5CBAB

3b4 in complex with cxcl13 - 3b4-cxcl13
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
QSALTQPASVSASPGQSITISCTGTSSDVGAYDWVSWYQQHPGKAPKLLIFDVNNRPSGVSHRFSGSKSGNTASLTISGLQAEDEADYYCSSYTRRDTYVFGTGTKVTVLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Combination of Structural and Empirical Analyses Delineates the Key Contacts Mediating Stability and Affinity Increases in an Optimized Biotherapeutic Single-chain Fv (scFv).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords 3b4 heavy chain
total genus 22
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cbaB00
2D9QB 5HHME 3B5GA 5JPNA 4MLSA 2C3GA 1YDPA 3BAEH 3O41B 4AH2B 3TBWA 1OWRM 3EYVA 3LS5L 5E8EA 3GSXB 3UTTD 3DYOA 2JCCB 3U7WH 3MV8E 1VHPA 1ZLWH 4AL8H 3LH2H 3H0TA 2R0LL 3ULVD 3GNML 1U92B 3HE7A 4P5TA 1RZGA 1RU9H 1AIFA 4N8VA 1C5CH 2HFTA 1YN6A 3ZE2E 4GKOA 3PABB 3S37H 1MCKA 2J88L 5KJRL 2X4UA 4HUNB 4HS8H 3ZL4L 5JA9A 4YIQB 2OZ4L 4CDHA 3OHXB 2VABB 2EH8H 5A2JH 5HGBA 4WHCA 2DN7A 1KUMA 5FM5O 5FO7A 2R0KH 5IW6B 2G60H 4KDTA 1NEZG 1U58A 5ERWB 4I0KA 5E5UB 5EO9A 4TNWK 4XRCB 1DR9A 4PJAF 4HUKB 1WLHA 1I3GH 2FGWH 2VR5A 3LKOA 5TGBA 3TJEL 4DZ8B 5IFHH 3Q3GA 4C56D 3VDAA 2WBWB 3WE6A 2VDNL 4DEPB 4RFEB 4OCYH 3L6FA 4G6JL 4FQXB 5BW7C 1S5IH 1SJEB 1UWXK 5E95B 5IBUG 3N9GL 3FQUB 4E41D 1YEJH 1XF4B 1N64L 1U8JB 4NNXA 4Y1AD 4LMQI 4L8SA 2LABA 2P5WD 1FZKB 1AI1L 4MQ7B 1MI5A 3OF6D 3G6AB 3HTLX 4HLZG 1QVOB 1T5XA 2QSVA 4G3YL 4YPGB 4UT9L 4W70A 4LMQE 1OD7A 5DS8B 4MD0A 4U6YA 1FFPB 2VDQL 2KKQA 1WAAE 3O2WL 3SQBA 3KDMB 1IBGH 4EUPA 3NPSB 1QSVA 1RV6X 3PG2A 3G5ZA 5EUKB 4A6YL 3OZ9L 2NY0D 3IDJA 3B3IA 4RA3A 4Y19B 5LGJA 1YPZB 5I71B 2ICWB 5INCA 5IB5B 1OVZA 5A2KH 4GRWB 4JFFD 3U46A 5I1HL 1QG3A 3SKMA 2FCBA 3HRZA 3B2UC 4G7VL 4KJWC 1DFBH 1X5GA 4Z8FL 1Q38A 3QXDA 4X0KB 4GQPH 5F88B 4PBXA 4PJXB 1G7PB 3QT2A 4R97B 4DZBB 1DVFB 3F6LA 1JF6A 2VOTA 3GJFH 3U6RB 4CVXB 3MRNB 2XA8L 5IMLA 1DQMH 1AGDB 4XXCA 5EO0A 2IFGA 3HG1D 1LO2H 2VQ1B 2XI9A 1B9ZA 2A1WH 1CICA 2RHEA 2R4RH 4G9DA 3NFSH 4YE4L 4MQ7A 3L3JA 1TIUA 35C8H 3JVGC 3V0WH 1T7VA 3MJ8A 2EEAA 1AHWB 1W72H 2VUOA 2WP3O 2EE2A 2NXYD 1M1SA 1QSEA 3N85H 3F7QA 4GRLC 4ODHH 4X6DE 3ZKXB 2FB4H 1AD9B 2FEDC 4JLRB 4MJ2A 1HXYB 5FGRA 4UB0L 2Z0BA 5FO7B 5C09D 2FX9L 1LWRA 1ZTXL 2XPGB 3T0EC 4NM8L 5B39G 4KUZL 3SQOH 3WIHL 2H26B 3FT3B 5K9OA 4HUVA 4N68A 5B8CB 3FFDA 1HN1A 4NPYB 3MJ6A 1IC1A 1E4WH 3BSZH 1YEEL 2W92A 4HQQH 4MD4B 3RTQD 4U7KA 3U0PA 4RGNC 4Y5XB 3TA3A 4M00A 1CS6A 3ZT5A 1JWSB 4J3UA 4RWHA 3TZVA 2Y7QA 2OJEB 3ROLB 5JPMB 1HINH 5C0JA 1IGTA 1RHHA 2DI7A 3QHFL 3ZMRA 4P2QB 1ZE3C 3VXOB 2AP2A 2LU3A 3TCLB 1AGFA 1T22A 5J12C 3G6AA 4XVTH 3TYGL 2GK0B 5GS2D 5JQ6H 4H25A 5C8JA 4NYLB 2B2XH 3RNQB 2QQNH 1F8TH 3NCYS 5C0IB 3FQUA 2C4FT 3HRPA 2IH3A 4QWWC 3L3OB 4RGND 3TBVA 5MEPB 3KPLA 5TF1L 4DAGH 3MLTA 1E4XH 4NC2B 4HCRL 2C26A 4XCCH 3KPSA 2XNAB 1U3HA 2GJZB 4YDJA 1K4DB 5BVJA 1DLFH 4HKBB 1F11A 4BQ8A 3KPPB 3U30C 4M02A 4PLKC 3D0VB 3T2NL 5CD5C 5F88A 1DDHA 3ZLQC 5BO1H 4MD5B 1C1EL 1V7MH 5IT2L 3S35L 1U8PA 4LOUD 3QJHB 3DX8A 2FB4L 3UYRH 4ZUSA 2NY3D 3SBWA 4M03A 1T89A 5IB5A 1QYGH 4HMEA 2BHYA 4NO3A 4WV1B 3SDCC 5CWSB 3VXME 1N59A 2VLLA 4P2RA 5EG6C 5BS0D 3SDXE 3O4OC 3O6FD 4NKOA 43CAB 4Y4KB 3O2DL 4I4WA 2G9HB 4PTUB 2J1KA 1P4LB 5JW4M 5C07A 1OAZL 1MQKL 1JHLH 1GC1H 3DBXA 1MIEL 2VAAB 3WV0A 5GGSB 1KB5L 5HYSG 4PRBA 1HINL 4JPVH 1UT9A 1ZGLB 2QSTA 3CZFA 4MDJA 3SDCD 5FOBA 4JKMA 4J8RA 1IE5A 1R3KB 3ESVF 5DJZA 3I75B 1OAKL 3SGJA 3AB0C 1G9NC 1NAKH 4HUXA 1OP9A 3W11C 3PWPE 1BF8A 4JRYA 5BOZG 3O81A 4IRSA 1WAAA 2DBLL 1FCGA 4EDWL 5T1DH 2YK1L 1IC7L 1R5VB 4OCMC 5GZOC 3S36H 1AR1C 4S10A 4O02L 5E00A 2QHRH 1BIIA 2BC4B 3PV6B 5ID0A 5DMIH 3CMOH 1SVZA 4HC1L 4UMGA 2P45B 3UZQA 4TUKL 1U8OB 3TH4T 3FHAA 3K81A 3NACH 4I18B 3HZYB 4WWKA 3TLRA 1MWAH 1ORSB 4X7TA 2QEJA 1JGUH 1QLEH 4I9WE 3CU7A 4HXAL 4GW5B 3QNYB 3QDGE 1RIVH 4LFHG 3W9DB 3HZVA 5C07E 4RAUB 3BZFB 3HE7B 5C8JB 2XA8H 1WBXA 2YXFA 4EQ3A 1JHTA 4U3CA 4R2GC 4CN4A 4OD1L 4PRNA 3H7BA 3EO0A 3I50H 3SE8H 5T3XE 4X80L 3I6GB 1UWGH 1U3JA 4ZPTB 2V2XB 3SDAC 4LVHB 4WWKC 3RI5K 1T5WA 1INQA 3GMRA 1VB9A 3UJJL 1R24A 4JPVL 1A6AB 5DEFB 1Q72L 1FL5B 2ZCLL 1F3DH 1QFOA 2AJSL 1GAFH 1CLCA 3ZYIA 3QI9A 1A7PL 4ZXBA 3IDXH 1OD9A 1JIBA 4LBEB 5KVGH 4LF3B 1UB5A 2VITB 5CBAB 3G08B 3MRJB 1G9NH 4LAQL 4HBQA 3JV4B 5EUOB 5F9OL 5GGUA 5B4MC 5TDPB 2HTKC 3DRQA 4PJHE 3HNTH 4Y5XC 1RZ8A 4RGNB 3LIZH 1WWCA 1FRGH 4YDLC 5E5MA 1VEOA 4WDIA 3UDWC 1UM5H 1P4IL 4WUUE 4P5MA 3U30B 4TSCH 2YRPA 3IJHB 1GC1C 3O3BB 4UIKL 4K2UL 2IG2H 4KPHH 2YWYA 3ARBA 5C0NC 2W0PA 3VFVA 5IUSA 2AK1L 1NMCC 2FWOB 5FF6A 4RX4A 2O5YL 4L4TA 3O45A 4RMSA 1CLYL 4RRPA 4QTHB 1BFOA 4EQ2A 1YMHB 3BN9C 3GMRB 1JZ6A 1CG9A 3PWUA 2CKNA 3LQZA 4M48H 5MENB 4WW2F 2YA2A 3T0XA 3RHWK 2CLRA 2F54D 4DGVL 1AXSB 4R4BB 3RWGA 5DRXB 2DQDH 4M6ML 4NRZB 3QH3B 3TO4A 3L7EA 1OSPH 3S7GA 1FDLH 4OIAA 4XC3H 2EC9T 1A7BA 5JOFA 3D69B 4WO4C 4DGIL 4S0TD 4PJ8A 1FAIL 3C60A 4R96A 5HGHB 2KZ1B 3WUWB 1Q9OB 1EEYA 4JB9L 5EC2A 5CEXB 4R97C 3UTPE 2YA1A 3QHTC 3OB0H 2EDWA 2P1YA 3CSYB 3HNVH 3V4UL 3M07A 1PY4A 3IT8D 3QXVA 4UT7L 4FFWD 2VDRL 2F5BH 5LQBL 4YHIA 3LD8C 3MLZL 1R5IB 4QY8A 5C6TH 2EDXA 