5CBFA

Structural and functional characterization of a calcium-activated cation channel from tsukamurella paurometabola
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
TLMFKRFFGAVRTSWRDPSTRGAVLSLAIIVTAATIFYTLAEKWSVIDSLFYAVSVGLPMGNGPLSPTLTLSKIFTLVYAILVVGLFVTVGGSLASAIVQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of a calcium-activated cation channel from Tsukamurella paurometabola.
pubmed doi rcsb
source organism Tsukamurella paurometabola (strain atcc 8368 / dsm 20162 / jcm 10117 / nbrc 1612
molecule tags Transport protein
molecule keywords Ion transport 2 domain protein
total genus 30
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5cbfA00
4HYOA 1R3LC 2K1EA 4MS2A 4WFGA 3ASNC 3SYOA 3UM7A 3E83A 3EFFK 4X88A 1OCCC 2NLJC 5J9PC 3F5WC 4OXSA 4GX0A 2QTOA 4P2ZA 1P7BA 3AG1C 2EINC 3K06A 3SPGA 2HFEC 3F7VC 2ITDC 4J9YB 2AHZA 4PA3A 2BOCC 2A0LA 2WLMA 4XDKA 5EBMC 3SYAA 4HZ3A 3T4ZA 2R9RB 3TCUA 5E1AC 2DYRC 4RAIA 5EBLC 3E8FA 1V54C 3K03A 1R3IC 2X6CA 4WFEA 3TETA 1JVMA 2EILC 4MW3A 4XDLA 5EK0A 2HG5C 1K4DC 2ITCC 5CBGA 2WLIA 4LBEC 4H37A 4P9PA 1R3KC 3STLC 2HJFC 4BW5A 5CBHA 3FB6C 2QKSA 3LDCA 3SPHA 2HVKC 3ZJZA 1XL6A 1V55C 1ZWIC 1G4YB 4F4LA 3LUTB 3E86A 4DXWA 1OCOC 4MVMA 4KFMA 4WFFA 2OCCC 3ABKC 5B1BC 3RW0A 4X8AA 2WLIB 4MVUA 4ZBMA 3LDDA 4RUFA 5KUKA 2WLKA 2KB1A 4RO2A 3STZC 4MVOA 5B1AC 3GB7C 1M56C 3ABMC 4XDJA 3E89A 2Q67A 4LCUC 1J95A 2DWEC 4PDRA 4JTAB 4LP8A 1M57C 4MSWC 2JK5C 2WLLB 3R65A 3ABLC 5IY5C 3OUSA 5EC1C 2EIKC 2ATKC 4QE9A 3KG2A 3F7YC 2IH3C 3K08A 3LNMB 3LDEA 4H33A 4PA6A 4PA7A 2H8PC 2Y69C 4J9ZB 3OUFA 2HVJC 3K0DA 3PJSK 1R3JC 2ZXWC 4QNHB 2A9HA 2EIMC 4MVRA 4PDMA 1BL8A 3RVYA 3SPJA 2A79B 3AG3C 4MTGA 2ZD9A 3RBZA 3SPCA 3OR7C 4P30A 5B3SC 3FB5C 4PDVA 4MTOA 2YEVA 4PDLA 3SJQC 3X2QC 2X6AA 2WLNA 3ASOC 3E8BA 4WFHA 4UUJC 3SYPA 2Q69A 1OCRC 1S5HC 3BEHA 1QLEC 2DYSC 1K4CC 3JYCA 2X6BA 3SPIA 2WLHA 3HPLC 3IFXA 2EIJC 2W0FC 4R7CA 4R8CA 3T2MA 3T4DA 1KKDA 3FB8C 3K0GA 3OR6C 5EC2C 4EKWA 3VOUA 2Q68A 2P7TC 3UKMA 1LNQA 3RVZA 4I9WA 1OCZC 4G28B 3T1CA 4RUEA 4P9OA 2AHYA 3ZRSA 2Q6AA 3SYQA 4X89A 4JTCB 5EBWC 5KUMA 4CBCA 2DWDC 2BOBC 3WG7C 4MVZA 3E8GA 3K04A 4R50A 3E8HA 4R6ZA 3FB7C 4GX5A 4PA9A 5CBFA 3OGCC 2IH1C 2WLLA 3AG2C 4JTDB 2WLJA 4G27B 4PA4A 4MVQA 4MVSA 3IGAC 4MTFA 4GX2A 4QE7A 5BZBA 4GX1A 4TWKA 3SYCA 1ORQC 4MW8A 3AG4C 1XL4A
chains in the Genus database with same CATH superfamily
3JARA 2NLJC 2QKCA 4EFEA 4JI7B 5KX5B 4B3MB 2LFRA 1YF2A 2VS0A 3CPWU 4YJ2A 1WPXA 1R3IC 1N8RW 2ZCEA 1JVMA 4P9PA 4X65O 1KC8W 4CH6A 1OV9A 3JASB 4JI7O 4I4TB 3ML0A 1JJ2U 2EULA 1XNRO 4JI1O 4ZBMA 5JQGB 3CXCU 1G8MA 1NQTA 2QDOA 1YXBA 3DGEA 4AQYO 4LF5B 1Y6XA 2AXTZ 2EX3A 3ABLB 2GUZB 2CH7B 2PYJA 2RDCA 4BIUA 1ZUQA 4QNHB 4LF4B 1QLEB 3ABUA 3C3TA 1XQ8A 4KP4A 3X2QC 1ZTEA 5IJ0A 1KKCA 3JAWB 4CS3A 1P49A 5H6QA 4F6RA 1QLEC 2JGUA 5BXZA 2W0FC 3X2QB 2XAJA 2XT9A 4KL1A 3RVZA 1QVFU 5F2VO 2JS5A 1NZ6A 2C2AA 4MVZA 1B6QA 1JCHA 5CB4A 3BY6A 4K0KO 4DW1A 4FFKA 2EINB 4I55B 2QE7G 4EB6A 2E5LO 1AROP 1P7GA 5IT9N 4WFGA 2JJ2G 5BMVA 3F5WC 4X66B 2CDYA 4P2ZA 1ZSPA 1M9NA 2AHZA 5J9PC 4N21A 1RSOA 4JAAA 1OCCB 4I50B 1N32O 5IJ0B 4WFEA 3CRQA 2Q4PA 1QCEA 4H37A 1EFRG 2ZINA 5JH7A 3FB6C 4LC1A 1OCRB 3RWRD 3DTUB 4RWUA 4JI6O 1XEQA 1G1XB 4I9QA 1CEZA 1KYOF 1R6TA 3OE7G 2Q9LA 4GKKB 1PL0A 3RW0A 2UU9O 2WLIB 4MVUA 5KHKA 1EBOA 3ZHTA 1H2NA 3STZC 1GKFA 1M1KW 3RYIB 2ZM6B 3BRCA 2VQEB 1GO3F 1SZXA 1FJGB 4PI2A 1O9GA 2IW5A 1AP5A 4AHCA 2RMKB 3M7MX 4O2AA 4J9ZB 1JPXA 2VWJA 4GKJB 4LWSA 5C8YB 1IZ3A 1V55B 4FPPA 5LHGA 1X59A 3SGIA 1DGSA 1E1QG 3G4SV 1XNQO 5GTHZ 1Q6IA 4R7CA 4R8CA 5LYJA 3T1HB 1JMKC 4EKWA 1N34B 1XREA 5IDJA 1KD1W 2XAFA 4DV6O 4JI8B 4UCSA 3DXRB 1K8AW 4UB6Z 3OMNB 2CTPA 3I56V 3T1HO 4JTDB 2DQ3A 3ZMTA 2ODMA 2PI5A 4GX1A 2ZIOA 5GTIZ 2MW2B 3UM7A 4J7ZA 5DEDA 5JVDB 4FM0A 1P7BA 2OWOA 5LMUB 1VQKV 4ABMA 4TQDA 4JI6B 4FJCC 1WLEA 3G67A 1URFA 3WB1A 5EBLC 2LP7A 1Q5OA 5CBGA 2HEPA 3SPHA 2JDIG 2PY5A 3ZJZA 4ZI7B 3KZIZ 5AG2A 5IYZA 2B5UA 1MSWD 4MVMA 1I7FA 1TVKB 5FNVB 3P3NA 1AR5A 4DR7O 1LUWA 2ZE8A 2P6JA 1M56C 2QJ1A 2JEUA 4LP8A 1RP3B 4O4HA 1YCIA 2CGNA 1NU1H 1KP2A 1YDXA 1Q81W 3ZMSA 1S3JA 1R3JC 2B1GA 3JSLA 3N2GB 1Q90D 2A79B 3AG3C 1LUVA 1VQ8V 3H9VA 4JI8O 1D5NA 5BY1A 2X6AA 2EIMB 4L8JA 5JVDA 4Q20A 1IBKB 4TV9A 2E3CA 4JI4O 2Q7GA 1KQSU 2FL4A 4DR6O 4YHHB 1XHZA 4U3FH 1M56B 3N2GA 1QNMA 2QEXV 2Z5UA 1L8DA 4HNAB 1HNZB 1NJIW 3K9SA 2Q6AA 1TUBA 3EHBB 4LF7B 2K9PA 2FMLA 4R6ZA 2Q8VA 1FXVA 1N0NA 5KHJA 3KCYA 2QSAA 1AR4A 2RCVA 3E83A 1HNZO 2BE3A 4UXNA 1W59A 2L6LA 1W2BU 4CS2A 3LSQA 1KB9F 2QM4A 3MD0A 2ITDC 2ZE7A 5C93A 1NVPD 4LFAO 1EN4A 1WAZA 2CK3G 1V54C 3B8NA 2XHBA 4C7UA 1H2GA 3CB2A 4UVAA 2WA3A 3CRAA 5FPOA 1R3KC 1JFFB 2HJFC 1N4CA 3OEEG 3L72H 2P90A 4DR3O 1Q7YW 5LHIA 4KHPB 1SQFA 1FD9A 3RYCA 3IC7A 1EZJA 4RO2A 3SJBC 1GK9A 2DWEC 4DV5B 2HHHB 4NVPA 3OUSA 2EIKC 2GDSA 4O2AB 1XBLA 3EVKA 5EIBD 1Z2GA 3PJSK 1BE3H 4LF4O 2A9HA 2N74A 1DTOA 4E2LA 2P67A 2QWPB 2QA4V 2WLNA 3ASOC 3FAVB 3OMIB 1VF6C 3HKCA 3P3PA 3ZMUA 3SPIA 1QQCA 1XMOO 5ITZB 2W6IG 2JGDA 5B1BB 4FMTA 2W0XA 3JALB 4TT3G 1D5AA 4BW9A 4J42A 3G6BA 3L9DA 1OHHG 5H5NA 4X64O 3S3WA 4XBFA 3JAMN 3ETGA 1A32A 1PNLA 2XOKG 3D8CA 5KHHA 2QR4A 5EBWC 4JI3B 5FPRA 2DYRB 2FYUH 3VQVA 1BQ0A 4K0KB 1K92A 4QIWF 4FLWA 3SPGA 4HYOA 3ASNC 3L71H 3F5TA 2OCHA 4JI5O 2LW7A 4YIOA 4X9QA 1DF5A 3T4ZA 1NTMH 2V7QG 1FFXB 5B5EZ 4LBEC 4EEQA 2IJIA 2ZIMA 5FL7G 2LGWA 1ZWIC 2ZR3A 3GWKC 5ITZA 5HFLA 4WFFA 4DRXB 2WLKA 4B3RB 5EZYB 2Z3YA 3QVNA 4I7ZB 5BR8O 1LR1A 3R65A 4UCVA 1QR8A 3NXSA 4OPAA 3CMEV 2ATKC 1VQNV 4QGPA 2UXCO 3K08A 3BABA 1XMQO 4DYLA 4I0XB 3CCMV 1JA8A 3UT5A 1GH6A 3J7AU 3RBZA 2YXHA 4JZ2A 4Z1VA 1AI5A 1X4TA 4ZI7A 1HNWO 1XNQB 3BEHA 1WA8B 2Y48A 1S5LZ 2ILMA 1WP8A 3K0GA 5KHGA 5JJJB 4WCEV 3UO2A 1OCZC 4DV6B 4YY3B 4JGSA 2Y4TA 1HP8A 2IBZH 1R6NA 3A2FA 