5CBFA

Structural and functional characterization of a calcium-activated cation channel from tsukamurella paurometabola
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
TLMFKRFFGAVRTSWRDPSTRGAVLSLAIIVTAATIFYTLAEKWSVIDSLFYAVSVGLPMGNGPLSPTLTLSKIFTLVYAILVVGLFVTVGGSLASAIVQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of a calcium-activated cation channel from Tsukamurella paurometabola.
pubmed doi rcsb
source organism Tsukamurella paurometabola (strain atcc 8368 / dsm 20162 / jcm 10117 / nbrc 1612
molecule tags Transport protein
molecule keywords Ion transport 2 domain protein
total genus 30
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5cbfA00
1ORQC 1OCCC 4EKWA 4X8AA 4PDMA 2Q69A 3AG2C 4MVMA 5EBMC 5EK0A 1OCOC 4RUFA 3SPIA 3LDEA 3E8GA 4WFGA 3SYOA 3HPLC 5CBHA 3KG2A 3ASOC 3ABLC 4GX2A 4P30A 4DXWA 4R8CA 3E8HA 4PA6A 1R3JC 4R7CA 3T1CA 1V55C 1JVMA 4PDLA 2HFEC 4GX1A 2ZD9A 3X2QC 3SYAA 4F4LA 2Q67A 3LUTB 3GB7C 4UUJC 3STLC 3VOUA 3ZRSA 2WLIA 3E86A 4J9YB 3RBZA 4G27B 5J9PC 1XL6A 1M56C 3ABKC 4R50A 3UKMA 3K04A 5IY5C 3E8FA 4H33A 1ZWIC 3E83A 1M57C 3F7YC 3F7VC 2ITDC 2EIMC 4HYOA 4MTGA 5E1AC 4MVRA 3UM7A 4JTCB 4MVQA 3SYQA 1J95A 3AG1C 3RVZA 2AHZA 2DWEC 2X6BA 3ZJZA 3AG4C 4P9PA 4RO2A 4MVUA 5EC2C 4BW5A 3SPCA 1XL4A 1QLEC 1K4DC 3BEHA 3T2MA 2QTOA 2EILC 2AHYA 1LNQA 2A0LA 4MVZA 3ASNC 4LCUC 2ATKC 4PA3A 2A79B 3RW0A 4MW3A 3TCUA 1G4YB 1BL8A 4P2ZA 3SPJA 5B3SC 3E8BA 3OGCC 4WFHA 3E89A 4R6ZA 1R3LC 4XDJA 3T4DA 3K08A 3K0GA 5BZBA 2ZXWC 2EIKC 4MSWC 4X88A 5CBGA 3JYCA 2A9HA 4LP8A 3TETA 4G28B 3EFFK 4MTOA 3WG7C 4J9ZB 4KFMA 2IH3C 5EBWC 5KUKA 2W0FC 4RUEA 2YEVA 2DYSC 2OCCC 3IFXA 1P7BA 1S5HC 2X6AA 5KUMA 2HVJC 2ITCC 3RVYA 3OR7C 2R9RB 3T4ZA 3OUFA 3FB6C 4JTAB 2DWDC 3SYPA 2Q6AA 1V54C 4MS2A 3K03A 4QE7A 4X89A 4PDRA 5EC1C 3OR6C 4RAIA 4P9OA 2WLLB 3R65A 4MVOA 2BOBC 4PA4A 5B1AC 4GX0A 2HJFC 3FB5C 3LDDA 4JTDB 2EINC 4WFEA 4MVSA 2X6CA 1OCRC 2K1EA 4QE9A 2Y69C 3LNMB 4QNHB 3PJSK 2KB1A 2P7TC 2HVKC 2Q68A 3FB7C 5CBFA 4CBCA 2DYRC 4XDKA 4H37A 4I9WA 5EBLC 3ABMC 4PA9A 5B1BC 3K0DA 4OXSA 4TWKA 2WLLA 4XDLA 1R3KC 4MW8A 3SPHA 2HG5C 4PDVA 4MTFA 4LBEC 2WLKA 3F5WC 4HZ3A 3SPGA 2BOCC 2QKSA 3STZC 2WLNA 3AG3C 3IGAC 2IH1C 3LDCA 1K4CC 2EIJC 4PA7A 3SYCA 1R3IC 3FB8C 3K06A 1KKDA 3OUSA 1OCZC 2WLHA 4WFFA 4ZBMA 3SJQC 2JK5C 4GX5A 2H8PC 2WLIB 2WLMA 2WLJA 2NLJC
chains in the Genus database with same CATH superfamily
1OHHG 4K0KB 3J7AU 2Z5UA 3RYIA 4NXNO 4FFKA 4X66B 1MABG 3I5DA 3KG2A 2MK3A 4GX2A 4R8CA 3TXSA 4W4KA 4PDLA 1Q3EA 5KLVH 1NU1H 3QF7A 2FL4A 1A32A 2EIMB 2IJKA 2CK3G 1L0LH 3RBZA 4KXRA 1I0HA 2N04A 4J10A 4H33A 5E79Z 1RPOA 3CCQV 2EJ7A 5JQGA 5IE9A 2W6JG 3F5TA 4MTGA 3UM7A 4I55A 2Q9LA 4DV3O 2AHZA 3R66A 2GUZA 4N21A 4OGQB 5D5PA 1MG1A 5L3GA 4JF3A 3M99B 3Q4HA 1QBZA 2QA4V 3LSSA 3E8BA 4ZI7B 5KX5A 2YXYA 1YZBA 2N05A 3K59A 5CBGA 1WB8A 3CPWU 1VQ7V 4I4TB 2MW2B 1S5HC 2CH7A 1VQPV 1YSCA 3J80N 1YDXA 1YITV 1FFTB 2FB5A 2WWWA 3D3QA 4FLXA 3W7WA 3C90A 1XHXA 1WA8A 5ITZB 3FX7A 5JCOC 4X64O 4WFAV 4JZ2A 1ZX3A 2OTLV 2BSKB 4LF9B 3BHPA 1ZSPA 5J2UB 1VF6A 4I9WA 3DTUB 2YEVB 3JAKA 3QO8A 3SPGA 2BOCC 1AJPA 1VF7A 4LF8B 1Q6IA 3OUSA 1OCZC 2WLIB 1ROPA 3CC7V 4HAMA 2PZSA 3QO7A 2R9AA 2JJ1G 2E74B 3J81N 1THZA 1YJNV 4LH7A 4JAAA 4DV2O 1XUQA 2E5LB 4DK0A 2ZR2A 5BR8B 4PA6A 3OMIB 1L0NH 3T1HB 1EN6A 3BABA 2HFEC 5JVDB 3H1HH 2D2CB 1KC8W 2KSDA 4J9YB 1NQTA 3ZBHA 1XL6A 2QJ1A 2Y4TA 1BE3H 4R50A 5LOVB 4DR3O 4NYKA 3K5MA 1NS1A 4UB6Z 3CJHA 3CE2A 4DR6B 1FFXA 4UCVA 3RVZA 4FFBB 1OJHA 1QLEC 1CP9A 4W4LA 4JI4B 1AI5A 2RQ6A 1AB3A 3AK3A 4H13B 3H1KH 2UU9O 1NTMH 1HNWO 3CCEV 1KP2A 4R6ZA 4DR2B 2AGAA 2P90A 4I55B 2EILB 4YIPA 3ZHTA 4LNUA 2P67A 3JAKB 2PGGA 4F6RA 3OR6C 2BOBC 5KHGA 3RYHB 3LDDA 1OCRB 4DUZO 2JDIG 2DQ3A 4GKJO 1Y74A 1OZ0A 1NVPB 3HR0A 1V9PA 3BAAA 3ABMC 5BY1A 4ZIBA 2RJZA 5CA0A 5TISZ 3DSQA 4GLXA 1IBLB 3QVNA 3APOA 2IH1C 2VWKA 1K4CC 4K35A 3N2KB 3UQ8A 4PELA 1KQSU 2O57A 1B06A 5LA6A 2WLJA 3OMAB 1O9HA 4PJ0Z 2P4KA 2P4VA 2UUCO 3HPLC 2AZ2A 4UVCA 2RDCA 3T1YO 3E8HA 5CA1B 3CHXA 4UV9A 5EZYB 1N8RW 4UXNA 4LH6A 1IBLO 3SYAA 4X9QA 2Q67A 2QGNA 2ZDIC 1GKFA 4K8ZA 1KECA 5IY5C 3JALB 4FM2A 4JI6B 1GO3F 4X66O 2ITDC 5BXZA 1K9MW 5LYJA 4GKJB 3SYQA 2Y0PA 2LFSA 5L3EA 2OCCB 1KBHA 1NBMG 3OW2U 4MVZA 2CTWA 5JVDA 4DR4O 1T5EA 1FJGO 4JI7O 4PHZA 2EIKC 2GUZB 3P3PA 1W0KG 1R6TA 4GCZA 1HNWB 2X6AA 5FL7G 4RWUA 4JTAB 3K03A 3Q4HB 3UO2A 4B3MB 3JASB 1M56B 5B1AC 5DEDA 4ZHQB 2BCCH 3ZMVA 1FPOA 4NR1A 2HLDG 3X2QB 4LF6B 2KB1A 2N74A 3OD4A 1V55B 2DYRC 3RYIB 5EBLC 1YEWA 1AR4A 1L1FA 1VQNV 2DOSA 4UB8Z 4JV5B 2L35A 5J2TB 4HBNA 3LSQA 1JPXA 2ZQMA 4JGSA 3K06A 5IYZA 1E1QG 5IJ0B 1SQVH 1S5LZ 3OAAG 3ZN0A 1N33O 4FIPC 1LR1A 4PDMA 4JI8O 4JI2B 1OCOC 2EJRA 2H94A 2F95B 3ASOC 1BHBA 1N36O 5EYPA 5LYJB 1NH2B 1CXZB 3CCSV 1RSOA 4EEQA 3VBBA 1K97A 3AK1A 2JS5A 1H2NA 1M57B 1E79G 2LFRA 2R70A 1E1RG 3P32A 2WAMA 2XASA 3TJTA 3WB2A 1WB7A 2LQTA 1J95A 5D5QA 5F2VO 3AG4C 4MVUA 4AHCA 4BW5A 1J5EB 4PD4F 1H8HG 3L74H 1VEWA 1H2GA 1MMMA 3TCUA 4MW3A 4ZHQA 3AG2B 1WA8B 2XAFA 2IM9A 5GTIZ 4J7ZA 3JD4A 3JAWA 1FFXB 2IJIA 2ZM6B 3WB1A 3JD3A 4WBNB 1XMOB 2FMLA 4NXMB 5CA0B 4LF6O 5KUMA 4TUYA 2QWQB 1F4NA 4X89A 2XAGA 4DR1O 5EC1C 2JGDB 3IAYA 1Q82W 1SESA 3THOA 4JTDB 2ZNIA 2LJ2A 1AROP 3D36A 5IWAO 2Y69C 3ZRXA 2YI8A 4TOIA 2OWOA 5HFLA 4ASUG 4TUYB 1AP6A 2P22C 3ABLB 3P30A 1NH2D 1H2LA 4PDVA 2BTQA 1AVMA 2XUMA 3B8NA 4JYCA 4I0XB 4IIJB 3RWRD 3SJQC 3CD6V 3WFVA 5C8YA 2QE7G 1HNZB 1PL4A 3E22A 1KYOF 2Q69A 4MVMA 4YJ3B 1XMQO 3CEIA 1Q43A 2AW9A 2XAJA 4XBFA 1JVMA 3B77A 5KHHA 4EFEA 2UUAO 1KKCA 5BMVB 1NR1A 2QM7A 3OFNG 2OT5A 5A9GA 5IY5B 4O4LA 2Q73A 3K04A 5DECA 4DW1A 1IVSA 1M4UA 4LF4O 1DF5A 5EYPB 4NTXA 2HHHB 2F66C 4O2BB 4U3JB 2JIZG 1HWYA 1YCIA 3L75H 3M7MX 4JI3O 5LP6C 4JAVA 4DR1B 1SS3A 3RW0A 2A0LA 4B3RB 4LCUC 1SETA 2UUAB 1ZTEA 2FYUH 3T1HO 