3TZVC 4H1LB 5J06A 4PJIB 1N8ZA 2VDPH 4WNQB 5E7FA 3VXTB 5EBMA 1MI5B 3O9WA 2DQJH 4FFZL 4QKXB 4BELD 4XPHH 4NZUH 2VLJB 4GG6F 1N2RB 2IAMA 4GT7A 4UDUB 3WKML 5I19H 4O9HH 5SWQB 1B4RA 3BUTA 3HS0A 5C08E 5DVNA 4S0SD 1KT2A 1OB1B 5FYLH 3SOBL 1QP1A 3I9GH 1ZVSA 1CCZA 1QFWM 2ATPB 2P48B 2DMKA 4XPFH 5TQ2H 1KGCE 4HD9A 3RVXD 1S9WA 3BKML 2R15A 1ZVYA 3FQXB 3DXAB 4XI5C 4H1LH 4PJEA 1FJ1A 3QNXB 4XPTH 1MPAL 1UM6H 4RAHA 3T0WA 5I8EB 8CGTA 3D0LB 2DM2A 1TJGL 4W68A 4PRPD 3UROR 3CH8A 5HD8D 3RVUD 2GJ6D 1FC2D 5KSVB 1KC5L 5L9DH 2N7AA 4JFYB 4R8WH 3BQUA 2BDNH 3DVGB 3A6CH 5D4QA 1LD9A 4NT6B 4OZGB 1MLBB 4XWOC 1RSFA 1DBKH 3BPCA 4UQ3A 3ARFA 3MYJA 1ZLWK 1FDLL 1NCBL 1AE6L 4I48B 4I77H 1HXMA 1ZEAL 1ND0A 1WBZB 3CDGB 5I71C 4S1RH 3MRRA 2QLVB 4M5ZL 4I0PC 5D7LE 4AT6A 4PD4K 2FIRT 5CZKA 3R8QA 4FXKB 1CIDA 3V0WL 1QRKA 4EN3C 3CCHB 4PREB 3E2HC 5F8RC 3VW3L 2ZSVA 3G6JA 2OSLB 4ZFOB 2MQCA 3BZEB 1O5DT 4XP1H 4OCXL 2APTA 3BZDA 4N0CC 5DUPL 3ZDZF 2UYLB 3IRZA 3T77B 4HZAA 4XNYH 2WZPD 2E9JA 3RUGF 5AAWA 1J5OH 4GXUM 4LLAA 1U91A 3OKEA 4ZDHB 4L3ED 3AY4A 1YC8A 1GGIH 5DJCA 3FT3A 5BS0B 1S9VB 5FFLA 2OR9H 1E0OB 4MDIA 4G7YH 1NCDL 1DZBA 5I17B 3FB7B 4MJIB 5DF0A 5MHSE 3KLHC 3CSPA 5GRJH 3RGVA 1KTLA 3NTCH 4X9HA 5ISZE 2I24N 3WJLC 4Z6AT 4NNPH 4JFEA 3NMEA 5CHNB 5H37H 2OTPA 3P9WB 2DTSA 4RX4D 4I48A 4LCIL 4HZLA 3O8XB 2X9YA 3CFBB 5SWZA 4GKSB 1F4XH 1KEGH 3OXRB 4MA7L 1CFQA 4MA8L 3U7YH 5L6YH 4XMPH 2OL3L 4XHJD 2B2XL 3BRDA 4TPRL 4PP1D 3TBVB 3ALPA 1JWUA 3VH8B 5DJ6A 1CBVH 5EORL 2PYFA 4BUGA 1EBPA 4OQTL 2AJXL 3ECBB 1BWWA 1YQ2A 2HLFC 1RZIB 1WF5A 3SJVB 1I1CA 1IAIM 4U1SB 5DRNB 3DVFA 4M5ZH 2GCYB 2IPKB 5H35A 2I07B 4ZTOL 5I8EA 3D0VA 4RBPK 4UINL 1T0NA 3EW3B 1DLFL 1OB1A 1UZ6F 3FONB 1CLYH 4JQXA 1YUHA 4ZUSB 2XIDA 3C8KB 1Q0XH 4OLWL 1CDBA 2LAAA 2AEIT 1RUMH 2V6HA 3EYUL 3TBTA 5EOQL 3UYRL 3MBEA 2R0ZL 2Q76A 4UUJA 1K2DA 4I13B 1FIGL 3SE4C 5ITBH 2X44D 1TCRA 4UDTA 2Q8AH 5HGDA 1KCSH 4R7NA 3ZKSD 1NGWB 4MNQE 4B5EA 3LEXB 2BOCA 4OFIA 5T1KD 1UJTA 4Z7OE 4C83A 5ADOL 2AS5M 1U8LA 2B5IC 4I3SH 3O2DH 2E9IA 4ZUWA 1TNMA 3TNNA 2A6DB 3VXRB 2FZ3B 1I9RH 1VESA 1ZGLA 1SYSB 5IB3B 1EO7A 4PRBB 4K7PY 3NCFB 5EN2A 3N50A 5C0FA 3U9UA 3VRJA 5JOPE 2EDEA 1AD0A 1BWMA 2EC8A 4JREC 4UV7L 4BQCA 5E1AA 1NAMB 2HVJB 1FV1B 5D7LB 3KLAB 5BJTB 4CMMB 3FT4A 32C2A 4QNPF 4UNTA 4ZXBB 2QADD 4K3JH 3T4YA 1AQDA 1AP2A 2BHUA 3T3PF 1U3YA 3GI8H 3ZKXC 3FTGB 3ZE1E 1U8HA 1RULH 1A22B 4MSWB 1EAJA 2NY4B 2V9QA 5JMOC 1OQXA 3VWJC 2ZG3A 2YEZB 1A1MB 1SVCP 1LK3H 5DA0B 5FCSH 2ERJB 5ID0B 3X17A 4LCWA 5I1AA 4N0YL 1GOFA 1IFHH 1K8DB 4L4JA 3UDWA 1C16A 1MAKA 1CFVL 4L3EB 5TF0A 1UQSB 3S34H 2BSRB 1HNFA 1U8LB 4PJAB 5ISZB 1H8SA 3EFFB 4LFHD 4U1LB 3S35X 3HZVB 3C2AL 1LO3L 4YC2B 3CPLB 4UT6H 4EBQL 3P9MA 4OJFH 4V1DE 5KTEH 2BXZA 1KCRL 3MRIA 4X9IA 4PJ5D 4AIOA 3VXPB 3X3GL 5JXED 3H42L 5KSBA 3BPLB 4Y1AB 5TE6H 1V3LA 1HWGB 1MCSA 1DEEA 3TO4C 2YMXL 1ZGLP 1KCLA 4YDKH 2GI7A 5ESVA 3QIWB 1T3FA 3ARGA 4L8CB 3QH3A 4YPJA 4JFDE 3DSFH 5BV7L 1AP2B 1T5WB 5BV7C 1XH3A 4MWFB 3HMXL 4DW2H 5IM7A 3CFJB 1WISA 4AG4H 4YBLB 4OI8A 1J8HA 4MXWH 3QFDB 4ONHB 2BY0A 4R6UA 1F6AB 1CLOH 3MPCA 1JHKH 1M7DA 2X1OA 3S5LG 1RJYA 4IM8A 5FYKU 2O93L 3NIGE 1P7QA 5D5MF 4X9GA 3CDYA 2CKBL 2ZOKB 5HYFA 3FB6A 4UILH 4YXKL 3RL2A 1CDJA 5ISZA 2MOVA 3E6HA 5GRVK 5I74C 3O9WB 2B4CC 1Y0LB 2F19L 3QUXA 2YD7A 2Q87A 4F7EA 3ME0A 2XNAA 4N0YH 1JUFB 2AXGB 4E5XB 1SBSH 2ADGA 3VDCA 3KXFD 3DURA 2VN4A 2ORBH 5CUSH 4KK8C 1FIEA 2XV6B 4M6AA 4BQ6A 1ZVSB 1E6OH 3D39E 4YR6B 5DD0H 4GRMB 2YS4A 3MROB 4KMLB 5EBLB 3UTZA 1MF2H 1SMOA 5F3HA 1IGFL 1KCRH 2UY6A 5C08B 1V8HA 2MKWA 3JV5A 2H9GA 4Z7WE 3QQ4B 3DGCR 2LU4A 4LSRL 1S3KH 4NRZA 3TN0D 1P9MA 3WMSA 4WIQA 2VL5B 5DRXA 1QFPA 1N6QL 1W72A 4JFQA 2ERJC 1QKZL 1JPFA 3PDDA 2GJ6A 4PJ7A 3RY5A 3MJ7B 1W72L 2X41A 4FMKA 1IGCH 1UM4H 5J4MA 2DM3A 3BDBA 2NY6B 3QUZB 3OKLB 5I1KH 1UJ3A 1QBLH 4RFNB 5C3LD 1JVKA 4UTAL 3OX8B 1MJ8L 4ZODA 2J6EA 4UT7H 1R6VA 2H6PA 4LASH 2HG5B 2B1AH 1MJ7H 4TULH 5FGSA 1N5YL 3TPKA 2YN3A 5FHAL 3U0TA 3BSZL 5F44A 1D5BB 4C56A 4M5YH 4MQTB 1C7SA 4N9GB 3FQTB 5EPMB 3PV6A 1FLRL 4JRXA 3W0WA 1M6OB 2XWBB 3DARA 1TVHA 1X6NA 3ULUD 1OTTC 3QHFH 4FQ2L 4MGXA 4TYUA 5B3JF 5HYIA 3CMGA 1FGNH 3SDYH 1EX0A 5K33A 1LGVA 2DQTH 1PQZA 1NLDH 1JMXA 2WIMA 3MV7A 5IW6A 2R0LH 3H7LA 1GPOL 4NFBA 5ENWB 1L9MA 2Y06L 4PJBF 1WGOA 3PGDA 3LY6A 4JM2B 4RFNC 3SEPA 4RGNE 5EU4A 1S3KL 1A6WL 1WAAF 1AY1L 1X4YA 3JWOL 2GTZA 3QUYB 1A6ZB 4EI6B 4U6VH 1ZS8A 2GT9B 3WIHA 3OKOB 5HYJD 4PJFE 4AEHL 1ND0B 5FV1L 1LP9F 2PW1B 2EYRB 5C1MB 2OZ4H 2OI9C 2DQEL 1BX2A 1B6UA 2YOCA 3ECBA 1ZHBB 5FKPA 1UB6B 1TJIL 3MR9A 3D85D 4ELMB 3GIVA 2AGJL 2X4OA 2HMIC 5I1KL 4GRLD 4CU6A 4CUCA 4FQJL 1NC2D 3T0VA 3TEUA 1DQJA 2R2BB 1M7IB 3MLVL 2YC1B 3CFKA 4X4XA 2JK5B 3QXDB 4X0KA 4G6JH 3G6DH 1D5IH 2VC2L 3CJJA 1IM9A 4Y16A 3QHZH 3QUML 2F8OA 4QRQB 4YXHL 3O9WD 1MLCB 4LLVA 5MP6H 3QQNA 3SE4A 3KJ6H 1MFEL 5TE7H 1DQQA 4NIKB 1W0WB 1U91B 3OKEB 3VD3A 1MIEH 5CGYD 1WUNT 2D0HA 5IBLC 4Z7WF 4Y5YB 2C3VA 3HN3A 3DX9A 1S9KC 3NIDF 1KB5B 5CJOL 2C1PA 3PV7A 1TDQA 1CD1A 1OLZA 1YQVL 2VH5L 1EFQA 3GMNA 4RGOL 4XGZB 4P3CH 1KENH 3GSNH 3CVHA 4GAGL 43C9A 5I18H 2W60B 1OHQA 3OR6A 1SM3H 3TO4D 4OIIL 2ZP0T 2EDTA 4Y4HA 