5CBFA

Structural and functional characterization of a calcium-activated cation channel from tsukamurella paurometabola
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
TLMFKRFFGAVRTSWRDPSTRGAVLSLAIIVTAATIFYTLAEKWSVIDSLFYAVSVGLPMGNGPLSPTLTLSKIFTLVYAILVVGLFVTVGGSLASAIVQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ion transport 2 domain protein
publication title Structural and functional characterization of a calcium-activated cation channel from Tsukamurella paurometabola.
pubmed doi rcsb
source organism Tsukamurella paurometabola (strain atcc 8368 / dsm 20162 / jcm 10117 / nbrc 1612
molecule tags Transport protein
total genus 30
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5cbfA00
2HVKC 4PDMA 4WFGA 4GX0A 5CBFA 4QE9A 4MVSA 4RO2A 1JVMA 4P9PA 4PA7A 3F5WC 2EINC 4G27B 2WLLA 4J9YB 2QKSA 3PJSK 1LNQA 3ABLC 2WLHA 3LDCA 5EC1C 3ZJZA 1KKDA 3K08A 2AHYA 3K0DA 3VOUA 2NLJC 3AG1C 3AG3C 2WLMA 1P7BA 4R7CA 3UM7A 4XDKA 2A0LA 3ABKC 1R3JC 4PDVA 3SPIA 4CBCA 3SYOA 3E89A 2HFEC 1ORQC 3BEHA 4X89A 4MW8A 1S5HC 3T2MA 5J9PC 3LNMB 3LDEA 3OR6C 5EBLC 2Q68A 3E8FA 4TWKA 4LP8A 1OCZC 3SPGA 5BZBA 4PDRA 1K4DC 2ITCC 4QE7A 4MTOA 1M56C 4MVUA 3E86A 5CBHA 2HG5C 2W0FC 3IFXA 1OCCC 2OCCC 3SYQA 4UUJC 2DWEC 3OGCC 3SPCA 1R3KC 4PA3A 3GB7C 3EFFK 3KG2A 1J95A 1XL4A 3RBZA 2BOBC 2X6BA 1OCOC 3ZRSA 2IH1C 4X8AA 1BL8A 3T1CA 3SYPA 3E8GA 5KUKA 1R3LC 3SPJA 2EIMC 4WFFA 2WLLB 4R6ZA 3OUFA 4LBEC 1OCRC 4G28B 4MVMA 4RUFA 4MW3A 3FB7C 2Q67A 3AG2C 4ZBMA 2ITDC 2IH3C 4QNHB 4BW5A 3F7VC 4H33A 2KB1A 2DWDC 2R9RB 2H8PC 3R65A 4JTDB 4PDLA 4JTAB 4LCUC 1V54C 1M57C 2Q69A 2P7TC 4P30A 2EILC 2HVJC 4HYOA 2AHZA 5EBMC 3X2QC 3FB6C 3T4DA 2WLIA 1QLEC 3FB5C 3IGAC 4MS2A 4PA9A 3STZC 2EIJC 4R8CA 1G4YB 3HPLC 5B3SC 3K04A 4WFEA 1V55C 3SYAA 4J9ZB 2QTOA 4JTCB 3AG4C 3E83A 4X88A 1XL6A 2K1EA 2Y69C 5E1AC 3LUTB 4MSWC 4PA4A 2JK5C 1K4CC 3ASOC 3ABMC 2X6AA 2BOCC 3K03A 4P9OA 3SPHA 3WG7C 2X6CA 3F7YC 4GX5A 2WLIB 4PA6A 4I9WA 2WLNA 4KFMA 2EIKC 2A9HA 2ATKC 3OUSA 3E8BA 5EK0A 3SYCA 3RVYA 2WLKA 5KUMA 5IY5C 3LDDA 4MVQA 3RVZA 1ZWIC 4H37A 3K06A 4MTGA 4GX1A 3E8HA 4RAIA 2ZXWC 4XDJA 2YEVA 4F4LA 2WLJA 2DYRC 4XDLA 3FB8C 2A79B 3K0GA 4RUEA 3SJQC 3ASNC 3TCUA 2DYSC 4OXSA 3UKMA 4MVRA 3OR7C 4WFHA 4MVOA 4R50A 5B1BC 1R3IC 5B1AC 3STLC 4GX2A 5EC2C 4EKWA 3TETA 4DXWA 2ZD9A 2Q6AA 4MVZA 5EBWC 3T4ZA 4MTFA 3RW0A 4HZ3A 2HJFC 5CBGA 4P2ZA 3JYCA
chains in the Genus database with same CATH superfamily
1NS1A 5B1OA 3JATA 3L73H 5LMUO 4J9YB 5FPRA 1YEWA 4NYKA 4H0LB 5GONB 2VQEB 3OFNG 4J80A 1K97A 1TA8A 2HFEC 4GKKB 2P6JA 2ZQMA 4YJ3A 3M7MX 4BIZA 5H5NA 1SQQH 5KHGA 4G2KA 4QE7A 1YF2A 1ZTEA 3OTFA 1WNSA 3SJAC 5B1BB 3CXCU 4QIWF 4Q6GA 4FLYA 4EB6A 2YXYA 2X6BA 1OCOC 3ZMVA 3AG7A 4WFFA 5JVDB 2QWRB 3OUFA 2BSKA 4EEQA 2UXNA 1BHBA 3JASA 4BW5A 3DXRB 1D5AA 4LCUC 2Q69A 1MOFA 2P7TC 5BXZA 3JARB 5IYBO 1N0NA 4O4JA 4DV7O 4DV6B 4OPHA 3ZHRA 4JF3A 1Q7YW 4X65B 1HW7A 2PZSA 1JFFA 4JI0O 4TOIA 1G8MA 1MABG 2GDSA 1Z5VA 2JJ1G 2RDCA 2ODMA 2UXCB 3OMIB 1E79G 2IU3A 4JV5O 3ZBHA 1M4UA 2Z3YA 3ZRVA 1LR1A 3TETA 4ZI7B 4B3SO 2JIZG 5LYJB 3JD3A 5EBWC 4FZ0A 5KHKA 3FAVA 2CTPA 1AJPA 1N32B 1E1QG 4GX0A 4LF4O 4RO2A 5IJ9B 5JQGB 2P4KA 3QTCA 4G27B 1QLNA 5B1AB 3K08A 3KKYA 3AG3C 1KD1W 2DQ3A 2YXHA 5C8YB 4JGSA 4CBCA 2KSDA 2AW9A 3BEHA 1S5HC 2EX3A 3T2MA 1X4TA 2RNBA 1S5LZ 3BY6A 3ZMSA 2UXBO 4PDRA 1XMOB 3JD2A 1AB3A 2Y0IA 3CEIA 2EJRA 1SQXH 3JCUZ 1Y4MA 1H8EG 4K8XA 2X0LA 2EBOA 4X8AA 3AK3A 5J2TA 3SPJA 3JATB 1BQZA 4J7ZA 3L74H 2IH3C 1AR1B 2XAHA 4KXRA 4JTAB 5KHHA 3CC4V 4AILC 5LMNB 1N33B 4J41A 3ZCCA 4YJ3B 1G4YB 1PM9A 3OAAG 2YDEA 3FX7A 2Y48A 5LGTA 1SQPH 1N0JA 1XEQA 2LJ2A 4WFBV 1OCOB 4RAIA 1XQ8A 3B8MA 2DYRC 5L3FA 1OJHA 1Q3EA 4CH6A 4UCOA 1EZJA 1A32A 1N4CA 2QGNA 1M5IA 3E22B 3W7UA 2OYQA 2XASA 2XOKG 2ZD9A 1NU1H 4HZ3A 5LA6B 2CGNA 4B7EA 2HVKC 1VQ5V 3RYIA 5D5PA 5D5QA 2QTSA 4B3TB 4LH6A 3IJ4A 3F5WC 5EYPB 2RJZA 2WLHA 3JSLA 3K0DA 1SZTA 2Q7HA 4JI7B 4GKJB 3CS5A 3QF7A 3UQ8A 4I50A 4LFBO 4LF6O 2P67A 2XNDG 4J10A 5H6QA 3OR6C 1NJIW 4DR5O 2RN9A 1QHTA 4E4EA 2DMXA 1VQKV 1IBMB 2CAZC 5CA1B 1GM8A 3CCVV 5EIBD 3KG2A 2V4DA 4WF9V 2IH1C 2GTAA 2LP7A 3E8GA 3MHHC 4YHHB 4LFAO 4MW3A 1S0VA 3UO2A 1IBLB 1KMIZ 2OCHA 3AG3B 2DE0X 3ZX6A 1Q6IA 3NR7A 1MNGA 2HVJC 1L1FA 4D7SA 3OT7A 2VQFB 1OCRB 4PA9A 4DR4B 4NXMB 4AI8A 1Y6XA 3CJHA 2Q5ZA 1L0NH 1AI4A 2ZE5A 1K92A 4JI5B 5LHGA 1KKCA 3JCZA 1SQFA 2UXDO 3SDLA 3VQVA 3E2EA 1MZEA 4JI1O 4KHPB 3F7YC 4J7JA 4DO2A 5LMUB 4IGGA 4ASUG 1SESA 4GX1A 2QKCA 4DV4O 3TGUH 2XAGA 2DYSC 2ZDIA 4OXSA 3N2KA 2W6JG 5EIBC 4EKWA 5ITZA 4DXWA 2FMLA 4DR7B 2QM4A 3CWBH 4Z2WA 2CUGA 2YIBD 2IJHA 4UV9A 5LL6Y 3JALA 3MDSA 1KUQA 1JVMA 2YICA 2EINC 4DV0B 1NZ6A 1LNQA 4AHCA 2KG7A 1VQNV 2R9IA 3U10A 5IWAO 1WA8A 2D3OW 1GN4A 2VS0A 4OPAA 4HNAB 2PUSA 3MD0A 2B1GA 4JI6O 4YXWG 4MW8A 2JEXA 1MSDA 2AZ0A 5KAFZ 4I9QA 1W59A 1XDCA 1IDSA 1TUBB 1QU7A 4O4HB 3ZHSA 2ZE7A 3SPCA 4DV3B 4GCZA 1PNKA 1XUQA 3EXAA 2HEPA 1KP2A 1R3LC 2AZ2A 4R6ZA 4G28B 3OEEG 4RUFA 4LF8B 1D2DA 4JTDB 2HHHO 3ETDA 1V54C 4HYOA 3X2QC 1RM1C 3WFVA 4NR1A 2YI8A 4DK1A 1MA1A 2QEXV 3HPLC 1HNXO 4JTCB 1AI6A 3E83A 4FMTA 4CZZA 2PI4A 4B3SB 3THOA 1EN5A 4N21A 5GTHZ 2DQ0A 1NR7A 4B3RO 1P49A 3CMEV 4LWSB 4NTYA 4X1IB 2B5UA 4N23A 1XNRO 4MVQA 5LGNA 1XHXA 4JI3O 4FLTA 4UCRA 1I5YA 3BA9A 4FLZA 4IIJB 1WAZA 4DR2B 3QG5A 4FFBB 4DUZB 1HR0O 2OTJV 1VMGA 3HKBA 3C90A 5J2UB 2LGWA 3Q4HA 4NTXA 3CC7V 4JYAB 1X59A 4PA7A 4MTXA 4I7ZB 2RMKB 1GRJA 2UUCO 1FPOA 5JCOC 1WB8A 5JH7B 2G38A 2KKWA 2YUAA 1P4RA 3ABKC 2Y4TA 2DOSA 3SPIA 3E89A 4JZ2A 2YIDA 1N8RW 3G80A 