1BMFG 2G38A 2CTQA 2YEVA 3RVYA 2BTQB 3W7XA 4MT8A 2DWDC 4H0LB 1XNRO 4LF8O 3IC7A 2QWOB 3ABKB 1N34O 1GTOA 3A8TA 1HNXO 2W0XA 3ZN1A 4I9QA 4DR7O 2E75B 4CBCA 4U3FH 4XDKA 1TVKA 3JD2A 2GBOA 3FD9A 2F4VB 2YXLA 4OXSA 2UXBB 2PY5A 1QR9A 4ZOLA 2WLKA 2CDYA 3G80A 5IJ9A 5AG2A 2WLNA 1IBMO 3IGAC 2QSAA 4JZGA 2WLHA 1K5SA 5H6QA 2KG7A 4EKWA 3E2EA 4F6EA 2HEPA 1F51A 3UT5A 1NI8A 1FD9A 4JI0B 2OCHA 3ZX6A 4R7CA 4B3SO 2VQEB 4UCTA 3CCUV 1GM9A 4F4LA 5KHKA 4DR5O 3VOUA 2YXHA 3BCCH 1BGYH 1FXKC 4O4IA 2XT9A 1BS3A 4DV6B 4DV4B 3E35A 1VIBA 1QU7A 5LGUA 2X7RB 2B5UA 4ZKIA 4WF9V 3OT7A 1Y66A 3WG7B 5GONA 3T2MA 2YIDA 1JA8A 1CPYA 5DM6V 1Y74B 1FXVA 2A3QA 1HDJA 3H1JH 2XAQA 3CCMV 4J41A 2VWJA 1GRJA 3S3XA 4LP8A 1JFFB 3WU2Z 5KUKA 5DN6G 1SKVA 2ZE6A 1HR0O 1FJGB 3AG4B 5J2TA 1HNZO 1Y4MA 2QKAA 1I94O 4ICGA 1XREA 4EFBA 1QQCA 4OX9O 1SERA 4LF5B 4GX0A 1QCEA 4LFBO 3P3NA 2GTAA 4X62O 3LNMB 4QNHB 2HVKC 4TV8A 4IIJA 2EBOA 1N33B 2JS3A 1GH6A 3ASOB 4TWKA 5IWAB 2WLLA 2OYQA 1AJQA 1RM1C 3K58A 2F23A 5IDJA 3TXQA 4IL6Z 1N0NA 1XI1A 4LWSA 3CMAV 2XOKG 1UFIA 3JATA 2JK5C 1YJ9V 3B09A 4UCSA 1SQPH 4L8JA 2QWNB 4JI5O 3SYOA 1UJWB 1S77D 1NR7A 3DC5A 4P30A 1Q90D 4DXWA 5HFMA 4DV1B 3BVOA 5C93A 3BY6A 5LGNA 3L72H 1GAXA 1I94B 3X2QC 4GKKB 3FAVA 2EINB 4QGPA 3GB7C 1BZKA 2WLIA 1JJOA 3CWBH 2DQ0A 5B1AB 2DMXA 4QIWF 2H3OA 3JCZA 3K9AA 3H1IH 4FM1A 4YJ3A 2C2AA 1WLEA 4CS4A 1XL4A 2P6JA 1MOFA 1JJ2U 3ASNC 1GM7A 1ZUQA 4Q6GA 1Q6UA 5B3SC 2Q4PA 1AILA 4XDJA 2WA4A 3ETGA 3FYIB 2XTAA 3TETA 4JI2O 3RGBA 4O4HB 2IW5A 1XHZA 2W0FC 3ICXA 5LL6Y 1M1KW 1AJNA 1F7YA 1RM1B 5J2UA 1KUQA 1NTKH 3OUFA 4I50B 4BIZA 1PL0A 2WSSG 4B3RO 5LMNB 1M90W 4TQDA 3FFQA 4DV2B 2E5LO 4AI8A 1H8EG 5IJ9B 4LFCB 2ZNJA 4C7UA 5IJ0A 4LF4B 1XOUA 3JD0A 3ML0A 2DN9A 5LGTA 4FLTA 5B1BC 1GMGA 1SF9A 4PA9A 5IYBO 2HKOA 4JI7B 2YUAA 4YIOA 4HZ3A 1I5YA 4RQEA 1L8DA 4JI1B 1YVWA 2XHBA 1WP8A 3MHSC 1I7FA 1PPJH 2QR4A 3SR2C 4K0KO 1B04A 2E76B 4RUFA 1BQ0A 1EN5A 2XAHA 3CRRA 4U7OA 4NKGB 4FFBA 3OM3B 5LHGA 3CXCU 3G67A 4GX1A 5KHIA 4GT1A 2KQXA 3UKMA 4BW9A 4OPAA 4LF9O 1TA8A 3F7YC 2JEUA 1AR5A 1Q8IA 1RFYA 2FTKA 4LFAB 5JJNB 5EC2C 3OMNB 2QKCA 1VF5B 3ZMUA 2ZCEA 2ATKC 1PP9H 1R6NA 2CGOA 5LMUO 3SPJA 4NTYA 4NB5A 4EB6B 1YTFD 4DV6O 2UUBB 1TVKB 4MSWC 2UUCB 4X88A 1Q5OA 4JYAO 4KFMA 4Q20A 4I5SA 3APQA 3IFXA 3ZRWB 3M8AA 2HVJC 2ITCC 4D6TH 1XDCA 3SYPA 1EN4A 4P9OA 4FLZA 1JMKC 4LNUB 4DV3B 1XMQB 1I5XA 1KMIZ 4TQFA 3RN4A 2UXDO 4IHJB 1K73W 4CH4A 3UT5B 2HG5C 4FLWA 4MTFA 4DR4B 4LF5O 3VQVA 3AG3C 1VF6C 1VQ6V 5FNVB 1MZFA 2B1IA 4FVMA 3FAVB 1U97A 3ABUA 4IYIA 3RYHA 4DR7B 4RQFA 1X4TA 1W0JG 1PNKA 4DUYO 4GKKO 5B5EZ 4CC5A 4BIOA 4G27B 2CGNA 4DV1O 2ZIOA 3W7SA 2ETNA 4IT5A 1WNSA 5EIBD 2UXCO 1DGSA 1DK1A 2CE4A 3ZRWA 4KUMA 1YI2V 1QLNA 2QTOA 4I7ZB 2QEXV 2V4DA 4DUYB 4P2ZA 4UCRA 5B3SB 4JPRA 4JI0O 2RN9A 3ASNB 2ZKOA 3OE7G 5LOVA 2UUBO 4X65B 3JYCA 5ITZA 1SQGA 3N2GA 1F4MA 1KD1W 4J7JA 4X1YB 1D5NA 2Q6AA 3ZMTA 2VQFB 5FLXN 2EULA 4PDRA 1JQ0A 5B1OA 2Y69B 4J7KA 1VQMV 2EINC 2JVDA 4FMTA 2UXBO 2K1EA 4NXNB 3B2EE 2Q68A 5H2FZ 3CP1A 1MA1A 5IYDO 3JSNA 1IZ3A 3EXAA 3L71H 5EZYA 2JRIA 5K1PA 1YTFB 1RSOB 2NR5A 2YIAA 4GX5A 4DO2A 2NLJC 3D36C 2UXDB 3CRQA 3AG2C 1XMOO 4NXMO 4U3JA 3SPIA 3C3TA 3L73H 2CAZC 2QWPB 2R9IA 1SZTA 2WA3A 2UXCB 3B4SA 2F43G 5IYZB 1XILA 4CH6A 3OTFA 1VQKV 4UUJC 3ZRSA 3E86A 1PD3A 4JAUA 1S0VA 2OIGA 2LO1A 1YHQV 5FPOA 1M57C 3LNNA 4ZI7A 3JSLA 4MVRA 4JTCB 5JWPA 2DWEC 4FLVA 2DYSB 4O2AA 4L87A 4WBNA 1NJIW 2YDEA 3SPCA 3W7TA 4OX9B 5LMNO 1IBKB 1B3QA 3A0BZ 3QTCA 4B3MO 2BTOA 1LNQA 4LR3A 1OCOB 1K3EA 2QM8A 5H5NA 4K3AA 1B6QA 3G6BA 5KHJA 4X1KA 1G8MA 1K34A 1P49A 3QG5A 4U7NA 4WFBV 3A2FA 2ZE8A 2ILMA 3K0GA 1IXBA 3B8MA 5BZBA 4TT3G 3WG7C 5EBWC 2Q7HA 3CCRV 1Q81W 1YXBA 1DTOA 3IJ4A 2ZE5A 3MHHC 3RYFA 1V54C 4O2BA 1BHAA 1JOYA 1FXKB 3HB3B 3R65A 1SC5B 4FZ0A 4WFEA 1WPBA 4JI5B 2D3OW 1FAFA 4DK1A 4E2LA 1ZLZA 2P7TC 1MZEA 2A06H 1R1BA 2E3CA 1BCCH 4OPHA 1S5JA 3F5WC 4I50A 4J80A 3STZC 3H01A 3SYCA 2EIKB 1S3JA 3GVMA 5CN0A 1XBLA 2M6YA 2Z0AA 3ZEDA 2Y48A 2HHHO 3BFRA 2HJDA 4JYAB 2Q7GA 5CBHA 5IYCO 1ENVA 4YXWG 3CRAA 3KKYA 1TGOA 2ZD9A 3S3WA 1IURA 2UXXA 5C8YB 5LHIA 1SQXH 3ABKC 3K79A 3BRCA 1ZWIC 4X1YA 1OV9A 2NN4A 3BA9A 2ZE7A 1SQBH 4DUZB 1AI4A 3AG1C 4PI0A 3ETEA 1HNXB 1COWG 5KAFZ 4P9PA 2KKWA 3ZMZA 3ZS8C 1AI7A 2IU3A 2PI5A 3D3IA 3WB0A 3ETQA 1ZL8A 1R73A 1DF4A 4JI4O 4F6RB 3K9SA 2ZDIA 2GTSA 1R3LC 3CB2A 4PI2A 1VARA 4FZ1A 2EIJB 3ZHUA 5LP6B 3EFFK 4DR2O 5GONB 4KP4A 3OR7C 2Y0IA 1AR1B 1SA0A 3I55V 1Y76B 1IBKO 2GDSA 2WLLB 5GTHZ 5KAIZ 3FB5C 3O65A 4J42A 2X6CA 3UO3A 4Z1MG 1OCRC 3DXRB 3FB7C 5CB4B 5CBFA 1K33A 3K0DA 4MW8A 1VQ4V 1Y67A 2VRZA 4Z2WA 2IBZH 4MTXA 1DLBA 2JGDA 2PYLA 4X1IA 3GWKC 3RYCA 4X20A 3W7UA 1G1XB 3ZMSA 4WFGA 3E8GA 2RNBA 3QNEA 4ZOLB 3ABLC 4DYLA 3ZHQA 1R3JC 3VQYA 4X1IB 1WJZA 3RFRA 1GK9A 2P5OA 1K5QA 2ADQB 4LF7B 3CXHF 1IDSA 4TV9B 3JATB 2X0LA 3KCXA 1YF2A 1WAZA 3U0ZA 3ZRVA 5LXTA 3MDSA 4NVPA 4K8XA 3ABTA 3BEHA 1N0JA 5JCOA 4WCEV 4DR5B 4ABMA 2Q0OC 1RPRA 3MAQA 1QVFU 4JV5O 3CC2V 1Y76A 1IX9A 1OCZB 3TK1A 1WPXA 4IYHA 3HKCA 4O2AB 1EZVH 1N32B 5FPRA 5EIBC 5H6RA 1D5AA 4J9ZB 1QHTA 3CYOA 4QJFB 4X62B 2M7WA 2R9RB 3CC4V 2YICA 3JARB 4JI3B 2L6LA 1TUEB 4X20B 3D8CA 3B40A 1WP7A 1VMGA 4MVSA 4QE9A 3K5OA 3UCSC 1HR0B 2JEXA 1IBMB 4LBEC 3SGIA 4NTWA 3K5NA 2NNUA 2B1GA 1N36B 2B9ZA 3NR7A 2Q7EA 2EIJC 3DXRA 4HNAB 5CB4A 3FB8C 1S72V 2P06A 1NZ6A 1NTZH 4WFFA 4ZBMA 1H38A 5L3FA 3KCYA 1VP7A 4X8AA 5JH7A 3HKBA 3BPZA 4TSFG 5JQGB 1EFRG 5LXTB 4JI6O 4CH5A 3CJHB 4B08A 2K9PA 4UFZA 1M5IA 1AI6A 1V55C 2DYRB 3ZCCA 5KMGB 3A0RA 1QR8A 1K8AW 3RYCB 3STLC 4AILC 3CMEV 5J9PC 5B66Z 1WN7A 3HKDB 5BR8O 1M56C 3N2KA 2ZM6O 1Y6XA 2Q5ZA 5K1XA 1N4CA 2EIMC 4DV4O 2CH7B 1M9NA 2X6BA 3DGEA 1FYJA 4RO2A 5BMVA 2XNDG 1K4DC 1P4RA 1SZXA 1TAEA 2ZXWB 2AHYA 1BL8A 3OEHG 3DC6A 2JGUA 1F23A 2ZXWC 2IJHA 3EVKA 4DV7O 2RCVA 4N23A 2F93B 2OCCC 1P7BA 