4I8DA 1OLLA 3FQRB 4UILL 4EN3B 4NO0A 2HKFL 4WUKL 2CKBB 1RZ7L 3L9RA 2MQ3A 1S78D 4YHPB 3GHEH 4IIQC 4K3EL 3RA7H 3FT4B 2QJDA 5DUMH 5EIVA 5JHLL 1F6LL 5JOFB 1AC6A 4JZJB 4NFCA 1FGVH 2R1YB 1MRDH 4N1HB 5E56A 5H35B 4LPCA 1YEKH 3NZ8B 3FT2B 4P99A 3VMOA 3C8KA 3H9YA 3UX9B 5E4EB 3NGBC 4XCNB 4F7MB 5BZDA 1ZT1A 1FPTH 1SQ2N 1XGRA 3VFPB 3B8YA 5I74B 4KRPC 1VADA 4UOW0 3QHZL 1J88A 1OL0A 1N8ZB 4XNZB 2AV7A 4X6CB 3ORJA 4FZEH 1NKRA 2FX9H 3GK8H 4G6FB 2JE8A 4R4ND 5T3XD 3EDJA 3FCTA 3GUTA 1BPVA 4LHUB 3OR6B 5EFIB 1G9MC 1KCUL 1A6ZA 5E99H 4ZXBD 5GRXG 5CFHA 4PJEE 3UJJH 1IGCL 1UM4L 3V4VH 5KSBB 2ZUQB 4IRSD 1E4WL 4LHQB 5BV7B 4JPIB 4HKJA 5I8CA 1YQVH 3TIDB 4QO1A 1KJ3L 3L3OA 4XBGB 3LHPH 1QLRA 3QJHA 5GIRB 1A7PH 3STBA 1L0XA 4ZFOL 1G6VK 3D5OF 2M2DA 4LKCA 4PB0H 1FJ1B 3QNXA 4XNXL 2XY1A 1BVZA 4QOKA 4F7CB 4P2OC 1N5YH 4NUJA 4NOFA 4N8VG 5GS1C 4OFKA 4Q58C 5B3JE 1RZ7H 4Y5XA 1KELL 3PWPA 4JZNB 4L9DA 1IAMA 5FYJE 4OFYD 3SHSA 1RURH 4KTEL 5D96B 3DX7B 3HE6D 1IM9B 3QUXD 4OTXH 5ICYA 3HA0A 1FRGL 4WJ5A 1BLNA 5JW3H 1HKLL 5CIPA 2GW5A 2P5EA 4HWBL 4E0RB 3BGMB 4MA1B 5SX4I 3H0TB 1NCTA 1VFBA 1YECH 2R1XA 4LRIC 4Z7OF 5IW1B 5ETUB 3QULA 3ZT6A 1HH9B 2VE6A 1H3GA 3H2WA 1NEZA 4O51A 1OM3L 4KH2A 3VRLE 3W5NA 5SWSE 5FA4B 1H3TA 4HPYH 3I3EA 5INDB 4JVUA 2H3NB 4J3TA 3BIBX 4QHLB 3M17A 3LRSB 2NY4C 1JWMA 3JWDL 3FOLA 5GRZA 3MLTB 3VXRD 3MNZA 5CSZA 5D1ZA 4PJDB 5HDBE 3P4MB 5FV2A 3FB5B 2FEEI 4PJXF 4Y4FB 5I1EH 4TNVF 2O5ZH 3CLEH 4JRYD 4RBPH 5KANI 3MA9L 4H88H 1NCWL 1C8PA 2Y6SC 4XC3L 1MFAH 4X4ME 1BIIB 2BC4A 4P2RD 5F6HJ 5BS0A 1DE4A 1DBMH 3V4VL 2B20A 4CVWA 4LCWE 2X1QA 5HGBB 2YMXH 2CR6A 3FB7A 4MJIA 1DANU 4KMTH 4IOIA 1YY8A 3QFJE 1RVFH 3KVQA 4EUPG 4G5ZL 5EO9B 3RY6A 5C2BH 5SV3A 3MLPA 2I9TA 4LSSH 3MCLH 4O2EA 1J1OH 2PR4L 5IVXF 5I15H 3WJJC 3ZTJH 1ORQB 3O8XC 1P4BH 4IIQA 4UU9A 5IF0A 4U49A 4NZUL 2DTML 4UQ3B 3T2QA 4KKCD 1BD2A 3VXNA 5CMAB 2R9HD 5I19L 5AYUH 3EO0B 5GSVA 3ARYA 4Y19D 2HN7B 4QT5A 1WBZA 3BKYL 5GGTH 2HT4C 4D0DB 1PY9A 4BK5A 4PJXE 3PP3H 4CN6A 4RGOH 4W81A 2O5XH 4JHAH 3RPKA 4LP5A 4OCLC 3BKMH 1PG7L 2NW3A 4TTDD 4YDVA 3LKQB 2MCPL 5HPMA 5EO1B 2EO1A 1QFUH 3BDYL 5IV2A 3TPUA 3QIUD 4Z0BH 1QD0A 1FE8L 4OLVL 1RZFH 2AJ3B 2E27H 3T8XB 1XF2A 3MRNA 4GMSL 3KPRA 1CE1H 1A4JB 1CGSL 1BM3L 5BRZE 3CDCA 5ACZB 1BD2E 5JHDA 3KYAA 2HJFB 1OAUH 1MFAL 2AW2A 1MCLA 3P30H 3PGDB 4EXPX 5D2LF 3GSNA 5DO2D 4XXDB 3I50L 1NSNL 5F7DB 1YEHL 1WICA 5DJDA 1X4XA 4P9HC 3IJHA 1S5HA 3H3PL 3F58L 3WFBL 3DV6A 1U9KA 3B9AA 4L29A 1FORH 1IARB 4YJZL 4Q0XH 4OCYL 1J18A 3BI9X 4KRLB 5FKPB 2YPLB 1BJMA 4G9DB 1JPTL 2OJZH 3NA9H 4PRNB 2H3NA 2BOBB 2VLKA 4WDIB 4ODVL 1XAUA 5JR1L 2K7PA 2YN5A 4DFIA 5SX4H 1KSRA 5CJQL 2N56A 5LKNA 1GGIL 3QEHA 1H3VA 2AK4B 2FIKB 1CXKA 4POZD 5IROA 3L1OH 4RIRA 5MEOB 2EKSB 3NFPA 3IJSB 3LDBB 2BNQE 1T1XA 4WI8A 2O5XL 4V2BA 3SCMA 1IBGL 5IJVB 1V05A 2IWGA 5HGHA 2VDLH 5CEZH 1CFSA 3LQZB 1JGEA 4X6CF 3RWFA 4JVWA 4U1KA 4U33A 2P47B 4Z0BL 3MV7B 2EDQA 1CFTB 3VFTB 3SDDA 3X11A 4FNLL 4EI5D 2V7NB 4PJCB 4ALAH 4LLQA 4JHZA 1PKQB 4U6XB 1HQRA 2R1WB 5C09A 3NIFE 1MUJA 1HHGA 3H9SB 4XP5L 3NAAH 2RBLA 4P5MB 5HHMB 1EGJH 4OZGE 2YKLH 3BP4A 1DQLL 4KWUA 3U4AA 2R69L 3D6GA 1YN6B 3PIQA 3FO2B 5DD5L 3BW9B 5CMAA 4EI6A 4JRXE 3GGWA 2Z92A 3VXRA 4YHPA 1HCVA 3HC3H 1WJ3A 1FNLA 5HI4C 5SWSD 1I8LA 4ZOCA 4FTVD 4NRXB 5C92A 3JWDH 4NCDA 3U4BH 2GY7B 4JM2F 2VXUH 3REVB 4X98B 3TM6A 5JQHC 1TJIH 3OWEA 2OS7A 5HYSA 1C5BL 1QRND 1T4KB 1P6AB 1KIPA 2A2QT 3S6CA 3GSUA 4NWTH 3OKMA 1ZGLM 4NRYB 3DUSB 4W6WB 4JG1H 3ZDXE 5FEBA 4HT1L 4CMMA 5C09E 3CFIC 4X4XB 1BFTA 1KULA 3CUPB 1MLCA 4LLVB 1F45A 3VFRB 3MUY1 1FNFA 4U1KB 4R96B 2FD6L 1LEGA 4PTTA 3KPTA 4PJFA 2R0WL 4XTRD 3FQXA 1EEQA 1DBBL 2E9WA 3PJSA 2QR0B 4ZFGL 3MRMB 3DMMA 1WCQA 4OZHE 3LKNA 3VJ6A 2VLRB 1F4WL 3EYFB 1MY5A 1V7NL 4OI9A 3RQ3A 4MNQB 3RVTD 3B9KD 5SX5H 5BXFA 3OSKA 4LSTL 4KI5C 3FB8B 3R06A 3QFJD 3D9AL 1QR4A 3G9AB 3K0WA 1MREH 4JN1H 3BAEL 2NZ9D 2D9CA 4FZ8L 4U7SA 3T08A 5F7UA 4XNQB 3VWKA 1IQWH 1QLFA 3S5LA 4XPFL 3QG6A 4PREA 2H32A 3B2VL 3GGWB 2W9DH 2IPUG 4C4KO 1JNHB 4XVJH 2DQFA 1TPXB 3EKCA 4Y4HB 1RUQH 1FBIL 3WXVL 4PG2A 4HG4K 1S7UB 3CXDL 4AM0A 1IL1A 3B6SB 1RZJC 4LOUC 1UM6L 2HVKA 1NUGA 5DJ2B 5CSBA 3WLWD 4OLUL 3RWCA 1GZQB 4Y4FC 3IDNA 4FXGA 2F74B 4HIJB 4JJ5A 5EU3A 3SJVE 3K4DA 3QP3A 4X7TB 1BJ1H 3MRKB 4FABL 1JYNA 1RFDH 1UGNA 1V3KA 5DHVB 4E42A 2ZKHH 4P5TC 4CVXA 5J1AB 1CU4H 2P8LB 5JDSA 4M93C 5D8JL 5LG1A 3MJ9H 1MEXH 4RGMB 3RFZC 1LO3H 1OSZB 2EXYC 3MUGA 3GBML 5J56B 1FN4A 2DJ4A 1SY6L 1HSAA 3DIFB 1IGYB 4JQIL 4PJGF 3M17B 3DVNB 5E9DD 3S3SA 3BKCH 5I1DA 5DJ6B 3MUZ1 3H42H 1I8MA 4YO0B 3MA7A 4Z0XA 4ELKA 3PWLB 3MOBH 5CZXC 4JLRA 5D72H 5ALBL 4P5TD 1RUKL 2WM0A 4ZS7H 4WU5A 4XI5D 3O8XD 5GS1B 5E6IA 3O8XA 3NPSC 4J1UA 4GKSA 2XRAH 3RUGE 3NFNA 1EK3A 1OTUC 2Y36L 4AM0B 1PX4A 3UCRA 3LZFL 4PGEA 3UTSE 1XZ0B 4CADA 5BMFL 1G6RA 1RZKC 4MAYA 3WS6C 1CVSC 3SDAB 1CYGA 4F8QA 3MRHB 4OCNC 4FFVC 2P24A 2F5AH 3V4PL 1E6JL 4O4YL 1MWAB 3K4AA 5GGUB 2QTEA 3JBG7 5DJCB 2X70B 5DHVA 4R2GB 1WC7B 2DIJA 4YXKH 4Q9RL 1OAQH 2IAND 4ODSL 1ZWIA 2ZUTA 3QIUC 1JJUA 3QWOA 1RZKL 2CLVA 4LLYB 1U8IB 5DK2A 1CGTA 5FECA 1K8IB 4F7PA 4XNZC 4DKDC 4OTXL 3GMMA 3P4NA 1MAJA 4Z76A 3BVNB 5E70A 4G6KH 