCUA 2FZ2A 4TTGA 2BEOA 3ZXGA 1MPXA 1RUI3 3GALA 2QDNA 1SZBA 1BBT3 1AR93 2JDYA 1D2SA 1TME2 4E4HA 5DN2A 1DZRA 2BGCA 1D0GA 3WW2A 4AEKA 3SH5A 4K20A 3BUCA 4KU8A 1CJPA 2VPVA 2VCCA 5DUWA 1H1IA 2GMEA 3I3BA 3ZXLA 5I0SA 4Q8KA 2PHFA 3DN7A 3VD9A 1NX9A 5F5AA 2X8KA 1BEV1 4XE9A 2X09A 2WSVA 3WDXA 5L9RA 1ZBA2 4I0BA 4KU7A 2DV9A 2JWPA 1PO21 2ADEA 3M3OA 5LASA 4CDUB 1AL21 1ZZ6A 1O91A 2WQ4A 2E63A 3JD72 3HN1A 3OF1A 1X33A 1LGCA 3PVOA 2E26A 4R8HA 2BQPA 3VDCA 3MUY1 1BLZA 1Z0HA 2WL1A 4MH0E 4OI1A 5FJHA 3C7GA 3GZEA 1HV1A 2Y64A 3FHAA 1HIXA 3B7MA 4OFGA 4UF0B 4HKLA 3AB0A 2V5YA 2W46A 4C91A 1Q8PA 2BU9A 4BQ4A 1CAVB 1OT5A 3LPGA 4AK3A 3LDKA 1QNWA 3UJOA 5I8YA 3WUDA 2YPDA 4CP2A 3AKTA 4B29A 2DUQA 1F5JA 4EWEA 2VNGA 4HXCA 4QKFA 1XRUA 4GB32 4UW3A 4IV3A 3GNEA 4WM7A 4C1WA 5ACA2 2ZHLA 5EIYB 5IFTA 3PMEA 3VN4A 3P1IA 1GQGA 5D2AA 3IIAA 1LOFC 2CNAA 3PU3A 5DDJ1 3H7YA 4CUCA 5FREA 1ENQA 1UYXA 3RJ2X 5A7SA 2O14A 4M4PA 4COWA 4KH9A 4GMP1 4GWJA 3ATGA 2ZABA 4PLNA 1OFNA 5C4WB 2ZGPA 3NQHA 4GAZA 1BBT1 2JKXA 2JG8B 2Y34A 3DXUA 5IAVA 2AH2A 2WZEA 2XQRA 1XNKA 2Z69A 4P9XA 5FY0A 3VDDC 2W08A 1G9AA 3VD3A 2ZPXA 3OBAA 1OMIA 3ON7A 3ZXEA 3WG1A 2D7FA 2P5BA 2MEV1 5T50A 3T0BA 2QQMA 1BEV3 4KGQA 3B94A 1QF3A 4GH4A 4EN0A 2DBIA 4OZOA 2IXKA 3RYKA 3OUJA 2JE9A 1IG0A 4QDSA 2VQUA 2WLQA 2DVGA 1NZCA 3AVSA 2HWF2 1MS8A 2QQOA 1HRV3 2FMYA 3VBHB 4YZ2A 3B02A 4Q4X2 4N43B 5C4WA 1Y4WA 4QMAA 1JZ2A 1W06A 1RHI2 3LA7A 4QU1A 5DUVA 1UIKA 3RNSA 3THTA 4AEMA 4GWIA 4HMZA 4NPRA 1C4RA 2HLEA 5CB7A 5C33A 3BTAA 1OVSA 3CMGA 2P4EA 4H14A 4BU2A 3QH6A 2RS12 2VOVA 4CEYB 4K40A 4XOGA 1RVF3 3Q9OA 1O8PA 2R0HA 4IXLA 4WM7B 2J1AA 5FZAA 1AL23 1H1MA 2R1DA 3K4DA 5T54A 1OSGA 4FPOB 3BN6A 4CP9B 3OTFA 3O1RA 3ZMOA 3E6DA 4DS0A 3VBOA 3HNBM 2ZMKA 4IEOA 2EAAA 1CAVA 1W9YA 3B3QE 4Z82A 4XTMA 2A6VA 4QXHA 4YZ5A 4YZ4A 4CA9A 2EALA 3VD4A 1NA1B 1QH6A 2XUMA 4WZCA 1W03A 1BK0A 2BFUS 2NM1A 3WHTA 5JMOA 2FDHA 3VBUA 3NAPA 2ORXA 4XFCA 4XMAA 5CFCC 2VH9A 2PELA 4H3WA 2WZR2 4PQ9A 5FXZA 3H7JA 1ZRRA 1UMIA 2ZEWA 2ZHMA 5CFCB 1OF4A 1POV3 1QY4A 4PDWA 5A7NA 1RIRA 1WUVA 3MEPA 4DO0A 4X6RB 3LGRA 4NO4A 2QQVA 4LT5A 4IEWA 4CDWB 2JB8A 2A6XA 4LPLA 1TMF2 1DQ6A 4K8FA 5FQ0B 4EN9B 5FYVA 3AXDA 4HSLA 4YGCA 2ZXQA 1RUJ2 1O8SA 1HLCA 4PIZA 2RS51 4IW3A 2VMDA 1S0DA 2DURA 1IQAA 1J3QA 2IVIB 3AKPA 1UQXA 