3EHBB 4X64B 4BWAA 2V7QG 4YJ2B 1K7DA 1LUVA 4UVBA 5LA6B 5IT9N 1PKXA 1VQ8V 1MSDA 1RP3B 1SRYA 2EZOA 2GHYA 1QVGU 1PM9A 3SJCC 4H37A 4DV7B 2LGWA 1V54B 1MNGA 4JI1O 3SPHA 3ETDA 3L70H 5LP6A 3JCUZ 1N34B 4B7KA 3HKEA 4YHHB 5KMGA 3T1YB 2JJ2G 5KA6A 1AP5A 4QPKA 1D2DA 4UCOA 2Q0AA 2QWRB 4B3TO 2WLMA 4DV0O 1ORQC 4CS2A 5EBMC 2IJJA 3CX5F 3H9VA 1H2MA 5EK0A 3HKDA 3LDEA 1XEQA 2AXTZ 4FLYA 2LGQA 1YIJV 2Q8VA 3ABMB 5B1NA 4DR3B 4CS3A 4AQYO 4FJCC 4HNAA 3T1CA 1P84F 1HW7A 4GZRB 3VQWA 3L9DA 3LUTB 3FYEB 2YSUB 1PV0A 1VQLV 4KHPO 3HKBB 3E8FA 2AZ0A 4Z1VA 4X1KB 1HP8A 2KG7B 3F7VC 5E1AC 4GYCB 2GV9A 4KL1A 4MVQA 5L3BA 1JFFA 3ZJZA 1Q7YW 1XNQO 2HR3A 2EILC 1NVPD 1G4YB 3FKSG 3OGCC 4GUNA 2DE0X 1BT8A 2PF4E 4UV8A 1EBOA 2LP7A 4CC6A 2PI4A 2F4VO 4PV1B 1IXMA 1QLEB 4MTOA 4LF7O 4JI8B 4J11A 2ODMA 2PTMA 4LC1A 4LWSB 4MS2A 4O4JA 2ARHA 4QE7A 1JCHA 2IU0A 3TGUH 1Q86W 1R6KA 2ADPA 3K57A 1H2KA 5CA3A 2A7WA 3PJSK 1KB9F 3CS5A 4YY3B 3LSUA 2PUSA 3E22B 1G6UA 3QO5A 2FKXA 1N32O 4BR6A 4H44B 1SA0B 1UPGA 3JASA 4XDLA 1NKDA 4LFCO 4FK5C 4UCUA 1MSWD 3SJAC 3A0HZ 3G4SV 3KZIZ 4B3SB 4BIUA 3ZHSA 1I08A 2RMKB 4FPPA 2QM4A 1R3IC 1Q6HA 4FLUA 2BE3A 4DV5B 2DJVA 4LFAO 4TV9A 1S76D 1ZL8B 3U11A 1US6A 1TUBA 1O9GA 3HKEB 1X59A 5LMUB 5A2QN 5KX5B 2Y4UA 3GWOA 2YIBD 4JYBA 1CEZA 3CRMA 4QPJA 5JH7B 1M93A 1GN3A 3BA8A 4IGGA 3ZIAG 5KA5A 1SQFA 3MD0A 5CA1A 4YJ2A 4G2KA 2A79B 4CH3A 1PNLA 1LUWA 4O4JB 3H1LH 2BSKA 2UXNA 1FS0G 2YIBA 3T4DA 3U10A 3AG3B 2Z3YA 3AG7A 4G28B 2CUGA 2GSMB 2VS0A 2IH3C 4RUEA 3JAMN 5L3CA 3AG1B 2LW1A 2QTSA 3T4ZA 5CMUA 1H2SB 1W59A 4DRXB 4AQYB 4MVOA 2ZINA 4PA4A 1PNMA 4A5UB 2HJFC 4JYYA 4BAYA 3ZHVA 4YY3O 3HKCB 3RYFB 1W2BU 4O4HA 2HP8A 5JJEB 5LBQA 2LW7A 4O4IB 5JJJB 4PA7A 2ZR3A 5H9CA 3OEEG 3JALA 1J5EO 2H8PC 3CSXA 4WFHA 1OCCC 2OIEA 4TV8B 3NXSA 1GM8A 3JD1A 3ZHRA 2DW4A 4D7SA 4YHHO 4I0XA 2ZIMA 2QDOA 2VQFO 2PYJA 1XNRB 3OTOB 3CCLV 2EX3A 1GN2A 5FNVA 2ZT9B 1BQZA 4X65O 1FKAO 4DW0A 3E83A 1TUBB 2YI9A 3C3SA 4DR6O 4HYOA 1P7GA 4FM0A 1GN6A 4DV5O 5GW7A 1VQ9V 2UU9B 2OTJV 3JAWB 1FXHA 1VQOV 4I4TA 1FXKA 1YJWV 4PA3A 3SDLA 1XNQB 3N2GB 1Z5WA 3K3WA 4CZZA 3AEIA 3G6EV 3K5LA 3E89A 2W6IG 3CRCA 3K08A 3RT3C 1XQ8A 4B7EA 5LHHA 2A9HA 4KHPB 4D7TA 1QNMA 2DYSC 2CTPA 4B3TB 1SQQH 3VQXA 2F1MA 3OGIB 3FB6C 3I56V 2EZPA 4IHJA 5L3DA 2V1DA 5B1BB 1EZJA 1BSMA 2VQEO 1VQ5V 4RAIA 2CTRA 3SJBC 3N27A 4E4EA 3O9OA 4EB6A 1ZAUA 3PN1A 4UVAA 1Z5VA 2YC0A 3AK2A 4DV0B 4JASA 1KP3A 1JR9A 3G71V 1GN4A 2R72A 1R3KC 3IC9A 1JX9A 1Z2GA 4LFBB 3OTOO 3CCVV 1OCCB 2YS8A 2QKSA 3LDCA 4O4LB 2WPDG 1EM1A 1NT2B 3JARA 1U96A 1KKDA 1URFA 1K92A 1KU9A 4DRXA 3CCJV
chains in the Genus database with same CATH topology
1OHHG 4X8AA 2Q69A 4MVMA 3ABUA 2Z5UA 4TSFG 4RQFA 1EFRG 1MABG 3KG2A 2MK3A 4GX2A 2XAJA 4R8CA 1AI6A 1V55C 2DYRB 4XBFA 3ZCCA 1JVMA 3B77A 1W0JG 1PNKA 3A0RA 4PDLA 2EIMB 1QR8A 2IJKA 1NR1A 1K8AW 2QM7A 2CK3G 3OFNG 3STLC 2OT5A 3CMEV 3RBZA 4G27B 5IY5B 5J9PC 1M56C 3W7SA 3K04A 4H33A 1RPOA 3CCQV 1DF5A 2W6JG 2EIMC 4MTGA 3UM7A 1M9NA 2AHZA 2X6BA 3DGEA 4RO2A 2JIZG 4N21A 1HWYA 2XNDG 3ZRWA 1K4DC 4KUMA 1P4RA 1MG1A 1YI2V 4JAVA 1QLNA 2QTOA 2ZXWB 5L3GA 2AHYA 3RW0A 2A0LA 2QEXV 4LCUC 4JF3A 3M99B 1SETA 1BL8A 4P2ZA 1QBZA 2QA4V 3OEHG 3LSSA 3E8BA 5B3SB 4JPRA 1BMFG 3ASNB 1F23A 2ZXWC 2IJHA 3OE7G 5CBGA 3JYCA 3CPWU 1VQ7V 4N23A 2YEVA 2OCCC 3RVYA 1P7BA 1F4MA 1S5HC 3EHBB 1KD1W 1VQPV 3W7XA 2V7QG 1YSCA 2DWDC 4MT8A 2Q6AA 1K7DA 3ZMTA 4UVBA 1YITV 1FFTB 3IC7A 4PDRA 1JQ0A 3ABKB 1GTOA 5B1OA 2WWWA 1PKXA 3W7WA 1VQ8V 2Y69B 1VQMV 1SRYA 2EINC 3ZN1A 4FMTA 2EZOA 2GHYA 2K1EA 1QVGU 4WFAV 2OTLV 2Q68A 4CBCA 4XDKA 4H37A 3JD2A 3CP1A 4I9WA 5IYDO 1V54B 4OXSA 3DTUB 2YEVB 3ETDA 1QR9A 3SPHA 2WLKA 3QO8A 3SPGA 2BOCC 1AJPA 2WLNA 3IGAC 2JJ2G 1YTFB 5KA6A 3OUSA 4QPKA 1OCZC 2WLHA 4GX5A 2WLIB 2WLMA 1K5SA 4DO2A 5H6QA 1ROPA 2NLJC 1ORQC 3CC7V 4HAMA 4EKWA 3E2EA 3QO7A 3AG2C 5EBMC 2IJJA 2JJ1G 5EK0A 3SPIA 1F51A 1THZA 3LDEA 1YIJV 2R9IA 1SZTA 1YJNV 3ABMB 5B1NA 2ZR2A 4FJCC 4R7CA 4PA6A 3T1CA 2F43G 3OMIB 3CCUV 1GM9A 2HFEC 4F4LA 1VQKV 3LUTB 4UUJC 3FYEB 3VOUA 3ZRSA 1KC8W 2YSUB 1PD3A 3E86A 1NQTA 4J9YB 1VQLV 4JAUA 1XL6A 1S0VA 4R50A 1FXKC 3E8FA 1YHQV 1M57C 3F7VC 5E1AC 3E35A 5LGUA 4MVRA 4JTCB 4MVQA 5L3BA 2X7RB 2B5UA 3RVZA 4ZKIA 2DWEC 4WF9V 2DYSB 4L87A 3ZJZA 1NJIW 1Y66A 3SPCA 3W7TA 1Q7YW 1QLEC 3WG7B 1CP9A 1AI5A 2HR3A 3T2MA 2EILC 1LNQA 1CPYA 1OCOB 1K3EA 2QM8A 1B6QA 1NVPD 1G4YB 5DM6V 1FXVA 3FKSG 1G8MA 1K34A 3OGCC 3CCEV 4U7NA 4WFBV 1KP2A 4R6ZA 4UV8A 1EBOA 2LP7A 2PI4A 2XAQA 2P90A 3CCMV 3K0GA 3B8MA 2EILB 5BZBA 1IXMA 4LP8A 5KUKA 4TT3G 1QLEB 4MTOA 5EBWC 3WG7C 5DN6G 3AG4B 4LC1A 3CCRV 1Q81W 1DTOA 1Y4MA 3MHHC 2P67A 1V54C 4MS2A 4QE7A 1BHAA 1JCHA 2IU0A 1JOYA 3OR6C 1FXKB 3HB3B 1Q86W 1R6KA 1SERA 3R65A 2BOBC 4GX0A 1QCEA 3LDDA 1OCRB 2JDIG 4WFEA 5CA3A 2D3OW 2DQ3A 3LNMB 4QNHB 3PJSK 4E2LA 1OZ0A 2P7TC 2HVKC 1NVPB 2EBOA 3QO5A 3ABMC 3ASOB 4TWKA 2WLLA 4XDLA 1NKDA 1AJQA 1RM1C 4FK5C 3F5WC 5IDJA 1MSWD 3G4SV 3STZC 4BIUA 3H01A 2IH1C 1K4CC 4FPPA 2EIKB 3SYCA 1R3IC 1S3JA 5CN0A 4PELA 3CMAV 2XOKG 1KQSU 2JK5C 1YJ9V 2WLJA 3OMAB 2Y48A 1S76D 3SYOA 1UJWB 3HPLC 5CBHA 1NR7A 5IYCO 1ENVA 4UVCA 1S77D 4YXWG 4P30A 4DXWA 5HFMA 3E8HA 5C93A 3BY6A 4UV9A 5LGNA 1N8RW 4UXNA 2ZD9A 3X2QC 3SYAA 2Q67A 2ZDIC 2EINB 3GB7C 1GKFA 2UXXA 2WLIA 3GWOA 5LHIA 2DQ0A 5B1AB 3ABKC 4JYBA 3K79A 1KECA 5IY5C 4QIWF 1CEZA 1ZWIC 4QPJA 1GO3F 3JCZA 2ITDC 3K9AA 1K9MW 3SYQA 1AI4A 2LFSA 3AG1C 5L3EA 3ETEA 1COWG 2C2AA 2OCCB 4P9PA 3ZMZA 1WLEA 3ZIAG 5KA5A 1XL4A 1AI7A 2P6JA 1MOFA 2IU3A 3MD0A 3D3IA 1JJ2U 2PI5A 1NBMG 3OW2U 4MVZA 1R73A 3ASNC 1GM7A 1DF4A 2A79B 4G2KA 2ZDIA 5B3SC 1PNLA 2UXNA 1R3LC 1FS0G 4XDJA 3T4DA 2EIKC 2EIJB 3ETGA 3FYIB 3AG3B 2Z3YA 3TETA 4G28B 3EFFK 2GSMB 2IW5A 2IH3C 2W0FC 1W0KG 4GCZA 4KP4A 4RUEA 5L3CA 2X6AA 5FL7G 1AJNA 1M1KW 1RM1B 3AG1B 3OR7C 3T4ZA 3OUFA 4JTAB 4BIZA 1PL0A 2WSSG 