3FKSG 1EBOA 4JI2O 4BAYA 1I0HA 2OT5A 2DYSB 5JVDA 3IFXA 1YSCA 1WP8A 4EFEA 4AQYO 1FAFA 3DXRA 2GHYA 1WJZA 2P90A 4FM2A 4X66O 2ZR2A 3FYEB 1BSMA 3JALB 5F2VO 3JARA 4WCEV 2EINB 2Q0OC 3P30A 4ZKIA 2IJKA 4HBNA 3RYCA 2EZOA 2DN9A 4O4LB 1T5EA 4IYHA 5DM6V 1TUEB 4LF9O 1W0JG 2H3OA 3FB6C 3TXSA 4EFBA 1Y67A 3T4DA 5IE9A 1JQ0A 3GWOA 4ZOLB 3C3SA 2LW1A 4GZRB 4YY3O 3OTOB 1BS3A 4QJFB 1M57B 3A0HZ 4UCVA 3K59A 2JEUA 1JA8A 2AGAA 5L3DA 2ATKC 1PNMA 3KCXA 3R66A 4LFCB 4YIOA 4ZI7A 1R1BA 1PL4A 1UFIA 2B1IA 4L8JA 2YEVA 2ZINA 1GM9A 2JGDA 1Q6UA 4JAAA 5IJ9A 5JQGA 4BWAA 4DV2B 5B1AC 4TV9B 3STLC 5EC2C 1VQ7V 2Q6AA 1I94O 2PI5A 1Q8IA 1YIJV 5CBGA 3JYCA 1RM1B 3KCYA 1NQTA 1H2GA 5C8YA 4NTWA 2Q4PA 1FXVA 2F66C 3L75H 3T1YO 3RYFB 3VQYA 2L35A 4CS4A 5BR8O 2E3CA 1PL0A 1F4MA 2R70A 2F4VO 4HAMA 4LFAB 1NR1A 2ZKOA 3LSQA 2ZIOA 1KQSU 3DC5A 3SPGA 3VQXA 2E74B 4FFKA 1N34B 4LR3A 1NVPD 5A9GA 1YDXA 3HKBB 5BY1A 3EFFK 3K5LA 1WB7A 3Q4HB 1J5EO 3L70H 5FL7G 1R73A 1XREA 2UXDB 4MVMA 4JI8O 4CH5A 2QDOA 2ITDC 4CC5A 1WPXA 2CDYA 1B04A 4PDLA 2QSAA 2C2AA 1W2BU 4KL1A 3ABKB 3I55V 1K5SA 3J81N 3LNNA 4K0KB 4PHZA 3ZEDA 5CB4B 4DV4B 5HFMA 3IGAC 3ABTA 1VF5B 3APQA 2Q7GA 2R72A 3WB1A 2JK5C 1SRYA 1FFXA 3K03A 4B08A 4U7NA 3ZMTA 2X6CA 1MZFA 1PP9H 4IHJB 1KYOF 5KUMA 3E22A 3RWRD 1IURA 3HR0A 3CX5F 3L9DA 4XDJA 5LA6A 3BHPA 4YJ2A 2A79B 2CTRA 3B77A 5B66Z 5L3BA 1S72V 3RYCB 2QWOB 5EYPA 4WFHA 1XHZA 1JOYA 1ZL8B 2W0XA 5L3CA 3AK2A 1ZSPA 5LP6C 5CBFA 3N2GA 3QO8A 1JX9A 2QR4A 3LDCA 3P3PA 1KKDA 4O2AA 3CSXA 3G6BA 1URFA 1HNZO 2P5OA 5CA1A 2HP8A 2ZNJA 2P22C 4DR1B 2YEVB 1YI2V 3E8FA 5KHJA 1B6QA 4TWKA 2UU9O 5L3GA 2JGDB 1NI8A 3WB0A 1N36O 4U3JB 2UUAB 1BL8A 3BFRA 4DV1O 2EIMC 1OCRC 4B3RB 4ZBMA 1VARA 4X62O 4NXNO 4L87A 3CCSV 4JI4O 1K34A 1VQOV 1Q43A 1I08A 4LH7A 4QPKA 3CCEV 1O9HA 3STZC 2V7QG 2RCVA 1V55C 4J9ZB 2BTQB 4DR3B 3ABMC 1NBMG 4JASA 2Y0PA 5IYZB 3K9AA 4TQFA 2GBOA 2GV9A 4LF5B 4RUEA 1FJGO 4D6TH 4B3MO 3LSSA 4R50A 2QA4V 1IBKB 1K3EA 3UM7A 3G4SV 3UCSC 2VWJA 3CB2A 4CS3A 4HNAA 3FFQA 2QWQB 4UVCA 2QM7A 4ZIBA 1FFXB 1GTOA 1ZLZA 3H9VA 4U3FH 4R7CA 3K3WA 4DW1A 4X66B 3I5DA 4DUYO 1TUBA 4O4HA 2UUBO 4UCSA 5IDJA 1XILA 2L6LA 3CXHF 4YJ2B 3HKCA 1P84F 1AJNA 1HP8A 1NVPB 1FFTB 3A0RA 3L72H 5EZYB 2CGOA 3RYHB 2ZM6O 4KUMA 3WU2Z 4UCTA 1SS3A 1Q81W 5LP6B 3ZIAG 4JAUA 3N2GB 4UXNA 1FXHA 1QCEA 3OD4A 1AI5A 4O2AB 3ETQA 4DRXA 4LNUB 1YTFB 1TAEA 3W7TA 1HDJA 4X64O 3CCQV 3RT3C 4LWSA 4X1IA 4X20B 1M93A 3M99B 3ML0A 1HWYA 3FD9A 3OM3B 2H94A 2Z5UA 4FLXA 1IXBA 1Y74A 2BTOA 4IIJA 4KFMA 2A9HA 1TGOA 4FFBA 2DW4A 2Q73A 3LDDA 3T1YB 3CRRA 2YI9A 3BVOA 1GO3F 1S77D 5J2UA 2EIMB 5BR8B 1H2SB 3ASNC 1XBLA 3TXQA 3O9OA 2EULA 5JJJB 3U0ZA 1GK9A 4NB5A 4DK0A 3T4ZA 3QO5A 3OMNB 1G6UA 5JH7A 4JYBA 4W4KA 2Z0AA 4QE9A 4MVSA 4I0XA 1BQ0A 1V55B 3B2EE 1MG1A 3CRQA 3TK1A 1O9GA 4PELA 5EC1C 3ABMB 3SJBC 5LOVB 1DGSA 2CTQA 1FD9A 2VQEO 1J5EB 2A06H 4X9QA 5C93A 3JAWB 4JI8B 3M8AA 4LF7O 1YJNV 1FXKC 4IL6Z 1OZ0A 5BZBA 1M9NA 2YS8A 1F7YA 4MTOA 1QBZA 2YXLA 2E5LO 3CCMV 1R3KC 1PD3A 4FJCC 4FK5C 1J95A 4O4LA 1Q82W 4OGQB 3ZRSA 4XBFA 4GLXA 5KLVH 1S76D 1L0LH 1NH2B 3AG2C 4ZOLA 4WBNB 3HKEB 2IJJA 1M57C 1SZXA 3UT5B 2F1MA 1Y76B 3BABA 3J7AU 2XHBA 4DV7B 1E1RG 4DV6O 1QLEC 2WWWA 2VRZA 2PGGA 2DJVA 4NVPA 4F6RB 3HKCB 1DTOA 1JPXA 3K57A 2OIEA 4I4TA 2X6AA 1RP3B 5JJEB 4JI0B 3WG7C 2XUMA 2WLNA 3E35A 1OHHG 3E8BA 2PF4E 4DV5O 4TV9A 4QGPA 1BGYH 1VQ8V 3K06A 4MTGA 3OW2U 2UXCO 1VQ9V 2YIBA 2RQ6A 4O4IA 2OWOA 3HB3B 1XNQO 3WB2A 1HNZB 4JV5B 4DRXB 2EIKB 2LO1A 5FNVB 4DW0A 4GX2A 2CTWA 3RYFA 2PYLA 4TQDA 1IXMA 3AEIA 4Z1MG 3CP1A 2X7RB 1N32O 2ZE8A 4LF4B 3K79A 1RSOB 4DR6O 3A0BZ 1G1XB 5CA3A 3P32A 3AG1C 5K1PA 5LHHA 1Y74B 3CCLV 4DV1B 1YXBA 1DF5A 2YSUB 3ZRWB 1ORQC 1SERA 4TUYB 2N74A 4I55B 2UXBB 1XMOO 3ASNB 2ITCC 3ICXA 3E86A 2JVDA 2DWEC 1S5JA 5H2FZ 5LBQA 3A8TA 1EFRG 5JCOA 4OX9O 1R6NA 1NT2B 2Q8VA 2WSSG 3T1CA 4I0XB 3ZHTA 3CCJV 5CB4A 3K9SA 4QNHB 2DWDC 2CH7B 1AR4A 3PN1A 3VQWA 1Q5OA 5FPOA 3LSUA 4IT5A 1FJGB 3FB5C 3KZIZ 3W7XA 4IHJA 4O2BB 3SGIA 1EZVH 2R9AA 4X88A 2MK3A 1FXKB 4ICGA 5CA0B 1K4CC 1V9PA 1Z5WA 2WLIB 4PD4F 1FYJA 2BCCH 2ILMA 1GH6A 1ROPA 4H37A 1ZL8A 2ZXWC 3I56V 1LUVA 2LW7A 3AG2B 5H6RA 1EM1A 3DSQA 1IZ3A 1QR8A 1R3IC 1Y66A 5CMUA 5LHIA 1NKDA 3G67A 2HKOA 2B9ZA 4GYCB 1BE3H 3D36C 3D36A 1QLEB 4B3TO 4P9PA 1AI7A 2ZM6B 3SJCC 4I4TB 4CH4A 3VOUA 1H2KA 4JI7O 3WG7B 2M6YA 4GKJO 4FPPA 2UXXA 2FTKA 4U3JA 1SETA 4LFBB 4LF6B 2PYJA 4BR6A 4O4IB 5IJ0B 1QVFU 5IYDO 1BZKA 3T1HO 2QWPB 4DR5B 1BT8A 1IBMO 5CBHA 2IW5A 4CH3A 2O57A 3OGCC 1SQGA 4PA3A 2K9PA 5KAIZ 1HNWO 1RPRA 5H9CA 1AP5A 2F93B 1GKFA 2GUZA 1OCZB 1KECA 2XT9A 1YITV 4YHHO 4J7KA 1IBLO 2P4VA 4WFAV 2R9RB 3AG1B 1GM7A 2BTQA 3D3QA 1CXZB 2M7WA 1H2NA 2ZCEA 2VQFO 1VF6C 3D8CA 2N05A 1VF6A 4NXMO 2QWNB 3BA8A 4JI5O 2QTOA 1EN6A 3AG4C 3H1LH 5DEDA 4UFZA 2Y69C 5IYZA 4X1YB 1AVMA 1AILA 1COWG 2ETNA 3SPHA 4JI1B 3RFRA 3J80N 3BAAA 2LQTA 4I9WA 1NTMH 1RFYA 4ZHQB 4XDLA 1YTFD 1H2LA 1VIBA 1YCIA 3IAYA 4MT8A 3ABUA 5JJNB 4W4LA 4GUNA 4LF7B 3TJTA 2XTAA 4DR7O 1U97A 1KB9F 3F5TA 4WFGA 4FLVA 2MW2B 5LXTB 5E79Z 5BMVA 4DV0O 1F23A 2QKSA 2E5LB 3ABLC 1F51A 1VP7A 4J42A 1WP7A 2AHYA 3JD1A 1K8AW 5IWAB 4PDVA 1GN2A 4FLUA 5KX5B 5EZYA 2GSMB 4JI6B 3RYHA 4TV8B 2WA4A 2ZXWB 2Q68A 4IYIA 5LP6A 3GWKC 4UUJC 3VBBA 4KP4A 4DV3O 3DGEA 4FZ1A 3BRCA 1PNLA 4LNUA 1GN3A 3CCRV 3ZN1A 5B5EZ 1JJOA 3B4SA 4RQFA 1JMKC 4LF8O 1NTKH 1XMQO 2XAQA 4X20A 5AG2A 4DV5B 2HHHB 1VQ6V 1Q90D 1QNMA 2YC0A 2ARHA 4UVAA 4FLWA 4PI0A 1XNQB 2JGUA 1IVSA 2EIJC 1H38A 1FS0G 2BE3A 4FIPC 1HNXB 2LFRA 3LUTB 4MSWC 1UJWB 4ABMA 1YJWV 1SC5B 3A2FA 1SA0A 3G71V 