4AF9A 1H8TB 4FPLA 4IEPA 4RA0A 1W6MA 4RD7A 1JHJA 1ZM1A 3WG3A 5I0DA 5IK4A 3USSA 4RHV1 4XABA 5F7UA 4W6YA 3D8CA 4DEQA 1H9PA 3FE5A 3O1PA 2C6SA 3GCXA 1MVEA 2XL9A 1OQ1A 3BKZA 4LNVA 1DGWA 1VR3A 2XJPA 1ZNPA 3R4UA 1SDWA 1DHKB 2WQZC 3FLRA 4XUPA 4Y5Z0 2IUWA 5T52A 4YVSC 4D69A 4JTOA 1AYN3 4AG4A 3RS6A 1AR92 4FTEA 5EQUA 4A3ZA 4RSUA 3LIGA 2XJUA 4WV8A 3VLBB 4AI8A 4FOWA 4LLOA 1W3VA 4R4XA 1DGRA 4OI2A 1YYNA 3QH7A 5F32A 1AF9A 4IERA 4MGIE 4OUMA 1E5HA 1EYBA 3OGGA 3WV6A 2R6QA 3NJXA 4MGQA 4HBNA 2JE7A 4Y1VA 4F8AA 1LESA 5JPMB 1W2UA 2D40A 1COV3 3T2TA 1VBC3 3ZXFA 2WBKA 4Y1XA 1VB2A 1YQ2A 4Y1YA 4P5YA 1ZX5A 1YJKA 4XJWA 5FZ1A 2PAEA 4AVBA 4GD4A 3MBWA 1Y7BA 2HYKA 2PHWA 2VUAA 1DZTA 3HOBA 3LDBA 1E5IA 5FZ9A 4LEJA 5C70A 5FZKA 3HN3A 1REDA 1OPMA 3SCGA 4MV2A 2VMFA 1PMJX 5DMYA 3ZKYA 1FV3A 2Y60A 1Y9MA 4LK6A 2XVKA 4WVMA 1AR81 3FUQA 4OYUA 3WY6A 2GNTA 3QOPA 4QPIA 1UZZA 3IZOA 2EIDA 4XJ8A 5DDJ3 3WP5A 4N7IA 5LW9A 3SQOA 3IIIA 4C90A 1XNDA 4FFGA 2NN8A 3N35A 1YI9A 1WCDJ 2VJXA 3TEXA 4AI9A 3PIGA 3LOBA 4K21A 1YQ6A 4KQ7A 1W04A 1V6IA 1QEXA 3W5MA 3NNLA 1ND2A 1SBDA 1LU2A 1WCSA 2WS92 3F95A 3MYXA 4DNYA 1H30A 3KHCA 1GICA 3L2HA 5FY9A 3KCYA 1M06G 2VMCA 2OQ6A 4NHMA 1UY0A 1SLCA 2LUWA 4HG6B 3MV11 2ILMA 4QX7A 4IE4A 5GJ6A 1EAH1 4WVVA 3W20A 5CADA 2H6BA 3FMGA 2GNMA 2W52A 3JU9A 4FPEA 5K0UA 1KFXL 4K6BA 2Z2SB 4OUEA 3ZFEA 1AVBA 4D7YA 1RINA 3NJYA 1BMV1 2JG8C 2BOIA 5J36A 4B1MA 3M2MA 2GAUA 2JDAA 4FPKA 3WOGA 1S0CA 2HH9A 5H9SA 4DEVA 3H8OA 2NYYA 1V9U1 1PGW2 1LR5A 2YMZA 2XJQA 4UWDA 4Y1ZA 1W6QB 5IW0A 4NJ4A 1N1TA 2VZ3A 4E4DX 3MI8A 5I0RA 4UW4A 3FLTA 4XUTA 4C0HA 1C8M1 3ZSMA 1ALYA 3CEWA 4XJAA 5JDBA 3FFQA 1LHUA 1WA6X 4GH4B 2HEYF 1W8UA 3N7KA 5FFOC 2R32A 2W92A 1OOPB 3VBHC 1RHI3 4A7ZA 4CSWA 4AEDA 1GR3A 1PIV2 3UJQA 3R0RA 4ATFA 4EN6B 5FOBB 4HT1T 5JPNB 1UZ0A 5KXCA 4JHTA 4NWVA 2E7AA 3WF4A 1O3SA 1UW8A 1R092 1OUXA 3AYDA 2ES3A 2X10A 3KF3A 1FATA 2W1UA 5CBLA 3PDQA 2YB7A 4XCAA 2HWB3 5IWFA 5J37A 4FVVA 2IWGB 1TE1B 4NR1A 3DV8A 4I3PA 3CZUA 4P14A 2WO3A 5A6ZA 3KQ4B 1EV12 3FUOA 4A2UA 1OLRA 4UFKA 1UYZA 5D8AA 3ZSEA 1GYKA 2A3WA 2VUCA 2ZX2A 2GP3A 4NOTA 4AYUA 1UKGA 3SKVA 2J1UA 2QQUA 1OA3A 1XC6A 5D8AC 3VZNA 1E5SA 3AX4A 4CCMA 4CPBD 2RS11 1YIFA 2G9FA 2NMOA 1QQP2 4NIGA 1UOBA 4XUNA 1AYM2 3JQXA 1APNA 4DB5A 3NNJA 1U0AA 3C7HA 5JCTA 4LITA 