4M62H 2PW2B 5DVKA 1FL6B 1U95B 1MWAL 3MCKB 1UKSA 3OXRA 4OV5A 3MJ9L 3WN5B 4QHLA 4PR5B 3ZTJG 1WFNA 4LGRB 5GS1A 4Y89A 2IALA 4OGXH 2VXQL 1YEIH 4PJDA 4WV1C 4JZJC 3S5LB 4ZNEE 3M1BB 3KS0J 1PKOA 3GJFB 5GHWH 4W4NA 2X4TB 4KQ3L 1B90A 1D5XA 1FIGH 1K3IA 5GGQL 1RUKH 3SE8L 4BQ9A 1U8HB 5DC0A 4N0UB 2YD5A 2BNUB 4HX1B 4K9EL 2ZUXA 4HCRA 3BMWA 3RZCC 4JFXB 4JO4L 4IRJC 4TUJB 1TQBB 4IOIB 2BNQD 2EC9U 3K7UA 4I3SL 4NKOB 4NKMA 4QGTA 1QRNE 1DBAL 1PG7X 2CXKA 2G2RA 5A1AA 3WS3B 5IK3B 5E94B 1HIML 5FO9B 4PLOB 1ZHLA 2KQNA 4O4YH 2BERA 1RPQA 3IYLW 4PRIB 4P4KC 5A16B 3UPRA 5C2BL 3RWDB 2QV2A 4C83B 3E1F1 3S3PA 4E9LA 2D03H 1T1ZB 4DUVA 2PCPB 5BZWB 2J8UB 2A9NL 3TYGH 5GGSY 3NCCB 4ZUWB 1DBBH 2CKBA 4M5YL 4ZFGH 4WW1B 4EKXA 2UWEB 3L5XL 1F8TL 3GJEB 3WL9B 1QEWA 3K74B 2IALB 5IB3A 4WNQA 1E4JA 2VRAA 4WCYH 4MX7B 1ZA6A 1MREL 3BKYH 1I75A 4RQQA 1U3HD 2DD8L 4WUUD 3VCLA 3ULUE 4U3HA 3MC0A 1UYWH 3GEWB 3EOAA 3QDME 1AFVL 3FRUA 1CI5A 4BUHA 4KQ4H 2NXYB 1WZ1L 1N0XL 1PG7H 3Q1SL 2VXQH 4NN5C 3O0RH 4LEXH 2VKWA 4HKXA 2Y25A 4MB5A 4V1DB 5LGHH 1NAML 2CK0H 1JMZA 4YHYC 3B9KC 5KSBF 3BWAA 1A6WH 4EIZC 3KPRD 5HDQH 1T80A 4PLNC 2VLLB 3KPRB 3TN0A 5C70A 4DCQB 1WCBA 3MRDA 3MV11 4D9RD 5ADPH 3RIFF 1WFOA 5F97E 3PGCB 1IGIH 2OM5A 4JM2C 1FSKC 4BJLA 5KG9A 2GSGB 4UTBH 1OGAA 3M8OL 1RIHH 4PJCE 2JJTA 2ZUVA 3EYVB 1G1CA 5I1GH 4GO6B 1DBAH 1XR9A 2DL9A 3KDMA 4PYHA 4XP4H 3HC0B 4M6NL 1S7VA 1UACH 1FORL 1QFWH 2ZCHH 5J3HD 1F5WA 4DW2L 4BKLB 3MODL 4K94H 4JJHA 4FQHB 2H41A 4DOHE 3QIBC 1JPTH 2OJZL 3BEWA 2X4NA 1QSZA 4ERSL 5F9WC 1CLZL 3C5SB 5B38B 1HHIA 3QI9B 1D5MA 1IC4L 4MCYA 5I73B 1FVEA 2VSDA 3ARRA 3DI3B 6FABH 4HF5H 4ODUB 1R5VA 5CBAA 3BYYA 3LPWA 5MERB 2KPNA 4PJHF 3UTSD 1S8DB 5E2UL 1AO7E 4MJID 1PZUB 4U31A 5E2TL 2NYYD 5CJXA 2F19H 3VGAC 4DCQA 4Z7UE 3U7WL 3MCG1 2L7JA 1XGRB 3OKKA 4EOWL 3RWFB 2OCFD 5JZ7D 2WV3A 3H8NA 1TJGH 1QPXA 3CSBA 1R3HA 1H8OA 4LLMA 2CMRH 1WZKA 1RMFL 1OAYL 5D6DC 4PGBA 5TFSL 3DJ9A 4PG2C 1JNHA 1X4ZA 4K3EH 1HHHB 2EXYD 5E4EC 4XP5H 3W5MA 3I84A 1K3ZA 1YMMD 4HH9B 2NW2A 4PLJC 4Z7NE 4J3OC 4ACPA 1OAXH 4TUOB 3CAFA 2NLJB 4RISL 4XC1L 4GAYA 2C3XA 3TT1L 2GSIB 1HOCB 1RK0B 2FGZA 2IH1B 2EE9A 5JLZA 1EA9C 1ZKAA 4L4VB 1F58H 3EJZC 3T2NH 4OKVB 2XQBH 1OTUD 2EEBA 1QSED 3K1DA 1Z9SA 1D5ZB 4ZPVA 4NQVA 4HPOH 2W59A 3HUJF 1I1FA 5DZNA 1VPOL 1AI1H 1FO0B 3T0DA 6FABL 2FHCA 5GS0C 4NQDB 3WEXB 2H8PB 5DUBA 2X89D 5LJYH 1NC4A 4WFHE 1R5IA 4QY8B 3ILQC 4D0DA 4RMRA 2EIBA 2DLEA 1SJHA 3GBNH 4MZ2A 3T09A 3U9UB 3VRJB 2PO6A 2V5TA 4YBLC 2ENSA 8FABA 2DDQL 4APQA 3VGAB 3MNVA 3GM8A 1HNGA 1UEMA 1JWMB 1P4IH 4XVUD 3ZHLA 5I1CL 5T3ZL 1OP5K 3KLHD 1Z9OA 3L3IB 1NGYB 2A6IB 4K23H 1TNNA 5CP7B 1TITA 3F7VB 2PYED 2H32B 3LB6C 4X6BA 4XMPL 1NLDL 2W9DL 3TVMB 5I73C 2UVEA 3GB7B 3D1MC 1GOGA 2ZG2A 3ILQD 1V3JA 1P7KA 4N1EA 2Z8VC 4NJ9H 2CO6B 2V7HB 3BT2H 4GKNB 4KK9D 2DYPA 5DA4A 3BUYB 3RVWD 5ABDE 4NPYA 2NY0C 3T4YB 1IVLA 1PQZB 4E42B 4S11A 5HYEA 1VSCA 2P8LA 5JDSB 5E8NA 3T65B 1OSPL 3VRIB 1T04B 1S8DA 3BOVA 3GMLB 5IB2A 5J9PB 4D0CA 4S1QH 2EO9A 2WK2A 3HLAB 3KYNB 5D1XA 3X12A 4IRJA 4HIEA 4J8RB 5IROC 5HDQL 4OZ4B 4PR5A 4YHIB 1JZ5A 4AY0A 3V4UH 4PJAA 2D7MA 3GSQA 3AGVA 3N1FC 1OTTD 4X7FC 4HUWB 3ZKNC 3LAFA 5MEPA 3GFUA 2J8UF 3GMQA 3K4ZA 4P4KD 3QUMH 4YO0A 1D7FA 3CVHB 2IAMB 2ADJA 1KLGB 3N06B 5C0AD 1ZAGA 1D9KC 2NW3B 4GXVL 1I9RL 1OOAA 2E8ZA 4ZD3L 1JP5A 2Q3ZA 4JO3H 1I7ZA 1T03L 3X14B 1YNTA 2NY2D 3EOYG 3SE3A 3PXJA 2PTVA 4XCNA 2ATKB 5B38G 1J1OL 2PR4H 4NQDA 2C3HA 3ABZA 5CP3A 2EDOA 1A3LH 1ADQA 1DBJH 2Z9TA 1N59B 4P2RB 3GSVB 3UTTA 2J4WL 1MPAH 3RTQC 5ICXB 3WIIL 4ONGH 4U6HB 4GBXB 3W39A 4JY5L 1EXUB 4KC3B 5D2NB 1JGDA 5GGRB 2HYMA 4JM4H 4QXGH 3QEGL 1LDSA 3N1PC 3DVIA 4D9RE 5IFJA 3HMXA 4WU7B 5A3IC 4KK6C 3FQNB 3HNTL 1FFPA 5MI0B 2N7BA 4KY1L 3TIDA 3PE9A 1SYVA 4K8RC 4NBYB 3FQRA 4F7EB 1FL6A 1U95A 4NN5B 4JO1H 4F2MA 3LN4B 2E27L 4HIXL 4GOSA 4LHUA 4U1NA 3C2AH 4Z78B 3L3HA 3QAZB 1BGXH 3GO1L 3PHOA 4AENB 3NPZB 3VW3H 2OP4L 4J7RA 2IADB 2L7UA 1CE6A 4AQ1B 3NZHL 1LEGB 5J0BA 1NGQH 5J9PA 4LNRB 5F89B 2EH7H 1S9YB 3PJSB 4TRPL 4X5XB 1KCVH 4CAGA 4YHLL 3KYNA 5CJBA 5D1XB 4X6DA 1XGTA 4X99A 2PNDA 4GG8B 4OGYL 4YZFF 1H3WM 3O3DB 1T03H 3PF2A 3H9SE 2WBJD 3BISA 4MJIE 2W0FB 4XP9H 1T04A 1T0MB 3IFNH 3IVKB 2VJXA 4JY6B 5F3BB 4D9QD 3QG6B 4JPWH 4KK5D 3QCTL 2FZ3A 3RP1A 2NTFB 4M8QB 3SKNA 5EFIA 4A2MA 5HHQB 3MLZH 3RBSA 2ICES 4LCIH 1NFDB 3PIQB 2KZWA 5GSRA 4EDWH 2AJVH 5DC9B 3WXWH 5I8CB 1YZZA 4KHTL 3EO1A 4OF5A 4HQQL 1PZ5B 2Q86A 5IJKC 4MX7A 4Z7NF 4KTEH 2W0LA 3L5XH 3I2CL 3GMQB 2EDBA 5DMIL 1Q9LB 5F7WC 4BSWA 1YJDL 4DTGH 4M9PA 2GTWA 5DXWA 4JKWA 4PJ8C 2OK0H 2YSSA 5I2IB 4GH7B 1NGZB 1IC5H 3BH9A 3W81A 3SGEI 1U8KA 1T22B 4I3RH 4O2EB 4CMHB 5CS7A 3BWAB 3IFOA 4LEXL 5IKCA 5J13B 1YN7A 1NMBL 4P57B 1UWXH 3WFHB 5DT1H 3TFKD 1OGTA 4CNIA 4PGJA 1KIRB 2E7HA 2XZZA 1CD0A 4JRXD 1LDPL 3PL6C 3DMMD 5IHZA 5DQDL 3LN9A 4IS6B 4NQDE 2FJGA 2X05A 1HYSD 3IU3B 2EH8L 1G7HA 3FQWA 1J0KA 1AXTH 2XT1B 4PJFF 3ULVC 3W0WE 5GS0D 4OGAC 1V3MA 5D70L 1CWVA 5GRVL 4S2SB 4YBQC 5IT2H 2LE9A 4OZFG 3CFCH 1NFIA 5EO1A 1FZMB 3IFNL 4NZDA 5HHOA 4IRZL 1LO0H 1X5XA 3QQ9D 4RRPG 4QRPB 3OAYH 3Q6FB 4L4TE 2VL4A 1TETL 2ZCHL 2CIKA 4OLYL 1S7TA 4JY4B 4NKIH 4W4OC 3LV3A 