5KMGB 1NH2D 3HKDB 4DR6B 5EK0A 4K3AA 3RVYA 1XNRB 5IY5C 3RVZA 2GUZB 1K5QA 1VQLV 4JI3B 4BIUA 3FB8C 3K0GA 5KHIA 3TCUA 4PI2A 1Q86W 2F23A 3L71H 3D3IA 2XAFA 4X1KB 4DR2O 4DUZO 4UB8Z 1HR0B 4UB6Z 4MTFA 2ZT9B 3RW0A 1DLBA 2E76B 4UCUA 2OIGA 5LOVA 4P2ZA 5K1XA 4JYAO 2WLLA 3JAWA 1K7DA 3UO3A 3AG4B 2Y69B 3ETEA 2UUCB 1LUWA 4FM0A 1ZUQA 3H1IH 4JZGA 2F43G 4OX9B 1PKXA 2A0LA 2V1DA 4JI2B 2HLDG 5EBLC 1MSWD 4LP8A 3B8NA 1I7FA 2HG5C 2W0FC 2OCCC 4D7TA 4UV8A 2IM9A 1IX9A 4C7UA 4WBNA 4AQYB 1QVGU 2QE7G 4TT3G 3HKEA 1SKVA 2BOBC 4NKGB 3UT5A 1WPBA 3RN4A 5BMVB 3OGIB 1Y76A 4LBEC 3FB7C 1RPOA 1K9MW 3ABLB 1U96A 4EB6B 4F6RA 1QQCA 2EILC 4UVBA 3W7WA 2AHZA 5EBMC 4LF9B 2BSKB 2AXTZ 5JWPA 3B40A 3JASB 3K04A 3OTOO 4YY3B 5E1AC 3ZMZA 2WA3A 2KQXA 2K1EA 5GW7A 2NN4A 5KA5A 3ASOC 1NTZH 1R6KA 1KBHA 2NR5A 4O4JB 3FYIB 4GX5A 1WN7A 4PA6A 2EIKC 5FNVA 1B06A 4RWUA 4B7KA 4LFCO 2WLKA 3CMAV 2FYUH 3N27A 3IC7A 1JFFB 5GTIZ 3ZS8C 3JAKA 3SJQC 4E2LA 3CD6V 1RSOA 4DV2O 2QKAA 1JR9A 1I94B 1ZAUA 4PDMA 3T1HB 2EIJB 3ZRWA 3PJSK 3K58A 1B3QA 2NLJC 3DTUB 3FAVB 1HNWB 4TUYA 1P7BA 2YIAA 4I55A 1SA0B 1VQPV 1R3JC 3P3NA 5LGUA 2F4VB 5IY5B 3K5NA 1US6A 5J9PC 2HJDA 3ZN0A 1PV0A 3QO7A 2LGQA 2CK3G 2JJ2G 1N34O 2PY5A 1OCCC 4F6EA 4K8ZA 4PV1B 3GB7C 1XL4A 2CH7A 2EJ7A 1GAXA 2WLLB 5L3EA 1SF9A 4GKKO 1YVWA 2W6IG 2Q67A 4O2BA 3S3XA 1KU9A 2ZR3A 1M1KW 2Q9LA 3K5OA 4H33A 3EVKA 3ZRXA 1FXKA 5CA0A 2A7WA 1ENVA 4Q20A 5DN6G 5J2TB 4K0KO 3OMAB 2WLIA 2PTMA 2ZDIC 5B3SC 5IYCO 1UPGA 5B1NA 3CCUV 5A2QN 3S3WA 1DK1A 2OCCB 1VQ4V 1Z2GA 2D2CB 3SYCA 2GTSA 1YJ9V 2Q7EA 4F4LA 1GMGA 2CE4A 1ZX3A 5HFLA 4CS2A 3UKMA 4MVRA 3OR7C 4MVOA 4X65O 2EILB 1GN6A 2DYRB 2Q0AA 1S3JA 3RGBA 3SR2C 4DYLA 2JS3A 1BCCH 3ZJZA 3ASOB 4BIOA 2P06A 3H1JH 1VQMV 5IJ0A 3RYIB 4XDKA 3MHSC 1AR5A 3ZMUA 4JAVA 1FKAO 1PPJH 1XMQB 4DR1O 3LNMB 3CRCA 3JAKB 1SQVH 2UU9B 1OCZC 2NNUA 2JDIG 3JSNA 3NXSA 1M56C 3H1KH 4MVUA 1N36B 5TISZ 3SYQA 1H8HG 4I50B 1XI1A 3ETGA 1TVKA 2UUAO 1XOUA 3RBZA 2N04A 2ZNIA 3JAMN 3JD4A 2FKXA 4YIPA 1JJ2U 4BW9A 1KC8W 3OE7G 1AJQA 4X62B 4NXNB 2KB1A 2H8PC 3R65A 4JI4B 4X1YA 3DC6A 4JPRA 3OEHG 2VWKA 4JYYA 4U7OA 3O65A 1D5NA 4MS2A 2Y4UA 1SQBH 3SYAA 2FL4A 2ZIMA 2ZE6A 4DR3O 2OTLV 4ZHQA 1AP6A 2BOCC 1CEZA 4P9OA 4K35A 3G6EV 5GONA 1DF4A 1OCCB 2LFSA 3CE2A 3CJHB 3BPZA 1THZA 3CPWU 3GVMA 4FM1A 2WLJA 3QNEA 2A3QA 5LMNO 4LF5O 4I5SA 1N33O 5LXTA 4B3MB 1P7GA 5B1BC 1M90W 3ZHUA 2QJ1A 4LC1A 3CHXA 1IBKO 1I5XA 2HJFC 2JS5A 2ADQB 1AROP 1OV9A 1R6TA 1EN4A 5B3SB 3N2KB 2FB5A 5KX5A 5ITZB 1F4NA 1Q6HA 4TV8A 3H1HH 1QR9A 2WLMA 1K33A 2QM8A 4DUYB 2F95B 2UUBB 3IC9A 3QVNA 3SYOA 2ADPA 3C3TA 3B09A 4X89A 3LDEA 1YHQV 5FLXN 2KG7B 2HR3A 1W0KG 1JCHA 4J11A 1K4DC 1WA8B 1CP9A 2XAJA 1MMMA 1K73W 1BMFG 3SYPA 5KUKA 3CC2V 1YZBA 4TSFG 4Z1VA 3CRAA 3ZHQA 3F7VC 3CYOA 1BHAA 1VEWA 4P30A 5LYJA 4RQEA 2JRIA 1L8DA 4PJ0Z 5KA6A 2E75B 4X64B 4FVMA 5KMGA 3HKDA 4R8CA 3BCCH 5IT9N 4WFEA 3EHBB 1XL6A 3CRMA 3MAQA 4PA4A 1V54B 3AK1A 1WLEA 3JD0A 1M56B 3X2QB 2EZPA 1TVKB 4H13B 4X1KA 4QPJA 3OUSA 2IBZH 4GT1A 1CPYA 5DECA 3ZHVA 2WAMA 1H2MA 1ZWIC 3E8HA 3H01A 2WPDG 3APOA 4DR4O 2IU0A 2IJIA 3K5MA 4A5UB 4H44B 1KP3A 4CC6A 3U11A 3W7SA 4MVZA 1VF7A 5CN0A 4JYCA 4KHPO
chains in the Genus database with same CATH topology
5B1OA 3CC7V 4QE9A 4MVSA 4PA7A 4J9YB 2WLLA 1V55B 4MTXA 1K7DA 3AG4B 1MG1A 2Y69B 3TK1A 3ETEA 4PELA 5EC1C 3ABMB 2F43G 1P4RA 1PKXA 2A0LA 3OFNG 3ABKC 1K97A 3SPIA 5C93A 2V1DA 3E89A 2HFEC 1N8RW 2P6JA 2ZQMA 3FKSG 1EBOA 1YJNV 2HLDG 1FXKC 5EBLC 4BIZA 1MSWD 4LP8A 1OZ0A 4BAYA 5BZBA 3B8NA 4G2KA 1M9NA 2OT5A 4QE7A 4MTOA 2DYSB 1QBZA 2HG5C 2W0FC 3IFXA 1YSCA 2OCCC 5B1BB 4UV8A 3CXCU 3CCMV 1R3KC 4QIWF 1QVGU 2QE7G 1PD3A 4FJCC 4FK5C 1J95A 4TT3G 2GHYA 2BOBC 2P90A 2X6BA 1Q82W 1OCOC 3ZRSA 2ZR2A 4XBFA 3FYEB 3ZMVA 4WFFA 1S76D 3OUFA 4LBEC 2EINB 4WCEV 1NH2B 3P30A 3FB7C 3AG2C 1RPOA 4ZKIA 1K9MW 2IJKA 2UXNA 3ABLB 1BHBA 4BW5A 2EZOA 2IJJA 4LCUC 1M57C 2Q69A 1MOFA 2P7TC 5DM6V 1TUEB 2EILC 4UVBA 3W7WA 2AHZA 5IYBO 5EBMC 1W0JG 3FB6C 1E1RG 3T4DA 1QLEC 1JQ0A 2WWWA 3GWOA 3K04A 4JF3A 1Q7YW 5E1AC 3ZMZA 2K1EA 5GW7A 5KA5A 1DTOA 1JPXA 4QJFB 1M57B 3ASOC 2X6AA 1R6KA 2JEUA 3WG7C 3FYIB 4GX5A 4PA6A 5L3DA 2WLNA 3E35A 2EIKC 1OHHG 2ATKC 1G8MA 3E8BA 1PNMA 1MABG 2WLKA 2JJ1G 3CMAV 1VQ8V 3K06A 4MTGA 3OW2U 3IC7A 2B1IA 1VQ9V 2YEVA 3OMIB 3HB3B 1E79G 3SJQC 1GM9A 4E2LA 3CD6V 2IU3A 2EIKB 2Z3YA 3ZRVA 3TETA 5B1AC 3STLC 4GX2A 5EC2C 1VQ7V 2JIZG 2Q6AA 3JD3A 5EBWC 2PI5A 1IXMA 3AEIA 4Z1MG 1YIJV 3CP1A 5CBGA 2X7RB 1AJPA 3JYCA 4PDMA 1RM1B 1E1QG 1NQTA 4GX0A 3K79A 1H2GA 4RO2A 2EIJB 4G27B 3ZRWA 1FXVA 1QLNA 3PJSK 5B1AB 5CA3A 3P32A 3K08A 2NLJC 3AG1C 3AG3C 3DTUB 1P7BA 1KD1W 2DQ3A 5LHHA 3CCLV 1VQPV 1R3JC 4JGSA 4CBCA 1DF5A 1F4MA 1PL0A 5LGUA 2YSUB 3ZRWB 4HAMA 1ORQC 1NR1A 3BEHA 1SERA 5IY5B 3LSQA 1S5HC 3T2MA 5J9PC 3ZN0A 3BY6A 3QO7A 3ZMSA 1KQSU 3SPGA 2CK3G 4PDRA 2JJ2G 3ASNB 3JD2A 2ITCC 3E86A 1OCCC 2EJRA 1NVPD 2DWEC 1Y4MA 5LBQA 3GB7C 1H8EG 1EFRG 3EFFK 1XL4A 2X0LA 1R6NA 2EBOA 4X8AA 5FL7G 1R73A 2WSSG 3T1CA 3SPJA 2WLLB 5L3EA 3CCJV 4MVMA 2W6IG 2Q67A 2ITDC 2IH3C 4QNHB 1WPXA 2ZR3A 1AR1B 1M1KW 4H33A 3ZRXA 2DWDC 2XAHA 4PDLA 1FXKA 2C2AA 4JTAB 1W2BU 3CC4V 3ABKB 3I55V 1ENVA 1K5SA 4Q20A 5DN6G 3OMAB 5HFMA 2WLIA 3IGAC 3FB5C 3ABTA 3ZCCA 3W7XA 2ZDIC 1G4YB 5B3SC 3OAAG 5IYCO 4X88A 2MK3A 1FXKB 2JK5C 1K4CC 5B1NA 1SRYA 3CCUV 3K03A 4U7NA 3ZMTA 2Y48A 2X6CA 5LGTA 2OCCB 1VQ4V 2WLIB 3SYCA 5KUMA 4WFBV 1ROPA 1OCOB 4H37A 1YJ9V 4RAIA 2ZXWC 4XDJA 1GMGA 3B8MA 4F4LA 2DYRC 3I56V 5L3FA 2A79B 5HFLA 3AG2B 3B77A 1EZJA 5L3BA 5H6RA 1S72V 3UKMA 4MVRA 3OR7C 4WFHA 4MVOA 1QR8A 