1CAUA 4I2OA 3MF9A 4RS5A 2AEZA 4I0AA 4CEYA 1AR82 5FYIA 1RHI1 1PO23 2XOMA 5A7OA 1H4GA 1POQA 1RUD3 2XONA 2EICA 4IE7A 4A6SA 4XCBA 3UK9A 3I54A 4BJ0A 4QHBA 5HCBA 4DRRA 5HI0A 3VBFB 1JZ7A 1RUF2 2PAMA 5LRRA 1DFQA 1WMDA 5FYCA 2WDBA 4XFFA 1U5IA 3GDBA 2CY6A 4GKXA 4AEDC 1NQJA 3WSOA 3VBHA 1WMEA 3WDYA 2UYAA 3RI9A 4QHOA 5AC91 2DVFA 5A1FA 4XJZA 5GM0A 4BQ2A 1H8TC 3DF0A 2BW8A 2VCMA 1FMD1 3C3VA 5C3PA 4FSJA 3QBQA 2QFEA 2ZGTA 1K42A 2ARCA 1CZSA 3P6BA 3RQ0A 3ZFFC 1FX5A 4BA6A 3NMBA 3B9CA 4GA9A 2W91A 4RFT0 4A4AA 1Z78A 1L7LA 4WZFA 5CKQA 1SQ4A 3P5BA 1DF0A 2PAKA 1W6PB 2A6YA 2JG8A 1NLRA 4JCKA 3H8UA 1IPKA 3WQ1A 1W6PA 4HK8A 1QKQA 1AL0G 3SEEA 5SV5A 3VBSC 4CEWB 2TBVA 1RUOA 5FLJA 2PHRA 1C3HA 2MPFA 2FD8A 1R081 2HKXA 2W68A 2JENA 3KF5A 4RHV2 5BXXA 1VALA 1PGL2 3MV01 5CVRA 1W99A 3LEGA 3VKFC 5FZHA 1AR71 1W3XA 5T5PA 3TAYA 4E4SA 1SCSA 1ND2C 1JW6A 4E8CA 3EYPA 2UWAA 3ZN6A 4ORFA 4AQ6A 1GKBA 3P3PA 4DXTA 3T0DA 5H9QA 2O0OA 1A6CA 1PM4A 1ZBE3 1D4M3 4PDWB 4Y1UA 3WXPA 2LW8A 2GALA 4X8NA 5A33B 2OQ7A 2WN2A 2JE8A 3J7LA 4SBVA 1I5ZA 3VZJA 4DMIA 4C0BA 4HFSA 2RE9A 2XVGA 5EXOA 1XJAA 4ZU4A 5B4XA 3O1SA 1S55A 3C8XA 4TN7A 3DPRA 1NLSA 5JAXA 1OFSA 1JOPA 1COV1 1OQDA 3CZJA 4MVTA 3WDVA 4ARYA 1CONA 2I07B 5C8WA 3MPBA 3PVNA 3NV2A 5EPAA 1TEIA 1DQ0A 2J42A 4K1ZA 5FKCA 3VD5A 1S0FA 1B35B 3BIWE 2B42B 4N7UA 1JI6A 4FPCA 3THCA 4FPYA 1YHFA 4BWOA 1MZFA 3KMHA 2E51A 2CSGA 2WNUB 3UGFA 2X5IA 4RGAA 1YFWA 2VBPA 3BTZA 1WW5A 1TME1 1UZWA 4JGZB 4JGYC 4URAA 5BNNC 5T3NA 2D6KA 2ERFA 2ZKNA 3OUHA 4XUOA 2XKPA 1GZCA 3JQWA 2AUYA 2W1SA 2K0GA 1QOSA 4BIFA 1QNYA 1H8VA 1LCLA 1WLDA 2VZUA 5JR2A 1GU3A 4UW6A 3ZXJA 4KG0A 3MIHA 3UESA 3M8LA 4U2AA 4GJYA 5EV7A 3ES4A 2D43A 2R0FA 2GN3A 4QGNA 5HCFA 1PZ9A 4O9GA 2CHHA 2WT1A 4LOTA 2YV8A 2P6HA 1ULOA 4DY5A 2XJSA 4I01A 1UMHA 5CG9A 5F3IA 3WDTA 5JZGB 1M4WA 3ZKUA 1UY1A 1YNAA 4LUMA 1JYTA 4S2GA 3UV9A 5FAXA 3LSEA 5FY4A 1YIPA 4OUSA 1L7QA 3WQ0A 3CO2A 4MGTA 1AXYA 2Y6KA 2VOWA 3GM8A 3WG4A 2OW4A 3WNMA 1WMFA 5KR7A 5IK5A 2QQJA 3OD0A 3P3NA 2GMPA 4RHV3 5FZ3A 1JN2P 1RJ7A 3DUIA 1SDDB 3IDEA 1RUJ3 3WP6A 4YRDA 3NNFA 2WAOA 4Y24A 1PX3A 1LOGA 4XBNA 4Q0QA 1NUKA 3BPZA 1GZWA 3MF6A 1CAWB 1LULA 2AC1A 1OLMA 2VMEA 4BE3A 1OHFA 2P3YA 4RS5C 5JR7B 5F2WA 4QM8A 3NAPC 3DEMA 1TME3 4Y20A 3I3EA 2YBSA 3H3ZA 1XYPA 2FCUA 2HWE3 3LZZA 