3VFWB 1GGYA 3L3HB 4PRHB 1XF3B 4XP1L 1QR1A 3S37X 5FHAH 2R0WH 4FTVA 2AKRB 3OQ3B 3JUZA 1JN6A 4ODUA 3AXLA 4QRRA 5C0AE 1U6AH 1U8KB 3L3DB 4Y16B 3V8CA 3C6LD 3VFOA 4U1GC 1MAML 2F9BT 2VZVA 5J1AA 4H20L 4X4ZA 1DQQB 4YNYB 4HFWB 4OLZH 5FUZH 4KK9C 3RVWC 2BP3A 4AZ8A 5JHDB 3V6FB 1T66C 4ETQB 1SY6A 1DL7H 5BOPA 1Q9KB 1TZHB 5HHOE 4OZFB 4TSBH 3EO9H 1L6ZA 1IFHL 1IAKA 3B2UD 3O3EB 3RY4A 3L9RB 4EOWH 3EO1B 3CXDH 3VXMB 1KLUB 4GQ9L 4LSPH 4HH8A 2A77L 2KBGA 4RFOL 4K07A 1RZFL 2DAVA 4GAFB 1CR9H 3VXTA 4MS8C 2MNUA 3JWOH 1RMFH 1N0LA 3ULUF 1CGUA 1MELA 3OJMB 1CDHA 1I8IA 3RVVD 3NCMA 2G75A 4C59B 4Z7WB 3Q6GH 2BXYA 1R5WB 4KY1H 2R29H 2BZDA 4BZ1H 3B9KB 1CU4L 1N6UA 3D25B 4KAQL 3ZKND 3OV6A 5GGVH 4L8BA 4OAWB 3D39B 1LO2L 1ONQA 2EYSB 4JB9H 1FZOB 1I8KA 3QXUA 4NO3B 4FQJH 2WMPA 5IM7B 5IVXE 3GBMH 2R4RL 4JFQB 1VGKA 4TTGA 3DSFL 4LIQH 1MJJB 4MHHG 1WIOA 2FBJL 5FYLD 5JXAL 3GZKA 4M9OA 5B39B 4ODHL 3EYUH 4YNYA 4DZ8A 1AJ7H 5CZVL 3NA9L 1OW0C 3MLYL 3QWOB 4XCEA 2EH7L 3MOAH 1I1YB 4PJCF 3KPSD 5EBWA 1S7XA 1VPOH 3AS3A 1U6AL 4BH7A 5I1JL 1X6LA 1NQBA 3EDFA 1EEUA 4LRNH 1QEWB 2EKJA 2XRAL 1HWHB 4ZTPH 5GGSA 3HR5B 3V6OA 3KYOB 4CL7A 3P73B 1TZGL 1A5FL 1EZVY 1KLUA 5L2JA 2ZCLH 2AEPL 2E6PA 2JJUA 3MNVB 1MUJB 4JG0H 3LV3B 1M7XA 2XTJB 5HVFB 5F7LB 1P2CA 2AEQH 3V4PH 2DDQH 2ITDB 3GJFK 4WEBH 4NQUA 1BVLA 1LMKA 4HKJB 1FZMA 3L3KB 4XPTL 4M7ZC 1I1AC 4OIIH 5CUSL 3QIUA 2ENYA 4NQTA 3DETD 3UZVB 1X5ZA 4M43H 2CDFA 2BVPA 3G08A 3MRJA 5FDWB 1NFDF 3STLA 3C08L 4ZOBA 5DYOB 5IW1A 1L7TL 4IOFD 5DUML 4F37F 1IGFH 5JHLH 4FTVB 3PGCA 4PPTA 4KK5C 2G5RA 4OZGF 1Z0MA 3RPIA 5IFAL 1KXQE 2CUMA 4N5ED 3L3DA 3FB8A 5C0CD 2HRPL 2LTQC 4K3GA 2JJSC 2HJLB 2KUTA 1XF1A 5DD1H 5EU7C 3HHRB 5HD8C 1MCPL 3O6KL 2F8VA 4PRID 2VQUA 2VXUL 2Z8RA 4OFDA 3VDBA 5L2KB 3O6MH 2FJHB 2CR3A 1IL1B 3B6SA 3WIFA 3L3JB 4LSQH 1N5AB 4U1NB 3IETB 1QFWI 4X6FB 3DLQR 1PG7W 4LDOB 3SDDC 5C86A 5IW3A 5IMMA 3RWIA 4LQFH 4KTDL 4OT1L 3S88L 3X3GH 3DXAE 1JWSA 4HK0A 3L95B 5I16B 2APFA 2DQFB 5D1QC 3GKWH 4M7ZB 3UTQA 4FFYL 2JIXB 3HE6C 4KJYA 1UA6L 3QSKB 4P2QA 1KJ3H 1V7NH 5K9OB 1ED3A 4XAWL 4HUVB 4LVNB 3FONA 4HKXB 1A9BA 4H5SB 1VDGA 5AD0B 2EYSA 3MUGB 2VAJA 2GY5A 3AREB 3MREA 4RNRB 4XNXH 3TBTB 3OXSB 4QRRE 3RIFK 5DGRA 1DLHA 2ITCA 4LAJH 3TZVB 1MFBH 1SEBB 2NZIA 4XPHL 3QPXH 4YBQD 5E8PB 5IP4A 2OX5A 4MCZA 5HHNB 5C6WH 3FAWA 2PTTA 5ID1B 3U82B 1OP5H 5L8KB 1CZ8H 4H20H 3DUUB 4JO2H 2D0GA 2ITDA 5C0RH 4OZIF 2XKNB 3HS0B 3WDHA 2BSTA 3ARBB 5M7QA 3HC0A 5D7JC 5EWIL 1ZHBA 1R3LA 2YBRB 3KJ4B 1A21A 2EDHA 3UYPA 3LH2L 3O45B 3CMOL 1QBBA 3LN4A 2CDFB 3ARGC 2BVEA 4FQLL 4P9MH 4BSWB 1HHKB 1Q8MA 2Y1VA 3MMEA 4QRSB 2P7TA 2DQUL 2A77H 4RFOH 4HK3J 4ZQKB 1ZLUH 2Y72A 2NX5B 4HXAH 3S37L 1X5YA 2JJWA 5CEZD 4PJDE 3UTSB 3OKNB 5DQJA 1ETZB 3JV6A 3OMZA 4G8EB 3MBXL 1U8PB 4LQFL 3VGFA 1M7DB 1ZWIB 3WNLA 2R2EA 2NZ9C 3IFOB 3QQ9C 4LNRA 4PV9B 5DJDB 5HYQB 3JXAA 3P4OB 3BKCL 2IADA 2VLRD 1NC4B 3IF1B 4FFYH 2CLZB 1LP9E 3EYQC 2HJFA 1IM3A 1CXFA 1FVCA 4P46B 3OJDB 4KMTL 1JL8A 1S7SA 4OLXL 3I75A 3CGTA 4P23C 4IBLT 2DKMA 3DWTA 4MA1C 2CK2A 1N6VA 3ZKMD 3BDXA 43C9B 1L0QA 4MD0B 1LE9A 1Q0YH 1CGYA 1YPZF 3MLYH 1UFUA 5D7SL 3EZ8A 4FQPA 5T1KB 1RZJL 3ARDD 5DMKA 4LASL 3EJJX 4QCIA 1YEDA 1R3IL 1LO5A 5K9JL 3FL7A 1H15A 3FFCE 1CXLA 1YEFL 2NY6D 2Q3AA 1EUUA 1S9VA 3BX7C 3I02B 5KS9A 4J4PA 5DRWA 5A40E 5GZND 1KG0B 3I2CH 3QEUB 2HT4D 4G8FA 5D5MA 3BQUC 2FJFB 3TP4A 4PJEB 3HAEA 1ADQL 4JR9L 1RUPL 2XFXB 1NGZA 3BH9B 4OM0L 5CZXD 2DWEA 1J1XL 1YEKL 4F7MA 3O2DA 4HG4J 3UJIL 1A14H 1JGLL 3QFDA 4ONHA 5IKCB 4GFTB 4J3WA 3BIKB 3WS6A 1HCFX 3MLUH 1IM3B 1BM3H 3BEVA 5DSCA 2A6JA 3PDGA 5JIIA 1T83C 4UIMA 3BP5B 5D1QA 5IMOA 4IDJH 5E94A 5DMJB 3IAPA 3C9NA 4M48L 1DQML 1Y18A 2EEDA 5D1ZB 2QL1A 3GUTB 5C0CE 2DL2A 2Q1EA 1I1AD 4AEIL 4DJMA 3DYMA 4GRWE 1KXTB 4AEHH 3AAZA 2MCG1 3H3PH 1A6PA 2N1KA 1TCMA 4K7FA 1IEAA 2J8HA 3BW9A 3FQWB 4LHUD 3HI5L 4FQCH 1FZJA 3QBTB 4TN9A 2DIAA 1GH7A 4KDVA 4TOYH 3AREC 4GG6B 1R3LB 5F7YC 4PJDF 2XZCH 4LBEA 1JYVA 2ZPKH 5J7CC 5D7SH 1DQDH 5FXCH 1CDYA 5ITBL 5EUOA 5GRUL 5F7FA 5CJQH 4JFXA 4J6RL 4Q2ZB 3PWPB 1NLBL 2OTUB 1P6FA 1LILA 4NQED 5IESH 3JV6B 2XWTA 2BSED 1W72B 3BIKA 5HHPB 3PDOB 2UWEF 4U2YA 4JQVC 3HFMH 4PJ9D 5JO5A 1VFBB 1ITBB 9CGTA 3N1MC 2XTJC 4FQXC 4AIZB 4ZSOB 4LLDA 4XT1C 2XN9B 4NWUH 3V95A 1I1AA 3BO8B 2DS4A 4Z7UA 3K8LA 1IKFL 1CFQB 4N90E 4MJ6B 3UJIH 4OM1H 4FNLH 2KQMA 4FQHA 2IEPA 3MV7D 1F2XK 2NY5C 1A47A 3O4OB 5GS2H 3ULVE 4AL8L 5D1QD 3U2SB 4KZDL 4FXGB 4HS6A 1AD9A 1HHIB 3GHBL 4PRPE 2CGRL 2W0KA 1JPGB 2FJFA 5DI8B 4XB7A 1I8IB 2OBGA 1S7VB 3TT3H 3PGFL 4KVNL 4U1JB 2NXZC 4BKLA 4KV5F 5A43C 5F8QC 2IBZX 1T0NB 2DOCA 5F9JA 3SDDD 5F1IB 1F42A 1UKQA 3RI5F 12E8H 4K9EC 3DXAD 1D6EB 3MV8B 4KU1A 3JVGA 4LL9A 1HDMB 1CK0H 1YY8B 3MLWL 1ACZA 3WNPA 4M1DL 4WI6A 3MGOA 2EYTA 3QWRD 1MFCH 3IU4H 1BEYH 2HJLA 2JJTC 4M6NH 5I0DA 2APVA 3GMOB 1KBGL 4X8XA 4QYOB 2DWEB 3QUYC 4ZUVB 4HMCA 5FO8B 1NCUA 4WW2A 4OF8A 4HKZB 1P5UA 1A7QH 4J1UB 1NC2B 1QHOA 2DF3A 5I66A 3RTQB 3ARTA 5J12B 4EN3A 4N8CH 4EI5A 4XNUH 3TGXA 3QFJA 5T3XH 4CDGC 3TBYB 4G80B 2Q7YA 3HC4L 2WBKA 3QXWA 2J5LB 4H1LA 4Y8DC 4ISVA 4NQSB 1SYVB 4JRYB 3WLWC 4G3YH 1O7VA 3KHQA 2H2SD 4NNYA 5E8DL 5FHBL 1HOCA 3TJHD 1AD0B 1UCBH 