1HNWB 2LJ2A 2YSUB 4WF9V 3D36A 4DUZO 1PNMA 2IH1C 2G38A 1OCOB 3IGAC 4GX2A 1U96A 3J80N 5LA6B 1Q86W 2KG7B 1BCCH 2JIZG 4W4KA 1OCCC 2Q7EA 1HNXO 1PL4A 1VIBA 4IIJB 3E2EA 1IURA 1NR1A 1K9MW 2DJVA 3H1LH 2UXNA 1R6KA 4IYIA 3ZCCA 4DV1B 5EIBC 1M5IA 3DC6A 2WLIA 1BGYH 3T1YO 1TA8A 2P06A 2AGAA 2GHYA 3K5OA 1G4YB 2P4KA 1QLNA 3THOA 4B3SB 2ADQB 3LDDA 4A5UB 1F4NA 5KUKA 3GB7C 4XDJA 1ENVA 1J95A 3WB2A 4J11A 2WLLB 4NXMO 4DV0B 4TOIA 1AI7A 5JQGA 1D2DA 1TUEB 3LDEA 2F4VB 1Y76B 3AG2B 4FFBB 4JV5B 2EIMC 2IJHA 2Q0AA 3OR7C 3Q4HB 2YICA 1OCRC 3IC9A 1M57B 3JYCA 4DK0A 2KSDA 5L3BA 1LNQA 2IU0A 3CD6V 1HNXB 4LF7O 2ETNA 5JJNB 3ZS8C 4X20A 2UUAO 5J2TB 3JASA 5B1AB 1HWYA 1E1RG 4FIPC 3FB7C 4GYCB 4MVSA 1S0VA 4YHHO 3H01A 3WFVA 3SYOA 4NXNB 2NNUA 3CCJV 4D7TA 2IM9A 3K58A 2FB5A 4LFAB 4J41A 3HKDB 2BOCC 5JCOC 5A2QN 2DYRC 2Q7HA 1YEWA 5J2UB 3VQYA 3TETA 1GM7A 4MW3A 4FLXA 1HR0O 1K4DC 2OT5A 1H8HG 4NXNO 3FFQA 4O4IB 3SR2C 3JATB 1FFTB 1PPJH 1S76D 4F4LA 2OCCC 1K7DA 4FLZA 1AB3A 5L3DA 1R1BA 4NB5A 3CCQV 4LCUC 1GM9A 5L3FA 4LFCB 4JASA 3B40A 1THZA 5EC1C 4QE9A 4DUYO 3RGBA 3F7YC 3LNMB 4JYAB 2ZNJA 5B3SB 4TUYA 5DECA 5BMVB 2P22C 5LGTA 3FAVA 4O4JA 1WN7A 4MVRA 2GSMB 5L3GA 3K5NA 5B3SC 4K3AA 2F23A 1GMGA 2YXLA 1XI1A 1NTZH 1NVPB 4LFCO 2Q69A 1PV0A 3H1HH 4DW0A 2X6BA 2UUBO 3ZHRA 3VOUA 2PTMA 4X20B 4O4IA 3ZX6A 4LFBB 1KBHA 3OM3B 4IT5A 1MSDA 1UFIA 3S3XA 4LR3A 2R9IA 2PZSA 1AR1B 3ETEA 1S72V 1FAFA 4TV8A 3E8HA 2UXDO 4PA9A 2UUBB 3AK1A 1IBLB 4PA4A 3ZMZA 2VWKA 4QE7A 1PM9A 4O2BB 4LFBO 4MW8A 1VQ5V 2PYLA 1YJ9V 4JYBA 1US6A 3JAKB 2YC0A 3CS5A 4JI5B 3K06A 5IWAO 4KHPO 2ZDIC 3O9OA 4B3MO 3RYFA 1F4MA 5EBMC 1VF7A 2A0LA 2EZPA 4FLVA 1RPOA 2YEVB 3TCUA 1N32B 5E1AC 2PF4E 2YIBA 1ROPA 3L73H 1FXKA 2EILC 2JJ1G 1JFFA 4X65B 1YI2V 1Y76A 3N2KA 1FKAO 5CA1B 2QKSA 4LF8B 4DUYB 2R72A 3E22A 2BTOA 1P4RA 3LUTB 1WA8A 3E86A 3ABKC 4B3RO 2OYQA 1SA0A 2F66C 3UCSC 1IXBA 4B7KA 1Z5VA 1MABG 1WJZA 3LSUA 1M57C 4MSWC 2OIEA 2XTAA 4FK5C 3OW2U 3G80A 3APOA 1IVSA 2IH3C 5FLXN 3CJHA 2UXBO 4TSFG 5CA0B 5EYPA 4X64B 1YVWA 3K5LA 2YI9A 3IAYA 3AG3B 4GKJO 4EFBA 1J5EO 2DN9A 1CXZB 1Q8IA 1I94B 3APQA 3CP1A 1K4CC 1BMFG 4GUNA 2ZNIA 1W0JG 2DOSA 1K3EA 2CAZC 5D5PA 2BSKA 5KA6A 5LGNA 3Q4HA 4I9WA 4YY3O 4K8XA 2N05A 4OGQB 3JALA 4O2BA 4X89A 1K73W 5KUMA 4CBCA 1I94O 3FKSG 4H44B 3WG7C 4U3JA 4UCOA 4MT8A 2EILB 2XNDG 4F6RB 2DMXA 4O4LB 3TXQA 4B3TO 4ZKIA 3JCZA 3TJTA 4MS2A 1SQVH 3OFNG 3IJ4A 3CRRA 4CC6A 2VQFO 2R9RB 1K5QA 4IHJB 4I55A 1K5SA 3CC7V 1BS3A 3AG1B 4YXWG 4ASUG 4ZIBA 5BR8B 4UCRA 5CBHA 4LH7A 1BT8A 4NTWA 4QPKA 3QTCA 2LO1A 4DRXA 2H94A 1B3QA 4DR4B 1V9PA 1HDJA 4NTYA 2DQ0A 4DR7B 5L3EA 3U0ZA 3E89A 2QWNB 2XAQA 4PDRA 3JD4A 2JK5C 2X7RB 5IJ9A 4DR2B 4X1IA 2H8PC 2EZOA 2W6JG 4B3SO 1EM1A 1SKVA 1K97A 3BHPA 3A0BZ 4DV7B 1BL8A 4D7SA 4FLYA 4W4LA 3SJCC 1NI8A 2EJ7A 4MTGA 2LFSA 1F51A 2BSKB 3CC4V 1NH2B 4NXMB 3E8BA 1FPOA 5J2UA 4I50A 5J2TA 1IBKO 4X1YB 4PJ0Z 3HKDA 2EIJC 1GN4A 3T2MA 2IJJA 3JARB 3FB8C 3UKMA 4CH5A 4OPHA 3CMAV 1XHXA 4B3TB 3E35A 2Y0PA 1AILA 2WAMA 4KUMA 4BIZA 1YITV 4LWSB 1BZKA 1CPYA 5K1PA 5TISZ 2DWDC 2CGOA 4FLTA 3LNNA 4I5SA 5LXTA 2RQ6A 4DV1O 3SYCA 3UO3A 1OZ0A 4ICGA 2OTLV 4PI0A 1H2LA 3UQ8A 4GX0A 4JI2O 2HFEC 1KUQA 4UV9A 3TGUH 2QWQB 2ZR2A 2Q5ZA 2EJRA 3ETDA 1N33B 1NH2D 3QO7A 3B4SA 3STLC 2E74B 2RNBA 3LDCA 2HVKC 1P84F 1WNSA 2CTQA 2LW1A 1SZTA 2UXXA 1GM8A 1MA1A 1H38A 2MK3A 2A3QA 2F95B 2RJZA 4RUFA 1N33O 2WSSG 4YJ3B 1BQZA 3KCXA 5CA3A 2AZ2A 4DV5O 2HHHO 2DW4A 1IDSA 4GT1A 5LGUA 1YSCA 2HJDA 4TV8B 4WFAV 3GVMA 3D36C 3OUFA 1DLBA 4LF6B 3CCVV 4JI0O 1SESA 1L1FA 3CCRV 1GAXA 5H6RA 5HFMA 5A9GA 4DR1B 2YEVA 2YIAA 2QM8A 3A8TA 1OJHA 3K79A 2F43G 5IYZB 3OTFA 3JD0A 3M8AA 2HLDG 3T4DA 1Y4MA 4E4EA 5GONB 1QBZA 3WU2Z 3HB3B 3I5DA 3DSQA 4O4HB 1L0NH 4DV4B 4IYHA 5CN0A 3BPZA 4EB6B 3W7XA 1AVMA 3FX7A 5E79Z 2CTRA 4JI3O 3E8GA 1U97A 4DR5B 3B77A 3CRMA 2P5OA 3AG2C 2OTJV 1MMMA 4X62B 1FXKB 2HP8A 4MVQA 3RT3C 1K34A 4TWKA 4JAVA 2ZE6A 5LOVB 4GCZA 3ZHSA 5JWPA 1E79G 5KLVH 4BIOA 1YTFD 4H0LB 5KHIA 4JZGA 4J9YB 2UXDB 2YDEA 3VQWA 3WG7B 5CA1A 4LF9O 1OCZB 4K35A 2XAGA 4NKGB 2ADPA 5EK0A 3W7WA 4CS4A 1YTFB 1Q3EA 4BR6A 1M93A 4MTXA 4DR3B 2LGQA 3LSSA 2B1IA 1RPRA 4JYAO 2BCCH 4UV8A 4B08A 4JI1B 3PN1A 4KFMA 4JI0B 1XDCA 3JATA 3EXAA 4J80A 1I08A 2Q67A 2ARHA 4AQYB 2HR3A 3CX5F 2RN9A 1Y74A 4U7OA 3CXHF 2EIJB 3K59A 3CEIA 4LF8O 3NR7A 3KG2A 1I5YA 3TXSA 4DV3O 4PA6A 2UXCB 1MNGA 2Y69C 1XMQB 3K0DA 2ZQMA 1PKXA 3WB0A 3HKBA 4PDMA 4U7NA 2R9AA 3OGIB 5KMGA 2ZD9A 2CE4A 5GONA 1N0JA 5LXTB 4UUJC 1XMOB 1T5EA 2DYSC 1RM1C 1KU9A 3IFXA 1SQGA 1IBLO 3OR6C 1NKDA 4IHJA 3CSXA 3HKCB 4P9OA 2HKOA 1MZEA 5KAIZ 4J10A 3RYCB 3CCEV 4DUZB 1GN3A 5IWAB 1B04A 4R50A 3K04A 1COWG 3E22B 3QNEA 3OGCC 2WLLA 2WLJA 1Y74B 2E5LB 3OT7A 2OIGA 3W7SA 1WB8A 1H2MA 1ORQC 2EIKB 3ASNB 2LQTA 1XL4A 4J7KA 3CWBH 1XUQA 3MAQA 3BCCH 5FNVA 1SQXH 1WPBA 3AG1C 4X66O 1B06A 1SQQH 5LMUO 5JCOA 4PA3A 2PGGA 4Q6GA 3SYAA 4B7EA 3G71V 4K8ZA 3RYHA 3A0HZ 4HBNA 2Y4UA 2ZDIA 1KP3A 2CUGA 2HG5C 1WB7A 4BWAA 3T1YB 1XL6A 1VQ6V 2QTSA 3OTOO 1VQPV 1OCOC 2GBOA 2UXBB 4KXRA 4GKKO 3ZHVA 5IE9A 1ZL8A 3MHHC 1NS1A 4LH6A 2IJKA 4H13B 2VQEO 4UFZA 3ABLC 4WFBV 3HR0A 5LBQA 3MHSC 4DR4O 2A7WA 2HVJC 3JD3A 2AW9A 3H1IH 4ZOLA 4FZ0A 3ETQA 4P30A 4PDVA 1YJNV 1Q6HA 1KECA 1EN6A 4IIJA 3D3IA 2OCCB 1FXHA 1NTKH 2WLHA 3HPLC 3ZHUA 3AEIA 1PD3A 4HNAA 4JYYA 5K1XA 2Q68A 2P7TC 2GTAA 1RM1B 2UUCB 3T1CA 1DK1A 3UT5B 5B66Z 1FYJA 4CC5A 4I0XA 3K5MA 5LL6Y 5LHHA 2UUAB 3ZEDA 3ZN0A 4GX5A 1UPGA 1ZLZA 3JSNA 3FYIB 1BSMA 1W0KG 1SC5B 2XUMA 3QF7A 1VQ7V 2UUCO 4IGGA 4TQFA 3TK1A 4YJ3A 3AG4C 1RSOB 1F7YA 1SERA 1R3LC 2QWOB 4QJFB 3ABKB 2QTOA 2GTSA 2YUAA 3W7UA 1VQOV 3CYOA 5LP6B 3BFRA 3ZRWB 2KG7A 4PHZA 1SETA 3BVOA 2KKWA 3E8FA 1I0HA 1SF9A 2XASA 1VMGA 5LP6C 1Z5WA 1HR0B 3CE2A 2GUZA 3K3WA 4BW5A 1PP9H 3SDLA 5DN6G 3HKEA 4GLXA 1V55C 1V54B 2JGDB 3CC2V 1JOYA 2PUSA 3P32A 