4B1LA 3ZFEB 3OYWA 3V0AB 1HRV1 3AFGA 4GALA 2RMU3 4IDZA 1J84A 4KBZA 2LS6A 2FMDA 1PHMA 4FO9A 3POIA 4BMEA 1TVGA 3PTYA 1OVPA 1IPJA 1HRV2 5BV6A 2H0VA 4LE4A 1ULCA 3VBOC 2PHUA 5LK7B 4JGYA 5FZIA 2DDUA 2RS13 3HD8B 4JTNA 4ZS3A 4ET7A 1QJY3 1VRBA 5CKNA 1JOJA 1VPHA 2X5IC 5FZOB 1H1AA 1LHOA 2VNRA 4JV4A 2P6CA 2TUNA 4TSVA 3LDRA 2VXJA 1XE8A 3AMHA 2RR11 3J8F1 3R05A 3H8XA 3PU8A 4XHXA 3GZAA 4Q1PA 2BNOA 2RS33 3HJRA 2E53A 3NKTA 4FQ4A 4BQ1A 4NAMA 5FK8A 1GUIA 4LBQD 2R49A 4AL9A 3LPFA 1O4YA 4Q29A 1G9BA 1AL22 1WCUA 5E8AA 1AR62 2BPA2 5DZGA 2YY1A 1NE4A 4W6WA 1QOTA 1WMXA 2YXSA 5CZKA 1YQ8A 1XB9A 4PI2A 1H9WA 4QQOA 4G9SB 4CZSA 2WC2A 4NRPA 4YG0A 1JH5A 1VBA2 3LFIA 1WW7A 4D3WA 2BZDA 4K9SA 4XFGA 1FT9A 2ZMLA 1PO11 5A1LA 2C4XA 4YGDA 2PHLA 3FC0A 4BK5A 3UGGA 4COUA 3WF3A 5C6CA 2WSUA 2WZR3 2OZ6A 3NRUA 5JOYA 1C8M3 1HX6A 4WVZA 1QDCA 4OLLA 3VDDA 3ZFEC 4P9JA 2R073 1ENSA 1RMU3 2QQWA 4BK4A 1H2MA 1T6GC 3VBSA 2QQLA 2W9XA 1W8NA 2G9GA 3MIBA 3OB8A 4AZZA 1J83A 1RUI1 2XB6C 3I49A 1SFYA 3PUAA 4QQ2A 2QBXA 2EXIA 2LTNA 3IAQA 4HOOA 1LOFA 3AM2A 4I3GA 1XSRA 5JI9A 1XXNA 3M3IA 4LMFA 2Q8DA 5FPXA 1FXZA 1XNBA 4JQRA 2E9QA 2Q8CA 3ZFFA 4FTSA 3G7DA 2Y6GA 4K3UA 4QX8A 5IUQA 2RV9A 3TN92 3CQOA 3K77A 1H0BA 2Q5TA 3ZN4A 1EY2A 1KQRA 1TNRA 1D4VB 5GLUA 1V00A 3ACLA 1QXPA 1VBE2 4FT8A 3VHPA 5A3LA 2P17A 1JYIA 3OGSA 2RJLA 1AXKA 1RUG2 2GC3A 4R9BA 1DIWA 3KT7A 3O0XA 4V2WA 2IXIA 4HK9A 4X6QB 2Y38A 1AYN2 1RGSA 3HIFA 3WNPA 2ZKLA 1QJU3 3NVCA 3WNLA 1QWRA 1R1A3 4XQDA 2B39A 4IV1B 3GJBA 2HEWF 1VAMA 3W59A 4BZ4A 4K8RB 5A7WB 1IG3A 1W9WA 1JYNA 5IHRA 4CEYC 4CU6A 4A45A 1AJOA 3T08A 5HCAA 5FK7A 2WR9A 1OH4A 2G19A 3M3EA 4QWNA 1MZ6A 3T1LA 4P02B 5T55A 1CR7A 3VBOB 4LK7A 3WT3A 3TEZA 2WNVB 3RI8A 4Z1VA 5JOZA 1HQNA 4V1PA 3ZSLA 3S0MA 1S1AA 4E27A 1IPSA 1NE6A 1AR63 3VKMA 1DGWX 2DVAA 4I30A 2JDZA 2CAVA 4QPGB 4QU2A 5GZFA 1KEXA 1NCQB 3WR0A 2NMNA 5B4NA 4Z8BA 2UWBA 4L97A 2D5FA 4PIYA 1DQ1A 2RHPA 1AYM3 1ZRCA 1ASJ1 2LRPA 4OVEA 1WD3A 3FBMA 4L2NA 5IVJA 4U36A 3E6BA 2DBNA 4LBLA 1BVVA 2CGOA 4GMP3 3WHUA 3WEZA 1SPPB 2L9LA 2W1QA 3APBA 3E97A 1FNYA 2EXKA 4YVSB 1JMUB 1O4ZA 4ISRA 1DU3D 5JSPA 3BIEA 2ZACA 2VVDA 2QVSB 1VBD3 3C7OA 3ACHA 5C8CB 1CX1A 4W4ZA 2J1TA 1NAEA 3BU0A 3ZR5A 1GANA 1OURA 5A70A 1LGNA 2VMGA 2VMIA 2WAAA 5EP9A 1UWWA 3KSCA 2VG9A 1PVXA 4MOAA 5CIRA 