5CMUA 1AR1B 3I55V 3K03A 2WLLB 1M90W 1M56B 4MVOA 5B1AC 4PA4A 1PNMA 2HJFC 3FB5C 3ZMVA 1H8EG 4BAYA 2X6CA 4Z1MG 1OCRC 2HLDG 3X2QB 2KB1A 3FB7C 5CBFA 1V55B 2DYRC 1K33A 3JD0A 3ML0A 5LGTA 5EBLC 1GMGA 4PA9A 5B1BC 5IYBO 2HKOA 3K0DA 4MW8A 1W2BU 1VQ4V 1L1FA 1VQNV 4HZ3A 1I5YA 5LBQA 4RQEA 3LSQA 4MTXA 1JPXA 2ZQMA 4PA7A 2ZR3A 4JGSA 5H9CA 3OEEG 3K06A 3MHSC 1DLBA 1E1QG 2H8PC 3ZN0A 3OAAG 4WFHA 4FIPC 1OCCC 4PDMA 1OCOC 4RUFA 3W7UA 2EJRA 3ZMSA 4WFGA 2H94A 3E8GA 2XAHA 3QNEA 3ASOC 4U7OA 1BHBA 3ABLC 1GM8A 3JD1A 3NXSA 2DW4A 1R3JC 3OM3B 1NH2B 5LHGA 3CXCU 3CCSV 4GX1A 3VBBA 1K97A 3CCLV 1GK9A 1M57B 1K5QA 1E79G 4GT1A 3UKMA 2LFRA 2X0LA 3E83A 1E1RG 3P32A 2WAMA 2XASA 3F7YC 2JEUA 4HYOA 2FTKA 1J95A 5GW7A 3ZRVA 1VQ9V 3AG4C 4MVUA 5EC2C 4BW5A 1FXHA 3OMNB 2OTJV 1VQOV 3ABTA 3ZMUA 3BEHA 1H8HG 1FXKA 1H2GA 4WCEV 1YJWV 4PA3A 3TCUA 2ATKC 4MW3A 1R6NA 1RPRA 3AG2B 3K3WA 4CZZA 3SPJA 3AEIA 3G6EV 1QVFU 2XAFA 3CC2V 3E89A 1OCZB 1WPXA 3TK1A 1YTFD 2W6IG 3K08A 3JD4A 4MSWC 4X88A 2IJIA 5LHHA 2A9HA 5H6RA 4J9ZB 4KFMA 3JD3A 4Q20A 4I5SA 3CYOA 3IFXA 2DYSC 3ZRWB 4QJFB 5KUMA 2HVJC 2ITCC 2M7WA 2R9RB 3I56V 3FB6C 2EZPA 1F4NA 5L3DA 2V1DA 3SYPA 5B1BB 3CC4V 1EZJA 4X89A 2XAGA 5EC1C 1VQ5V 4RAIA 4P9OA 1TUEB 1Q82W 1SESA 4JTDB 4MVSA 1AROP 3D36A 4QE9A 2Y69C 4UVAA 1I5XA 3ZRXA 2JEXA 5HFLA 4JASA 1KP3A 4ASUG 3ABLB 3G71V 1K73W 3P30A 1R3KC 1NH2D 2HG5C 1JX9A 4PDVA 4MTFA 4LBEC 3CCVV 1OCCB 2NNUA 2B1GA 2QKSA 3AG3C 1VQ6V 3LDCA 2EIJC 3B8NA 2WPDG 1S72V 3FB8C 4JYCA 1KKDA 3SJQC 3CD6V 4WFFA 1K92A 4ZBMA 3WFVA 1H38A 2B1IA 2QE7G 5L3FA 3CCJV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORQ C;  1OCC C;  4EKW A;  4X8A A;  4PDM A;  2Q69 A;  3AG2 C;  4MVM A;  5EBM C;  5EK0 A;  1OCO C;  4RUF A;  3SPI A;  3LDE A;  3E8G A;  4WFG A;  3SYO A;  3HPL C;  5CBH A;  3KG2 A;  3ASO C;  3ABL C;  4GX2 A;  4P30 A;  4DXW A;  4R8C A;  3E8H A;  4PA6 A;  1R3J C;  4R7C A;  3T1C A;  1V55 C;  1JVM A;  4PDL A;  2HFE C;  4GX1 A;  2ZD9 A;  3X2Q C;  3SYA A;  4F4L A;  2Q67 A;  3LUT B;  3GB7 C;  4UUJ C;  3STL C;  3VOU A;  3ZRS A;  2WLI A;  3E86 A;  4J9Y B;  3RBZ A;  4G27 B;  5J9P C;  1XL6 A;  1M56 C;  3ABK C;  4R50 A;  3UKM A;  3K04 A;  5IY5 C;  3E8F A;  4H33 A;  1ZWI C;  3E83 A;  1M57 C;  3F7Y C;  3F7V C;  2ITD C;  2EIM C;  4HYO A;  4MTG A;  5E1A C;  4MVR A;  3UM7 A;  4JTC B;  4MVQ A;  3SYQ A;  1J95 A;  3AG1 C;  3RVZ A;  2AHZ A;  2DWE C;  2X6B A;  3ZJZ A;  3AG4 C;  4P9P A;  4RO2 A;  4MVU A;  5EC2 C;  4BW5 A;  3SPC A;  1XL4 A;  1QLE C;  1K4D C;  3BEH A;  3T2M A;  2QTO A;  2EIL C;  2AHY A;  1LNQ A;  2A0L A;  4MVZ A;  3ASN C;  4LCU C;  2ATK C;  4PA3 A;  2A79 B;  3RW0 A;  4MW3 A;  3TCU A;  1G4Y B;  1BL8 A;  4P2Z A;  3SPJ A;  5B3S C;  3E8B A;  3OGC C;  4WFH A;  3E89 A;  4R6Z A;  1R3L C;  4XDJ A;  3T4D A;  3K08 A;  3K0G A;  5BZB A;  2ZXW C;  2EIK C;  4MSW C;  4X88 A;  5CBG A;  3JYC A;  2A9H A;  4LP8 A;  3TET A;  4G28 B;  3EFF K;  4MTO A;  3WG7 C;  4J9Z B;  4KFM A;  2IH3 C;  5EBW C;  5KUK A;  2W0F C;  4RUE A;  2YEV A;  2DYS C;  2OCC C;  3IFX A;  1P7B A;  1S5H C;  2X6A A;  5KUM A;  2HVJ C;  2ITC C;  3RVY A;  3OR7 C;  2R9R B;  3T4Z A;  3OUF A;  3FB6 C;  4JTA B;  2DWD C;  3SYP A;  2Q6A A;  1V54 C;  4MS2 A;  3K03 A;  4QE7 A;  4X89 A;  4PDR A;  5EC1 C;  3OR6 C;  4RAI A;  4P9O A;  2WLL B;  3R65 A;  4MVO A;  2BOB C;  4PA4 A;  5B1A C;  4GX0 A;  2HJF C;  3FB5 C;  3LDD A;  4JTD B;  2EIN C;  4WFE A;  4MVS A;  2X6C A;  1OCR C;  2K1E A;  4QE9 A;  2Y69 C;  3LNM B;  4QNH B;  3PJS K;  2KB1 A;  2P7T C;  2HVK C;  2Q68 A;  3FB7 C;  5CBF A;  4CBC A;  2DYR C;  4XDK A;  4H37 A;  4I9W A;  5EBL C;  3ABM C;  4PA9 A;  5B1B C;  3K0D A;  4OXS A;  4TWK A;  2WLL A;  4XDL A;  1R3K C;  4MW8 A;  3SPH A;  2HG5 C;  4PDV A;  4MTF A;  4LBE C;  2WLK A;  3F5W C;  4HZ3 A;  3SPG A;  2BOC C;  2QKS A;  3STZ C;  2WLN A;  3AG3 C;  3IGA C;  2IH1 C;  3LDC A;  1K4C C;  2EIJ C;  4PA7 A;  3SYC A;  1R3I C;  3FB8 C;  3K06 A;  1KKD A;  3OUS A;  1OCZ C;  2WLH A;  4WFF A;  4ZBM A;  3SJQ C;  2JK5 C;  4GX5 A;  2H8P C;  2WLI B;  2WLM A;  2WLJ A;  2NLJ C; 
#chains in the Genus database with same CATH topology
 1OHH G;  4K0K B;  3J7A U;  2Z5U A;  3RYI A;  4NXN O;  4FFK A;  4X66 B;  1MAB G;  3I5D A;  3KG2 A;  2MK3 A;  4GX2 A;  4R8C A;  3TXS A;  4W4K A;  4PDL A;  1Q3E A;  5KLV H;  1NU1 H;  3QF7 A;  2FL4 A;  1A32 A;  2EIM B;  2IJK A;  2CK3 G;  1L0L H;  3RBZ A;  4KXR A;  1I0H A;  2N04 A;  4J10 A;  4H33 A;  5E79 Z;  1RPO A;  3CCQ V;  2EJ7 A;  5JQG A;  5IE9 A;  2W6J G;  3F5T A;  4MTG A;  3UM7 A;  4I55 A;  2Q9L A;  4DV3 O;  2AHZ A;  3R66 A;  2GUZ A;  4N21 A;  4OGQ B;  5D5P A;  1MG1 A;  5L3G A;  4JF3 A;  3M99 B;  3Q4H A;  1QBZ A;  2QA4 V;  3LSS A;  3E8B A;  4ZI7 B;  5KX5 A;  2YXY A;  1YZB A;  2N05 A;  3K59 A;  5CBG A;  1WB8 A;  3CPW U;  1VQ7 V;  4I4T B;  2MW2 B;  1S5H C;  2CH7 A;  1VQP V;  1YSC A;  3J80 N;  1YDX A;  1YIT V;  1FFT B;  2FB5 A;  2WWW A;  3D3Q A;  4FLX A;  3W7W A;  3C90 A;  1XHX A;  1WA8 A;  5ITZ B;  3FX7 A;  5JCO C;  4X64 O;  4WFA V;  4JZ2 A;  1ZX3 A;  2OTL V;  2BSK B;  4LF9 B;  3BHP A;  1ZSP A;  5J2U B;  1VF6 A;  4I9W A;  3DTU B;  2YEV B;  3JAK A;  3QO8 A;  3SPG A;  2BOC C;  1AJP A;  1VF7 A;  4LF8 B;  1Q6I A;  3OUS A;  1OCZ C;  2WLI B;  1ROP A;  3CC7 V;  4HAM A;  2PZS A;  3QO7 A;  2R9A A;  2JJ1 G;  2E74 B;  3J81 N;  1THZ A;  1YJN V;  4LH7 A;  4JAA A;  4DV2 O;  1XUQ A;  2E5L B;  4DK0 A;  2ZR2 A;  5BR8 B;  4PA6 A;  3OMI B;  1L0N H;  3T1H B;  1EN6 A;  3BAB A;  2HFE C;  5JVD B;  3H1H H;  2D2C B;  1KC8 W;  2KSD A;  4J9Y B;  1NQT A;  3ZBH A;  1XL6 A;  2QJ1 A;  2Y4T A;  1BE3 H;  4R50 A;  5LOV B;  4DR3 O;  4NYK A;  3K5M A;  1NS1 A;  4UB6 Z;  3CJH A;  3CE2 A;  4DR6 B;  1FFX A;  4UCV A;  3RVZ A;  4FFB B;  1OJH A;  1QLE C;  1CP9 