2FKXA 1JX9A 3ZBHA 4ZHQA 3ABMC 5LA6A 2BTQA 1QR9A 2YIDA 4YIPA 3ZRXA 3VQXA 2DYSB 2YS8A 3RYHB 4I4TA 3P30A 1QVGU 1DF4A 4GZRB 3HKEB 2F4VO 2QGNA 4LF6O 4F6EA 3JAKA 2L35A 2ZXWC 4RQEA 2YIBD 5KMGB 4X1IB 2BTQB 1JQ0A 2ZKOA 3SJQC 4CH3A 1GN2A 3SYPA 3BA8A 5IY5B 3ICXA 3QO8A 3ZRVA 3FYEB 2JRIA 1SRYA 4X1YA 3DXRA 5LMNB 1KKDA 5EC2C 3N27A 3U11A 3K57A 4DR6B 3A0RA 1GRJA 4UCUA 4RUEA 5KA5A 3VBBA 4JI2B 4JTCB 2BOBC 2M7WA 5IJ9B 1IBMB 4JPRA 3AK3A 4DK1A 5B1OA 4X62O 2WPDG 1AI6A 5JH7B 4NTXA 3H1KH 2GV9A 1JR9A 3M99B 3QO5A 4WBNA 3CCSV 1SS3A 2K1EA 1VF5B 4DV4O 3CCLV 1AP6A 3F7VC 2V4DA 4XDKA 4DO2A 3CJHB 4FM1A 4HZ3A 3N2KB 4RAIA 2F93B 1FXKC 3K03A 4Z2WA 2Q73A 5CA0A 1QU7A 1HW7A 1Y66A 3C3SA 1XOUA 5H9CA 2QM7A 4YJ2B 1MZFA 3ZHQA 1GN6A 2Y0IA 3BAAA 5CB4B 1NBMG 4NR1A 5KAFZ 1VQ9V 2ZE5A 2KB1A 3AG4B 5B1AC 2P4VA 1SQBH 2H3OA 4L87A 4DR1O 1M90W 2KQXA 1VQLV 1FS0G 5IY5C 1AJNA 2AZ0A 5DM6V 2UU9B 3RVYA 3SPCA 2PI4A 2ZM6O 4MTOA 4UB8Z 3ASOB 4LNUA 2EBOA 1FJGO 3U10A 3JD1A 4HAMA 4DR5O 1M4UA 5H2FZ 4BAYA 4J7JA 3CRCA 2A06H 4JYCA 5EZYA 5GW7A 1VQ4V 1S77D 5L3CA 4OX9O 4AILC 4O4JB 3AK2A 4Z1MG 2AHYA 4NYKA 5LYJB 5IYCO 3G6EV 2CH7A 1IX9A 1TVKA 4LF9B 4G27B 3JD2A 5BZBA 1GTOA 1ZAUA 1I5XA 2JS3A 4X1KB 2JVDA 3FD9A 3AG7A 3EFFK 4FFBA 2QKAA 4PD4F 2VQFB 2NR5A 2EINC 2Z0AA 1KMIZ 3I55V 5LP6A 3KKYA 1YIJV 2WLMA 1VF6A 1YJWV 1R73A 3HKBB 3O65A 3K9AA 3QG5A 1G6UA 2ITCC 1UJWB 3RFRA 3L70H 1QHTA 3JAWA 4DV3B 1RFYA 3ZIAG 2M6YA 4DXWA 5B1BC 1NT2B 5D5QA 4MVOA 2ZT9B 1FFXA 1H2SB 2O57A 4TV9B 3R66A 3ZMVA 4ZHQB 2WWWA 1SA0B 4UCTA 2NN4A 2IU3A 1YHQV 1Q82W 1BHBA 3L75H 1TGOA 1JJOA 1TAEA 4DR2O 4U3JB 1N34O 4DV7O 4JV5O 3SPJA 4O4LA 3OEHG 3RYIA 3FB5C 4G2KA 4OX9B 1J5EB 4X1KA 4WFHA 3J81N 2X0LA 1XILA 4D6TH 3W7TA 1MG1A 3ZRWA 5IYBO 3CCUV 2CTWA 1S5JA 4PV1B 4PELA 4N23A 2Q0OC 1L0LH 1BHAA 3MDSA 4JAUA 1Y67A 3SYQA 4UVCA 1H8EG 2YI8A 3BA9A 2F1MA 2Y69B 4FZ1A 1YZBA 4CZZA 5B1NA 5EYPB 4DV2O 1MOFA 4JTAB 4WBNB 4QPJA 4FM2A 4CH4A 4X88A 1VARA 1H2KA 4OXSA 3ZN1A 1PNKA 2XAHA 1EZVH 3B2EE 5CMUA 3OTOB 4UVBA 1VP7A 5C8YA 4FVMA 3OAAG 2D3OW 1VEWA 2X6CA 4FLUA 4DV2B 4XDLA 1N36O 1ZX3A 3OD4A 3D3QA 3B8MA 2E75B 1IXMA 3H1JH 2D2CB 3CHXA 4TUYB 3OMAB 1Q6UA 1VQMV 4X8AA 2B9ZA 1AI4A 2FTKA 4LNUB 2DE0X 2WA4A 3B09A 2YXYA 3ABTA 1N36B 3RN4A 4AI8A 1EN5A 4DV0O 4IL6Z 1ZL8B 2ZXWB 5KX5A 1CP9A 2V1DA 3GWOA 4H33A 1O9HA 4PA7A 1XNRB 1K33A 1AJPA 1SQPH 1WP7A 4ZOLB 2JEXA 1NR7A 3L74H 4PDLA 3ABMB 4JF3A 4LF5O 5IYDO 1F23A 1S5HC 3DC5A 5LMNO 3RYFB 2QWRB 4JI4B 1AJQA 1Q43A 2R70A 3C90A 5JJEB 4G28B 5LOVA 2VRZA 3JCUZ 3ZRSA 1IBMO 4RQFA 5CBFA 2N04A 4MTFA 1TUBB 2E76B 3SJAC
chains in the Genus database with same CATH topology
4HYOA 1R3LC 4MS2A 4QJFB 3ASNC 3ABKB 2NLJC 2QTOA 3W7UA 3OFNG 1VQOV 3CYOA 3ZRWB 2LFRA 1DF5A 3T4ZA 2R9RB 3CPWU 1SETA 1K5QA 3E8FA 2V7QG 1WPXA 1R3IC 1N8RW 2XASA 1JVMA 1K5SA 3CC7V 3AG1B 4YXWG 4LBEC 4P9PA 4ASUG 2IJIA 3K3WA 4BW5A 5CBHA 1KC8W 5FL7G 4QPKA 5DN6G 1V55C 1ZWIC 1V54B 2ZR3A 3CC2V 3ML0A 2H94A 5HFLA 4WFFA 1JJ2U 1JOYA 3P32A 4ZBMA 3CXCU 2DQ0A 1G8MA 2WLKA 1JX9A 5L3EA 1NQTA 3ABMC 3E89A 2XAQA 1QR9A 2Z3YA 4PDRA 3ZRXA 3DGEA 3JD4A 2DYSB 2JK5C 2X7RB 3P30A 3R65A 1QVGU 1QR8A 3NXSA 1DF4A 3CMEV 2ATKC 1VQNV 3ABLB 3K08A 2H8PC 2EZOA 2W6JG 2ZXWC 4BIUA 1K97A 4QNHB 4RQEA 3CCMV 1BL8A 1QLEB 4MTGA 3RBZA 2LFSA 3ABUA 1F51A 1AI5A 1JQ0A 3SJQC 4KP4A 3CC4V 3X2QC 1NH2B 3E8BA 3SYPA 5IY5B 3QO8A 5H6QA 3ZRVA 3BEHA 1QLEC 3FYEB 1SRYA 2Y48A 2EIJC 2W0FC 3T2MA 2IJJA 2XAJA 3X2QB 3FB8C 3K0GA 5EC2C 1KKDA 3UKMA 4WCEV 3CMAV 3E35A 3RVZA 1OCZC 3A0RA 1QVFU 4RUEA 2WAMA 4JGSA 4KUMA 4BIZA 1YITV 5KA5A 3VBBA 1CPYA 1R6NA 4JTCB 2C2AA 2DWDC 2BOBC 2YSUB 2M7WA 3D36A 4MVZA 4JPRA 4WF9V 1B6QA 1JCHA 1PNMA 3BY6A 5B1OA 2IH1C 2WPDG 4I5SA 2EINB 1AI6A 1OCOB 2QE7G 3IGAC 4GX2A 3M99B 3SYCA 3QO5A 1AROP 1OZ0A 3CCSV 1Q86W 2K1EA 4WFGA 2OTLV 2JIZG 1OCCC 2JJ2G 3CCLV 3F5WC 4GX0A 4P2ZA 3E2EA 2HFEC 1NR1A 3F7VC 4UV9A 1K9MW 1M9NA 2AHZA 2UXNA 5J9PC 1R6KA 2ZR2A 4N21A 4XDKA 2EJRA 4HZ3A 4DO2A 3ZCCA 1OCCB 3ETDA 4RAIA 1FXKC 3K03A 4WFEA 1NH2D 3QO7A 1Y66A 1QCEA 2WLIA 4H37A 1EFRG 5H9CA 3STLC 3FB6C 2QM7A 4LC1A 1OCRB 3LDCA 2HVKC 2GHYA 1NBMG 1G4YB 3DTUB 1CEZA 1VQ9V 1SZTA 2UXXA 1QLNA 3OE7G 1GM8A 1H38A 1PL0A 3RW0A 2MK3A 2WLIB 4MVUA 1EBOA 3LDDA 4RUFA 1F4NA 5KUKA 2KB1A 3AG4B 1GKFA 3STZC 5B1AC 3GB7C 1M1KW 2WSSG 4XDJA 1ENVA 4L87A 1J95A 5CA3A 1M90W 1GO3F 2DW4A 1VQLV 2WLLB 4GT1A 5LGUA 1FS0G 1YSCA 5IY5C 1AI7A 1AJNA 2IW5A 1TUEB 3LDEA 4WFAV 5DM6V 3AG2B 4J9ZB 1JPXA 3OUFA 1DLBA 3CCVV 1SESA 1L1FA 3CCRV 2EIMC 5H6RA 2IJHA 5HFMA 3RVYA 3SPCA 3OR7C 2PI4A 4MTOA 2YEVA 3ASOB 1V55B 2EBOA 2QM8A 4FPPA 5LHGA 1OCRC 3JYCA 1M57B 3JD1A 1E1QG 3K79A 2F43G 3G4SV 4HAMA 3JD0A 4R7CA 4R8CA 2HLDG 3T4DA 1Y4MA 4EKWA 5L3BA 4BAYA 1QBZA 1LNQA 4JYCA 5IDJA 2XAFA 1KD1W 3HB3B 5GW7A 2IU0A 3CD6V 1VQ4V 1S77D 5L3CA 1SERA 4Z1MG 2AHYA 5CN0A 3W7XA 5IYCO 1K8AW 3E8GA 5B1AB 1HWYA 1E1RG 4FIPC 3FB7C 3OMNB 3G6EV 3B77A 3AG2C 3I56V 2OTJV 4JTDB 2DQ3A 4G27B 1FXKB 3JD2A 4MVSA 4MVQA 3ZMTA 1S0VA 5BZBA 1K34A 1GTOA 2PI5A 1I5XA 4GX1A 4TWKA 3H01A 4JAVA 3WFVA 3SYOA 4GCZA 3UM7A 2NNUA 3EFFK 1E79G 1YTFD 3CCJV 1P7BA 2EINC 3SPGA 1VQKV 3I55V 4FJCC 4J9YB 2BOCC 1WLEA 2WLMA 1YIJV 2DYRC 5EBLC 3WG7B 1YJWV 1OCZB 2XAGA 1R73A 3TETA 1GM7A 4MW3A 3K9AA 2LP7A 5EK0A 3W7WA 2ITCC 1K4DC 5CBGA 1UJWB 2OT5A 1H8HG 1YTFB 4MTXA 3SPHA 2JDIG 3ZJZA 1FFTB 3LSSA 1S76D 2B1IA 1RPRA 4F4LA 3ZIAG 2B5UA 4UV8A 4DXWA 4MVMA 1MSWD 4KFMA 2OCCC 5B1BC 1K7DA 5L3DA 4MVOA 2P6JA 1M56C 2JEUA 2Q67A 3CCQV 4LCUC 1GM9A 5L3FA 2HR3A 4LP8A 3ZMVA 4JASA 4U7OA 2WWWA 1THZA 2EIJB 5EC1C 4QE9A 2IU3A 1YHQV 3KG2A 1I5YA 1Q82W 3F7YC 3LNMB 1BHBA 4PA6A 5B3SB 1KP2A 2Y69C 5LGTA 1Q81W 3ZMSA 3K0DA 1S3JA 1R3JC 1PKXA 2ZQMA 4PDMA 4MVRA 2B1GA 4U7NA 2GSMB 3SPJA 2A79B 3AG3C 5L3GA 2ZD9A 3OEHG 5B3SC 1VQ8V 3FB5C 4G2KA 1GMGA 2X6AA 2EIMB 4WFHA 1NVPB 4UUJC 2Q69A 