1DQ4A 2D6OX 2Q1MA 4INDA 3S57A 1OLQA 2BVVA 3KZ4C 4R9DA 5ANNA 4AXOA 4D0QA 3JUUA 1YO8A 3SCFA 2UU8A 5FY1A 3B93A 4GWNA 1HXS2 4N9HA 4WVWA 1Z7S1 5KXBA 4MXWB 3ZDSA 4UOJA 5CG8A 3ZYJB 1MQTB 5HV0A 4B7EA 4QDQA 4YW4A 2YC0A 1RUG3 1HKDA 1ULEA 4GZ9A 1A78A 4XDPA 3EBRA 1G9FA 4OHYA 2AR6A 1O4TA 3MGUA 5CFDA 3RZKA 2JJ6A 3QD6A 2EAKA 1IS4A 4AHYA 3EHKA 4LJHA 4KWUA 4JDMA 1VBD1 2TNFA 1SFPA 5C3SA 4TLGA 4AAPA 3H1YA 3POWA 3H42B 4QKBA 1JODA 2AZ5A 2BDRA 2V09A 5LA9A 1URXA 1UNBA 2ZX1A 2F4PA 1KS5A 3I2FA 4PT6A 5FPVA 3U1XA 4Y33A 4RQPB 2HWD3 3AZXA 2YHJA 2DU0A 3QLQA 2DCTA 2OKXA 2BERA 3RDIA 1WCKA 3DPRC 4BOWA 4IV1A 4MXWA 3UKTA 2FQPA 3AKQA 3I97A 1Y9GA 4EQVA 2ZOEB 5C3RA 5C4WC 3N9QA 5EWSA 2CDPA 4QPYA 3H8RA 5LB6A 3OPTA 4J25A 4AVVA 1XU2A 3N36A 3CJIB 1PO22 1VBA3 2C1FA 3J4UH 2HWC1 2OIIA 3N7MA 1XE0A 3LD8A 1NXMA 4GH4C 4L11A 4IL7A 4XF1A 5GLTA 4LQRA 2ZA9A 4WM8B 1DQ5A 1JOBA 2XLGA 3KS7A 1VBE1 5FYUA 3ZN5A 1KJRA 4C1XA 2D98A 3RRDA 4KL1A 1K45A 4CP1A 4ITCA 4QXKA 5JUVA 4XILA 4JRAA 1X8EA 3ZXDA 4E9KA 2A70A 1RMU2 4ZU5A 2XHKA 4F7ZA 1LKNA 4NIAA 3LKJA 1EAH2 4M4RA 3VBSB 4KWKA 5J98B 2R7EB 4CCEA 2Y0OA 1T2XA 4R4ZA 3KV5A 4ES8A 3VDDB 3SEPA 5K0UB 1RUH3 2PLV1 4RGGA 1DDLA 5DPNA 1VMJA 2OPKA 4WM7C 5G05L 3UL2A 3IKWA 2WKKA 1IKPA 5FO8B 1LHWA 1ZZ7A 4QQLA 5G04L 1TQ5A 2RDSA 2VZSA
chains in the Genus database with same CATH topology
3AP9A 4JAAA 1NY72 2CL2A 2F6BA 4AI3A 1H8TA 4LBJA 3OGJA 4CDXB 4YG3A 4M3CA 1AX1A 3ZFGB 1HDKA 2ET7A 4DZGA 1WLTA 4FCAA 4XETA 2C9AA 3JCIA 4LO5B 4AQ2A 1UD1A 4AGVA 4FP2A 3NJZA 1H2KA 1JBCA 2WNUA 3MW3A 1MVQA 5FQ0A 4DPNA 5KHGA 3AMMA 3E5QA 1MS3A 2AREA 1COV2 3OY8B 1S0JA 3V0BA 1DQ2A 2UWCA 4P9GA 4BM8A 5CFCA 5AFEA 3ASIA 3VBUC 1HQWA 3DPRB 1RUH1 2PLV3 1WW6A 4GKYA 2Q8OA 1QJU1 2DVDA 4HVOA 2XLFA 3J8F2 1OPOA 5A33A 4Q4W3 3W58A 1YI7A 3FWEA 4IEYA 2OA2A 4E2QA 5F9TA 5L36A 5AC93 3LAGA 1FV2A 2XPJA 3A0NA 4Y20B 1DGLA 1RUD2 2C5DA 2RS31 1CAWA 2BVBA 1ZRDA 4HKWA 2GH2A 4Y4YA 2QZ2A 2Z79A 1W39A 1GNHA 1X82A 2ARXA 1XYOA 1CAXA 2ZGMA 3FBYA 5C9AB 2IZWA 3ZYGA 4EN7B 3VZOA 1V6KA 3MDPA 3KCXA 1ULFA 3QACA 1RB8G 3USUB 4CDXC 4MGYE 4LO7A 4M0NA 3SXWA 1HXS3 1GNZA 2CGNA 1Q43A 4LBKA 4CP0A 5J3UA 3KD4A 5FRAA 3KGZA 3V64A 2CGPA 4Q0SA 3RG0A 2R16A 5J7MA 5K0UC 4FXGB 5LRSA 3WLUA 3D0SA 3R6SA 3IDCB 4YVWC 1DYKA 4SLIA 4XF0A 5J09A 1BYHA 