A;  4W4L A;  4JI4 B;  1AI5 A;  2RQ6 A;  1AB3 A;  3AK3 A;  4H13 B;  3H1K H;  2UU9 O;  1NTM H;  1HNW O;  3CCE V;  1KP2 A;  4R6Z A;  4DR2 B;  2AGA A;  2P90 A;  4I55 B;  2EIL B;  4YIP A;  3ZHT A;  4LNU A;  2P67 A;  3JAK B;  2PGG A;  4F6R A;  3OR6 C;  2BOB C;  5KHG A;  3RYH B;  3LDD A;  1OCR B;  4DUZ O;  2JDI G;  2DQ3 A;  4GKJ O;  1Y74 A;  1OZ0 A;  1NVP B;  3HR0 A;  1V9P A;  3BAA A;  3ABM C;  5BY1 A;  4ZIB A;  2RJZ A;  5CA0 A;  5TIS Z;  3DSQ A;  4GLX A;  1IBL B;  3QVN A;  3APO A;  2IH1 C;  2VWK A;  1K4C C;  4K35 A;  3N2K B;  3UQ8 A;  4PEL A;  1KQS U;  2O57 A;  1B06 A;  5LA6 A;  2WLJ A;  3OMA B;  1O9H A;  4PJ0 Z;  2P4K A;  2P4V A;  2UUC O;  3HPL C;  2AZ2 A;  4UVC A;  2RDC A;  3T1Y O;  3E8H A;  5CA1 B;  3CHX A;  4UV9 A;  5EZY B;  1N8R W;  4UXN A;  4LH6 A;  1IBL O;  3SYA A;  4X9Q A;  2Q67 A;  2QGN A;  2ZDI C;  1GKF A;  4K8Z A;  1KEC A;  5IY5 C;  3JAL B;  4FM2 A;  4JI6 B;  1GO3 F;  4X66 O;  2ITD C;  5BXZ A;  1K9M W;  5LYJ A;  4GKJ B;  3SYQ A;  2Y0P A;  2LFS A;  5L3E A;  2OCC B;  1KBH A;  1NBM G;  3OW2 U;  4MVZ A;  2CTW A;  5JVD A;  4DR4 O;  1T5E A;  1FJG O;  4JI7 O;  4PHZ A;  2EIK C;  2GUZ B;  3P3P A;  1W0K G;  1R6T A;  4GCZ A;  1HNW B;  2X6A A;  5FL7 G;  4RWU A;  4JTA B;  3K03 A;  3Q4H B;  3UO2 A;  4B3M B;  3JAS B;  1M56 B;  5B1A C;  5DED A;  4ZHQ B;  2BCC H;  3ZMV A;  1FPO A;  4NR1 A;  2HLD G;  3X2Q B;  4LF6 B;  2KB1 A;  2N74 A;  3OD4 A;  1V55 B;  2DYR C;  3RYI B;  5EBL C;  1YEW A;  1AR4 A;  1L1F A;  1VQN V;  2DOS A;  4UB8 Z;  4JV5 B;  2L35 A;  5J2T B;  4HBN A;  3LSQ A;  1JPX A;  2ZQM A;  4JGS A;  3K06 A;  5IYZ A;  1E1Q G;  5IJ0 B;  1SQV H;  1S5L Z;  3OAA G;  3ZN0 A;  1N33 O;  4FIP C;  1LR1 A;  4PDM A;  4JI8 O;  4JI2 B;  1OCO C;  2EJR A;  2H94 A;  2F95 B;  3ASO C;  1BHB A;  1N36 O;  5EYP A;  5LYJ B;  1NH2 B;  1CXZ B;  3CCS V;  1RSO A;  4EEQ A;  3VBB A;  1K97 A;  3AK1 A;  2JS5 A;  1H2N A;  1M57 B;  1E79 G;  2LFR A;  2R70 A;  1E1R G;  3P32 A;  2WAM A;  2XAS A;  3TJT A;  3WB2 A;  1WB7 A;  2LQT A;  1J95 A;  5D5Q A;  5F2V O;  3AG4 C;  4MVU A;  4AHC A;  4BW5 A;  1J5E B;  4PD4 F;  1H8H G;  3L74 H;  1VEW A;  1H2G A;  1MMM A;  3TCU A;  4MW3 A;  4ZHQ A;  3AG2 B;  1WA8 B;  2XAF A;  2IM9 A;  5GTI Z;  4J7Z A;  3JD4 A;  3JAW A;  1FFX B;  2IJI A;  2ZM6 B;  3WB1 A;  3JD3 A;  4WBN B;  1XMO B;  2FML A;  4NXM B;  5CA0 B;  4LF6 O;  5KUM A;  4TUY A;  2QWQ B;  1F4N A;  4X89 A;  2XAG A;  4DR1 O;  5EC1 C;  2JGD B;  3IAY A;  1Q82 W;  1SES A;  3THO A;  4JTD B;  2ZNI A;  2LJ2 A;  1ARO P;  3D36 A;  5IWA O;  2Y69 C;  3ZRX A;  2YI8 A;  4TOI A;  2OWO A;  5HFL A;  4ASU G;  4TUY B;  1AP6 A;  2P22 C;  3ABL B;  3P30 A;  1NH2 D;  1H2L A;  4PDV A;  2BTQ A;  1AVM A;  2XUM A;  3B8N A;  4JYC A;  4I0X B;  4IIJ B;  3RWR D;  3SJQ C;  3CD6 V;  3WFV A;  5C8Y A;  2QE7 G;  1HNZ B;  1PL4 A;  3E22 A;  1KYO F;  2Q69 A;  4MVM A;  4YJ3 B;  1XMQ O;  3CEI A;  1Q43 A;  2AW9 A;  2XAJ A;  4XBF A;  1JVM A;  3B77 A;  5KHH A;  4EFE A;  2UUA O;  1KKC A;  5BMV B;  1NR1 A;  2QM7 A;  3OFN G;  2OT5 A;  5A9G A;  5IY5 B;  4O4L A;  2Q73 A;  3K04 A;  5DEC A;  4DW1 A;  1IVS A;  1M4U A;  4LF4 O;  1DF5 A;  5EYP B;  4NTX A;  2HHH B;  2F66 C;  4O2B B;  4U3J B;  2JIZ G;  1HWY A;  1YCI A;  3L75 H;  3M7M X;  4JI3 O;  5LP6 C;  4JAV A;  4DR1 B;  1SS3 A;  3RW0 A;  2A0L A;  4B3R B;  4LCU C;  1SET A;  2UUA B;  1ZTE A;  2FYU H;  3T1H O;  1BMF G;  2G38 A;  2CTQ A;  2YEV A;  3RVY A;  2BTQ B;  3W7X A;  4MT8 A;  2DWD C;  4H0L B;  1XNR O;  4LF8 O;  3IC7 A;  2QWO B;  3ABK B;  1N34 O;  1GTO A;  3A8T A;  1HNX O;  2W0X A;  3ZN1 A;  4I9Q A;  4DR7 O;  2E75 B;  4CBC A;  4U3F H;  4XDK A;  1TVK A;  3JD2 A;  2GBO A;  3FD9 A;  2F4V B;  2YXL A;  4OXS A;  2UXB B;  2PY5 A;  1QR9 A;  4ZOL A;  2WLK A;  2CDY A;  3G80 A;  5IJ9 A;  5AG2 A;  2WLN A;  1IBM O;  3IGA C;  2QSA A;  4JZG A;  2WLH A;  1K5S A;  5H6Q A;  2KG7 A;  4EKW A;  3E2E A;  4F6E A;  2HEP A;  1F51 A;  3UT5 A;  1NI8 A;  1FD9 A;  4JI0 B;  2OCH A;  3ZX6 A;  4R7C A;  4B3S O;  2VQE B;  4UCT A;  3CCU V;  1GM9 A;  4F4L A;  5KHK A;  4DR5 O;  3VOU A;  2YXH A;  3BCC H;  1BGY H;  1FXK C;  4O4I A;  2XT9 A;  1BS3 A;  4DV6 B;  4DV4 B;  3E35 A;  1VIB A;  1QU7 A;  5LGU A;  2X7R B;  2B5U A;  4ZKI A;  4WF9 V;  3OT7 A;  1Y66 A;  3WG7 B;  5GON A;  3T2M A;  2YID A;  1JA8 A;  1CPY A;  5DM6 V;  1Y74 B;  1FXV A;  2A3Q A;  1HDJ A;  3H1J H;  2XAQ A;  3CCM V;  4J41 A;  2VWJ A;  1GRJ A;  3S3X A;  4LP8 A;  1JFF B;  3WU2 Z;  5KUK A;  5DN6 G;  1SKV A;  2ZE6 A;  1HR0 O;  1FJG B;  3AG4 B;  5J2T A;  1HNZ O;  1Y4M A;  2QKA A;  1I94 O;  4ICG A;  1XRE A;  4EFB A;  1QQC A;  4OX9 O;  1SER A;  4LF5 B;  4GX0 A;  1QCE A;  4LFB O;  3P3N A;  2GTA A;  4X62 O;  3LNM B;  4QNH B;  2HVK C;  4TV8 A;  4IIJ A;  2EBO A;  1N33 B;  2JS3 A;  1GH6 A;  3ASO B;  4TWK A;  5IWA B;  2WLL A;  2OYQ A;  1AJQ A;  1RM1 C;  3K58 A;  2F23 A;  5IDJ A;  3TXQ A;  4IL6 Z;  1N0N A;  1XI1 A;  4LWS A;  3CMA V;  2XOK G;  1UFI A;  3JAT A;  2JK5 C;  1YJ9 V;  3B09 A;  4UCS A;  1SQP H;  4L8J A;  2QWN B;  4JI5 O;  3SYO A;  1UJW B;  1S77 D;  1NR7 A;  3DC5 A;  4P30 A;  1Q90 D;  4DXW A;  5HFM A;  4DV1 B;  3BVO A;  5C93 A;  3BY6 A;  5LGN A;  3L72 H;  1GAX A;  1I94 B;  3X2Q C;  4GKK B;  3FAV A;  2EIN B;  4QGP A;  3GB7 C;  1BZK A;  2WLI A;  1JJO A;  3CWB H;  2DQ0 A;  5B1A B;  2DMX A;  4QIW F;  2H3O A;  3JCZ A;  3K9A A;  3H1I H;  4FM1 A;  4YJ3 A;  2C2A A;  1WLE A;  4CS4 A;  1XL4 A;  2P6J A;  1MOF A;  1JJ2 U;  3ASN C;  1GM7 A;  1ZUQ A;  4Q6G A;  1Q6U A;  5B3S C;  2Q4P A;  1AIL A;  4XDJ A;  2WA4 A;  3ETG A;  3FYI B;  2XTA A;  3TET A;  4JI2 O;  3RGB A;  4O4H B;  2IW5 A;  1XHZ A;  2W0F C;  3ICX A;  5LL6 Y;  1M1K W;  1AJN A;  1F7Y A;  1RM1 B;  5J2U A;  1KUQ A;  1NTK H;  3OUF A;  