1R3IC 3W7UA 1JOYA 1Y66A 2XASA 2XOKG 2ZD9A 5CMUA 5LHIA 1NKDA 4HZ3A 2EILB 5L3CA 2HKOA 2DYRB 2HVKC 1VQ5V 1S3JA 5CBFA 3D36A 1QLEB 4P9PA 3F5WC 3QO8A 1JX9A 1AI7A 3LDCA 2WLHA 3ZJZA 1KKDA 3ASOB 3K0DA 3VOUA 1SZTA 1VQMV 3WG7B 4XDKA 3MHSC 4FPPA 2UXXA 3ZMUA 2FTKA 4JAVA 1SETA 3LNMB 2P67A 2XNDG 2YEVB 5H6QA 1YI2V 3OR6C 3E8FA 1QVFU 5IYDO 1B6QA 4TWKA 1OCZC 2NNUA 5L3GA 2JDIG 1NJIW 3NXSA 1VQKV 1M56C 4MVUA 5CBHA 2IW5A 3SYQA 1GM8A 3OGCC 1H8HG 3ETGA 4PA3A 3CCVV 3KG2A 1RPRA 4WF9V 5H9CA 3RBZA 1GKFA 2IH1C 1BL8A 1OCZB 2LP7A 3E8GA 3JD4A 1KECA 3MHHC 1JJ2U 2EIMC 1YITV 1OCRC 1KC8W 4MW3A 1S0VA 4ZBMA 3OE7G 1AJQA 4WFAV 2KB1A 2R9RB 3AG1B 2H8PC 3AG3B 3R65A 4L87A 3CCSV 4JPRA 1GM7A 3OEHG 1K34A 2HVJC 2M7WA 1L1FA 4U7OA 1VQOV 1OCRB 4QPKA 4PA9A 3CCEV 4MS2A 3STZC 2V7QG 1AI4A 1K92A 1V55C 3SYAA 4J9ZB 2QTOA 5LHGA 3AG4C 2Y69C 3JCZA 2OTLV 3ABMC 1COWG 1CEZA 2BOCC 4P9OA 3G6EV 3E2EA 3SPHA 1NBMG 1DF4A 1OCCB 3F7YC 2LFSA 4I9WA 4JASA 4DO2A 1THZA 4ASUG 3CPWU 1SESA 4GX1A 3K9AA 2WLJA 3QNEA 4XDLA 1YTFD 4RUEA 4I5SA 4MT8A 3ABUA 2XAGA 2DYSC 2ZDIA 4OXSA 3LSSA 4R50A 2W6JG 5B1BC 4EKWA 2QA4V 1M90W 4DXWA 4LC1A 1I5XA 1K3EA 2HJFC 3UM7A 3G4SV 4WFGA 4UV9A 2IJHA 1AROP 1JVMA 5B3SB 2EINC 1F23A 2QKSA 1F4NA 1LNQA 3ABLC 1F51A 4UVCA 2QM7A 2AHYA 1GTOA 1QR9A 2WLMA 3JD1A 1K8AW 1K33A 4R7CA 3K3WA 1VQNV 2QM8A 2R9IA 4PDVA 2D3OW 3SYOA 3MD0A 2B1GA 2GSMB 4X89A 4YXWG 4MW8A 2JEXA 5IDJA 3LDEA 2ZXWB 1YHQV 2Q68A 2HR3A 1W0KG 1JCHA 1K4DC 1AJNA 1NVPB 1FFTB 1CP9A 2XAJA 3A0RA 4UUJC 3VBBA 3SPCA 4KP4A 3DGEA 1PNKA 4GCZA 4KUMA 1K73W 1Q81W 1PNLA 3ZIAG 1BMFG 1KP2A 4JAUA 3CCRV 3SYPA 5KUKA 1R3LC 3CC2V 3ZN1A 4UXNA 4R6ZA 1FXHA 4G28B 3OEEG 4RUFA 4TSFG 1QCEA 4RQFA 1AI5A 3F7VC 2XAQA 3CYOA 4JTDB 1BHAA 1VQ6V 3ETDA 1V54C 4P30A 4RQEA 4HYOA 1YTFB 3X2QC 4UVAA 1RM1C 3W7TA 3WFVA 5KA6A 3CCQV 2EIJC 1H38A 1FS0G 4R8CA 2QEXV 3HPLC 4FIPC 4WFEA 3EHBB 2LFRA 4JTCB 1AI6A 3E83A 4FMTA 1XL6A 4CZZA 2PI4A 3LUTB 3M99B 4MSWC 4PA4A 3ML0A 1V54B 1UJWB 1WLEA 1HWYA 3JD0A 3OM3B 4N21A 1M56B 2DQ0A 1YJWV 1NR7A 2H94A 2Z5UA 3X2QB 3CMEV 3G71V 4KFMA 1NH2D 2EZPA 2A9HA 4QPJA 3OUSA 5EK0A 2B5UA 2DW4A 4N23A 3RVYA 4GT1A 1CPYA 5IY5C 3LDDA 4MVQA 2WAMA 1ZWIC 3RVZA 1K5QA 5LGNA 1VQLV 3E8HA 1GO3F 3H01A 1S77D 4BIUA 2WPDG 3FB8C 2EIMB 3K0GA 1I5YA 2IU0A 2IJIA 3ASNC 3TCUA 1Q86W 3D3IA 2XAFA 1KP3A 1GK9A 3W7SA 2OTJV 4MVZA 3T4ZA 3QO5A 4MTFA 3RW0A 1DLBA 3OMNB 5CN0A 4JYCA 4JYBA 4P2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVK C;  4PDM A;  4WFG A;  4GX0 A;  5CBF A;  4QE9 A;  4MVS A;  4RO2 A;  1JVM A;  4P9P A;  4PA7 A;  3F5W C;  2EIN C;  4G27 B;  2WLL A;  4J9Y B;  2QKS A;  3PJS K;  1LNQ A;  3ABL C;  2WLH A;  3LDC A;  5EC1 C;  3ZJZ A;  1KKD A;  3K08 A;  2AHY A;  3K0D A;  3VOU A;  2NLJ C;  3AG1 C;  3AG3 C;  2WLM A;  1P7B A;  4R7C A;  3UM7 A;  4XDK A;  2A0L A;  3ABK C;  1R3J C;  4PDV A;  3SPI A;  4CBC A;  3SYO A;  3E89 A;  2HFE C;  1ORQ C;  3BEH A;  4X89 A;  4MW8 A;  1S5H C;  3T2M A;  5J9P C;  3LNM B;  3LDE A;  3OR6 C;  5EBL C;  2Q68 A;  3E8F A;  4TWK A;  4LP8 A;  1OCZ C;  3SPG A;  5BZB A;  4PDR A;  1K4D C;  2ITC C;  4QE7 A;  4MTO A;  1M56 C;  4MVU A;  3E86 A;  5CBH A;  2HG5 C;  2W0F C;  3IFX A;  1OCC C;  2OCC C;  3SYQ A;  4UUJ C;  2DWE C;  3OGC C;  3SPC A;  1R3K C;  4PA3 A;  3GB7 C;  3EFF K;  3KG2 A;  1J95 A;  1XL4 A;  3RBZ A;  2BOB C;  2X6B A;  1OCO C;  3ZRS A;  2IH1 C;  4X8A A;  1BL8 A;  3T1C A;  3SYP A;  3E8G A;  5KUK A;  1R3L C;  3SPJ A;  2EIM C;  4WFF A;  2WLL B;  4R6Z A;  3OUF A;  4LBE C;  1OCR C;  4G28 B;  4MVM A;  4RUF A;  4MW3 A;  3FB7 C;  2Q67 A;  3AG2 C;  4ZBM A;  2ITD C;  2IH3 C;  4QNH B;  4BW5 A;  3F7V C;  4H33 A;  2KB1 A;  2DWD C;  2R9R B;  2H8P C;  3R65 A;  4JTD B;  4PDL A;  4JTA B;  4LCU C;  1V54 C;  1M57 C;  2Q69 A;  2P7T C;  4P30 A;  2EIL C;  2HVJ C;  4HYO A;  2AHZ A;  5EBM C;  3X2Q C;  3FB6 C;  3T4D A;  2WLI A;  1QLE C;  3FB5 C;  3IGA C;  4MS2 A;  4PA9 A;  3STZ C;  2EIJ C;  4R8C A;  1G4Y B;  3HPL C;  5B3S C;  3K04 A;  4WFE A;  1V55 C;  3SYA A;  4J9Z B;  2QTO A;  4JTC B;  3AG4 C;  3E83 A;  4X88 A;  1XL6 A;  2K1E A;  2Y69 C;  5E1A C;  3LUT B;  4MSW C;  4PA4 A;  2JK5 C;  1K4C C;  3ASO C;  3ABM C;  2X6A A;  2BOC C;  3K03 A;  4P9O A;  3SPH A;  3WG7 C;  2X6C A;  3F7Y C;  4GX5 A;  2WLI B;  4PA6 A;  4I9W A;  2WLN A;  4KFM A;  2EIK C;  2A9H A;  2ATK C;  3OUS A;  3E8B A;  5EK0 A;  3SYC A;  3RVY A;  2WLK A;  5KUM A;  5IY5 C;  3LDD A;  4MVQ A;  3RVZ A;  1ZWI C;  4H37 A;  3K06 A;  4MTG A;  4GX1 A;  3E8H A;  4RAI A;  2ZXW C;  4XDJ A;  2YEV A;  4F4L A;  2WLJ A;  2DYR C;  4XDL A;  3FB8 C;  2A79 B;  3K0G A;  4RUE A;  3SJQ C;  3ASN C;  3TCU A;  2DYS C;  4OXS A;  3UKM A;  4MVR A;  3OR7 C;  4WFH A;  4MVO A;  4R50 A;  5B1B C;  1R3I C;  5B1A C;  3STL C;  4GX2 A;  5EC2 C;  4EKW A;  3TET A;  4DXW A;  2ZD9 A;  2Q6A A;  4MVZ A;  5EBW C;  3T4Z A;  4MTF A;  3RW0 A;  4HZ3 A;  2HJF C;  5CBG A;  4P2Z A;  3JYC A; 
#chains in the Genus database with same CATH topology