1S0BA 3AZYA 1BQPA 1SLBA 2NQYA 5L7OB 1YFXA 4IV3C 4RS5B 5CNAA 3B00A 3VGIA 1CAUB 1PGSA 1HRI1 4TYSA 1AX2A 4XBQA 1IS3A 1EV11 2IXHA 4XQWA 4G3YC 1CQ9A 4B4QA 1Q5OA 1BJQA 3TN93 4QPIC 3W9AA 2DCJA 4COVA 2QUOA 5KXEA 3AYCA 4MXVA 5I0UA 2CTVA 5FLIA 1NCRC 4LTAA 5KHHA 2XWBB 2GNDA 3CF6E 2A6ZA 4XDQA 4Q1RA 2EVXA 1MEC2 3GZTB 1LEDA 1N1YA 5FMOS 1R1ZA 3AJZA 2A5ZA 2GDFA 4FOYA 4AEDB 4AQSA 1PK6B 2QE3A 1UPSA 4JRLA 2HWB2 3HWJA 4R9AA 1HQLA 2VU9A 3VZLA 2D3PA 4XPVA 4AI1A 1SBFA 1V9U2 4YFZA 1EV13 5C8CA 2WNEA 3WW1A 4N43C 3J26N 1AR72 3S30A 1CVNA 4YVSA 4S2HA 1KRIA 1PGL1 3ZIXA 1K5MC 3O12A 2BBVA 2W0XA 4QGMA 4XXPA 1ASJ3 2D44A 1CAXB 1GFF2 1O3RA 3B69A 4AEJA 1BVP1 3TNPB 3VHNA 2ZCWA 1RVF1 2GMMA 3THPA 5CA6A 4FAGA 4B3NA 3CJXA 3AP7A 3B9IA 1WW4A 3POYA 3I8TA 4L92A 2ZX0A 4LBQB 2BTVC 2EF6A 2RMU1 5FPZA 3H3UA 1QJU2 2ZX3A 2DCZA 4YZ3A 5BNPB 4PDWC 3ILNA 3O5SA 4NVPA 2AENA 3NO8A 1W6OB 4MLOA 3ZPYA 4GMP0 2HWD2 2K2SA 4GQ7A 1BEV2 4K1YA 2BFUL 4AVCA 1RUF1 3VHRA 1XQNA 4TLFA 2XBO1 4MX3A 2AGSA 2NZ9A 4M3CE 3TOJA 4AW7A 3AYAA 1ONAA 4YVWB 3SMHA 3U4XA 4D7SA 2XH6A 3BU7A 2H0BA 4Q26A 1QQP1 4XF9A 1AJKA 3TWIA 1EPWA 2MHFA 1AHSA 5LEKA 5JMCA 3LWCA 3TNQA 4M3CB 2RJKA 4XFHA 1I6XA 3ZFFB 4Q2FA 5E1RA 4J1XA 5IK8A 1UKRA 3WP4A 4QX5A 2A7AA 2I2SA 3ST7A 2PQQA 1RMU1 3CLPA 3ES1A 5GLWA 1RUE3 1IGOA 4M0HA 2XG3A 1FPN2 4Q4V3 5JOWA 4AVTA 2GU9A 2QJVA 1PZ7A 3GBGA 4AI2A 3I7DA 1RUJ1 4XZPA 4W6XA 1KITA 1R1A1 1QXRA 3AP5A 3PMSA 4O9EA 4HPKB 1QH7A 2HWC2 3JBG1 1C8M2 3OBTA 5GLVA 2VNOA 1PGW1 4IEXA 3K48A 3MIEA 4YLZA 1TMF3 4CDUC 3JZVA 1DBNA 3WZ1A 1BMV2 4XTPA 4YW3A 1DLLA 5JLVA 4CRQA 1J59A 1S2BA 4BYYA 3V56A 3ZYIB 4P9YA 1UMZA 4L8QA 2OYZA 3J9SA 5IT6A 2LM3A 4CDQA 4YM3A 3WDUA 3WNXA 1QJY1 1LHVA 4AFMA 1V6JA 4AFAA 5KWRA 1POV1 2VW1A 3V0AA 2P37A 4QPIB 2UY8A 4CDQB 4KGGA 1Q56A 1KJLA 2XJTA 3H1WA 1KDKA 3DL3A 4LA2A 2ETEA 3MFAA 1MEC3 1Z7S2 4Q4X1 5FDBA 3U10A 2P34A 3MLLA 2QQPA 4XW3A 3AZZA 2OUJA 4LBOA 1E57A 1OKQA 3M4FA 4JC1A 1C1FA 5B2GB 3IN9A 2NLRA 2A3XA 2VECA 2ZBJA 3B5LB 2WWSA 4DFSA 5JZGA 1QJX1 1NG0A 1ASJ2 3AZVA 4YM0A 3X29B 4RR3A 5DG1A 2B9UA 3JBG3 2VQ0A 5GALA 1VBC1 2MNGA 2RS32 3I59B 4IEUA 2PHDA 2CAUA 5C9AC 1UU5A 2VUJA 3EQEA 4S2DA 3NKGA 1YFUA 3MICA 2PHXA 4A7YA 4OHVA 1GZ9A 3KQRA 4QQPA 3LCPA 3SNMA 2O8OA 2RM22 3D82A 2WNVA 3RMYA 4YSFA 1OA2A 1B35A 1RUH2 