2X0LA 2DYSC 1RM1C 2X6BA 4Q20A 3W7TA 1MG1A 3IFXA 3ZRWA 5IYBO 3CCUV 3OR6C 1KQSU 3VOUA 1NKDA 4PELA 4N23A 1M56B 3OM3B 4P9OA 2HKOA 1BHAA 2QEXV 2Z5UA 4JAUA 1NJIW 2R9IA 2Q6AA 3SYQA 1AR1B 3CCEV 3EHBB 4UVCA 3ETEA 1S72V 1H8EG 4R50A 3K04A 1COWG 3E8HA 4R6ZA 3QNEA 4PA9A 1FXVA 3OGCC 2WLLA 2Y69B 4PA4A 2WLJA 3ZMZA 4QE7A 3W7SA 4CZZA 5B1NA 1MOFA 1ORQC 4MW8A 2EIKB 3ASNB 4JTAB 1VQ5V 1YJ9V 1XL4A 4QPJA 3E83A 4X88A 4JYBA 4UXNA 4OXSA 3ZN1A 1PNKA 2XAHA 1W2BU 3AG1C 5CMUA 3K06A 3LSQA 2ZDIC 3MD0A 2ITDC 5C93A 1F4MA 4PA3A 2A0LA 5EBMC 4UVBA 1NVPD 2EZPA 3SYAA 1RPOA 2YEVB 3TCUA 5E1AC 3G71V 3OAAG 2D3OW 1ROPA 1V54C 2CK3G 2X6CA 1FXKA 3B8NA 2EILC 2JJ1G 1H2GA 1KP3A 2ZDIA 4XDLA 4UVAA 2HG5C 1YI2V 1R3KC 2HJFC 3OEEG 2QKSA 2P90A 1XL6A 3B8MA 1VQ6V 1Q7YW 1IXMA 5LHIA 1P4RA 3LUTB 3E86A 3OMAB 1VQPV 1OCOC 1VQMV 3ABKC 4X8AA 1AI4A 2FTKA 3IC7A 1EZJA 4RO2A 3MHHC 2IJKA 1GK9A 1MABG 3ABTA 2DWEC 1M57C 4MSWC 3ABLC 4WFBV 3OUSA 2EIKC 4FK5C 2ZXWB 3OW2U 1CP9A 5LBQA 2V1DA 3GWOA 2IH3C 4H33A 3MHSC 4PA7A 2HVJC 4TSFG 3PJSK 1K33A 1AJPA 2A9HA 3JD3A 1DTOA 4E2LA 2JEXA 2P67A 1NR7A 4P30A 1YJNV 4PDVA 3AG3B 4PDLA 3ABMB 4JF3A 2QA4V 2WLNA 3ASOC 1KECA 3OMIB 5IYDO 1F23A 1S5HC 3CP1A 3SPIA 3ZMUA 3D3IA 1K4CC 1BMFG 2OCCB 1FXHA 2W6IG 2WLHA 5B1BB 3HPLC 1W0JG 3AEIA 4FMTA 1AJQA 1PD3A 1K3EA 4TT3G 5KA6A 5LGNA 2Q68A 2P7TC 1OHHG 1RM1B 4I9WA 3T1CA 4G28B 4XBFA 3ETGA 3ZRSA 1PNLA 2XOKG 4X89A 5LHHA 5EBWC 1K73W 5KUMA 4CBCA 3FKSG 2DYRB 3WG7C 4RQFA 3ZN0A 4GX5A 5CBFA 4MT8A 2EILB 3FYIB 2XNDG 1K92A 1W0KG 4MTFA 4QIWF 4ZKIA 1VQ7V 3JCZA 3TK1A 3AG4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYO A;  1R3L C;  2K1E A;  4MS2 A;  4WFG A;  3ASN C;  3SYO A;  3UM7 A;  3E83 A;  3EFF K;  4X88 A;  1OCC C;  2NLJ C;  5J9P C;  3F5W C;  4OXS A;  4GX0 A;  2QTO A;  4P2Z A;  1P7B A;  3AG1 C;  2EIN C;  3K06 A;  3SPG A;  2HFE C;  3F7V C;  2ITD C;  4J9Y B;  2AHZ A;  4PA3 A;  2BOC C;  2A0L A;  2WLM A;  4XDK A;  5EBM C;  3SYA A;  4HZ3 A;  3T4Z A;  2R9R B;  3TCU A;  5E1A C;  2DYR C;  4RAI A;  5EBL C;  3E8F A;  1V54 C;  3K03 A;  1R3I C;  2X6C A;  4WFE A;  3TET A;  1JVM A;  2EIL C;  4MW3 A;  4XDL A;  5EK0 A;  2HG5 C;  1K4D C;  2ITC C;  5CBG A;  2WLI A;  4LBE C;  4H37 A;  4P9P A;  1R3K C;  3STL C;  2HJF C;  4BW5 A;  5CBH A;  3FB6 C;  2QKS A;  3LDC A;  3SPH A;  2HVK C;  3ZJZ A;  1XL6 A;  1V55 C;  1ZWI C;  1G4Y B;  4F4L A;  3LUT B;  3E86 A;  4DXW A;  1OCO C;  4MVM A;  4KFM A;  4WFF A;  2OCC C;  3ABK C;  5B1B C;  3RW0 A;  4X8A A;  2WLI B;  4MVU A;  4ZBM A;  3LDD A;  4RUF A;  5KUK A;  2WLK A;  2KB1 A;  4RO2 A;  3STZ C;  4MVO A;  5B1A C;  3GB7 C;  1M56 C;  3ABM C;  4XDJ A;  3E89 A;  2Q67 A;  4LCU C;  1J95 A;  2DWE C;  4PDR A;  4JTA B;  4LP8 A;  1M57 C;  4MSW C;  2JK5 C;  2WLL B;  3R65 A;  3ABL C;  5IY5 C;  3OUS A;  5EC1 C;  2EIK C;  2ATK C;  4QE9 A;  3KG2 A;  3F7Y C;  2IH3 C;  3K08 A;  3LNM B;  3LDE A;  4H33 A;  4PA6 A;  4PA7 A;  2H8P C;  2Y69 C;  4J9Z B;  3OUF A;  2HVJ C;  3K0D A;  3PJS K;  1R3J C;  2ZXW C;  4QNH B;  2A9H A;  2EIM C;  4MVR A;  4PDM A;  1BL8 A;  3RVY A;  3SPJ A;  2A79 B;  3AG3 C;  4MTG A;  2ZD9 A;  3RBZ A;  3SPC A;  3OR7 C;  4P30 A;  5B3S C;  3FB5 C;  4PDV A;  4MTO A;  2YEV A;  4PDL A;  3SJQ C;  3X2Q C;  2X6A A;  2WLN A;  3ASO C;  3E8B A;  4WFH A;  4UUJ C;  3SYP A;  2Q69 A;  1OCR C;  1S5H C;  3BEH A;  1QLE C;  2DYS C;  1K4C C;  3JYC A;  2X6B A;  3SPI A;  2WLH A;  3HPL C;  3IFX A;  2EIJ C;  2W0F C;  4R7C A;  4R8C A;  3T2M A;  3T4D A;  1KKD A;  3FB8 C;  3K0G A;  3OR6 C;  5EC2 C;  4EKW A;  3VOU A;  2Q68 A;  2P7T C;  3UKM A;  1LNQ A;  3RVZ A;  4I9W A;  1OCZ C;  4G28 B;  3T1C A;  4RUE A;  4P9O A;  2AHY A;  3ZRS A;  2Q6A A;  3SYQ A;  4X89 A;  4JTC B;  5EBW C;  5KUM A;  4CBC A;  2DWD C;  2BOB C;  3WG7 C;  4MVZ A;  3E8G A;  3K04 A;  4R50 A;  3E8H A;  4R6Z A;  3FB7 C;  4GX5 A;  4PA9 A;  5CBF A;  3OGC C;  2IH1 C;  2WLL A;  3AG2 C;  4JTD B;  2WLJ A;  4G27 B;  4PA4 A;  4MVQ A;  4MVS A;  3IGA C;  4MTF A;  4GX2 A;  4QE7 A;  5BZB A;  4GX1 A;  4TWK A;  3SYC A;  1ORQ C;  4MW8 A;  3AG4 C;  1XL4 A; 
#chains in the Genus database with same CATH topology
 3JAR A;  2NLJ C;  2QKC A;  4EFE A;  4JI7 B;  5KX5 B;  4B3M B;  2LFR A;  1YF2 A;  2VS0 A;  3CPW U;  4YJ2 A;  1WPX A;  1R3I C;  1N8R W;  2ZCE A;  1JVM A;  4P9P A;  4X65 O;  1KC8 W;  4CH6 A;  1OV9 A;  3JAS B;  4JI7 O;  4I4T B;  3ML0 A;  1JJ2 U;  2EUL A;  1XNR O;  4JI1 O;  4ZBM A;  5JQG B;  3CXC U;  1G8M A;  1NQT A;  2QDO A;  1YXB A;  3DGE A;  4AQY O;  4LF5 B;  1Y6X A;  2AXT Z;  2EX3 A;  3ABL B;  2GUZ B;  2CH7 B;  2PYJ A;  2RDC A;  4BIU A;  1ZUQ A;  4QNH B;  4LF4 B;  1QLE B;  3ABU A;  3C3T A;  1XQ8 A;  4KP4 A;  3X2Q C;  1ZTE A;  5IJ0 A;  1KKC A;  3JAW B;  4CS3 A;  1P49 A;  5H6Q A;  4F6R A;  1QLE C;  2JGU A;  5BXZ A;  2W0F C;  3X2Q B;  2XAJ A;  2XT9 A;  4KL1 A;  3RVZ A;  1QVF U;  5F2V O;  2JS5 A;  1NZ6 A;  2C2A A;  4MVZ A;  1B6Q A;  1JCH A;  5CB4 A;  3BY6 A;  4K0K O;  4DW1 A;  4FFK A;  2EIN B;  4I55 B;  2QE7 G;  4EB6 A;  2E5L O;  1ARO P;  1P7G A;  5IT9 N;  4WFG A;  2JJ2 G;  5BMV A;  3F5W C;  4X66 B;  2CDY A;  4P2Z A;  1ZSP A;  1M9N A;  2AHZ A;  5J9P C;  4N21 A;  1RSO A;  4JAA A;  1OCC B;  4I50 B;  1N32 O;  5IJ0 B;  4WFE A;  3CRQ A;  2Q4P A;  1QCE A;  4H37 A;  1EFR G;  2ZIN A;  5JH7 A;  3FB6 C;  4LC1 A;  1OCR B;  3RWR D;  3DTU B;  4RWU A;  4JI6 O;  1XEQ A;  1G1X B;  4I9Q A;  1CEZ A;  1KYO F;  1R6T A;  3OE7 G;  2Q9L A;  4GKK B;  1PL0 A;  3RW0 A;  2UU9 O;  2WLI B;  4MVU A;  5KHK A;  1EBO A;  3ZHT A;  1H2N A;  3STZ C;  1GKF A;  1M1K W;  3RYI B;  2ZM6 B;  3BRC A;  2VQE B;  1GO3 F;  1SZX A;  1FJG B;  4PI2 A;  1O9G A;  2IW5 A;  1AP5 A;  4AHC A;  2RMK B;  3M7M X;  4O2A A;  4J9Z B;  1JPX A;  2VWJ A;  4GKJ B;  4LWS A;  5C8Y B;  1IZ3 