 1NS1 A;  5B1O A;  3JAT A;  3L73 H;  5LMU O;  4J9Y B;  5FPR A;  1YEW A;  4NYK A;  4H0L B;  5GON B;  2VQE B;  3OFN G;  4J80 A;  1K97 A;  1TA8 A;  2HFE C;  4GKK B;  2P6J A;  2ZQM A;  4YJ3 A;  3M7M X;  4BIZ A;  5H5N A;  1SQQ H;  5KHG A;  4G2K A;  4QE7 A;  1YF2 A;  1ZTE A;  3OTF A;  1WNS A;  3SJA C;  5B1B B;  3CXC U;  4QIW F;  4Q6G A;  4FLY A;  4EB6 A;  2YXY A;  2X6B A;  1OCO C;  3ZMV A;  3AG7 A;  4WFF A;  5JVD B;  2QWR B;  3OUF A;  2BSK A;  4EEQ A;  2UXN A;  1BHB A;  3JAS A;  4BW5 A;  3DXR B;  1D5A A;  4LCU C;  2Q69 A;  1MOF A;  2P7T C;  5BXZ A;  3JAR B;  5IYB O;  1N0N A;  4O4J A;  4DV7 O;  4DV6 B;  4OPH A;  3ZHR A;  4JF3 A;  1Q7Y W;  4X65 B;  1HW7 A;  2PZS A;  1JFF A;  4JI0 O;  4TOI A;  1G8M A;  1MAB G;  2GDS A;  1Z5V A;  2JJ1 G;  2RDC A;  2ODM A;  2UXC B;  3OMI B;  1E79 G;  2IU3 A;  4JV5 O;  3ZBH A;  1M4U A;  2Z3Y A;  3ZRV A;  1LR1 A;  3TET A;  4ZI7 B;  4B3S O;  2JIZ G;  5LYJ B;  3JD3 A;  5EBW C;  4FZ0 A;  5KHK A;  3FAV A;  2CTP A;  1AJP A;  1N32 B;  1E1Q G;  4GX0 A;  4LF4 O;  4RO2 A;  5IJ9 B;  5JQG B;  2P4K A;  3QTC A;  4G27 B;  1QLN A;  5B1A B;  3K08 A;  3KKY A;  3AG3 C;  1KD1 W;  2DQ3 A;  2YXH A;  5C8Y B;  4JGS A;  4CBC A;  2KSD A;  2AW9 A;  3BEH A;  1S5H C;  2EX3 A;  3T2M A;  1X4T A;  2RNB A;  1S5L Z;  3BY6 A;  3ZMS A;  2UXB O;  4PDR A;  1XMO B;  3JD2 A;  1AB3 A;  2Y0I A;  3CEI A;  2EJR A;  1SQX H;  3JCU Z;  1Y4M A;  1H8E G;  4K8X A;  2X0L A;  2EBO A;  4X8A A;  3AK3 A;  5J2T A;  3SPJ A;  3JAT B;  1BQZ A;  4J7Z A;  3L74 H;  2IH3 C;  1AR1 B;  2XAH A;  4KXR A;  4JTA B;  5KHH A;  3CC4 V;  4AIL C;  5LMN B;  1N33 B;  4J41 A;  3ZCC A;  4YJ3 B;  1G4Y B;  1PM9 A;  3OAA G;  2YDE A;  3FX7 A;  2Y48 A;  5LGT A;  1SQP H;  1N0J A;  1XEQ A;  2LJ2 A;  4WFB V;  1OCO B;  4RAI A;  1XQ8 A;  3B8M A;  2DYR C;  5L3F A;  1OJH A;  1Q3E A;  4CH6 A;  4UCO A;  1EZJ A;  1A32 A;  1N4C A;  2QGN A;  1M5I A;  3E22 B;  3W7U A;  2OYQ A;  2XAS A;  2XOK G;  2ZD9 A;  1NU1 H;  4HZ3 A;  5LA6 B;  2CGN A;  4B7E A;  2HVK C;  1VQ5 V;  3RYI A;  5D5P A;  5D5Q A;  2QTS A;  4B3T B;  4LH6 A;  3IJ4 A;  3F5W C;  5EYP B;  2RJZ A;  2WLH A;  3JSL A;  3K0D A;  1SZT A;  2Q7H A;  4JI7 B;  4GKJ B;  3CS5 A;  3QF7 A;  3UQ8 A;  4I50 A;  4LFB O;  4LF6 O;  2P67 A;  2XND G;  4J10 A;  5H6Q A;  3OR6 C;  1NJI W;  4DR5 O;  2RN9 A;  1QHT A;  4E4E A;  2DMX A;  1VQK V;  1IBM B;  2CAZ C;  5CA1 B;  1GM8 A;  3CCV V;  5EIB D;  3KG2 A;  2V4D A;  4WF9 V;  2IH1 C;  2GTA A;  2LP7 A;  3E8G A;  3MHH C;  4YHH B;  4LFA O;  4MW3 A;  1S0V A;  3UO2 A;  1IBL B;  1KMI Z;  2OCH A;  3AG3 B;  2DE0 X;  3ZX6 A;  1Q6I A;  3NR7 A;  1MNG A;  2HVJ C;  1L1F A;  4D7S A;  3OT7 A;  2VQF B;  1OCR B;  4PA9 A;  4DR4 B;  4NXM B;  4AI8 A;  1Y6X A;  3CJH A;  2Q5Z A;  1L0N H;  1AI4 A;  2ZE5 A;  1K92 A;  4JI5 B;  5LHG A;  1KKC A;  3JCZ A;  1SQF A;  2UXD O;  3SDL A;  3VQV A;  3E2E A;  1MZE A;  4JI1 O;  4KHP B;  3F7Y C;  4J7J A;  4DO2 A;  5LMU B;  4IGG A;  4ASU G;  1SES A;  4GX1 A;  2QKC A;  4DV4 O;  3TGU H;  2XAG A;  2DYS C;  2ZDI A;  4OXS A;  3N2K A;  2W6J G;  5EIB C;  4EKW A;  5ITZ A;  4DXW A;  2FML A;  4DR7 B;  2QM4 A;  3CWB H;  4Z2W A;  2CUG A;  2YIB D;  2IJH A;  4UV9 A;  5LL6 Y;  3JAL A;  3MDS A;  1KUQ A;  1JVM A;  2YIC A;  2EIN C;  4DV0 B;  1NZ6 A;  1LNQ A;  4AHC A;  2KG7 A;  1VQN V;  2R9I A;  3U10 A;  5IWA O;  1WA8 A;  2D3O W;  1GN4 A;  2VS0 A;  4OPA A;  4HNA B;  2PUS A;  3MD0 A;  2B1G A;  4JI6 O;  4YXW G;  4MW8 A;  2JEX A;  1MSD A;  2AZ0 A;  5KAF Z;  4I9Q A;  1W59 A;  1XDC A;  1IDS A;  1TUB B;  1QU7 A;  4O4H B;  3ZHS A;  2ZE7 A;  3SPC A;  4DV3 B;  4GCZ A;  1PNK A;  1XUQ A;  3EXA A;  2HEP A;  1KP2 A;  1R3L C;  2AZ2 A;  4R6Z A;  4G28 B;  3OEE G;  4RUF A;  4LF8 B;  1D2D A;  4JTD B;  2HHH O;  3ETD A;  1V54 C;  4HYO A;  3X2Q C;  1RM1 C;  3WFV A;  4NR1 A;  2YI8 A;  4DK1 A;  1MA1 A;  2QEX V;  3HPL C;  1HNX O;  4JTC B;  1AI6 A;  3E83 A;  4FMT A;  4CZZ A;  2PI4 A;  4B3S B;  3THO A;  1EN5 A;  4N21 A;  5GTH Z;  2DQ0 A;  1NR7 A;  4B3R O;  1P49 A;  3CME V;  4LWS B;  4NTY A;  4X1I B;  2B5U A;  4N23 A;  1XNR O;  4MVQ A;  5LGN A;  1XHX A;  4JI3 O;  4FLT A;  4UCR A;  1I5Y A;  3BA9 A;  4FLZ A;  4IIJ B;  1WAZ A;  4DR2 B;  3QG5 A;  4FFB B;  4DUZ B;  1HR0 O;  2OTJ V;  1VMG A;  3HKB A;  3C90 A;  5J2U B;  2LGW A;  3Q4H A;  4NTX A;  3CC7 V;  4JYA B;  1X59 A;  4PA7 A;  4MTX A;  4I7Z B;  2RMK B;  1GRJ A;  2UUC O;  1FPO A;  5JCO C;  1WB8 A;  5JH7 B;  2G38 A;  2KKW A;  2YUA A;  1P4R A;  3ABK C;  2Y4T A;  2DOS A;  3SPI A;  3E89 A;  4JZ2 A;  2YID A;  1N8R W;  3G80 A;  3FKS G;  1EBO A;  4JI2 O;  4BAY A;  1I0H A;  2OT5 A;  2DYS B;  5JVD A;  3IFX A;  1YSC A;  1WP8 A;  4EFE A;  4AQY O;  1FAF A;  3DXR A;  2GHY A;  1WJZ A;  2P90 A;  4FM2 A;  4X66 O;  2ZR2 A;  3FYE B;  1BSM A;  3JAL B;  5F2V O;  3JAR A;  4WCE V;  2EIN B;  2Q0O C;  3P30 A;  4ZKI A;  2IJK A;  4HBN A;  3RYC A;  2EZO A;  2DN9 A;  4O4L B;  1T5E A;  4IYH A;  5DM6 V;  1TUE B;  4LF9 O;  1W0J G;  2H3O A;  3FB6 C;  3TXS A;  4EFB A;  1Y67 A;  3T4D A;  5IE9 A;  1JQ0 A;  3GWO A;  4ZOL B;  3C3S A;  2LW1 A;  4GZR B;  4YY3 O;  3OTO B;  1BS3 A;  4QJF B;  1M57 B;  3A0H Z;  4UCV A;  3K59 A;  2JEU A;  1JA8 A;  2AGA A;  5L3D A;  2ATK C;  1PNM A;  3KCX A;  3R66 A;  4LFC B;  4YIO A;  4ZI7 A;  1R1B A;  1PL4 A;  1UFI A;  2B1I A;  4L8J A;  2YEV A;  2ZIN A;  1GM9 A;  2JGD A;  1Q6U A;  4JAA A;  5IJ9 A;  5JQG A;  4BWA A;  4DV2 B;  5B1A C;  4TV9 B;  3STL C;  5EC2 C;  1VQ7 V;  2Q6A A;  1I94 O;  2PI5 A;  1Q8I A;  1YIJ V;  5CBG A;  3JYC A;  1RM1 B;  3KCY A;  1NQT A;  1H2G A;  5C8Y A;  4NTW A;  2Q4P A;  1FXV A;  2F66 C;  3L75 H;  3T1Y O;  3RYF B;  3VQY A;  2L35 A;  4CS4 A;  5BR8 O;  2E3C A;  1PL0 A;  1F4M A;  2R70 A;  2F4V O;  4HAM A;  4LFA B;  1NR1 A;  2ZKO A;  3LSQ A;  2ZIO A;  1KQS U;  3DC5 A;  3SPG A;  3VQX A;  2E74 B;  4FFK A;  1N34 B;  4LR3 A;  1NVP D;  5A9G A;  1YDX A;  3HKB B;  5BY1 A;  3EFF K;  3K5L A;  1WB7 A;  3Q4H B;  1J5E O;  3L70 H;  5FL7 G;  1R73 A;  1XRE A;  2UXD B;  4MVM A;  4JI8 