4I50 B;  4BIZ A;  1PL0 A;  2WSS G;  4B3R O;  5LMN B;  1M90 W;  4TQD A;  3FFQ A;  4DV2 B;  2E5L O;  4AI8 A;  1H8E G;  5IJ9 B;  4LFC B;  2ZNJ A;  4C7U A;  5IJ0 A;  4LF4 B;  1XOU A;  3JD0 A;  3ML0 A;  2DN9 A;  5LGT A;  4FLT A;  5B1B C;  1GMG A;  1SF9 A;  4PA9 A;  5IYB O;  2HKO A;  4JI7 B;  2YUA A;  4YIO A;  4HZ3 A;  1I5Y A;  4RQE A;  1L8D A;  4JI1 B;  1YVW A;  2XHB A;  1WP8 A;  3MHS C;  1I7F A;  1PPJ H;  2QR4 A;  3SR2 C;  4K0K O;  1B04 A;  2E76 B;  4RUF A;  1BQ0 A;  1EN5 A;  2XAH A;  3CRR A;  4U7O A;  4NKG B;  4FFB A;  3OM3 B;  5LHG A;  3CXC U;  3G67 A;  4GX1 A;  5KHI A;  4GT1 A;  2KQX A;  3UKM A;  4BW9 A;  4OPA A;  4LF9 O;  1TA8 A;  3F7Y C;  2JEU A;  1AR5 A;  1Q8I A;  1RFY A;  2FTK A;  4LFA B;  5JJN B;  5EC2 C;  3OMN B;  2QKC A;  1VF5 B;  3ZMU A;  2ZCE A;  2ATK C;  1PP9 H;  1R6N A;  2CGO A;  5LMU O;  3SPJ A;  4NTY A;  4NB5 A;  4EB6 B;  1YTF D;  4DV6 O;  2UUB B;  1TVK B;  4MSW C;  2UUC B;  4X88 A;  1Q5O A;  4JYA O;  4KFM A;  4Q20 A;  4I5S A;  3APQ A;  3IFX A;  3ZRW B;  3M8A A;  2HVJ C;  2ITC C;  4D6T H;  1XDC A;  3SYP A;  1EN4 A;  4P9O A;  4FLZ A;  1JMK C;  4LNU B;  4DV3 B;  1XMQ B;  1I5X A;  1KMI Z;  4TQF A;  3RN4 A;  2UXD O;  4IHJ B;  1K73 W;  4CH4 A;  3UT5 B;  2HG5 C;  4FLW A;  4MTF A;  4DR4 B;  4LF5 O;  3VQV A;  3AG3 C;  1VF6 C;  1VQ6 V;  5FNV B;  1MZF A;  2B1I A;  4FVM A;  3FAV B;  1U97 A;  3ABU A;  4IYI A;  3RYH A;  4DR7 B;  4RQF A;  1X4T A;  1W0J G;  1PNK A;  4DUY O;  4GKK O;  5B5E Z;  4CC5 A;  4BIO A;  4G27 B;  2CGN A;  4DV1 O;  2ZIO A;  3W7S A;  2ETN A;  4IT5 A;  1WNS A;  5EIB D;  2UXC O;  1DGS A;  1DK1 A;  2CE4 A;  3ZRW A;  4KUM A;  1YI2 V;  1QLN A;  2QTO A;  4I7Z B;  2QEX V;  2V4D A;  4DUY B;  4P2Z A;  4UCR A;  5B3S B;  4JPR A;  4JI0 O;  2RN9 A;  3ASN B;  2ZKO A;  3OE7 G;  5LOV A;  2UUB O;  4X65 B;  3JYC A;  5ITZ A;  1SQG A;  3N2G A;  1F4M A;  1KD1 W;  4J7J A;  4X1Y B;  1D5N A;  2Q6A A;  3ZMT A;  2VQF B;  5FLX N;  2EUL A;  4PDR A;  1JQ0 A;  5B1O A;  2Y69 B;  4J7K A;  1VQM V;  2EIN C;  2JVD A;  4FMT A;  2UXB O;  2K1E A;  4NXN B;  3B2E E;  2Q68 A;  5H2F Z;  3CP1 A;  1MA1 A;  5IYD O;  3JSN A;  1IZ3 A;  3EXA A;  3L71 H;  5EZY A;  2JRI A;  5K1P A;  1YTF B;  1RSO B;  2NR5 A;  2YIA A;  4GX5 A;  4DO2 A;  2NLJ C;  3D36 C;  2UXD B;  3CRQ A;  3AG2 C;  1XMO O;  4NXM O;  4U3J A;  3SPI A;  3C3T A;  3L73 H;  2CAZ C;  2QWP B;  2R9I A;  1SZT A;  2WA3 A;  2UXC B;  3B4S A;  2F43 G;  5IYZ B;  1XIL A;  4CH6 A;  3OTF A;  1VQK V;  4UUJ C;  3ZRS A;  3E86 A;  1PD3 A;  4JAU A;  1S0V A;  2OIG A;  2LO1 A;  1YHQ V;  5FPO A;  1M57 C;  3LNN A;  4ZI7 A;  3JSL A;  4MVR A;  4JTC B;  5JWP A;  2DWE C;  4FLV A;  2DYS B;  4O2A A;  4L87 A;  4WBN A;  1NJI W;  2YDE A;  3SPC A;  3W7T A;  4OX9 B;  5LMN O;  1IBK B;  1B3Q A;  3A0B Z;  3QTC A;  4B3M O;  2BTO A;  1LNQ A;  4LR3 A;  1OCO B;  1K3E A;  2QM8 A;  5H5N A;  4K3A A;  1B6Q A;  3G6B A;  5KHJ A;  4X1K A;  1G8M A;  1K34 A;  1P49 A;  3QG5 A;  4U7N A;  4WFB V;  3A2F A;  2ZE8 A;  2ILM A;  3K0G A;  1IXB A;  3B8M A;  5BZB A;  4TT3 G;  3WG7 C;  5EBW C;  2Q7H A;  3CCR V;  1Q81 W;  1YXB A;  1DTO A;  3IJ4 A;  2ZE5 A;  3MHH C;  3RYF A;  1V54 C;  4O2B A;  1BHA A;  1JOY A;  1FXK B;  3HB3 B;  3R65 A;  1SC5 B;  4FZ0 A;  4WFE A;  1WPB A;  4JI5 B;  2D3O W;  1FAF A;  4DK1 A;  4E2L A;  1ZLZ A;  2P7T C;  1MZE A;  2A06 H;  1R1B A;  2E3C A;  1BCC H;  4OPH A;  1S5J A;  3F5W C;  4I50 A;  4J80 A;  3STZ C;  3H01 A;  3SYC A;  2EIK B;  1S3J A;  3GVM A;  5CN0 A;  1XBL A;  2M6Y A;  2Z0A A;  3ZED A;  2Y48 A;  2HHH O;  3BFR A;  2HJD A;  4JYA B;  2Q7G A;  5CBH A;  5IYC O;  1ENV A;  4YXW G;  3CRA A;  3KKY A;  1TGO A;  2ZD9 A;  3S3W A;  1IUR A;  2UXX A;  5C8Y B;  5LHI A;  1SQX H;  3ABK C;  3K79 A;  3BRC A;  1ZWI C;  4X1Y A;  1OV9 A;  2NN4 A;  3BA9 A;  2ZE7 A;  1SQB H;  4DUZ B;  1AI4 A;  3AG1 C;  4PI0 A;  3ETE A;  1HNX B;  1COW G;  5KAF Z;  4P9P A;  2KKW A;  3ZMZ A;  3ZS8 C;  1AI7 A;  2IU3 A;  2PI5 A;  3D3I A;  3WB0 A;  3ETQ A;  1ZL8 A;  1R73 A;  1DF4 A;  4JI4 O;  4F6R B;  3K9S A;  2ZDI A;  2GTS A;  1R3L C;  3CB2 A;  4PI2 A;  1VAR A;  4FZ1 A;  2EIJ B;  3ZHU A;  5LP6 B;  3EFF K;  4DR2 O;  5GON B;  4KP4 A;  3OR7 C;  2Y0I A;  1AR1 B;  1SA0 A;  3I55 V;  1Y76 B;  1IBK O;  2GDS A;  2WLL B;  5GTH Z;  5KAI Z;  3FB5 C;  3O65 A;  4J42 A;  2X6C A;  3UO3 A;  4Z1M G;  1OCR C;  3DXR B;  3FB7 C;  5CB4 B;  5CBF A;  1K33 A;  3K0D A;  4MW8 A;  1VQ4 V;  1Y67 A;  2VRZ A;  4Z2W A;  2IBZ H;  4MTX A;  1DLB A;  2JGD A;  2PYL A;  4X1I A;  3GWK C;  3RYC A;  4X20 A;  3W7U A;  1G1X B;  3ZMS A;  4WFG A;  3E8G A;  2RNB A;  3QNE A;  4ZOL B;  3ABL C;  4DYL A;  3ZHQ A;  1R3J C;  3VQY A;  4X1I B;  1WJZ A;  3RFR A;  1GK9 A;  2P5O A;  1K5Q A;  2ADQ B;  4LF7 B;  3CXH F;  1IDS A;  4TV9 B;  3JAT B;  2X0L A;  3KCX A;  1YF2 A;  1WAZ A;  3U0Z A;  3ZRV A;  5LXT A;  3MDS A;  4NVP A;  4K8X A;  3ABT A;  3BEH A;  1N0J A;  5JCO A;  4WCE V;  4DR5 B;  4ABM A;  2Q0O C;  1RPR A;  3MAQ A;  1QVF U;  4JV5 O;  3CC2 V;  1Y76 A;  1IX9 A;  1OCZ B;  3TK1 A;  1WPX A;  4IYH A;  3HKC A;  4O2A B;  1EZV H;  1N32 B;  5FPR A;  5EIB C;  5H6R A;  1D5A A;  4J9Z B;  1QHT A;  3CYO A;  4QJF B;  4X62 B;  2M7W A;  2R9R B;  3CC4 V;  2YIC A;  3JAR B;  4JI3 B;  2L6L A;  1TUE B;  4X20 B;  3D8C A;  3B40 A;  1WP7 A;  1VMG A;  4MVS A;  4QE9 A;  3K5O A;  3UCS C;  1HR0 B;  2JEX A;  1IBM B;  4LBE C;  3SGI A;  4NTW A;  3K5N A;  2NNU A;  2B1G A;  1N36 B;  2B9Z A;  3NR7 A;  2Q7E A;  2EIJ C;  3DXR A;  4HNA B;  5CB4 A;  3FB8 C;  1S72 V;  2P06 A;  1NZ6 A;  1NTZ H;  4WFF A;  4ZBM A;  1H38 A;  5L3F A;  3KCY A;  1VP7 A;  4X8A A;  5JH7 A;  3HKB A;  3BPZ A;  4TSF G;  5JQG B;  1EFR G;  5LXT B;  4JI6 O;  4CH5 A;  3CJH B;  4B08 A;  2K9P A;  4UFZ A;  1M5I A;  