A;  1V55 B;  4FPP A;  5LHG A;  1X59 A;  3SGI A;  1DGS A;  1E1Q G;  3G4S V;  1XNQ O;  5GTH Z;  1Q6I A;  4R7C A;  4R8C A;  5LYJ A;  3T1H B;  1JMK C;  4EKW A;  1N34 B;  1XRE A;  5IDJ A;  1KD1 W;  2XAF A;  4DV6 O;  4JI8 B;  4UCS A;  3DXR B;  1K8A W;  4UB6 Z;  3OMN B;  2CTP A;  3I56 V;  3T1H O;  4JTD B;  2DQ3 A;  3ZMT A;  2ODM A;  2PI5 A;  4GX1 A;  2ZIO A;  5GTI Z;  2MW2 B;  3UM7 A;  4J7Z A;  5DED A;  5JVD B;  4FM0 A;  1P7B A;  2OWO A;  5LMU B;  1VQK V;  4ABM A;  4TQD A;  4JI6 B;  4FJC C;  1WLE A;  3G67 A;  1URF A;  3WB1 A;  5EBL C;  2LP7 A;  1Q5O A;  5CBG A;  2HEP A;  3SPH A;  2JDI G;  2PY5 A;  3ZJZ A;  4ZI7 B;  3KZI Z;  5AG2 A;  5IYZ A;  2B5U A;  1MSW D;  4MVM A;  1I7F A;  1TVK B;  5FNV B;  3P3N A;  1AR5 A;  4DR7 O;  1LUW A;  2ZE8 A;  2P6J A;  1M56 C;  2QJ1 A;  2JEU A;  4LP8 A;  1RP3 B;  4O4H A;  1YCI A;  2CGN A;  1NU1 H;  1KP2 A;  1YDX A;  1Q81 W;  3ZMS A;  1S3J A;  1R3J C;  2B1G A;  3JSL A;  3N2G B;  1Q90 D;  2A79 B;  3AG3 C;  1LUV A;  1VQ8 V;  3H9V A;  4JI8 O;  1D5N A;  5BY1 A;  2X6A A;  2EIM B;  4L8J A;  5JVD A;  4Q20 A;  1IBK B;  4TV9 A;  2E3C A;  4JI4 O;  2Q7G A;  1KQS U;  2FL4 A;  4DR6 O;  4YHH B;  1XHZ A;  4U3F H;  1M56 B;  3N2G A;  1QNM A;  2QEX V;  2Z5U A;  1L8D A;  4HNA B;  1HNZ B;  1NJI W;  3K9S A;  2Q6A A;  1TUB A;  3EHB B;  4LF7 B;  2K9P A;  2FML A;  4R6Z A;  2Q8V A;  1FXV A;  1N0N A;  5KHJ A;  3KCY A;  2QSA A;  1AR4 A;  2RCV A;  3E83 A;  1HNZ O;  2BE3 A;  4UXN A;  1W59 A;  2L6L A;  1W2B U;  4CS2 A;  3LSQ A;  1KB9 F;  2QM4 A;  3MD0 A;  2ITD C;  2ZE7 A;  5C93 A;  1NVP D;  4LFA O;  1EN4 A;  1WAZ A;  2CK3 G;  1V54 C;  3B8N A;  2XHB A;  4C7U A;  1H2G A;  3CB2 A;  4UVA A;  2WA3 A;  3CRA A;  5FPO A;  1R3K C;  1JFF B;  2HJF C;  1N4C A;  3OEE G;  3L72 H;  2P90 A;  4DR3 O;  1Q7Y W;  5LHI A;  4KHP B;  1SQF A;  1FD9 A;  3RYC A;  3IC7 A;  1EZJ A;  4RO2 A;  3SJB C;  1GK9 A;  2DWE C;  4DV5 B;  2HHH B;  4NVP A;  3OUS A;  2EIK C;  2GDS A;  4O2A B;  1XBL A;  3EVK A;  5EIB D;  1Z2G A;  3PJS K;  1BE3 H;  4LF4 O;  2A9H A;  2N74 A;  1DTO A;  4E2L A;  2P67 A;  2QWP B;  2QA4 V;  2WLN A;  3ASO C;  3FAV B;  3OMI B;  1VF6 C;  3HKC A;  3P3P A;  3ZMU A;  3SPI A;  1QQC A;  1XMO O;  5ITZ B;  2W6I G;  2JGD A;  5B1B B;  4FMT A;  2W0X A;  3JAL B;  4TT3 G;  1D5A A;  4BW9 A;  4J42 A;  3G6B A;  3L9D A;  1OHH G;  5H5N A;  4X64 O;  3S3W A;  4XBF A;  3JAM N;  3ETG A;  1A32 A;  1PNL A;  2XOK G;  3D8C A;  5KHH A;  2QR4 A;  5EBW C;  4JI3 B;  5FPR A;  2DYR B;  2FYU H;  3VQV A;  1BQ0 A;  4K0K B;  1K92 A;  4QIW F;  4FLW A;  3SPG A;  4HYO A;  3ASN C;  3L71 H;  3F5T A;  2OCH A;  4JI5 O;  2LW7 A;  4YIO A;  4X9Q A;  1DF5 A;  3T4Z A;  1NTM H;  2V7Q G;  1FFX B;  5B5E Z;  4LBE C;  4EEQ A;  2IJI A;  2ZIM A;  5FL7 G;  2LGW A;  1ZWI C;  2ZR3 A;  3GWK C;  5ITZ A;  5HFL A;  4WFF A;  4DRX B;  2WLK A;  4B3R B;  5EZY B;  2Z3Y A;  3QVN A;  4I7Z B;  5BR8 O;  1LR1 A;  3R65 A;  4UCV A;  1QR8 A;  3NXS A;  4OPA A;  3CME V;  2ATK C;  1VQN V;  4QGP A;  2UXC O;  3K08 A;  3BAB A;  1XMQ O;  4DYL A;  4I0X B;  3CCM V;  1JA8 A;  3UT5 A;  1GH6 A;  3J7A U;  3RBZ A;  2YXH A;  4JZ2 A;  4Z1V A;  1AI5 A;  1X4T A;  4ZI7 A;  1HNW O;  1XNQ B;  3BEH A;  1WA8 B;  2Y48 A;  1S5L Z;  2ILM A;  1WP8 A;  3K0G A;  5KHG A;  5JJJ B;  4WCE V;  3UO2 A;  1OCZ C;  4DV6 B;  4YY3 B;  4JGS A;  2Y4T A;  1HP8 A;  2IBZ H;  1R6N A;  3A2F A;  1HNW B;  2LJ2 A;  2YSU B;  4WF9 V;  3D36 A;  4DUZ O;  1PNM A;  2IH1 C;  2G38 A;  1OCO B;  3IGA C;  4GX2 A;  1U96 A;  3J80 N;  5LA6 B;  1Q86 W;  2KG7 B;  1BCC H;  2JIZ G;  4W4K A;  1OCC C;  2Q7E A;  1HNX O;  1PL4 A;  1VIB A;  4IIJ B;  3E2E A;  1IUR A;  1NR1 A;  1K9M W;  2DJV A;  3H1L H;  2UXN A;  1R6K A;  4IYI A;  3ZCC A;  4DV1 B;  5EIB C;  1M5I A;  3DC6 A;  2WLI A;  1BGY H;  3T1Y O;  1TA8 A;  2P06 A;  2AGA A;  2GHY A;  3K5O A;  1G4Y B;  2P4K A;  1QLN A;  3THO A;  4B3S B;  2ADQ B;  3LDD A;  4A5U B;  1F4N A;  5KUK A;  3GB7 C;  4XDJ A;  1ENV A;  1J95 A;  3WB2 A;  4J11 A;  2WLL B;  4NXM O;  4DV0 B;  4TOI A;  1AI7 A;  5JQG A;  1D2D A;  1TUE B;  3LDE A;  2F4V B;  1Y76 B;  3AG2 B;  4FFB B;  4JV5 B;  2EIM C;  2IJH A;  2Q0A A;  3OR7 C;  3Q4H B;  2YIC A;  1OCR C;  3IC9 A;  1M57 B;  3JYC A;  4DK0 A;  2KSD A;  5L3B A;  1LNQ A;  2IU0 A;  3CD6 V;  1HNX B;  4LF7 O;  2ETN A;  5JJN B;  3ZS8 C;  4X20 A;  2UUA O;  5J2T B;  3JAS A;  5B1A B;  1HWY A;  1E1R G;  4FIP C;  3FB7 C;  4GYC B;  4MVS A;  1S0V A;  4YHH O;  3H01 A;  3WFV A;  3SYO A;  4NXN B;  2NNU A;  3CCJ V;  4D7T A;  2IM9 A;  3K58 A;  2FB5 A;  4LFA B;  4J41 A;  3HKD B;  2BOC C;  5JCO C;  5A2Q N;  2DYR C;  2Q7H A;  1YEW A;  5J2U B;  3VQY A;  3TET A;  1GM7 A;  4MW3 A;  4FLX A;  1HR0 O;  1K4D C;  2OT5 A;  1H8H G;  4NXN O;  3FFQ A;  4O4I B;  3SR2 C;  3JAT B;  1FFT B;  1PPJ H;  1S76 D;  4F4L A;  2OCC C;  1K7D A;  4FLZ A;  1AB3 A;  5L3D A;  1R1B A;  4NB5 A;  3CCQ V;  4LCU C;  1GM9 A;  5L3F A;  4LFC B;  4JAS A;  3B40 A;  1THZ A;  5EC1 C;  4QE9 A;  4DUY O;  3RGB A;  3F7Y C;  3LNM B;  4JYA B;  2ZNJ A;  5B3S B;  4TUY A;  5DEC A;  5BMV B;  2P22 C;  5LGT A;  3FAV A;  4O4J A;  1WN7 A;  4MVR A;  2GSM B;  5L3G A;  3K5N A;  5B3S C;  4K3A A;  2F23 A;  1GMG A;  2YXL A;  1XI1 A;  1NTZ H;  1NVP B;  4LFC O;  2Q69 A;  1PV0 A;  3H1H H;  4DW0 A;  2X6B A;  2UUB O;  3ZHR A;  3VOU A;  2PTM A;  4X20 B;  4O4I A;  3ZX6 A;  4LFB B;  1KBH A;  3OM3 B;  4IT5 A;  1MSD A;  1UFI A;  3S3X A;  4LR3 A;  2R9I A;  2PZS A;  1AR1 B;  3ETE A;  1S72 V;  1FAF A;  4TV8 A;  3E8H A;  2UXD O;  4PA9 A;  2UUB B;  3AK1 A;  1IBL B;  4PA4 A;  3ZMZ A;  2VWK A;  4QE7 A;  1PM9 A;  4O2B B;  4LFB O;  4MW8 A;  1VQ5 V;  2PYL A;  1YJ9 V;  4JYB A;  1US6 A;  3JAK B;  2YC0 A;  3CS5 A;  4JI5 B;  3K06 A;  5IWA O;  4KHP O;  