O;  4CH5 A;  2QDO A;  2ITD C;  4CC5 A;  1WPX A;  2CDY A;  1B04 A;  4PDL A;  2QSA A;  2C2A A;  1W2B U;  4KL1 A;  3ABK B;  3I55 V;  1K5S A;  3J81 N;  3LNN A;  4K0K B;  4PHZ A;  3ZED A;  5CB4 B;  4DV4 B;  5HFM A;  3IGA C;  3ABT A;  1VF5 B;  3APQ A;  2Q7G A;  2R72 A;  3WB1 A;  2JK5 C;  1SRY A;  1FFX A;  3K03 A;  4B08 A;  4U7N A;  3ZMT A;  2X6C A;  1MZF A;  1PP9 H;  4IHJ B;  1KYO F;  5KUM A;  3E22 A;  3RWR D;  1IUR A;  3HR0 A;  3CX5 F;  3L9D A;  4XDJ A;  5LA6 A;  3BHP A;  4YJ2 A;  2A79 B;  2CTR A;  3B77 A;  5B66 Z;  5L3B A;  1S72 V;  3RYC B;  2QWO B;  5EYP A;  4WFH A;  1XHZ A;  1JOY A;  1ZL8 B;  2W0X A;  5L3C A;  3AK2 A;  1ZSP A;  5LP6 C;  5CBF A;  3N2G A;  3QO8 A;  1JX9 A;  2QR4 A;  3LDC A;  3P3P A;  1KKD A;  4O2A A;  3CSX A;  3G6B A;  1URF A;  1HNZ O;  2P5O A;  5CA1 A;  2HP8 A;  2ZNJ A;  2P22 C;  4DR1 B;  2YEV B;  1YI2 V;  3E8F A;  5KHJ A;  1B6Q A;  4TWK A;  2UU9 O;  5L3G A;  2JGD B;  1NI8 A;  3WB0 A;  1N36 O;  4U3J B;  2UUA B;  1BL8 A;  3BFR A;  4DV1 O;  2EIM C;  1OCR C;  4B3R B;  4ZBM A;  1VAR A;  4X62 O;  4NXN O;  4L87 A;  3CCS V;  4JI4 O;  1K34 A;  1VQO V;  1Q43 A;  1I08 A;  4LH7 A;  4QPK A;  3CCE V;  1O9H A;  3STZ C;  2V7Q G;  2RCV A;  1V55 C;  4J9Z B;  2BTQ B;  4DR3 B;  3ABM C;  1NBM G;  4JAS A;  2Y0P A;  5IYZ B;  3K9A A;  4TQF A;  2GBO A;  2GV9 A;  4LF5 B;  4RUE A;  1FJG O;  4D6T H;  4B3M O;  3LSS A;  4R50 A;  2QA4 V;  1IBK B;  1K3E A;  3UM7 A;  3G4S V;  3UCS C;  2VWJ A;  3CB2 A;  4CS3 A;  4HNA A;  3FFQ A;  2QWQ B;  4UVC A;  2QM7 A;  4ZIB A;  1FFX B;  1GTO A;  1ZLZ A;  3H9V A;  4U3F H;  4R7C A;  3K3W A;  4DW1 A;  4X66 B;  3I5D A;  4DUY O;  1TUB A;  4O4H A;  2UUB O;  4UCS A;  5IDJ A;  1XIL A;  2L6L A;  3CXH F;  4YJ2 B;  3HKC A;  1P84 F;  1AJN A;  1HP8 A;  1NVP B;  1FFT B;  3A0R A;  3L72 H;  5EZY B;  2CGO A;  3RYH B;  2ZM6 O;  4KUM A;  3WU2 Z;  4UCT A;  1SS3 A;  1Q81 W;  5LP6 B;  3ZIA G;  4JAU A;  3N2G B;  4UXN A;  1FXH A;  1QCE A;  3OD4 A;  1AI5 A;  4O2A B;  3ETQ A;  4DRX A;  4LNU B;  1YTF B;  1TAE A;  3W7T A;  1HDJ A;  4X64 O;  3CCQ V;  3RT3 C;  4LWS A;  4X1I A;  4X20 B;  1M93 A;  3M99 B;  3ML0 A;  1HWY A;  3FD9 A;  3OM3 B;  2H94 A;  2Z5U A;  4FLX A;  1IXB A;  1Y74 A;  2BTO A;  4IIJ A;  4KFM A;  2A9H A;  1TGO A;  4FFB A;  2DW4 A;  2Q73 A;  3LDD A;  3T1Y B;  3CRR A;  2YI9 A;  3BVO A;  1GO3 F;  1S77 D;  5J2U A;  2EIM B;  5BR8 B;  1H2S B;  3ASN C;  1XBL A;  3TXQ A;  3O9O A;  2EUL A;  5JJJ B;  3U0Z A;  1GK9 A;  4NB5 A;  4DK0 A;  3T4Z A;  3QO5 A;  3OMN B;  1G6U A;  5JH7 A;  4JYB A;  4W4K A;  2Z0A A;  4QE9 A;  4MVS A;  4I0X A;  1BQ0 A;  1V55 B;  3B2E E;  1MG1 A;  3CRQ A;  3TK1 A;  1O9G A;  4PEL A;  5EC1 C;  3ABM B;  3SJB C;  5LOV B;  1DGS A;  2CTQ A;  1FD9 A;  2VQE O;  1J5E B;  2A06 H;  4X9Q A;  5C93 A;  3JAW B;  4JI8 B;  3M8A A;  4LF7 O;  1YJN V;  1FXK C;  4IL6 Z;  1OZ0 A;  5BZB A;  1M9N A;  2YS8 A;  1F7Y A;  4MTO A;  1QBZ A;  2YXL A;  2E5L O;  3CCM V;  1R3K C;  1PD3 A;  4FJC C;  4FK5 C;  1J95 A;  4O4L A;  1Q82 W;  4OGQ B;  3ZRS A;  4XBF A;  4GLX A;  5KLV H;  1S76 D;  1L0L H;  1NH2 B;  3AG2 C;  4ZOL A;  4WBN B;  3HKE B;  2IJJ A;  1M57 C;  1SZX A;  3UT5 B;  2F1M A;  1Y76 B;  3BAB A;  3J7A U;  2XHB A;  4DV7 B;  1E1R G;  4DV6 O;  1QLE C;  2WWW A;  2VRZ A;  2PGG A;  2DJV A;  4NVP A;  4F6R B;  3HKC B;  1DTO A;  1JPX A;  3K57 A;  2OIE A;  4I4T A;  2X6A A;  1RP3 B;  5JJE B;  4JI0 B;  3WG7 C;  2XUM A;  2WLN A;  3E35 A;  1OHH G;  3E8B A;  2PF4 E;  4DV5 O;  4TV9 A;  4QGP A;  1BGY H;  1VQ8 V;  3K06 A;  4MTG A;  3OW2 U;  2UXC O;  1VQ9 V;  2YIB A;  2RQ6 A;  4O4I A;  2OWO A;  3HB3 B;  1XNQ O;  3WB2 A;  1HNZ B;  4JV5 B;  4DRX B;  2EIK B;  2LO1 A;  5FNV B;  4DW0 A;  4GX2 A;  2CTW A;  3RYF A;  2PYL A;  4TQD A;  1IXM A;  3AEI A;  4Z1M G;  3CP1 A;  2X7R B;  1N32 O;  2ZE8 A;  4LF4 B;  3K79 A;  1RSO B;  4DR6 O;  3A0B Z;  1G1X B;  5CA3 A;  3P32 A;  3AG1 C;  5K1P A;  5LHH A;  1Y74 B;  3CCL V;  4DV1 B;  1YXB A;  1DF5 A;  2YSU B;  3ZRW B;  1ORQ C;  1SER A;  4TUY B;  2N74 A;  4I55 B;  2UXB B;  1XMO O;  3ASN B;  2ITC C;  3ICX A;  3E86 A;  2JVD A;  2DWE C;  1S5J A;  5H2F Z;  5LBQ A;  3A8T A;  1EFR G;  5JCO A;  4OX9 O;  1R6N A;  1NT2 B;  2Q8V A;  2WSS G;  3T1C A;  4I0X B;  3ZHT A;  3CCJ V;  5CB4 A;  3K9S A;  4QNH B;  2DWD C;  2CH7 B;  1AR4 A;  3PN1 A;  3VQW A;  1Q5O A;  5FPO A;  3LSU A;  4IT5 A;  1FJG B;  3FB5 C;  3KZI Z;  3W7X A;  4IHJ A;  4O2B B;  3SGI A;  1EZV H;  2R9A A;  4X88 A;  2MK3 A;  1FXK B;  4ICG A;  5CA0 B;  1K4C C;  1V9P A;  1Z5W A;  2WLI B;  4PD4 F;  1FYJ A;  2BCC H;  2ILM A;  1GH6 A;  1ROP A;  4H37 A;  1ZL8 A;  2ZXW C;  3I56 V;  1LUV A;  2LW7 A;  3AG2 B;  5H6R A;  1EM1 A;  3DSQ A;  1IZ3 A;  1QR8 A;  1R3I C;  1Y66 A;  5CMU A;  5LHI A;  1NKD A;  3G67 A;  2HKO A;  2B9Z A;  4GYC B;  1BE3 H;  3D36 C;  3D36 A;  1QLE B;  4B3T O;  4P9P A;  1AI7 A;  2ZM6 B;  3SJC C;  4I4T B;  4CH4 A;  3VOU A;  1H2K A;  4JI7 O;  3WG7 B;  2M6Y A;  4GKJ O;  4FPP A;  2UXX A;  2FTK A;  4U3J A;  1SET A;  4LFB B;  4LF6 B;  2PYJ A;  4BR6 A;  4O4I B;  5IJ0 B;  1QVF U;  5IYD O;  1BZK A;  3T1H O;  2QWP B;  4DR5 B;  1BT8 A;  1IBM O;  5CBH A;  2IW5 A;  4CH3 A;  2O57 A;  3OGC C;  1SQG A;  4PA3 A;  2K9P A;  5KAI Z;  1HNW O;  1RPR A;  5H9C A;  1AP5 A;  2F93 B;  1GKF A;  2GUZ A;  1OCZ B;  1KEC A;  2XT9 A;  1YIT V;  4YHH O;  4J7K A;  1IBL O;  2P4V A;  4WFA V;  2R9R B;  3AG1 B;  1GM7 A;  2BTQ A;  3D3Q A;  1CXZ B;  2M7W A;  1H2N A;  2ZCE A;  2VQF O;  1VF6 