4LK4A 3T3PE 2YUZA 5F96H 1IKFH 1HKFA 5FKAA 5E6ZA 5DHVH 2F15A 2YPKB 3EOBB 4EZMA 3D0LA 1I7RB 3JWNC 5IIEB 4U1GB 2R23B 1CLOL 1P69B 1WWBX 5E2JA 4JM2D 5TGBB 3CDFA 3RWHA 1IQDB 5ACMA 1YYMH 1LD9B 4NT6A 1I4FB 2QKIA 1QRNA 4TVPL 1B0GB 5CWSA 1Y6KR 1MCIA 3MFGB 4GRLB 2UZYB 4GMSH 1KIRA 3U1SL 5HDOA 1LEIB 3KLSA 3F5WA 4HEPG 4NHCL 4LLQB 3F8UB 3GMOA 4X6DB 5LAXA 1L7TH 4GUPA 3LKRB 3FN3A 5K93A 5FYJL 2AJXH 3HZMB 4KUCD 1F3RB 1OAUL 4NQVB 4F15B 1RFDL 2VLRE 4PY7A 3DV4B 1UXWB 2FYYA 3RUGA 1KTRL 3HKFA 4MNGA 5F9AC 4OB5L 3PP3K 1O7SA 4BFEA 3IU4L 4LNVA 5JHDE 1A8JH 2AJYL 1DVFC 3SE9L 4G43A 4XHJC 4MDJB 5D6CB 5L0QC 1PFCA 1F4YL 5C0CA 5DWUH 4OLWH 4QRPD 4AYFA 4NNYB 2FJHA 3C6SA 2NY3C 3U36B 1KIPB 3LQAH 3P0GB 3QDJA 3VD5A 1PZ5A 1I85A 2X4QA 4XMLH 3L3IA 1EH9A 5GS0L 2ICWJ 1KTDA 4NO2A 5JW5B 3TO2B 3AMKA 5E8DH 2D4FA 3W82A 3VRIA 3T1WA 3CFJA 4N0UE 4G8GE 3N0PB 3B9DA 3BN9D 4PIRF 1X5AA 2AJZA 4M1CD 1QSFB 1I1FB 1KENL 3DRQB 1S7SB 1XGPA 4AQOA 4LGSB 5I9QB 4BFBD 5I17A 5JOPD 2H32H 4JKPH 3H9HB 1ZLVK 2V7NA 1G9NL 4LAQH 4LCYA 5DEZA 2ARJB 5I76B 3IGAA 4ZNEA 1FFNA 2ZG1A 1A9EA 2CIIA 3U4EA 5DMGC 4CGTA 3FCTB 3PQYB 2E5EA 3FKUS 4R90L 2V17L 1BECA 5HI3D 1CXHA 1I7RA 2Z92B 1BAFH 3S4SG 2BCKA 2V5MA 4K7PX 4QCIB 1RULL 4NC0B 4GKZA 3RY6C 2ED9A 1A6TA 3BRFA 4N90D 4HUWA 5IOPA 2DLHA 4CMHC 4DVBA 3CD4A 2G5BA 5IVNA 3TO4B 3VWJA 3IFPA 2O5YH 1YEIL 2BVQA 4S1QL 4FA8A 1NUNB 4PY8J 2CGRH 2FO4B 5DC4B 3UTTB 1HI6A 1JPST 1EEYB 1JGVL 2COQA 5JW4Q 5C0BA 4BFGA 5D2NA 1ZOXA 5DQDH 5KS9F 3IF1A 2HH0L 3QAZC 2P5EE 1EHNA 4RMWA 3RWEB 1ZMYA 5CKGA 1EEZA 2CDEB 3LKRA 1U8NA 3MRGB 5J57B 4XX1E 1NJ9B 1BEYL 2F53B 4Y88A 2WINB 3MV9B 7FABL 1BVKA 1AHWA 4Z78A 4WHTB 4JN1L 2NXZD 3D3VE 4JKPL 4HULB 4HJGB 3F7RA 4Y5YC 2X4SA 4K3DH 5H2BB 1WT5C 5D6CA 3LN5A 3T0AA 4FFZH 4LCCA 1KLGA 1A3LL 5KN5B 1JF5A 5D1XC 1KELH 4ZXBC 1J8KA 1X7QA 5JA8B 2WUBL 5F9WB 3BPLC 5CILH 1EVTC 3NVQA 1JNLH 4G6ML 1LP9A 3LSOA 1WC7A 2DD8H 3FO0H 4OLUH 4JQXC 5KOMC 1BMGA 1EJ6A 1TMCB 1AQDB 3EYSL 4PTUA 3KLDA 3K80A 3LRGA 1QBML 4HK3N 1AFVH 1DEDA 3QDMD 5GJSH 5HHOD 1NGXB 1CD1B 5JNYA 4PJ5B 4MSWA 2AXJA 1GXEA 5C0JB 3DO3A 4OM0H 5EUOF 2AJZB 4JPKH 5IHUH 4LSDA 4X5XA 3ZHKA 1KC5H 2C7UA 4B53A 1RZGB 4YEEA 1FVDA 2FL5A 4KRNA 3TIEA 3PABA 3VXPA 1CDGA 4H26A 5TDNA 3HUJB 4HS8L 3PL6D 3OHXA 4BZ1L 3VD4A 3CPLA 1WK0A 4ZAKA 1DBML 4UTBL 1NGQL 4OV6F 3BZEA 4UDUA 2ZSWB 1XT5A 3U0WL 1ZLUK 3DHJA 1AXIB 5FB8B 4OQ1A 4MLIA 1MNUL 4Y1AA 3SKUD 3VFNB 3FO9A 3V5HA 3MLSL 5MEQA 1OP3H 1YPZE 1ZT4B 1FYTD 3Q3GB 4QRPE 3S9DB 1FNSH 4G9FE 4XP9L 3MGTA 5IMKA 4OCXH 4HGKC 4F7TB 4ERSH 4ZFFA 3D2UA 2VWEC 5ACZA 3IDGA 1F4HA 1QA9B 4K8RD 3FRPA 1OY3B 4N1CA 5AYUL 2IAMC 2YSSB 3JV0A 5I2IA 1P7HL 3RPIB 3ZZ1A 2CDGA 3G6JF 1PEZA 3FO0L 2P46B 2Y5TA 1H0DA 1NCDH 1BZ9B 4AMKH 5JO5B 5F1NA 4JFPB 5KW9H 5E08H 4Y2OA 2AEQL 3DBXB 2AV1A 3G5ZB 3LHPL 5EUKA 3GKZA 2P49B 1NFIB 4WRLA 3NIFF 2D7TH 3TVMA 5CJ5A 2X4RB 4YR6A 1NMAL 4DVRL 3MV9E 5GSRB 2VXTL 1R24B 3IDJB 3O2VL 2BOBA 5EUOE 3PNWB 2GITA 2ESVA 3RWIB 2NY1D 4OGXL 4S2SA 5HVWA 5CP7A 3RVVC 4DQOH 3GHBH 4O2FB 3A6BH 1LEKB 4D8PB 1I7TB 1JV5A 2HTLC 3P9LA 5C0AB 3MBEB 4BSVB 1AQKL 2NX5D 5FA3A 4FP8L 3KAAA 3L3GB 1LDPH 1B2WL 4PRHD 4QHNA 3UTTE 3TT1H 3F5WB 4ZS6C 4PB9H 3TVMC 3MV8D 3MRBA 3R06B 1Q9KA 5KVFL 3QO1A 4G6AD 2EYTB 1JN6B 1CK0L 2BOCB 3DV4A 1X5JA 5DMGD 5C0DB 1NGXA 3QO0B 4KZEL 3EUUA 1J0IA 2DKSA 5FAAA 3UTPD 5HI3C 2ESVE 3QNZB 3V5DB 1QSEB 3R0MA 4HIHA 2YPLE 2GKIA 5I1EL 5GGVY 4HGWA 3RGHA 1TETH 1NANI 1HQ4B 4J4PC 4YPGA 4ZYKB 4F3FA 4KMQA 3FQTA 2FBOJ 5AAMA 1LO5B 1W8OA 3ET9F 4HHAB 1G84A 4NQSA 3LQAC 2XG4A 4OCWH 3EDDA 4ONFH 2H6PB 2Q7YB 5DRWB 4HJ0D 4EDXA 4XWGL 3Q6FA 2JF1A 2HLAB 2VDLL 4F7TA 4IHOB 4Z5RA 2QQLL 1P9MC 1QUNA 1M05A 4XCYA 5DLML 5T1MB 3TFKC 4ZAKD 5H94A 3BPOC 4RWYH 4UI2A 4XPBH 4JRWA 4WO4A 2VXTH 1MCRA 4OLZL 4S1SH 1KXVC 2D7NA 2Z31B 2BVOB 4DN4L 1I3UA 3RIAK 4HSQA 3DX7A 3BJLA 4HUMB 1CD9B 1E6JH 1JI1A 2DI9A 5GGRA 3CUPA 3O0RL 4JDZA 4UUJB 1EGJA 4OGAD 5LGHL 1K5NA 4G6MH 5IF0B 3H9HA 5ILTH 4PTTB 5IBLD 3LD8B 2Z91B 3GSVA 2NY3B 1AGBA 3QA3B 3SO3B 2BX5A 4OZHA 4M7LL 1NBVL 2J88H 5AG9A 4RGMC 2GJZA 4YDJB 5FYJH 3TWCL 4HKBA 1NCBH 3MRQA 4YX2L 4M93B 3ARZA 3AFLA 3KLAA 5BJTA 5JW4N 2NY5L 4JPKL 5IHUL 2EYRA 3RZCD 4KDTC 3OKYA 2HP4A 3TJEH 3PHQA 3SE9H 1UACL 1W2KT 3SE3C 1CL7H 4LIQL 1UXSB 3ZYOA 3IFPB 4YHOL 4PV8B 1OGAE 5E2VH 4L8DB 2CRMA 3OTTA 2APXA 1P7QD 3LQAL 4Y1AE 4Y5YA 2P5WE 4K3HA 4ONFL 3KYMB 2WW8A 4D3CL 4LCCC 3EFFA 1CXIA 2Y7QB 2ZUUA 2NXYC 2E7LC 3QCVL 2BRRL 5E5RB 1GIGL 5F71A 4M8QA 3SKNB 3B83A 4ORGB 1NUFA 4MXVE 1NJ9A 5ISZD 2WQRA 2HFEA 2P8MA 3NABL 1ULVA 4HUUB 1CFNA 1ZV5A 1T3FB 2CKBH 5K9QI 2DBJA 2YPVL 5EBMB 4U3XA 4AMKL 3BXNB 4NQCD 4U1JA 4P4KB 2HWZL 2P43B 4GS7C 3RNKB 4XPAL 1K6QL 3RDTD 4U1HA 5KAQG 4UNUA 4YK4C 2NY5H 4EDXB 5C6PB 1S7QB 3E0GA 3FN9A 1JGUL 4GW5A 1VADB 4P57A 4XXCC 2LVCA 1T83A 2OTWB 4JKLA 1KJ2A 1YY9C 1DLHB 1U58B 1DN2A 5IVZA 5IB2B 1FYTE 1G0YR 5C07B 1EGJL 4WW2B 3VXRE 5KVMC 4LSRH 4I4WB 2E7MA 3HZKB 3NZHH 2L0DA 3CC5A 4ELME 1J0JA 4L3CA 1T1WA 1VEPA 4D3CH 1QKZH 4HS3A 4B0MM 1UH2A 4PGCA 1FFOB 4HDIA 2GJJA 2GHWB 3P0VL 4LLUA 2XXMB 1KIQB 5DRZA 1RY7B 2C5DC 2YPLA 5DJXA 5TPWL 4LCWD 4ZPTA 1MQ8A 3VCLB 5FOBB 4PJBB 1FC1A 2ADGB 