2ZDI C;  3O9O A;  4B3M O;  3RYF A;  1F4M A;  5EBM C;  1VF7 A;  2A0L A;  2EZP A;  4FLV A;  1RPO A;  2YEV B;  3TCU A;  1N32 B;  5E1A C;  2PF4 E;  2YIB A;  1ROP A;  3L73 H;  1FXK A;  2EIL C;  2JJ1 G;  1JFF A;  4X65 B;  1YI2 V;  1Y76 A;  3N2K A;  1FKA O;  5CA1 B;  2QKS A;  4LF8 B;  4DUY B;  2R72 A;  3E22 A;  2BTO A;  1P4R A;  3LUT B;  1WA8 A;  3E86 A;  3ABK C;  4B3R O;  2OYQ A;  1SA0 A;  2F66 C;  3UCS C;  1IXB A;  4B7K A;  1Z5V A;  1MAB G;  1WJZ A;  3LSU A;  1M57 C;  4MSW C;  2OIE A;  2XTA A;  4FK5 C;  3OW2 U;  3G80 A;  3APO A;  1IVS A;  2IH3 C;  5FLX N;  3CJH A;  2UXB O;  4TSF G;  5CA0 B;  5EYP A;  4X64 B;  1YVW A;  3K5L A;  2YI9 A;  3IAY A;  3AG3 B;  4GKJ O;  4EFB A;  1J5E O;  2DN9 A;  1CXZ B;  1Q8I A;  1I94 B;  3APQ A;  3CP1 A;  1K4C C;  1BMF G;  4GUN A;  2ZNI A;  1W0J G;  2DOS A;  1K3E A;  2CAZ C;  5D5P A;  2BSK A;  5KA6 A;  5LGN A;  3Q4H A;  4I9W A;  4YY3 O;  4K8X A;  2N05 A;  4OGQ B;  3JAL A;  4O2B A;  4X89 A;  1K73 W;  5KUM A;  4CBC A;  1I94 O;  3FKS G;  4H44 B;  3WG7 C;  4U3J A;  4UCO A;  4MT8 A;  2EIL B;  2XND G;  4F6R B;  2DMX A;  4O4L B;  3TXQ A;  4B3T O;  4ZKI A;  3JCZ A;  3TJT A;  4MS2 A;  1SQV H;  3OFN G;  3IJ4 A;  3CRR A;  4CC6 A;  2VQF O;  2R9R B;  1K5Q A;  4IHJ B;  4I55 A;  1K5S A;  3CC7 V;  1BS3 A;  3AG1 B;  4YXW G;  4ASU G;  4ZIB A;  5BR8 B;  4UCR A;  5CBH A;  4LH7 A;  1BT8 A;  4NTW A;  4QPK A;  3QTC A;  2LO1 A;  4DRX A;  2H94 A;  1B3Q A;  4DR4 B;  1V9P A;  1HDJ A;  4NTY A;  2DQ0 A;  4DR7 B;  5L3E A;  3U0Z A;  3E89 A;  2QWN B;  2XAQ A;  4PDR A;  3JD4 A;  2JK5 C;  2X7R B;  5IJ9 A;  4DR2 B;  4X1I A;  2H8P C;  2EZO A;  2W6J G;  4B3S O;  1EM1 A;  1SKV A;  1K97 A;  3BHP A;  3A0B Z;  4DV7 B;  1BL8 A;  4D7S A;  4FLY A;  4W4L A;  3SJC C;  1NI8 A;  2EJ7 A;  4MTG A;  2LFS A;  1F51 A;  2BSK B;  3CC4 V;  1NH2 B;  4NXM B;  3E8B A;  1FPO A;  5J2U A;  4I50 A;  5J2T A;  1IBK O;  4X1Y B;  4PJ0 Z;  3HKD A;  2EIJ C;  1GN4 A;  3T2M A;  2IJJ A;  3JAR B;  3FB8 C;  3UKM A;  4CH5 A;  4OPH A;  3CMA V;  1XHX A;  4B3T B;  3E35 A;  2Y0P A;  1AIL A;  2WAM A;  4KUM A;  4BIZ A;  1YIT V;  4LWS B;  1BZK A;  1CPY A;  5K1P A;  5TIS Z;  2DWD C;  2CGO A;  4FLT A;  3LNN A;  4I5S A;  5LXT A;  2RQ6 A;  4DV1 O;  3SYC A;  3UO3 A;  1OZ0 A;  4ICG A;  2OTL V;  4PI0 A;  1H2L A;  3UQ8 A;  4GX0 A;  4JI2 O;  2HFE C;  1KUQ A;  4UV9 A;  3TGU H;  2QWQ B;  2ZR2 A;  2Q5Z A;  2EJR A;  3ETD A;  1N33 B;  1NH2 D;  3QO7 A;  3B4S A;  3STL C;  2E74 B;  2RNB A;  3LDC A;  2HVK C;  1P84 F;  1WNS A;  2CTQ A;  2LW1 A;  1SZT A;  2UXX A;  1GM8 A;  1MA1 A;  1H38 A;  2MK3 A;  2A3Q A;  2F95 B;  2RJZ A;  4RUF A;  1N33 O;  2WSS G;  4YJ3 B;  1BQZ A;  3KCX A;  5CA3 A;  2AZ2 A;  4DV5 O;  2HHH O;  2DW4 A;  1IDS A;  4GT1 A;  5LGU A;  1YSC A;  2HJD A;  4TV8 B;  4WFA V;  3GVM A;  3D36 C;  3OUF A;  1DLB A;  4LF6 B;  3CCV V;  4JI0 O;  1SES A;  1L1F A;  3CCR V;  1GAX A;  5H6R A;  5HFM A;  5A9G A;  4DR1 B;  2YEV A;  2YIA A;  2QM8 A;  3A8T A;  1OJH A;  3K79 A;  2F43 G;  5IYZ B;  3OTF A;  3JD0 A;  3M8A A;  2HLD G;  3T4D A;  1Y4M A;  4E4E A;  5GON B;  1QBZ A;  3WU2 Z;  3HB3 B;  3I5D A;  3DSQ A;  4O4H B;  1L0N H;  4DV4 B;  4IYH A;  5CN0 A;  3BPZ A;  4EB6 B;  3W7X A;  1AVM A;  3FX7 A;  5E79 Z;  2CTR A;  4JI3 O;  3E8G A;  1U97 A;  4DR5 B;  3B77 A;  3CRM A;  2P5O A;  3AG2 C;  2OTJ V;  1MMM A;  4X62 B;  1FXK B;  2HP8 A;  4MVQ A;  3RT3 C;  1K34 A;  4TWK A;  4JAV A;  2ZE6 A;  5LOV B;  4GCZ A;  3ZHS A;  5JWP A;  1E79 G;  5KLV H;  4BIO A;  1YTF D;  4H0L B;  5KHI A;  4JZG A;  4J9Y B;  2UXD B;  2YDE A;  3VQW A;  3WG7 B;  5CA1 A;  4LF9 O;  1OCZ B;  4K35 A;  2XAG A;  4NKG B;  2ADP A;  5EK0 A;  3W7W A;  4CS4 A;  1YTF B;  1Q3E A;  4BR6 A;  1M93 A;  4MTX A;  4DR3 B;  2LGQ A;  3LSS A;  2B1I A;  1RPR A;  4JYA O;  2BCC H;  4UV8 A;  4B08 A;  4JI1 B;  3PN1 A;  4KFM A;  4JI0 B;  1XDC A;  3JAT A;  3EXA A;  4J80 A;  1I08 A;  2Q67 A;  2ARH A;  4AQY B;  2HR3 A;  3CX5 F;  2RN9 A;  1Y74 A;  4U7O A;  3CXH F;  2EIJ B;  3K59 A;  3CEI A;  4LF8 O;  3NR7 A;  3KG2 A;  1I5Y A;  3TXS A;  4DV3 O;  4PA6 A;  2UXC B;  1MNG A;  2Y69 C;  1XMQ B;  3K0D A;  2ZQM A;  1PKX A;  3WB0 A;  3HKB A;  4PDM A;  4U7N A;  2R9A A;  3OGI B;  5KMG A;  2ZD9 A;  2CE4 A;  5GON A;  1N0J A;  5LXT B;  4UUJ C;  1XMO B;  1T5E A;  2DYS C;  1RM1 C;  1KU9 A;  3IFX A;  1SQG A;  1IBL O;  3OR6 C;  1NKD A;  4IHJ A;  3CSX A;  3HKC B;  4P9O A;  2HKO A;  1MZE A;  5KAI Z;  4J10 A;  3RYC B;  3CCE V;  4DUZ B;  1GN3 A;  5IWA B;  1B04 A;  4R50 A;  3K04 A;  1COW G;  3E22 B;  3QNE A;  3OGC C;  2WLL A;  2WLJ A;  1Y74 B;  2E5L B;  3OT7 A;  2OIG A;  3W7S A;  1WB8 A;  1H2M A;  1ORQ C;  2EIK B;  3ASN B;  2LQT A;  1XL4 A;  4J7K A;  3CWB H;  1XUQ A;  3MAQ A;  3BCC H;  5FNV A;  1SQX H;  1WPB A;  3AG1 C;  4X66 O;  1B06 A;  1SQQ H;  5LMU O;  5JCO A;  4PA3 A;  2PGG A;  4Q6G A;  3SYA A;  4B7E A;  3G71 V;  4K8Z A;  3RYH A;  3A0H Z;  4HBN A;  2Y4U A;  2ZDI A;  1KP3 A;  2CUG A;  2HG5 C;  1WB7 A;  4BWA A;  3T1Y B;  1XL6 A;  1VQ6 V;  2QTS A;  3OTO O;  1VQP V;  1OCO C;  2GBO A;  2UXB B;  4KXR A;  4GKK O;  3ZHV A;  5IE9 A;  1ZL8 A;  3MHH C;  1NS1 A;  4LH6 A;  2IJK A;  4H13 B;  2VQE O;  4UFZ A;  3ABL C;  4WFB V;  3HR0 A;  5LBQ A;  3MHS C;  4DR4 O;  2A7W A;  2HVJ C;  3JD3 A;  2AW9 A;  3H1I H;  4ZOL A;  4FZ0 A;  3ETQ A;  4P30 A;  4PDV A;  1YJN V;  1Q6H A;  1KEC A;  1EN6 A;  4IIJ A;  3D3I A;  2OCC B;  1FXH A;  1NTK H;  2WLH A;  3HPL C;  3ZHU A;  3AEI A;  1PD3 A;  4HNA A;  4JYY A;  5K1X A;  2Q68 A;  2P7T C;  2GTA A;  1RM1 B;  2UUC B;  3T1C A;  1DK1 A;  3UT5 B;  5B66 Z;  1FYJ A;  4CC5 A;  4I0X A;  3K5M A;  5LL6 Y;  5LHH A;  2UUA B;  3ZED A;  3ZN0 A;  4GX5 A;  1UPG A;  1ZLZ A;  3JSN A;  3FYI B;  1BSM A;  1W0K G;  1SC5 