C;  3D8C A;  2N05 A;  1VF6 A;  4NXM O;  2QWN B;  3BA8 A;  4JI5 O;  2QTO A;  1EN6 A;  3AG4 C;  3H1L H;  5DED A;  4UFZ A;  2Y69 C;  5IYZ A;  4X1Y B;  1AVM A;  1AIL A;  1COW G;  2ETN A;  3SPH A;  4JI1 B;  3RFR A;  3J80 N;  3BAA A;  2LQT A;  4I9W A;  1NTM H;  1RFY A;  4ZHQ B;  4XDL A;  1YTF D;  1H2L A;  1VIB A;  1YCI A;  3IAY A;  4MT8 A;  3ABU A;  5JJN B;  4W4L A;  4GUN A;  4LF7 B;  3TJT A;  2XTA A;  4DR7 O;  1U97 A;  1KB9 F;  3F5T A;  4WFG A;  4FLV A;  2MW2 B;  5LXT B;  5E79 Z;  5BMV A;  4DV0 O;  1F23 A;  2QKS A;  2E5L B;  3ABL C;  1F51 A;  1VP7 A;  4J42 A;  1WP7 A;  2AHY A;  3JD1 A;  1K8A W;  5IWA B;  4PDV A;  1GN2 A;  4FLU A;  5KX5 B;  5EZY A;  2GSM B;  4JI6 B;  3RYH A;  4TV8 B;  2WA4 A;  2ZXW B;  2Q68 A;  4IYI A;  5LP6 A;  3GWK C;  4UUJ C;  3VBB A;  4KP4 A;  4DV3 O;  3DGE A;  4FZ1 A;  3BRC A;  1PNL A;  4LNU A;  1GN3 A;  3CCR V;  3ZN1 A;  5B5E Z;  1JJO A;  3B4S A;  4RQF A;  1JMK C;  4LF8 O;  1NTK H;  1XMQ O;  2XAQ A;  4X20 A;  5AG2 A;  4DV5 B;  2HHH B;  1VQ6 V;  1Q90 D;  1QNM A;  2YC0 A;  2ARH A;  4UVA A;  4FLW A;  4PI0 A;  1XNQ B;  2JGU A;  1IVS A;  2EIJ C;  1H38 A;  1FS0 G;  2BE3 A;  4FIP C;  1HNX B;  2LFR A;  3LUT B;  4MSW C;  1UJW B;  4ABM A;  1YJW V;  1SC5 B;  3A2F A;  1SA0 A;  3G71 V;  5KMG B;  1NH2 D;  3HKD B;  4DR6 B;  5EK0 A;  4K3A A;  3RVY A;  1XNR B;  5IY5 C;  3RVZ A;  2GUZ B;  1K5Q A;  1VQL V;  4JI3 B;  4BIU A;  3FB8 C;  3K0G A;  5KHI A;  3TCU A;  4PI2 A;  1Q86 W;  2F23 A;  3L71 H;  3D3I A;  2XAF A;  4X1K B;  4DR2 O;  4DUZ O;  4UB8 Z;  1HR0 B;  4UB6 Z;  4MTF A;  2ZT9 B;  3RW0 A;  1DLB A;  2E76 B;  4UCU A;  2OIG A;  5LOV A;  4P2Z A;  5K1X A;  4JYA O;  2WLL A;  3JAW A;  1K7D A;  3UO3 A;  3AG4 B;  2Y69 B;  3ETE A;  2UUC B;  1LUW A;  4FM0 A;  1ZUQ A;  3H1I H;  4JZG A;  2F43 G;  4OX9 B;  1PKX A;  2A0L A;  2V1D A;  4JI2 B;  2HLD G;  5EBL C;  1MSW D;  4LP8 A;  3B8N A;  1I7F A;  2HG5 C;  2W0F C;  2OCC C;  4D7T A;  4UV8 A;  2IM9 A;  1IX9 A;  4C7U A;  4WBN A;  4AQY B;  1QVG U;  2QE7 G;  4TT3 G;  3HKE A;  1SKV A;  2BOB C;  4NKG B;  3UT5 A;  1WPB A;  3RN4 A;  5BMV B;  3OGI B;  1Y76 A;  4LBE C;  3FB7 C;  1RPO A;  1K9M W;  3ABL B;  1U96 A;  4EB6 B;  4F6R A;  1QQC A;  2EIL C;  4UVB A;  3W7W A;  2AHZ A;  5EBM C;  4LF9 B;  2BSK B;  2AXT Z;  5JWP A;  3B40 A;  3JAS B;  3K04 A;  3OTO O;  4YY3 B;  5E1A C;  3ZMZ A;  2WA3 A;  2KQX A;  2K1E A;  5GW7 A;  2NN4 A;  5KA5 A;  3ASO C;  1NTZ H;  1R6K A;  1KBH A;  2NR5 A;  4O4J B;  3FYI B;  4GX5 A;  1WN7 A;  4PA6 A;  2EIK C;  5FNV A;  1B06 A;  4RWU A;  4B7K A;  4LFC O;  2WLK A;  3CMA V;  2FYU H;  3N27 A;  3IC7 A;  1JFF B;  5GTI Z;  3ZS8 C;  3JAK A;  3SJQ C;  4E2L A;  3CD6 V;  1RSO A;  4DV2 O;  2QKA A;  1JR9 A;  1I94 B;  1ZAU A;  4PDM A;  3T1H B;  2EIJ B;  3ZRW A;  3PJS K;  3K58 A;  1B3Q A;  2NLJ C;  3DTU B;  3FAV B;  1HNW B;  4TUY A;  1P7B A;  2YIA A;  4I55 A;  1SA0 B;  1VQP V;  1R3J C;  3P3N A;  5LGU A;  2F4V B;  5IY5 B;  3K5N A;  1US6 A;  5J9P C;  2HJD A;  3ZN0 A;  1PV0 A;  3QO7 A;  2LGQ A;  2CK3 G;  2JJ2 G;  1N34 O;  2PY5 A;  1OCC C;  4F6E A;  4K8Z A;  4PV1 B;  3GB7 C;  1XL4 A;  2CH7 A;  2EJ7 A;  1GAX A;  2WLL B;  5L3E A;  1SF9 A;  4GKK O;  1YVW A;  2W6I G;  2Q67 A;  4O2B A;  3S3X A;  1KU9 A;  2ZR3 A;  1M1K W;  2Q9L A;  3K5O A;  4H33 A;  3EVK A;  3ZRX A;  1FXK A;  5CA0 A;  2A7W A;  1ENV A;  4Q20 A;  5DN6 G;  5J2T B;  4K0K O;  3OMA B;  2WLI A;  2PTM A;  2ZDI C;  5B3S C;  5IYC O;  1UPG A;  5B1N A;  3CCU V;  5A2Q N;  3S3W A;  1DK1 A;  2OCC B;  1VQ4 V;  1Z2G A;  2D2C B;  3SYC A;  2GTS A;  1YJ9 V;  2Q7E A;  4F4L A;  1GMG A;  2CE4 A;  1ZX3 A;  5HFL A;  4CS2 A;  3UKM A;  4MVR A;  3OR7 C;  4MVO A;  4X65 O;  2EIL B;  1GN6 A;  2DYR B;  2Q0A A;  1S3J A;  3RGB A;  3SR2 C;  4DYL A;  2JS3 A;  1BCC H;  3ZJZ A;  3ASO B;  4BIO A;  2P06 A;  3H1J H;  1VQM V;  5IJ0 A;  3RYI B;  4XDK A;  3MHS C;  1AR5 A;  3ZMU A;  4JAV A;  1FKA O;  1PPJ H;  1XMQ B;  4DR1 O;  3LNM B;  3CRC A;  3JAK B;  1SQV H;  2UU9 B;  1OCZ C;  2NNU A;  2JDI G;  3JSN A;  3NXS A;  1M56 C;  3H1K H;  4MVU A;  1N36 B;  5TIS Z;  3SYQ A;  1H8H G;  4I50 B;  1XI1 A;  3ETG A;  1TVK A;  2UUA O;  1XOU A;  3RBZ A;  2N04 A;  2ZNI A;  3JAM N;  3JD4 A;  2FKX A;  4YIP A;  1JJ2 U;  4BW9 A;  1KC8 W;  3OE7 G;  1AJQ A;  4X62 B;  4NXN B;  2KB1 A;  2H8P C;  3R65 A;  4JI4 B;  4X1Y A;  3DC6 A;  4JPR A;  3OEH G;  2VWK A;  4JYY A;  4U7O A;  3O65 A;  1D5N A;  4MS2 A;  2Y4U A;  1SQB H;  3SYA A;  2FL4 A;  2ZIM A;  2ZE6 A;  4DR3 O;  2OTL V;  4ZHQ A;  1AP6 A;  2BOC C;  1CEZ A;  4P9O A;  4K35 A;  3G6E V;  5GON A;  1DF4 A;  1OCC B;  2LFS A;  3CE2 A;  3CJH B;  3BPZ A;  1THZ A;  3CPW U;  3GVM A;  4FM1 A;  2WLJ A;  3QNE A;  2A3Q A;  5LMN O;  4LF5 O;  4I5S A;  1N33 O;  5LXT A;  4B3M B;  1P7G A;  5B1B C;  1M90 W;  3ZHU A;  2QJ1 A;  4LC1 A;  3CHX A;  1IBK O;  1I5X A;  2HJF C;  2JS5 A;  2ADQ B;  1ARO P;  1OV9 A;  1R6T A;  1EN4 A;  5B3S B;  3N2K B;  2FB5 A;  5KX5 A;  5ITZ B;  1F4N A;  1Q6H A;  4TV8 A;  3H1H H;  1QR9 A;  2WLM A;  1K33 A;  2QM8 A;  4DUY B;  2F95 B;  2UUB B;  3IC9 A;  3QVN A;  3SYO A;  2ADP A;  3C3T A;  3B09 A;  4X89 A;  3LDE A;  1YHQ V;  5FLX N;  2KG7 B;  2HR3 A;  1W0K G;  1JCH A;  4J11 A;  1K4D C;  1WA8 B;  1CP9 A;  2XAJ A;  1MMM A;  1K73 W;  1BMF G;  3SYP A;  5KUK A;  3CC2 V;  1YZB A;  4TSF G;  4Z1V A;  3CRA A;  3ZHQ A;  3F7V C;  3CYO A;  1BHA A;  1VEW A;  4P30 A;  5LYJ A;  4RQE A;  2JRI A;  1L8D A;  4PJ0 Z;  5KA6 A;  2E75 B;  4X64 B;  4FVM A;  5KMG A;  3HKD A;  4R8C A;  3BCC H;  5IT9 N;  4WFE A;  3EHB B;  1XL6 A;  3CRM A;  3MAQ A;  4PA4 A;  1V54 B;  3AK1 A;  1WLE A;  3JD0 A;  1M56 B;  3X2Q B;  2EZP A;  1TVK B;  4H13 B;  4X1K A;  4QPJ A;  3OUS A;  2IBZ H;  4GT1 A;  1CPY A;  5DEC A;  3ZHV A;  2WAM A;  1H2M A;  1ZWI C;  3E8H A;  3H01 A;  2WPD G;  3APO A;  4DR4 O;  2IU0 A;  2IJI A;  3K5M A;  4A5U B;  4H44 B;  1KP3 A;  4CC6 A;  3U11 A;  3W7S A;  4MVZ A;  1VF7 A;  5CN0 A;  4JYC A;  4KHP O; 