4I1NB 1MH5B 3EOAB 3QUZD 5D7IF 3BXNA 3FRUB 4XBEL 4Q6YA 1JBJA 5GQBA 2XN9E 3MX0A 1TJHL 3TC9A 5KSUA 4FQQB 3C6LB 1FG2A 5T3ZH 5EULV 3MZTA 1OWWA 3A0OA 3VGDA 3W2DH 4BK4A 3EYOB 4ENED 4PUBH 5DVLA 4P3WA 1KPUA 3EDEA 4ZS6D 1UENA 3LN5B 4Q6IB 4YHKL 3S36X 2D2OA 3MYZA 4OD3L 1A6UH 4M7KH 3TN0B 3QG7L 1J86A 3KPMB 2XZAL 1VENA 2C9AA 4MNHB 2CJUL 4Y19E 4UDTB 4GUPB 4F58H 1WFUA 3MRMA 4FFVD 4MDIB 1FLTX 3E6FB 5GS3A 1NBZA 4F57H 4LU5L 4PJXA 1JI2A 2Y5TB 4LDEB 5D5ME 1QBMH 1TLKA 5F1NB 4Y2DD 2E7BA 1FNAA 5FO9A 5EWIH 4EEEA 3Q5YA 1MHCB 5FYKD 5JNYB 4JGMA 3F12A 3EOTH 4LPTA 1UC6A 1SYSA 2NNAB 3ZDYF 4ORGA 4QTHA 2Q6WB 5CGYC 2B8OT 2QSQA 5ANME 5GHWL 3C6SB 3U36A 4Y7MA 1DUZB 3MRLB 3SY0A 2Y07H 2X4OB 4YFEA 3IS1X 1H8NA 1CE1L 2OR8A 2YPLD 1CGSH 3C5SA 3SDCB 4OUUB 5BRZA 3FOLB 2ARJQ 3PWUB 1PSKH 3PHOB 4ISVB 4JFDB 1FNGA 4BH8B 3QDJD 5SWZD 3P4MA 1JTOA 1KTDB 1PGRB 3C6LA 3U9PL 2RJMA 3MMEB 4N0RA 4YEFA 2I60L 3DROA 3C5ZC 1FAIH 2HA1A 2ZSWA 3OBAA 1HYSC 1H3XA 3P11H 4NQCA 4ZNCD 2WUCH 2DM7A 3JUYA 4O58H 5D9SA 2A1WL 1YEGH 4XP6L 3O6FB 1RD6A 3MLVH 4Y5VA 1UWEL 4P48A 4RAVB 4X7SL 3U79A 3IJYB 2EDRA 2NPLX 4MD4A 3VFRA 1GHFH 2DRUA 2XQBL 1F6FB 5I30H 1EIBA 1Z3GH 1KPRB 1S9XB 3H3BC 1B0GA 1KB5A 4HS3B 2Q76B 1NCAH 3S8WA 2EECA 2B7DT 5GPRA 1GOHA 2DQJL 3MGAA 3QUMB 5CINH 5C0EA 4NSKA 3D87B 4QEGA 3C2SA 3QRGL 2W9EL 3ULSB 5T33L 4PY7B 4XVSH 4ONGL 2EDJA 2BRRH 4XNMB 5HJ3B 1R3IH 4FS0A 3DOSA 4JM4L 4TUOA 1CQKA 2NY7L 5FUOH 3P0YH 3TPUB 1NDGB 4HWNA 4PJBE 3KPLB 4FN0A 5I18L 4UBDC 1J10A 1ADQH 4JR9H 3MXWL 4P46C 5IVXA 4ZO7A 3ALWA 5ALCH 1NAMH 2CK0L 1YEDB 1VFAB 4OSUH 4ODTL 5AZEL 3S97C 4WO4B 5J6HB 4N0FB 1OAQL 5JQ6L 5HPMB 5EU5B 3GRWL 3MLUL 5I8OL 1XGQA 5EA0H 3TBWB 5AZ2L 5C07D 4HFUH 2VLME 4MJ5A 4W6YB 4M1GL 4JFED 3AM8C 1TTUA 4LSVL 5IGXL 2OJEA 3QUKB 2A73A 4B7LA 1RHHB 1MLBA 2QADB 3JSSA 5DUBB 1HH6B 2VDKL 3O11A 2VLJD 3CLFL 1E27A 4UBDD 4JHBA 2DQHL 3L3GA 1MI5D 2W91A 5TDOA 2X7LB 3UZEA 2ZUSA 4X80H 2I9LB 1UKTA 1NBZB 5GJTH 1BIHA 1F4YH 2H1PH 2RGSA 1IAIL 5JMRA 1MHCA 1C5BH 1ZA3B 4KI5F 1EO8L 3L7FA 3BQUD 1I3VA 1K85A 2XWJA 2E3VA 4U6TA 4KRMB 2IPTH 3IJSA 1K4DA 1IEAB 3MROA 4XTRC 1V5JA 5SWQA 1R3KA 1OP3K 4HH9A 4HHAA 3VH8G 3MV01 2Q86B 1XCTB 1NLBH 3UTOA 3MSPA 1YY9D 1IMHC 1CGXA 2HLAA 1C12A 2H2SC 2FX7L 5EC1B 4QHMA 3O2WH 4BH8A 5EU5A 2EICA 2W65B 5ANMA 3RWJB 4J12A 5DJYA 3NTCL 3FMGH 5EU6E 1AGEB 3WFCH 4J3SA 5KSAB 1JYWA 3PP4H 2IGFH 4QRUB 3REWA 3LS4L 3NZ8A 1RUAH 3HE6B 4TSCL 5K9QG 3HB3D 4XPBL 4RWYL 3BRGC 4OZIA 5E00B 4ODTH 4JFYA 4MCZB 3QB7C 5ID1A 4PLKD 2CLVB 5CD5D 1BP3B 3AROA 3LMJH 4WO4D 4I2XB 2HFGL 1LNUB 4WUUB 4KHXH 3UPAA 4WTXA 5IJKA 5AZ2H 1DCLA 3SDDB 5DURB 2ITCB 5J11B 2Z4QB 1OTSC 3ULUL 1ES0A 3RVXC 1GGBL 5DRNA 2YK1H 1G0DA 4KVNH 4A6YB 3PXHA 4U6VL 1BQHB 3ARVA 2DLIA 4RQQB 3SJVA 2P8PB 4NZTL 3CFEA 3ROOA 5HYSB 4CU8A 3LPGA 5DS8A 4DKFL 4HC1H 1XMWA 5FYKL 1M6OA 3ZE0F 4M61B 1DVFD 3M1BA 5EZOL 4F15C 5HHOB 3BHBA 4F37K 5DFTA 3ZSSA 1IZJA 4QXTB 2XQYG 4NBXB 3WSQH 2X2YA 4UB0H 4QRSA 4MMXC 1PSKL 1T7ZA 5ADPL 15C8H 1NEZB 4L8DA 3ROLA 3OJDA 3QDJE 5JPMA 4I18A 1KN2H 1A3QA 2H2PC 2VDPL 2CRIA 3O4LB 3M8OH 1NGWA 3W11D 2YUXA 3V6ZB 4N8CL 3VFOB 4YUEL 3U6RA 4HLJA 3T0BA 4O58L 3P4OA 5IFJB 4WGWB 2IQAA 2OLDA 1MRFH 3UPCA 1IT9L 1U41A 3L7FB 4HV8B 1QFWL 2VZUA 4D0CB 4G8GA 3HE7D 5TH2A 4DEPC 5IEHA 2A83A 4W4OA 5IB4B 4NZJA 5FYLL 1F4AA 1UB6A 4R7DA 4HIIB 1P4BL 4JPWL 1PDKA 4M7LT 2F5AL 2QQKH 3EO9L 1L0YA 4GAGH 1C12B 1J11A 4YDVB 1YYML 1JNLL 1ZA6B 1MHPH 3UYOD 3MRKA 5IV2B 4DAGL 1FNHA 3P0YL 2NCMA 4U1IB 4P5KA 4QGYA 1VERA 1UH3A 3RX7A 4JN2B 4Z7QF 1NH6A 3Q0HA 2ZUYA 1EJOH 4P23A 4OZFH 1A1OA 3QDJB 1A4KB 1AE6H 4XPAH 1L4IA 1VGEL 3MFFA 4OF0A 3RNQA 4M62L 2C3WA 1GGUA 3ZDYE 3DMMC 4HWUA 3DIFA 1CDUA 4PJGA 4D9LL 2Z8WC 5GSVB 5HGGS 1T0MA 5ACLA 4Z8FH 1N3NB 5F21B 2APBA 2AQ3A 1IGTB 5JIKA 2YD4A 3F12B 4YXLL 3QEQB 3AMLA 4M1GH 1BFVH 2VLMD 3HZKA 1ORQA 4NGHH 1SHMA 3RUGB 4I2XA 1N2RA 5EB9A 3G04B 4KQ3H 1RAMA 1XGPB 3S4SA 3VMNA 4XNYL 1INDH 4OI7A 3HG1E 4WI4A 3O4LD 4V2CB 3I6LD 4YFLF 4ZSOE 4PJIA 5HHXH 3T0EA 2AJ3A 3VG9B 5ESAA 4K9EH 1SBBA 4JFDA 1EAPB 5F7KC 2AXHA 2VXSH 5LXGL 4WENB 4XCYB 1JRHI 3VI4E 4HK0B 1I3RA 2GK2A 5DVOA 5DK3A 4MJ4A 5KVEH 1Q0YL 1DTUA 4X6DF 2DWDB 4ODVH 2X4QB 1FZJB 2HLFD 1U93B 5D9SB 4NZRH 3EYOA 3ULVH 3GI9L 5KSUB 3BPNB 3DVGA 4IJ3B 1S7WB 4PB0L 1R3JA 2BVUA 3WJLA 2YRZA 4I2XE 3BMVA 5M95B 5DQ9B 4P46D 1JRHL 1KPVA 3GMMB 4L5FL 3OXSA 3KNBA 2DYPD 3P4NB 3EBAA 4DOHB 2EIDA 4WWKD 5JPNB 5C0EB 1NC4D 3RKPA 3BH8B 4JFEE 3VFSB 3RIAF 2CJUH 3WFCL 5IHZB 3K46A 4MS8D 1MAMH 5LVEA 2D7TL 2NY6C 3QO1B 3TH2T 2PTTB 2ADIA 1T21B 1A6VL 2LVEA 3BGFC 4QHUA 5IQ9B 2WINA 4OQTA 2VWEE 3IGAB 4A2LA 3OAUH 4D9LH 1DL7L 2X9WA 4R9HA 3JTTA 1A14L 1JGLH 5TQ2L 1MCOH 3OKDB 4CVUA 4APQD 1MJUL 5GIRA 4P4RB 4YXLH 4OLEA 1RU9L 4FXLA 5ESQB 4DQOL 1N5AA 4IDJL 3AS2A 2UUDH 3MXVL 2YR3A 3KPRE 2X4UB 4JFZH 1GGBH 3LKPB 1PAMA 1U3HC 2W07A 4JQVA 4GW4A 5H8DA 5EOCL 3SDCA 2DYPB 4XCCL 1TTGA 5DQJB 3DGGB 4MB3A 1HZHL 1Q9LA 2E8YA 1EUTA 2X4SB 2VUYA 3CLEL 4QXUL 1F97A 2FR4B 4GRWH 4KTYA 1X5IA 4P2RE 5KVFH 3U9PH 1NUDA 3WCYA 3FZUD 5IMLB 5BO1L 3DI2B 2DMCA 1HQRB 2IMMA 2R1WA 5C09B 1Q72H 4G42B 4YGVA 5T3ZD 1HYRC 1EHLH 4KKBD 3BESR 4NO5B 1DQDL 5HDBF 