B;  2XUM A;  3QF7 A;  1VQ7 V;  2UUC O;  4IGG A;  4TQF A;  3TK1 A;  4YJ3 A;  3AG4 C;  1RSO B;  1F7Y A;  1SER A;  1R3L C;  2QWO B;  4QJF B;  3ABK B;  2QTO A;  2GTS A;  2YUA A;  3W7U A;  1VQO V;  3CYO A;  5LP6 B;  3BFR A;  3ZRW B;  2KG7 A;  4PHZ A;  1SET A;  3BVO A;  2KKW A;  3E8F A;  1I0H A;  1SF9 A;  2XAS A;  1VMG A;  5LP6 C;  1Z5W A;  1HR0 B;  3CE2 A;  2GUZ A;  3K3W A;  4BW5 A;  1PP9 H;  3SDL A;  5DN6 G;  3HKE A;  4GLX A;  1V55 C;  1V54 B;  2JGD B;  3CC2 V;  1JOY A;  2PUS A;  3P32 A;  2FKX A;  1JX9 A;  3ZBH A;  4ZHQ A;  3ABM C;  5LA6 A;  2BTQ A;  1QR9 A;  2YID A;  4YIP A;  3ZRX A;  3VQX A;  2DYS B;  2YS8 A;  3RYH B;  4I4T A;  3P30 A;  1QVG U;  1DF4 A;  4GZR B;  3HKE B;  2F4V O;  2QGN A;  4LF6 O;  4F6E A;  3JAK A;  2L35 A;  2ZXW C;  4RQE A;  2YIB D;  5KMG B;  4X1I B;  2BTQ B;  1JQ0 A;  2ZKO A;  3SJQ C;  4CH3 A;  1GN2 A;  3SYP A;  3BA8 A;  5IY5 B;  3ICX A;  3QO8 A;  3ZRV A;  3FYE B;  2JRI A;  1SRY A;  4X1Y A;  3DXR A;  5LMN B;  1KKD A;  5EC2 C;  3N27 A;  3U11 A;  3K57 A;  4DR6 B;  3A0R A;  1GRJ A;  4UCU A;  4RUE A;  5KA5 A;  3VBB A;  4JI2 B;  4JTC B;  2BOB C;  2M7W A;  5IJ9 B;  1IBM B;  4JPR A;  3AK3 A;  4DK1 A;  5B1O A;  4X62 O;  2WPD G;  1AI6 A;  5JH7 B;  4NTX A;  3H1K H;  2GV9 A;  1JR9 A;  3M99 B;  3QO5 A;  4WBN A;  3CCS V;  1SS3 A;  2K1E A;  1VF5 B;  4DV4 O;  3CCL V;  1AP6 A;  3F7V C;  2V4D A;  4XDK A;  4DO2 A;  3CJH B;  4FM1 A;  4HZ3 A;  3N2K B;  4RAI A;  2F93 B;  1FXK C;  3K03 A;  4Z2W A;  2Q73 A;  5CA0 A;  1QU7 A;  1HW7 A;  1Y66 A;  3C3S A;  1XOU A;  5H9C A;  2QM7 A;  4YJ2 B;  1MZF A;  3ZHQ A;  1GN6 A;  2Y0I A;  3BAA A;  5CB4 B;  1NBM G;  4NR1 A;  5KAF Z;  1VQ9 V;  2ZE5 A;  2KB1 A;  3AG4 B;  5B1A C;  2P4V A;  1SQB H;  2H3O A;  4L87 A;  4DR1 O;  1M90 W;  2KQX A;  1VQL V;  1FS0 G;  5IY5 C;  1AJN A;  2AZ0 A;  5DM6 V;  2UU9 B;  3RVY A;  3SPC A;  2PI4 A;  2ZM6 O;  4MTO A;  4UB8 Z;  3ASO B;  4LNU A;  2EBO A;  1FJG O;  3U10 A;  3JD1 A;  4HAM A;  4DR5 O;  1M4U A;  5H2F Z;  4BAY A;  4J7J A;  3CRC A;  2A06 H;  4JYC A;  5EZY A;  5GW7 A;  1VQ4 V;  1S77 D;  5L3C A;  4OX9 O;  4AIL C;  4O4J B;  3AK2 A;  4Z1M G;  2AHY A;  4NYK A;  5LYJ B;  5IYC O;  3G6E V;  2CH7 A;  1IX9 A;  1TVK A;  4LF9 B;  4G27 B;  3JD2 A;  5BZB A;  1GTO A;  1ZAU A;  1I5X A;  2JS3 A;  4X1K B;  2JVD A;  3FD9 A;  3AG7 A;  3EFF K;  4FFB A;  2QKA A;  4PD4 F;  2VQF B;  2NR5 A;  2EIN C;  2Z0A A;  1KMI Z;  3I55 V;  5LP6 A;  3KKY A;  1YIJ V;  2WLM A;  1VF6 A;  1YJW V;  1R73 A;  3HKB B;  3O65 A;  3K9A A;  3QG5 A;  1G6U A;  2ITC C;  1UJW B;  3RFR A;  3L70 H;  1QHT A;  3JAW A;  4DV3 B;  1RFY A;  3ZIA G;  2M6Y A;  4DXW A;  5B1B C;  1NT2 B;  5D5Q A;  4MVO A;  2ZT9 B;  1FFX A;  1H2S B;  2O57 A;  4TV9 B;  3R66 A;  3ZMV A;  4ZHQ B;  2WWW A;  1SA0 B;  4UCT A;  2NN4 A;  2IU3 A;  1YHQ V;  1Q82 W;  1BHB A;  3L75 H;  1TGO A;  1JJO A;  1TAE A;  4DR2 O;  4U3J B;  1N34 O;  4DV7 O;  4JV5 O;  3SPJ A;  4O4L A;  3OEH G;  3RYI A;  3FB5 C;  4G2K A;  4OX9 B;  1J5E B;  4X1K A;  4WFH A;  3J81 N;  2X0L A;  1XIL A;  4D6T H;  3W7T A;  1MG1 A;  3ZRW A;  5IYB O;  3CCU V;  2CTW A;  1S5J A;  4PV1 B;  4PEL A;  4N23 A;  2Q0O C;  1L0L H;  1BHA A;  3MDS A;  4JAU A;  1Y67 A;  3SYQ A;  4UVC A;  1H8E G;  2YI8 A;  3BA9 A;  2F1M A;  2Y69 B;  4FZ1 A;  1YZB A;  4CZZ A;  5B1N A;  5EYP B;  4DV2 O;  1MOF A;  4JTA B;  4WBN B;  4QPJ A;  4FM2 A;  4CH4 A;  4X88 A;  1VAR A;  1H2K A;  4OXS A;  3ZN1 A;  1PNK A;  2XAH A;  1EZV H;  3B2E E;  5CMU A;  3OTO B;  4UVB A;  1VP7 A;  5C8Y A;  4FVM A;  3OAA G;  2D3O W;  1VEW A;  2X6C A;  4FLU A;  4DV2 B;  4XDL A;  1N36 O;  1ZX3 A;  3OD4 A;  3D3Q A;  3B8M A;  2E75 B;  1IXM A;  3H1J H;  2D2C B;  3CHX A;  4TUY B;  3OMA B;  1Q6U A;  1VQM V;  4X8A A;  2B9Z A;  1AI4 A;  2FTK A;  4LNU B;  2DE0 X;  2WA4 A;  3B09 A;  2YXY A;  3ABT A;  1N36 B;  3RN4 A;  4AI8 A;  1EN5 A;  4DV0 O;  4IL6 Z;  1ZL8 B;  2ZXW B;  5KX5 A;  1CP9 A;  2V1D A;  3GWO A;  4H33 A;  1O9H A;  4PA7 A;  1XNR B;  1K33 A;  1AJP A;  1SQP H;  1WP7 A;  4ZOL B;  2JEX A;  1NR7 A;  3L74 H;  4PDL A;  3ABM B;  4JF3 A;  4LF5 O;  5IYD O;  1F23 A;  1S5H C;  3DC5 A;  5LMN O;  3RYF B;  2QWR B;  4JI4 B;  1AJQ A;  1Q43 A;  2R70 A;  3C90 A;  5JJE B;  4G28 B;  5LOV A;  2VRZ A;  3JCU Z;  3ZRS A;  1IBM O;  4RQF A;  5CBF A;  2N04 A;  4MTF A;  1TUB B;  2E76 B;  3SJA C; 
#chains in the Genus database with same CATH homology
 4HYO A;  1R3L C;  4MS2 A;  4QJF B;  3ASN C;  3ABK B;  2NLJ C;  2QTO A;  3W7U A;  3OFN G;  1VQO V;  3CYO A;  3ZRW B;  2LFR A;  1DF5 A;  3T4Z A;  2R9R B;  3CPW U;  1SET A;  1K5Q A;  3E8F A;  2V7Q G;  1WPX A;  1R3I C;  1N8R W;  2XAS A;  1JVM A;  1K5S A;  3CC7 V;  3AG1 B;  4YXW G;  4LBE C;  4P9P A;  4ASU G;  2IJI A;  3K3W A;  4BW5 A;  5CBH A;  1KC8 W;  5FL7 G;  4QPK A;  5DN6 G;  1V55 C;  1ZWI C;  1V54 B;  2ZR3 A;  3CC2 V;  3ML0 A;  2H94 A;  5HFL A;  4WFF A;  1JJ2 U;  1JOY A;  3P32 A;  4ZBM A;  3CXC U;  2DQ0 A;  1G8M A;  2WLK A;  1JX9 A;  5L3E A;  1NQT A;  3ABM C;  3E89 A;  2XAQ A;  1QR9 A;  2Z3Y A;  4PDR A;  3ZRX A;  3DGE A;  3JD4 A;  2DYS B;  2JK5 C;  2X7R B;  3P30 A;  3R65 A;  1QVG U;  1QR8 A;  3NXS A;  1DF4 A;  3CME V;  2ATK C;  1VQN V;  3ABL B;  3K08 A;  2H8P C;  2EZO A;  2W6J G;  2ZXW C;  4BIU A;  1K97 A;  4QNH B;  4RQE A;  3CCM V;  1BL8 A;  1QLE B;  4MTG A;  3RBZ A;  2LFS A;  3ABU A;  1F51 A;  1AI5 A;  1JQ0 A;  3SJQ C;  4KP4 A;  3CC4 V;  3X2Q C;  1NH2 B;  3E8B A;  3SYP A;  5IY5 B;  3QO8 A;  5H6Q A;  3ZRV A;  3BEH A;  1QLE C;  3FYE B;  1SRY A;  2Y48 A;  2EIJ C;  2W0F C;  3T2M A;  2IJJ A;  2XAJ A;  3X2Q B;  3FB8 C;  3K0G A;  5EC2 C;  1KKD A;  3UKM A;  4WCE V;  3CMA V;  3E35 A;  3RVZ A;  1OCZ C;  3A0R A;  1QVF U;  4RUE A;  2WAM A;  4JGS A;  4KUM A;  