1AI6 A;  1V55 C;  2DYR B;  3ZCC A;  5KMG B;  3A0R A;  1QR8 A;  1K8A W;  3RYC B;  3STL C;  4AIL C;  3CME V;  5J9P C;  5B66 Z;  1WN7 A;  3HKD B;  5BR8 O;  1M56 C;  3N2K A;  2ZM6 O;  1Y6X A;  2Q5Z A;  5K1X A;  1N4C A;  2EIM C;  4DV4 O;  2CH7 B;  1M9N A;  2X6B A;  3DGE A;  1FYJ A;  4RO2 A;  5BMV A;  2XND G;  1K4D C;  1P4R A;  1SZX A;  1TAE A;  2ZXW B;  2AHY A;  1BL8 A;  3OEH G;  3DC6 A;  2JGU A;  1F23 A;  2ZXW C;  2IJH A;  3EVK A;  4DV7 O;  2RCV A;  4N23 A;  2F93 B;  2OCC C;  1P7B A;  3EHB B;  4X64 B;  4BWA A;  2V7Q G;  4YJ2 B;  1K7D A;  1LUV A;  4UVB A;  5LA6 B;  5IT9 N;  1PKX A;  1VQ8 V;  1MSD A;  1RP3 B;  1SRY A;  2EZO A;  2GHY A;  1QVG U;  1PM9 A;  3SJC C;  4H37 A;  4DV7 B;  2LGW A;  1V54 B;  1MNG A;  4JI1 O;  3SPH A;  3ETD A;  3L70 H;  5LP6 A;  3JCU Z;  1N34 B;  4B7K A;  3HKE A;  4YHH B;  5KMG A;  3T1Y B;  2JJ2 G;  5KA6 A;  1AP5 A;  4QPK A;  1D2D A;  4UCO A;  2Q0A A;  2QWR B;  4B3T O;  2WLM A;  4DV0 O;  1ORQ C;  4CS2 A;  5EBM C;  2IJJ A;  3CX5 F;  3H9V A;  1H2M A;  5EK0 A;  3HKD A;  3LDE A;  1XEQ A;  2AXT Z;  4FLY A;  2LGQ A;  1YIJ V;  2Q8V A;  3ABM B;  5B1N A;  4DR3 B;  4CS3 A;  4AQY O;  4FJC C;  4HNA A;  3T1C A;  1P84 F;  1HW7 A;  4GZR B;  3VQW A;  3L9D A;  3LUT B;  3FYE B;  2YSU B;  1PV0 A;  1VQL V;  4KHP O;  3HKB B;  3E8F A;  2AZ0 A;  4Z1V A;  4X1K B;  1HP8 A;  2KG7 B;  3F7V C;  5E1A C;  4GYC B;  2GV9 A;  4KL1 A;  4MVQ A;  5L3B A;  1JFF A;  3ZJZ A;  1Q7Y W;  1XNQ O;  2HR3 A;  2EIL C;  1NVP D;  1G4Y B;  3FKS G;  3OGC C;  4GUN A;  2DE0 X;  1BT8 A;  2PF4 E;  4UV8 A;  1EBO A;  2LP7 A;  4CC6 A;  2PI4 A;  2F4V O;  4PV1 B;  1IXM A;  1QLE B;  4MTO A;  4LF7 O;  4JI8 B;  4J11 A;  2ODM A;  2PTM A;  4LC1 A;  4LWS B;  4MS2 A;  4O4J A;  2ARH A;  4QE7 A;  1JCH A;  2IU0 A;  3TGU H;  1Q86 W;  1R6K A;  2ADP A;  3K57 A;  1H2K A;  5CA3 A;  2A7W A;  3PJS K;  1KB9 F;  3CS5 A;  4YY3 B;  3LSU A;  2PUS A;  3E22 B;  1G6U A;  3QO5 A;  2FKX A;  1N32 O;  4BR6 A;  4H44 B;  1SA0 B;  1UPG A;  3JAS A;  4XDL A;  1NKD A;  4LFC O;  4FK5 C;  4UCU A;  1MSW D;  3SJA C;  3A0H Z;  3G4S V;  3KZI Z;  4B3S B;  4BIU A;  3ZHS A;  1I08 A;  2RMK B;  4FPP A;  2QM4 A;  1R3I C;  1Q6H A;  4FLU A;  2BE3 A;  4DV5 B;  2DJV A;  4LFA O;  4TV9 A;  1S76 D;  1ZL8 B;  3U11 A;  1US6 A;  1TUB A;  1O9G A;  3HKE B;  1X59 A;  5LMU B;  5A2Q N;  5KX5 B;  2Y4U A;  3GWO A;  2YIB D;  4JYB A;  1CEZ A;  3CRM A;  4QPJ A;  5JH7 B;  1M93 A;  1GN3 A;  3BA8 A;  4IGG A;  3ZIA G;  5KA5 A;  1SQF A;  3MD0 A;  5CA1 A;  4YJ2 A;  4G2K A;  2A79 B;  4CH3 A;  1PNL A;  1LUW A;  4O4J B;  3H1L H;  2BSK A;  2UXN A;  1FS0 G;  2YIB A;  3T4D A;  3U10 A;  3AG3 B;  2Z3Y A;  3AG7 A;  4G28 B;  2CUG A;  2GSM B;  2VS0 A;  2IH3 C;  4RUE A;  3JAM N;  5L3C A;  3AG1 B;  2LW1 A;  2QTS A;  3T4Z A;  5CMU A;  1H2S B;  1W59 A;  4DRX B;  4AQY B;  4MVO A;  2ZIN A;  4PA4 A;  1PNM A;  4A5U B;  2HJF C;  4JYY A;  4BAY A;  3ZHV A;  4YY3 O;  3HKC B;  3RYF B;  1W2B U;  4O4H A;  2HP8 A;  5JJE B;  5LBQ A;  2LW7 A;  4O4I B;  5JJJ B;  4PA7 A;  2ZR3 A;  5H9C A;  3OEE G;  3JAL A;  1J5E O;  2H8P C;  3CSX A;  4WFH A;  1OCC C;  2OIE A;  4TV8 B;  3NXS A;  1GM8 A;  3JD1 A;  3ZHR A;  2DW4 A;  4D7S A;  4YHH O;  4I0X A;  2ZIM A;  2QDO A;  2VQF O;  2PYJ A;  1XNR B;  3OTO B;  3CCL V;  2EX3 A;  1GN2 A;  5FNV A;  2ZT9 B;  1BQZ A;  4X65 O;  1FKA O;  4DW0 A;  3E83 A;  1TUB B;  2YI9 A;  3C3S A;  4DR6 O;  4HYO A;  1P7G A;  4FM0 A;  1GN6 A;  4DV5 O;  5GW7 A;  1VQ9 V;  2UU9 B;  2OTJ V;  3JAW B;  1FXH A;  1VQO V;  4I4T A;  1FXK A;  1YJW V;  4PA3 A;  3SDL A;  1XNQ B;  3N2G B;  1Z5W A;  3K3W A;  4CZZ A;  3AEI A;  3G6E V;  3K5L A;  3E89 A;  2W6I G;  3CRC A;  3K08 A;  3RT3 C;  1XQ8 A;  4B7E A;  5LHH A;  2A9H A;  4KHP B;  4D7T A;  1QNM A;  2DYS C;  2CTP A;  4B3T B;  1SQQ H;  3VQX A;  2F1M A;  3OGI B;  3FB6 C;  3I56 V;  2EZP A;  4IHJ A;  5L3D A;  2V1D A;  5B1B B;  1EZJ A;  1BSM A;  2VQE O;  1VQ5 V;  4RAI A;  2CTR A;  3SJB C;  3N27 A;  4E4E A;  3O9O A;  4EB6 A;  1ZAU A;  3PN1 A;  4UVA A;  1Z5V A;  2YC0 A;  3AK2 A;  4DV0 B;  4JAS A;  1KP3 A;  1JR9 A;  3G71 V;  1GN4 A;  2R72 A;  1R3K C;  3IC9 A;  1JX9 A;  1Z2G A;  4LFB B;  3OTO O;  3CCV V;  1OCC B;  2YS8 A;  2QKS A;  3LDC A;  4O4L B;  2WPD G;  1EM1 A;  1NT2 B;  3JAR A;  1U96 A;  1KKD A;  1URF A;  1K92 A;  1KU9 A;  4DRX A;  3CCJ V; 
#chains in the Genus database with same CATH homology
 1OHH G;  4X8A A;  2Q69 A;  4MVM A;  3ABU A;  2Z5U A;  4TSF G;  4RQF A;  1EFR G;  1MAB G;  3KG2 A;  2MK3 A;  4GX2 A;  2XAJ A;  4R8C A;  1AI6 A;  1V55 C;  2DYR B;  4XBF A;  3ZCC A;  1JVM A;  3B77 A;  1W0J G;  1PNK A;  3A0R A;  4PDL A;  2EIM B;  1QR8 A;  2IJK A;  1NR1 A;  1K8A W;  2QM7 A;  2CK3 G;  3OFN G;  3STL C;  2OT5 A;  3CME V;  3RBZ A;  4G27 B;  5IY5 B;  5J9P C;  1M56 C;  3W7S A;  3K04 A;  4H33 A;  1RPO A;  3CCQ V;  1DF5 A;  2W6J G;  2EIM C;  4MTG A;  3UM7 A;  1M9N A;  2AHZ A;  2X6B A;  3DGE A;  4RO2 A;  2JIZ G;  4N21 A;  1HWY A;  2XND G;  3ZRW A;  1K4D C;  4KUM A;  1P4R A;  1MG1 A;  1YI2 V;  4JAV A;  1QLN A;  2QTO A;  2ZXW B;  5L3G A;  2AHY A;  3RW0 A;  2A0L A;  2QEX V;  4LCU C;  4JF3 A;  3M99 B;  1SET A;  1BL8 A;  4P2Z A;  1QBZ A;  2QA4 V;  3OEH G;  3LSS A;  3E8B A;  5B3S B;  4JPR A;  1BMF G;  3ASN B;  1F23 A;  2ZXW C;  2IJH A;  3OE7 G;  5CBG A;  3JYC A;  3CPW U;  1VQ7 V;  4N23 A;  2YEV A;  2OCC C;  3RVY A;  1P7B A;  1F4M A;  1S5H C;  3EHB B;  1KD1 W;  1VQP V;  3W7X A;  2V7Q G;  1YSC A;  2DWD C;  4MT8 A;  2Q6A A;  1K7D A;  3ZMT A;  4UVB A;  1YIT V;  1FFT B;  3IC7 A;  4PDR A;  1JQ0 A;  3ABK B;  1GTO A;  5B1O A;  2WWW A;  1PKX A;  3W7W A;  1VQ8 V;  2Y69 B;  1VQM V;  1SRY A;  2EIN C;  3ZN1 A;  4FMT A;  2EZO A;  2GHY A;  2K1E A;  1QVG U;  4WFA V;  2OTL