4O51B 3L6FB 2VSCA 4FQXD 5BZDB 4RNRA 3ARWA 4MNQA 3RTQA 3MYJB 4NKMB 3O3EA 5TJWK 4NC1E 3ARFC 3B9EA 1NEUA 1AKJD 1ZHLB 4QYOA 1N64H 3THML 4LSUH 1H5BA 5J6GB 1PJ9A 4NSKB 2VISB 4YUEH 3MTRA 5EPMA 5IG7A 1VACA 1IT9H 1D5BA 3DETC 3QXAB 2ZJSL 3TNMB 1U93A 1KFAL 1WV7T 5HHVH 4N9OB 4XWOD 4G7YL 3T2PA 1AO7A 1JWUB 5H2BA 5CLTA 1BJ1J 3F7VA 3VI3F 3IDNB 1I4FA 3WD5L 4PY8I 3NH7H 1KIUA 1DBJL 5CJXC 3MV7E 1MJUH 3DUHA 2UVFA 5J6HA 2YZ8A 4IOSD 3KWWA 2MWCA 4JCLA 5KVDL 1J0YA 3DRTB 1EERB 5ICZA 3AY4C 4EI5C 3OPZH 5B39A 5T1DL 5GXBB 1XIWC 4MA8H 4DGVH 4X8JB 4IIQB 4UU9B 2APWA 2VERN 5E8NB 3T65A 4D94A 1I1YA 3VXSE 1K2DB 1CN4A 3PWNA 3VGHA 4GRWF 3WDJA 1BZQK 4XZUA 4IMLB 5LAXB 1FVDB 4NP4L 1QLEL 1I8LC 5EZLB 2E6QA 1IGJB 5M94B 4JJ5B 3MLSH 1BVLB 4NKIL 2HG5A 1Q0XL 1AR1D 1BZ7A 1QSEE 1OGAD 3MNZB 5CSZB 3VFVB 3PWVB 2FWOA 5FF6B 4OCSH 2N4IA 3WBDA 4HPOL 4MXWL 4Q6IA 5ALBH 2HVKB 3VXSA 3VU2A 5DJ8A 3PWPD 2IQ9H 3R0NA 5KOVC 3ZKQD 5HHXL 2OR7A 3WFEL 4KTDH 4OT1H 5EC1A 4JREB 3QCVH 4LCUB 3BJ91 1UCBL 1DN0B 1TVBB 2FX7H 4Y4KA 1JK8A 4ZAKC 3DO7A 1NKOA 1A7NH 1ZSDB 2MPAL 2AJSH 3GSXA 2BSRA 5MENE 2BRQA 3DECA 2NTSP 3ZE2F 3WDIA 2Q8BH 3KXFE 3TN0C 3GI9H 1N4XL 4TVPE 5DDHB 3LEXA 1RUAL 4OD2A 4YHMH 1GL4B 2XICA 3ZE0E 4WUUA 4TVPH 2X6MA 2CXGA 3C6LC 2FATL 3D39D 3D18A 3QWRA 5D1ZD 3U1SH 4L3CB 2HFGH 5SV4A 4NQCE 3RJDA 2D3VA 2GAZA 2JB6A 4NO0B 5K9KB 4K3JL 2J6EH 4ZO8A 3BE1L 2VABA 4DTGL 5ITFA 2VZTA 5CIPH 4Y4FD 4RIRB 1JPGA 5E1AB 1MVUB 4PJ9A 4K71B 5IWLA 2WWMD 1M05B 1N6QH 5F70A 1MCOL 4DKEL 2MTPA 4F3FB 32C2B 1XZ0A 4CADB 5I0ZA 2XKUA 5DJ8B 1OF2B 4FTVE 3UAJD 2DLFL 1FG2B 5B4MD 1A4KA 3U4BL 1TFHA 2OQJB 5EZOH 1A3RH 5DK2B 3BHBB 4YDIL 1RJYB 2UV3A 4LEOB 3TH3T 5DHXB 5TE4H 1FO0H 4LCWB 3RL2B 3VFUA 1AGBB 4YFDB 5EIIB 1YA5A 2CRZA 4ZUVA 5GS0H 2FNBA 1KCUH 5E99L 3P0VH 4Y4HD 2YD1A 5C0BB 1FH5L 5BZWA 4G8GD 5FUCE 3CFCL 3KYKH 5TQ0L 4HV8A 1AGCA 4OCWL 1MQKH 1OAZH 4ELMF 5KSAC 3RBGA 4HIHB 5CD3A 1Z0NA 4GS7B 1NANH 4JPIA 5D6DA 2YD2A 4R0LC 3HMXH 5DLMH 3MQIA 5BQ7A 4LKCB 4OZHB 3O9WC 5K59F 2PUQT 1INQB 1QLRB 3I3DA 4MAYC 3WUWG 5E4IA 2JTDA 4S1SL 2VLKB 2GCYA 2MQ0A 4OKDA 4M43L 1JCKA 3O6LL 4WHTA 4TUJA 4URTB 3WXVH 4ZFOA 5DI8A 1CBVL 3V7AE 1NGYA 1PYWA 1MSPA 3IDUA 4G6FD 4G9FA 1IM9D 3VXSB 1LQSR 3SGEH 4JANB 1AY1H 1CF8L 4PJEF 1KNOB 5EO0B 1NBVH 3BGMA 5C9JB 4OBRA 5SX5K 4ODBD 5DD1L 1CFSB 2VXVL 1F90H 4WTWA 2VNCA 3GNMH 1MIMH 5C2UB 1TZHA 2VL5A 2B1HH 5EDXA 4H0IA 1Y6MR 3MLWH 5EOQH 2QADC 1GZPB 4JZOA 4DUXA 1SEBA 3QUMA 3V6OE 4KJPC 1ZT7B 5CHNA 3ZYJA 1JGVH 4KROB 4LIQE 2ZOLA 1CL7L 1G7QA 2O5ZL 1NDMB 5L7XH 3WFZA 2I07A 5F6IB 1P5VA 3FOMA 2R29L 1P53A 2SEBA 3G6DL 2UWEE 3FRPG 1JHTB 4KAQH 4FFWC 2G60L 5HI5C 1KF9B 1RIHL 5E9DA 2IFFL 3BEWB 2PYFB 3CZJA 1TVHB 3CXHK 1ZT4A 1E28B 3PHQB 3RRQA 3WO4B 1U2HA 4XAWH 2H45A 2DJSA 4OGYH 1RVFL 3SO3C 3PUCA 1PYWB 1SMAA 2NQCA 2ADJB 4PJ9B 3HUJE 3REWB 2IJ0C 4C56B 1J05A 5HDLA 5I30L 5JUEH 4P4KA 3RX5A 4O2CA 5F96L 3C60B 3I3BA 3OB8A 1QO3A 1IAII 4Y16C 1WIPA 4WHDA 2DWDA 5ICXA 4OGZA 3HPLA 4H25B 3PWJA 2M26A 2WBJB 2GSGA 1G7PA 1BOGB 5D93C 4ESKA 5C0IA 2VDOL 4Z9KB 5CCKH 3T1FA 5KVGL 5D1XD 2DB8A 1WCBB 3EIFA 1TZGH 3FJTA 4PJFB 3V6FA 3MA7B 3EHBC 3RGVC 5DZOA 1HH9A 1VKXA 1A7NL 1FVCB 3VXSD 1XIWD 1CTNA 1JTTA 4YC2C 2PKDA 3CC5B 2XY2A 1AGCB 4P2OD 1K6QH 2GFBB 1TVDA 1FQ9C 1CDCA 1M7IA 2KDGA 4YHML 5I1HH 3O3BA 3CFKB 1D9KA 1WZMA 1Q1JL 1KEGL 3KPNA 4UNVA 2OK0L 2AQ1A 5C0CB 1OAYH 4UT6L 3SPVB 5C0FB 2AJYH 1UZ8A 2G75B 4DFHA 5FYJD 4KROC 3MR9B 2J6EL 3VWJB 2X1PA 5DZLA 2V2WB 3NIDE 2ESVB 2PXYB 5J13C 3TT3L 3L5JA 3CLFH 3HPJB 3GSRA 3JZ7A 4ZTOH 1IEBB 1MFDH 3TV3L 3RKDC 1U8IA 5FECB 4PJ8B 4LQ1A 3P3YA 1MCPH 3O3AA 3D69A 1ZVHA 5JTWA 2ED7A 3S96B 3OR7B 3W0WD 3MBEC 1I9IH 5TH2B 2LU7A 4JVPA 5JUEL 1AGFB 4HGWB 3WNKA 4KROD 2X89A 1Q9OA 4R7DB 5DD3H 1B88A 4YDLB 4U4BA 1SJXA 5MEND 3O3DA 4B41A 1LNUA 2D7PA 3MUHL 4NN7C 1FFOA 3OAYK 3VGGA 1G7LB 3S88H 2HFFB 2VC2H 2JCCE 4ZUTB 3GIVB 4YXHH 5K9JH 5C9KA 3KYKL 1YEEH 1J87A 5JW4R 3T77A 3ZHDA 1A1NB 3UBXI 5IB1B 5H94B 1KEML 2VLJA 3O3UN 3UTQB 3LKQA 2DIBA 2BNUA 2JLLA 2IGFL 4MB4A 1GGCH 5C08A 4U2ZA 1KACB 1IGML 1DEEB 4NN6B 2V2TB 3SOBH 3B4NA 4WWKB 1KOAA 3C5JA 3O2VH 4RMQA 4K23L 2D7OA 5HGAB 3AU1A 5EOCJ 1OM3H 1E6OL 1BREA 3KPMA 1GVIA 1PX3A 5HPOA 3EOTL 3VFTA 4JDVA 2V9TA 1UH4A 3TF7C 4P3DA 3IKKA 4NUGL 5AEAA 3MJ7A 3O41A 4AH2A 3ZO0A 4B7IA 3BZ4B 3X12B 3MRQB 3A6CL 5HJ3A 4Z18A 4C55A 1VEMA 1KPRA 1S9XA 3W9EA 3FB6B 3QYCA 4DKFH 1F13A 1IGIL 4CNIB 3QA3A 1BF2A 2IPUK 4I77L 1CFVH 3R1GH 5ITFB 4R26H 5SWSB 1JE6A 2R0KL 4L9LA 1OCWH 5EBLA 5GGVL 2Q7NA 4NWTL 2ZPKL 5D2NE 3BUYA 3IDYB 3AC0A 4HT1H 1DSFH 3CCHA 5IFHL 1FPTL 5D2NC 4U6YB 4V1DD 5BS0E 4J6RH 3H9ZA 1I7UB 1A64A 2CUHA 3L5HA 4F9PC 4TTDC 4AIXA 4FQIH 5TE6L 1SEQL 3FN0H 3S96A 1PW3A 4HWBA 4U1IA 2PXYD 1OW0A 4HFWA 3AB0B 2R2HB 3ARED 1ZT1B 2B39A 1MCHA 1TVBA 1BQUA 3VG0H 3UP1A 4QHKJ 2QR0A 5T33H 1NPUA 3DTXB 1GGCL 3HPJA 4P0DA 4RA0C 3S98A 4JM2A 4FQ2H 1AO7D 4QHUB 3RGVB 2CH8A 4PJ7F 2MHAB 3X11B 1JGDB 1H0DB 4NM4H 2MPAH 3AS0A 2GJ6B 4PJ7B 4NC1C 2LAGB 4PRPB 2A74B 1ZA3A 5IHLB 5IHBA 3CVHH 2DMBA 1FBIH 1N4XH 3WNMA 4OD2B 3CSGA 1E4XI 1BFOB 2XYCA 4JY5H 2I9LA 5I75C 4JRXB 4X6CE 4HC1A 3VH8A 3VFMB 2CMRL 3RWCB 4HIJA 2QHLA 3QEGH