4QD2A 1U5YA 5D1IA 4BMBA 2VULA 3LSDA 3JD71 1I1EA 1WD4A 3NAPB 1LB2A 1OQEA 1FOD3 2JXAA 4CDWC 1BK1A 5IK7A 4I0WB 1CN1A 4NN0A 4P9LA 1VBE3 4MYEA 2TEPA 1KD7A 3RYRA 4EV0A 3JB4C 2AYHA 2IFRA 4N53C 5ABJC 2IFWA 3JB8A 1ULDA 3CJIC 4ZU7A 3NW4A 5JSOA 1LU1A 3R4DB 5A3MA 1FI2A 3TN91 4JGZC 2ZHKA 2QZ3A 4H7LA 4X8PA 4FPGA 4BPZA 2E7TA 2FZ1A 5BPXA 2ZGNA 1D4M2 4Q4W2 3NV1A 2RS53 1BKZA 2HWE2 4EJRA 1D4M1 2ZMNA 2DTWA 2R061 3WQ7A 1V6MA 4FBFA 3K51A 5A32B 3OPZA 3T1MA 3TB0A 2JD4A 4HVQA 3BODA 1SLAA 2K9ZA 1ZZ9A 2UURA 1EPZA 5E16A 4I02A 2YROA 4D7TA 4HN0A 4N90A 5TSWA 2ZJCA 3IM0A 5T5JA 4GB33 3ZFGC 5ACA3 2O8QA 1N47A 4NHLA 4DXZA 3SHRA 1UN1A 5BNPC 3HBZA 2ZZQA 1FNZA 1YFYA 2MEV2 1UX6A 4BIOA 1PMIA 2G4IA 4NWWA 2R063 3PLQA 3VV1A 1B09A 2E7QA 3FHIB 2ZGKA 3AK0A 1PO13 5BNOA 1PVC2 1VRH2 4B4PA 1SMVA 2XVLA 1YLLA 3IPVB 3M7AA 4FP3A 5K7PA 1W6NA 2RM21 1X50A 2A6WA 4FPJA 1LRHA 2P3KA 5HXVA 4ONUA 3BB6A 2R041 3D4KA 3AMNA 4Q4Y2 1VBD2 1X8MA 1VJ2A 4UXAA 5L7OA 4QM9A 2YZ4A 1MQTA 5BNOB 1IOAA 3VBFC 4XJ9A 3I59A 1SFNA 5GLZA 5KC6A 5AFBA 4LBNA 1G86A 3H1MA 4HN1A 4E2SA 4Q8LA 3O0WA 2VW0A 4IQPA 4AQTA 5EYXA 1OOPA 4CEWA 1HXS1 3M3QA 3NWKA 1C8NA 2VW2A 2GC1A 1XU1A 5FO7B 1G8WA 3USUA 1OI6A 2IXLA 4LO6B 1LOEA 4FQZA 4Y26A 5E88A 3MPPG 3CU7A 4DRVA 2R1BA 1FPN3 4Q4V2 2BWCA 3MIDA 2XL7A 4OI4A 4MSVA 5FMOL 1VIWB 2D93A 1H2NA 2XWJB 2ZGQA 4XMIA 3WW3A 2ZAHA 4CEWC 1CJDA 1ENRA 3RWNA 2GNBA 1PM7A 2PFWA 3ZXAC 4XF4A 3SH4A 1RUE1 1V6LA 2R043 5DXDA 3WCSA 3JD73 3ME2A 2WFF2 2B5HA 1RUC2 2PHTA 3FFZA 1ND2B 4P5HA 2DUOA 3KGLA 1QOOA 1N1VA 4YFWA 3VBRC 3GBWA 2EXHA 3MLKA 1IS6A 1Q8OA 1VBB3 3A0KA 1NA1C 2D3SA 4YYOA 2WA4A 2X5IB 1J58A 3ENRA 1J3RA 2R071 1UU6A 4XFBA 1J1TA 3AYEA 3ZIWA 1LEMA 4YW2A 1D2QA 2C0ZA 2DFCA 1UIJA 4TWTA 2CYFA 2CWMA 1AYN1 5BNQA 3HAGA 1MZ5A 3SITA 3TYJA 4PBOA 1A3KA 1C57A 4QPGC 5BNPA 2QCSB 2DUPA 1ZZ8A 3M3CA 1FPN1 3VZMA 3ZFGA 2XLAA 4WM8C 1IKQA 1ND3A 3E5XA 3IMNA 3N7LA 2ZTNA 2GH8A 4AI0A 1R082 3TRSB 5JI7A 1NCQC 2WFF1 1RJ8A 1Y3TA 1SACA 1G6NA 2JEMA 2OZJA 4FOQA 1RUI2 1RUE2 2VOKA 1S0EA 5E89A 4HKOA 4J1WA 3AZWA 4Q4X3 4P9IA 2A75A 3MW2A 5EZWA 2BNNA 4DOUA 1QJX2 2Z5WA 5DZEA 1LHNA 4YM1A 1HV0A 4WM8A 4LUKA 4ZXKA 2BUKA 2ZGUA 3LOIA 2E6VA 1EAH3 4PLOA 3ZX7A 4AVSA 1GSLA 4ISQA 3J8F3 3CJIA 4AHWA 1S2KA 4LHNA 1PK6A 4XJUA 4L99A 4N9IA 4LULA 1F2NA 3CL1A 