V;  2Q68 A;  4CBC A;  4XDK A;  4H37 A;  3JD2 A;  3CP1 A;  4I9W A;  5IYD O;  1V54 B;  4OXS A;  3DTU B;  2YEV B;  3ETD A;  1QR9 A;  3SPH A;  2WLK A;  3QO8 A;  3SPG A;  2BOC C;  1AJP A;  2WLN A;  3IGA C;  2JJ2 G;  1YTF B;  5KA6 A;  3OUS A;  4QPK A;  1OCZ C;  2WLH A;  4GX5 A;  2WLI B;  2WLM A;  1K5S A;  4DO2 A;  5H6Q A;  1ROP A;  2NLJ C;  1ORQ C;  3CC7 V;  4HAM A;  4EKW A;  3E2E A;  3QO7 A;  3AG2 C;  5EBM C;  2IJJ A;  2JJ1 G;  5EK0 A;  3SPI A;  1F51 A;  1THZ A;  3LDE A;  1YIJ V;  2R9I A;  1SZT A;  1YJN V;  3ABM B;  5B1N A;  2ZR2 A;  4FJC C;  4R7C A;  4PA6 A;  3T1C A;  2F43 G;  3OMI B;  3CCU V;  1GM9 A;  2HFE C;  4F4L A;  1VQK V;  3LUT B;  4UUJ C;  3FYE B;  3VOU A;  3ZRS A;  1KC8 W;  2YSU B;  1PD3 A;  3E86 A;  1NQT A;  4J9Y B;  1VQL V;  4JAU A;  1XL6 A;  1S0V A;  4R50 A;  1FXK C;  3E8F A;  1YHQ V;  1M57 C;  3F7V C;  5E1A C;  3E35 A;  5LGU A;  4MVR A;  4JTC B;  4MVQ A;  5L3B A;  2X7R B;  2B5U A;  3RVZ A;  4ZKI A;  2DWE C;  4WF9 V;  2DYS B;  4L87 A;  3ZJZ A;  1NJI W;  1Y66 A;  3SPC A;  3W7T A;  1Q7Y W;  1QLE C;  3WG7 B;  1CP9 A;  1AI5 A;  2HR3 A;  3T2M A;  2EIL C;  1LNQ A;  1CPY A;  1OCO B;  1K3E A;  2QM8 A;  1B6Q A;  1NVP D;  1G4Y B;  5DM6 V;  1FXV A;  3FKS G;  1G8M A;  1K34 A;  3OGC C;  3CCE V;  4U7N A;  4WFB V;  1KP2 A;  4R6Z A;  4UV8 A;  1EBO A;  2LP7 A;  2PI4 A;  2XAQ A;  2P90 A;  3CCM V;  3K0G A;  3B8M A;  2EIL B;  5BZB A;  1IXM A;  4LP8 A;  5KUK A;  4TT3 G;  1QLE B;  4MTO A;  5EBW C;  3WG7 C;  5DN6 G;  3AG4 B;  4LC1 A;  3CCR V;  1Q81 W;  1DTO A;  1Y4M A;  3MHH C;  2P67 A;  1V54 C;  4MS2 A;  4QE7 A;  1BHA A;  1JCH A;  2IU0 A;  1JOY A;  3OR6 C;  1FXK B;  3HB3 B;  1Q86 W;  1R6K A;  1SER A;  3R65 A;  2BOB C;  4GX0 A;  1QCE A;  3LDD A;  1OCR B;  2JDI G;  4WFE A;  5CA3 A;  2D3O W;  2DQ3 A;  3LNM B;  4QNH B;  3PJS K;  4E2L A;  1OZ0 A;  2P7T C;  2HVK C;  1NVP B;  2EBO A;  3QO5 A;  3ABM C;  3ASO B;  4TWK A;  2WLL A;  4XDL A;  1NKD A;  1AJQ A;  1RM1 C;  4FK5 C;  3F5W C;  5IDJ A;  1MSW D;  3G4S V;  3STZ C;  4BIU A;  3H01 A;  2IH1 C;  1K4C C;  4FPP A;  2EIK B;  3SYC A;  1R3I C;  1S3J A;  5CN0 A;  4PEL A;  3CMA V;  2XOK G;  1KQS U;  2JK5 C;  1YJ9 V;  2WLJ A;  3OMA B;  2Y48 A;  1S76 D;  3SYO A;  1UJW B;  3HPL C;  5CBH A;  1NR7 A;  5IYC O;  1ENV A;  4UVC A;  1S77 D;  4YXW G;  4P30 A;  4DXW A;  5HFM A;  3E8H A;  5C93 A;  3BY6 A;  4UV9 A;  5LGN A;  1N8R W;  4UXN A;  2ZD9 A;  3X2Q C;  3SYA A;  2Q67 A;  2ZDI C;  2EIN B;  3GB7 C;  1GKF A;  2UXX A;  2WLI A;  3GWO A;  5LHI A;  2DQ0 A;  5B1A B;  3ABK C;  4JYB A;  3K79 A;  1KEC A;  5IY5 C;  4QIW F;  1CEZ A;  1ZWI C;  4QPJ A;  1GO3 F;  3JCZ A;  2ITD C;  3K9A A;  1K9M W;  3SYQ A;  1AI4 A;  2LFS A;  3AG1 C;  5L3E A;  3ETE A;  1COW G;  2C2A A;  2OCC B;  4P9P A;  3ZMZ A;  1WLE A;  3ZIA G;  5KA5 A;  1XL4 A;  1AI7 A;  2P6J A;  1MOF A;  2IU3 A;  3MD0 A;  3D3I A;  1JJ2 U;  2PI5 A;  1NBM G;  3OW2 U;  4MVZ A;  1R73 A;  3ASN C;  1GM7 A;  1DF4 A;  2A79 B;  4G2K A;  2ZDI A;  5B3S C;  1PNL A;  2UXN A;  1R3L C;  1FS0 G;  4XDJ A;  3T4D A;  2EIK C;  2EIJ B;  3ETG A;  3FYI B;  3AG3 B;  2Z3Y A;  3TET A;  4G28 B;  3EFF K;  2GSM B;  2IW5 A;  2IH3 C;  2W0F C;  1W0K G;  4GCZ A;  4KP4 A;  4RUE A;  5L3C A;  2X6A A;  5FL7 G;  1AJN A;  1M1K W;  1RM1 B;  3AG1 B;  3OR7 C;  3T4Z A;  3OUF A;  4JTA B;  4BIZ A;  1PL0 A;  2WSS G;  5CMU A;  1AR1 B;  3I55 V;  3K03 A;  2WLL B;  1M90 W;  1M56 B;  4MVO A;  5B1A C;  4PA4 A;  1PNM A;  2HJF C;  3FB5 C;  3ZMV A;  1H8E G;  4BAY A;  2X6C A;  4Z1M G;  1OCR C;  2HLD G;  3X2Q B;  2KB1 A;  3FB7 C;  5CBF A;  1V55 B;  2DYR C;  1K33 A;  3JD0 A;  3ML0 A;  5LGT A;  5EBL C;  1GMG A;  4PA9 A;  5B1B C;  5IYB O;  2HKO A;  3K0D A;  4MW8 A;  1W2B U;  1VQ4 V;  1L1F A;  1VQN V;  4HZ3 A;  1I5Y A;  5LBQ A;  4RQE A;  3LSQ A;  4MTX A;  1JPX A;  2ZQM A;  4PA7 A;  2ZR3 A;  4JGS A;  5H9C A;  3OEE G;  3K06 A;  3MHS C;  1DLB A;  1E1Q G;  2H8P C;  3ZN0 A;  3OAA G;  4WFH A;  4FIP C;  1OCC C;  4PDM A;  1OCO C;  4RUF A;  3W7U A;  2EJR A;  3ZMS A;  4WFG A;  2H94 A;  3E8G A;  2XAH A;  3QNE A;  3ASO C;  4U7O A;  1BHB A;  3ABL C;  1GM8 A;  3JD1 A;  3NXS A;  2DW4 A;  1R3J C;  3OM3 B;  1NH2 B;  5LHG A;  3CXC U;  3CCS V;  4GX1 A;  3VBB A;  1K97 A;  3CCL V;  1GK9 A;  1M57 B;  1K5Q A;  1E79 G;  4GT1 A;  3UKM A;  2LFR A;  2X0L A;  3E83 A;  1E1R G;  3P32 A;  2WAM A;  2XAS A;  3F7Y C;  2JEU A;  4HYO A;  2FTK A;  1J95 A;  5GW7 A;  3ZRV A;  1VQ9 V;  3AG4 C;  4MVU A;  5EC2 C;  4BW5 A;  1FXH A;  3OMN B;  2OTJ V;  1VQO V;  3ABT A;  3ZMU A;  3BEH A;  1H8H G;  1FXK A;  1H2G A;  4WCE V;  1YJW V;  4PA3 A;  3TCU A;  2ATK C;  4MW3 A;  1R6N A;  1RPR A;  3AG2 B;  3K3W A;  4CZZ A;  3SPJ A;  3AEI A;  3G6E V;  1QVF U;  2XAF A;  3CC2 V;  3E89 A;  1OCZ B;  1WPX A;  3TK1 A;  1YTF D;  2W6I G;  3K08 A;  3JD4 A;  4MSW C;  4X88 A;  2IJI A;  5LHH A;  2A9H A;  5H6R A;  4J9Z B;  4KFM A;  3JD3 A;  4Q20 A;  4I5S A;  3CYO A;  3IFX A;  2DYS C;  3ZRW B;  4QJF B;  5KUM A;  2HVJ C;  2ITC C;  2M7W A;  2R9R B;  3I56 V;  3FB6 C;  2EZP A;  1F4N A;  5L3D A;  2V1D A;  3SYP A;  5B1B B;  3CC4 V;  1EZJ A;  4X89 A;  2XAG A;  5EC1 C;  1VQ5 V;  4RAI A;  4P9O A;  1TUE B;  1Q82 W;  1SES A;  4JTD B;  4MVS A;  1ARO P;  3D36 A;  4QE9 A;  2Y69 C;  4UVA A;  1I5X A;  3ZRX A;  2JEX A;  5HFL A;  4JAS A;  1KP3 A;  4ASU G;  3ABL B;  3G71 V;  1K73 W;  3P30 A;  1R3K C;  1NH2 D;  2HG5 C;  1JX9 A;  4PDV A;  4MTF A;  4LBE C;  3CCV V;  1OCC B;  2NNU A;  2B1G A;  2QKS A;  3AG3 C;  1VQ6 V;  3LDC A;  2EIJ C;  3B8N A;  2WPD G;  1S72 V;  3FB8 C;  4JYC A;  1KKD A;  3SJQ C;  3CD6 V;  4WFF A;  1K92 A;  4ZBM A;  3WFV A;  1H38 A;  2B1I A;  2QE7 G;  5L3F A;  3CCJ V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...