4BIZ A;  1YIT V;  5KA5 A;  3VBB A;  1CPY A;  1R6N A;  4JTC B;  2C2A A;  2DWD C;  2BOB C;  2YSU B;  2M7W A;  3D36 A;  4MVZ A;  4JPR A;  4WF9 V;  1B6Q A;  1JCH A;  1PNM A;  3BY6 A;  5B1O A;  2IH1 C;  2WPD G;  4I5S A;  2EIN B;  1AI6 A;  1OCO B;  2QE7 G;  3IGA C;  4GX2 A;  3M99 B;  3SYC A;  3QO5 A;  1ARO P;  1OZ0 A;  3CCS V;  1Q86 W;  2K1E A;  4WFG A;  2OTL V;  2JIZ G;  1OCC C;  2JJ2 G;  3CCL V;  3F5W C;  4GX0 A;  4P2Z A;  3E2E A;  2HFE C;  1NR1 A;  3F7V C;  4UV9 A;  1K9M W;  1M9N A;  2AHZ A;  2UXN A;  5J9P C;  1R6K A;  2ZR2 A;  4N21 A;  4XDK A;  2EJR A;  4HZ3 A;  4DO2 A;  3ZCC A;  1OCC B;  3ETD A;  4RAI A;  1FXK C;  3K03 A;  4WFE A;  1NH2 D;  3QO7 A;  1Y66 A;  1QCE A;  2WLI A;  4H37 A;  1EFR G;  5H9C A;  3STL C;  3FB6 C;  2QM7 A;  4LC1 A;  1OCR B;  3LDC A;  2HVK C;  2GHY A;  1NBM G;  1G4Y B;  3DTU B;  1CEZ A;  1VQ9 V;  1SZT A;  2UXX A;  1QLN A;  3OE7 G;  1GM8 A;  1H38 A;  1PL0 A;  3RW0 A;  2MK3 A;  2WLI B;  4MVU A;  1EBO A;  3LDD A;  4RUF A;  1F4N A;  5KUK A;  2KB1 A;  3AG4 B;  1GKF A;  3STZ C;  5B1A C;  3GB7 C;  1M1K W;  2WSS G;  4XDJ A;  1ENV A;  4L87 A;  1J95 A;  5CA3 A;  1M90 W;  1GO3 F;  2DW4 A;  1VQL V;  2WLL B;  4GT1 A;  5LGU A;  1FS0 G;  1YSC A;  5IY5 C;  1AI7 A;  1AJN A;  2IW5 A;  1TUE B;  3LDE A;  4WFA V;  5DM6 V;  3AG2 B;  4J9Z B;  1JPX A;  3OUF A;  1DLB A;  3CCV V;  1SES A;  1L1F A;  3CCR V;  2EIM C;  5H6R A;  2IJH A;  5HFM A;  3RVY A;  3SPC A;  3OR7 C;  2PI4 A;  4MTO A;  2YEV A;  3ASO B;  1V55 B;  2EBO A;  2QM8 A;  4FPP A;  5LHG A;  1OCR C;  3JYC A;  1M57 B;  3JD1 A;  1E1Q G;  3K79 A;  2F43 G;  3G4S V;  4HAM A;  3JD0 A;  4R7C A;  4R8C A;  2HLD G;  3T4D A;  1Y4M A;  4EKW A;  5L3B A;  4BAY A;  1QBZ A;  1LNQ A;  4JYC A;  5IDJ A;  2XAF A;  1KD1 W;  3HB3 B;  5GW7 A;  2IU0 A;  3CD6 V;  1VQ4 V;  1S77 D;  5L3C A;  1SER A;  4Z1M G;  2AHY A;  5CN0 A;  3W7X A;  5IYC O;  1K8A W;  3E8G A;  5B1A B;  1HWY A;  1E1R G;  4FIP C;  3FB7 C;  3OMN B;  3G6E V;  3B77 A;  3AG2 C;  3I56 V;  2OTJ V;  4JTD B;  2DQ3 A;  4G27 B;  1FXK B;  3JD2 A;  4MVS A;  4MVQ A;  3ZMT A;  1S0V A;  5BZB A;  1K34 A;  1GTO A;  2PI5 A;  1I5X A;  4GX1 A;  4TWK A;  3H01 A;  4JAV A;  3WFV A;  3SYO A;  4GCZ A;  3UM7 A;  2NNU A;  3EFF K;  1E79 G;  1YTF D;  3CCJ V;  1P7B A;  2EIN C;  3SPG A;  1VQK V;  3I55 V;  4FJC C;  4J9Y B;  2BOC C;  1WLE A;  2WLM A;  1YIJ V;  2DYR C;  5EBL C;  3WG7 B;  1YJW V;  1OCZ B;  2XAG A;  1R73 A;  3TET A;  1GM7 A;  4MW3 A;  3K9A A;  2LP7 A;  5EK0 A;  3W7W A;  2ITC C;  1K4D C;  5CBG A;  1UJW B;  2OT5 A;  1H8H G;  1YTF B;  4MTX A;  3SPH A;  2JDI G;  3ZJZ A;  1FFT B;  3LSS A;  1S76 D;  2B1I A;  1RPR A;  4F4L A;  3ZIA G;  2B5U A;  4UV8 A;  4DXW A;  4MVM A;  1MSW D;  4KFM A;  2OCC C;  5B1B C;  1K7D A;  5L3D A;  4MVO A;  2P6J A;  1M56 C;  2JEU A;  2Q67 A;  3CCQ V;  4LCU C;  1GM9 A;  5L3F A;  2HR3 A;  4LP8 A;  3ZMV A;  4JAS A;  4U7O A;  2WWW A;  1THZ A;  2EIJ B;  5EC1 C;  4QE9 A;  2IU3 A;  1YHQ V;  3KG2 A;  1I5Y A;  1Q82 W;  3F7Y C;  3LNM B;  1BHB A;  4PA6 A;  5B3S B;  1KP2 A;  2Y69 C;  5LGT A;  1Q81 W;  3ZMS A;  3K0D A;  1S3J A;  1R3J C;  1PKX A;  2ZQM A;  4PDM A;  4MVR A;  2B1G A;  4U7N A;  2GSM B;  3SPJ A;  2A79 B;  3AG3 C;  5L3G A;  2ZD9 A;  3OEH G;  5B3S C;  1VQ8 V;  3FB5 C;  4G2K A;  1GMG A;  2X6A A;  2EIM B;  4WFH A;  1NVP B;  4UUJ C;  2Q69 A;  2X0L A;  2DYS C;  1RM1 C;  2X6B A;  4Q20 A;  3W7T A;  1MG1 A;  3IFX A;  3ZRW A;  5IYB O;  3CCU V;  3OR6 C;  1KQS U;  3VOU A;  1NKD A;  4PEL A;  4N23 A;  1M56 B;  3OM3 B;  4P9O A;  2HKO A;  1BHA A;  2QEX V;  2Z5U A;  4JAU A;  1NJI W;  2R9I A;  2Q6A A;  3SYQ A;  1AR1 B;  3CCE V;  3EHB B;  4UVC A;  3ETE A;  1S72 V;  1H8E G;  4R50 A;  3K04 A;  1COW G;  3E8H A;  4R6Z A;  3QNE A;  4PA9 A;  1FXV A;  3OGC C;  2WLL A;  2Y69 B;  4PA4 A;  2WLJ A;  3ZMZ A;  4QE7 A;  3W7S A;  4CZZ A;  5B1N A;  1MOF A;  1ORQ C;  4MW8 A;  2EIK B;  3ASN B;  4JTA B;  1VQ5 V;  1YJ9 V;  1XL4 A;  4QPJ A;  3E83 A;  4X88 A;  4JYB A;  4UXN A;  4OXS A;  3ZN1 A;  1PNK A;  2XAH A;  1W2B U;  3AG1 C;  5CMU A;  3K06 A;  3LSQ A;  2ZDI C;  3MD0 A;  2ITD C;  5C93 A;  1F4M A;  4PA3 A;  2A0L A;  5EBM C;  4UVB A;  1NVP D;  2EZP A;  3SYA A;  1RPO A;  2YEV B;  3TCU A;  5E1A C;  3G71 V;  3OAA G;  2D3O W;  1ROP A;  1V54 C;  2CK3 G;  2X6C A;  1FXK A;  3B8N A;  2EIL C;  2JJ1 G;  1H2G A;  1KP3 A;  2ZDI A;  4XDL A;  4UVA A;  2HG5 C;  1YI2 V;  1R3K C;  2HJF C;  3OEE G;  2QKS A;  2P90 A;  1XL6 A;  3B8M A;  1VQ6 V;  1Q7Y W;  1IXM A;  5LHI A;  1P4R A;  3LUT B;  3E86 A;  3OMA B;  1VQP V;  1OCO C;  1VQM V;  3ABK C;  4X8A A;  1AI4 A;  2FTK A;  3IC7 A;  1EZJ A;  4RO2 A;  3MHH C;  2IJK A;  1GK9 A;  1MAB G;  3ABT A;  2DWE C;  1M57 C;  4MSW C;  3ABL C;  4WFB V;  3OUS A;  2EIK C;  4FK5 C;  2ZXW B;  3OW2 U;  1CP9 A;  5LBQ A;  2V1D A;  3GWO A;  2IH3 C;  4H33 A;  3MHS C;  4PA7 A;  2HVJ C;  4TSF G;  3PJS K;  1K33 A;  1AJP A;  2A9H A;  3JD3 A;  1DTO A;  4E2L A;  2JEX A;  2P67 A;  1NR7 A;  4P30 A;  1YJN V;  4PDV A;  3AG3 B;  4PDL A;  3ABM B;  4JF3 A;  2QA4 V;  2WLN A;  3ASO C;  1KEC A;  3OMI B;  5IYD O;  1F23 A;  1S5H C;  3CP1 A;  3SPI A;  3ZMU A;  3D3I A;  1K4C C;  1BMF G;  2OCC B;  1FXH A;  2W6I G;  2WLH A;  5B1B B;  3HPL C;  1W0J G;  3AEI A;  4FMT A;  1AJQ A;  1PD3 A;  1K3E A;  4TT3 G;  5KA6 A;  5LGN A;  2Q68 A;  2P7T C;  1OHH G;  1RM1 B;  4I9W A;  3T1C A;  4G28 B;  4XBF A;  3ETG A;  3ZRS A;  1PNL A;  2XOK G;  4X89 A;  5LHH A;  5EBW C;  1K73 W;  5KUM A;  4CBC A;  3FKS G;  2DYR B;  3WG7 C;  4RQF A;  3ZN0 A;  4GX5 A;  5CBF A;  4MT8 A;  2EIL B;  3FYI B;  2XND G;  1K92 A;  1W0K G;  4MTF A;  4QIW F;  4ZKI A;  1VQ7 V;  3JCZ A;  3TK1 A;  3AG4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...