1GV9A 1UCXA 1AR61 4ES9A 5BYNA 4OULA 1G9DA 1H2LA 5JOXA 3WCRA 1TQ5A 3KCCA 3EJKA 3MIGA 1N3QA 1O5LA 2UYBA 4LE3A 4RQPA 2JG9C 1B35C 1AYM1 3GBFA 1NA1A 2RR12 3AFKA 3ALQA 1YRZA 3NV3A 4LR4A 1ZRFA 5SV8A 2WNVC 4UBGA 4IESA 2GN7A 5KHIA 4COYA 4D94A 1KS4A 4MUVA 4Q4Y1 2IXJA 2Y0IA 2Q0AA 4IEQA 5H9PA 3VKNA 5CFDB 1GQHA 1O5UA 2D6PA 4XF3A 5LEJA 4P9WA 3GYDA 3OJBA 2JECA 3PNAA 3U07A 3MW4A 3HT1A 4OHXA 1CIWA 2FHRA 1ZBE2 4EWDA 1GBGA 1ZZCA 1UPIA 1QU0A 4HPKA 2Q4SA 3N7JA 1PK6C 4MGZE 2WINB 5GKAC 2XJVA 4HVRA 4Z2WA 2DCYA 3AKRA 2OUHA 1R1A2 4NHKA 2WIIB 3HQXA 4AGRA 2JX9A 2XGXA 1MEC1 1ZBA3 4DINB 5KXDA 2PTMA 2P2KA 5A32A 4BLIA 2VMHA 1W6QA 3AP6A 1AXZA 3RJRA 2D6NA 1RITA 2HJIA 3BALA 4E2GA 4Z92B 2D6MA 2VVFA 3WG2A 4EWAA 4KG8A 3VL9A 1I9RA 1X7NA 1BZWA 1L3JA 3MFCA 5FOJB 4ATEA 4XYXA 2DYCA 4MZUA 2R062 4EN8B 2KXLA 3S7IA 2ZGOA 3ILRA 4OZXA 1WBFA 1NCQA 1SEFA 4LBMA 1N1SA 1N3PA 2DF7A 3VHOA 3E5UA 1WA4A 2NP0A 4IV3B 2SBAA 3OD4A 5H9RA 1AR73 1J3PA 1ND3C 3G6JB 1JHNA 1IZ3A 1UAIA 2W39A 3UKVA 5JWPA 1ENXA 3OBRA 2GC2A 5JSRA 1NYWA 5EFUA 2VVEA 5BUVA 5LK5A 1W0PA 2XBO2 1V9U3 4YW1A 3POSA 1C1LA 3AJYA 1YJLA 2A3YA 2ZGSA 2RM23 1VBB1 4F83A 2R30A 1YUDA 1UZYA 4CDUA 1O7FA 3MIFA 4XIKA 1N3OA 4JDOA 1WLCA 4QGLA 1F9KA 1CGPA 1FOD2 1OA4A 3FZ3A 1LODA 2IXCA 4JVAA 4QQHA 1NXD1 1DZQA 2O1QA 4AFCA 1Q8VA 3IDBB 3U11A 1AR91 1VLNA 3KM5A 4F3JA 2SLIA 4YM2A 1LOAA 4IEZA 5CAZA 3CNAA 1VBC2 5L73A 3I2DA 4Q0VA 2D3RA 3V65A 3VZKA 1JTZX 1SCRA 1WBLA 1V6OA 1AX0A 1UF2C 3D0JA 1POV0 1U5ZA 1W6MB 3GZUC 1FMD2 2HWB1 3I4IA 1XE7A 3FLPA 1TMF1 4YGBA 1MS5A 4XXAA 1AUYA 3GF6A 2EIGA 5AC92 2ENRA 2IC1A 2VOXA 1K5MB 4BHPA 4XHBA 1OOPC 4CDWA 2WZR1 4CYDA 2D97A 2WJSA 4YGEA 4EROA 1CPNA 3M1HA 1LTEA 3S6PA 5BY5A 1MS9A 1YXWA 4FXKB 4PCRA 2ATFA 3OY8A 5K8SA 1S0IA 2HWC3 4QT6A 1BCXA 1WLWA 4AGGA 2FBEA 1J1LA 3HMYA 4Q0UA 1PNFA 1VB4A 5L7OC 5K9YA 4JGYB 5BNNB 3B01A 1NY71 1IS5A 1RUC1 4H7MA 4UBHA 4HL0A 2WFPA 2Y26A 4LHLA 4Q27A 2X53S 1HRI2 2DU1A 3NV4A 1MS0A 2NPIA 2ET1A 4FPFA 4ASLA 1HW5A 2JG9A 4RQPC 4XFAA 4Y22B 3OCPA 3OYWB 5KHJA 1JUHA 2WT2A 4RL7A 3ELNA 4META 1NCRB 4A7KA 3S7EA 2BYVE 1R091 1GZWB 1NOVA 4LO8A 1MS1A 1VAKA 2YYOA 2CWSA 1K5MA 2GZWA 5BNOC 5J48A 3L2YA 4YNIA 2N7GA 4GULA 3KLSA 3TBDA 4R9CA 1V6NA 1PIV1 2HWF1 4HLTA 3ZYPA 1YCIA 2YGMA 5L19A 5AVAA 4N43A 1AZDA 3SH3A 4J6GA