#chains in the Genus database with same CATH homology
 5B1O A;  3CC7 V;  4QE9 A;  4MVS A;  4PA7 A;  4J9Y B;  2WLL A;  1V55 B;  4MTX A;  1K7D A;  3AG4 B;  1MG1 A;  2Y69 B;  3TK1 A;  3ETE A;  4PEL A;  5EC1 C;  3ABM B;  2F43 G;  1P4R A;  1PKX A;  2A0L A;  3OFN G;  3ABK C;  1K97 A;  3SPI A;  5C93 A;  2V1D A;  3E89 A;  2HFE C;  1N8R W;  2P6J A;  2ZQM A;  3FKS G;  1EBO A;  1YJN V;  2HLD G;  1FXK C;  5EBL C;  4BIZ A;  1MSW D;  4LP8 A;  1OZ0 A;  4BAY A;  5BZB A;  3B8N A;  4G2K A;  1M9N A;  2OT5 A;  4QE7 A;  4MTO A;  2DYS B;  1QBZ A;  2HG5 C;  2W0F C;  3IFX A;  1YSC A;  2OCC C;  5B1B B;  4UV8 A;  3CXC U;  3CCM V;  1R3K C;  4QIW F;  1QVG U;  2QE7 G;  1PD3 A;  4FJC C;  4FK5 C;  1J95 A;  4TT3 G;  2GHY A;  2BOB C;  2P90 A;  2X6B A;  1Q82 W;  1OCO C;  3ZRS A;  2ZR2 A;  4XBF A;  3FYE B;  3ZMV A;  4WFF A;  1S76 D;  3OUF A;  4LBE C;  2EIN B;  4WCE V;  1NH2 B;  3P30 A;  3FB7 C;  3AG2 C;  1RPO A;  4ZKI A;  1K9M W;  2IJK A;  2UXN A;  3ABL B;  1BHB A;  4BW5 A;  2EZO A;  2IJJ A;  4LCU C;  1M57 C;  2Q69 A;  1MOF A;  2P7T C;  5DM6 V;  1TUE B;  2EIL C;  4UVB A;  3W7W A;  2AHZ A;  5IYB O;  5EBM C;  1W0J G;  3FB6 C;  1E1R G;  3T4D A;  1QLE C;  1JQ0 A;  2WWW A;  3GWO A;  3K04 A;  4JF3 A;  1Q7Y W;  5E1A C;  3ZMZ A;  2K1E A;  5GW7 A;  5KA5 A;  1DTO A;  1JPX A;  4QJF B;  1M57 B;  3ASO C;  2X6A A;  1R6K A;  2JEU A;  3WG7 C;  3FYI B;  4GX5 A;  4PA6 A;  5L3D A;  2WLN A;  3E35 A;  2EIK C;  1OHH G;  2ATK C;  1G8M A;  3E8B A;  1PNM A;  1MAB G;  2WLK A;  2JJ1 G;  3CMA V;  1VQ8 V;  3K06 A;  4MTG A;  3OW2 U;  3IC7 A;  2B1I A;  1VQ9 V;  2YEV A;  3OMI B;  3HB3 B;  1E79 G;  3SJQ C;  1GM9 A;  4E2L A;  3CD6 V;  2IU3 A;  2EIK B;  2Z3Y A;  3ZRV A;  3TET A;  5B1A C;  3STL C;  4GX2 A;  5EC2 C;  1VQ7 V;  2JIZ G;  2Q6A A;  3JD3 A;  5EBW C;  2PI5 A;  1IXM A;  3AEI A;  4Z1M G;  1YIJ V;  3CP1 A;  5CBG A;  2X7R B;  1AJP A;  3JYC A;  4PDM A;  1RM1 B;  1E1Q G;  1NQT A;  4GX0 A;  3K79 A;  1H2G A;  4RO2 A;  2EIJ B;  4G27 B;  3ZRW A;  1FXV A;  1QLN A;  3PJS K;  5B1A B;  5CA3 A;  3P32 A;  3K08 A;  2NLJ C;  3AG1 C;  3AG3 C;  3DTU B;  1P7B A;  1KD1 W;  2DQ3 A;  5LHH A;  3CCL V;  1VQP V;  1R3J C;  4JGS A;  4CBC A;  1DF5 A;  1F4M A;  1PL0 A;  5LGU A;  2YSU B;  3ZRW B;  4HAM A;  1ORQ C;  1NR1 A;  3BEH A;  1SER A;  5IY5 B;  3LSQ A;  1S5H C;  3T2M A;  5J9P C;  3ZN0 A;  3BY6 A;  3QO7 A;  3ZMS A;  1KQS U;  3SPG A;  2CK3 G;  4PDR A;  2JJ2 G;  3ASN B;  3JD2 A;  2ITC C;  3E86 A;  1OCC C;  2EJR A;  1NVP D;  2DWE C;  1Y4M A;  5LBQ A;  3GB7 C;  1H8E G;  1EFR G;  3EFF K;  1XL4 A;  2X0L A;  1R6N A;  2EBO A;  4X8A A;  5FL7 G;  1R73 A;  2WSS G;  3T1C A;  3SPJ A;  2WLL B;  5L3E A;  3CCJ V;  4MVM A;  2W6I G;  2Q67 A;  2ITD C;  2IH3 C;  4QNH B;  1WPX A;  2ZR3 A;  1AR1 B;  1M1K W;  4H33 A;  3ZRX A;  2DWD C;  2XAH A;  4PDL A;  1FXK A;  2C2A A;  4JTA B;  1W2B U;  3CC4 V;  3ABK B;  3I55 V;  1ENV A;  1K5S A;  4Q20 A;  5DN6 G;  3OMA B;  5HFM A;  2WLI A;  3IGA C;  3FB5 C;  3ABT A;  3ZCC A;  3W7X A;  2ZDI C;  1G4Y B;  5B3S C;  3OAA G;  5IYC O;  4X88 A;  2MK3 A;  1FXK B;  2JK5 C;  1K4C C;  5B1N A;  1SRY A;  3CCU V;  3K03 A;  4U7N A;  3ZMT A;  2Y48 A;  2X6C A;  5LGT A;  2OCC B;  1VQ4 V;  2WLI B;  3SYC A;  5KUM A;  4WFB V;  1ROP A;  1OCO B;  4H37 A;  1YJ9 V;  4RAI A;  2ZXW C;  4XDJ A;  1GMG A;  3B8M A;  4F4L A;  2DYR C;  3I56 V;  5L3F A;  2A79 B;  5HFL A;  3AG2 B;  3B77 A;  1EZJ A;  5L3B A;  5H6R A;  1S72 V;  3UKM A;  4MVR A;  3OR7 C;  4WFH A;  4MVO A;  1QR8 A;  1R3I C;  3W7U A;  1JOY A;  1Y66 A;  2XAS A;  2XOK G;  2ZD9 A;  5CMU A;  5LHI A;  1NKD A;  4HZ3 A;  2EIL B;  5L3C A;  2HKO A;  2DYR B;  2HVK C;  1VQ5 V;  1S3J A;  5CBF A;  3D36 A;  1QLE B;  4P9P A;  3F5W C;  3QO8 A;  1JX9 A;  1AI7 A;  3LDC A;  2WLH A;  3ZJZ A;  1KKD A;  3ASO B;  3K0D A;  3VOU A;  1SZT A;  1VQM V;  3WG7 B;  4XDK A;  3MHS C;  4FPP A;  2UXX A;  3ZMU A;  2FTK A;  4JAV A;  1SET A;  3LNM B;  2P67 A;  2XND G;  2YEV B;  5H6Q A;  1YI2 V;  3OR6 C;  3E8F A;  1QVF U;  5IYD O;  1B6Q A;  4TWK A;  1OCZ C;  2NNU A;  5L3G A;  2JDI G;  1NJI W;  3NXS A;  1VQK V;  1M56 C;  4MVU A;  5CBH A;  2IW5 A;  3SYQ A;  1GM8 A;  3OGC C;  1H8H G;  3ETG A;  4PA3 A;  3CCV V;  3KG2 A;  1RPR A;  4WF9 V;  5H9C A;  3RBZ A;  1GKF A;  2IH1 C;  1BL8 A;  1OCZ B;  2LP7 A;  3E8G A;  3JD4 A;  1KEC A;  3MHH C;  1JJ2 U;  2EIM C;  1YIT V;  1OCR C;  1KC8 W;  4MW3 A;  1S0V A;  4ZBM A;  3OE7 G;  1AJQ A;  4WFA V;  2KB1 A;  2R9R B;  3AG1 B;  2H8P C;  3AG3 B;  3R65 A;  4L87 A;  3CCS V;  4JPR A;  1GM7 A;  3OEH G;  1K34 A;  2HVJ C;  2M7W A;  1L1F A;  4U7O A;  1VQO V;  1OCR B;  4QPK A;  4PA9 A;  3CCE V;  4MS2 A;  3STZ C;  2V7Q G;  1AI4 A;  1K92 A;  1V55 C;  3SYA A;  4J9Z B;  2QTO A;  5LHG A;  3AG4 C;  2Y69 C;  3JCZ A;  2OTL V;  3ABM C;  1COW G;  1CEZ A;  2BOC C;  4P9O A;  3G6E V;  3E2E A;  3SPH A;  1NBM G;  1DF4 A;  1OCC B;  3F7Y C;  2LFS A;  4I9W A;  4JAS A;  4DO2 A;  1THZ A;  4ASU G;  3CPW U;  1SES A;  4GX1 A;  3K9A A;  2WLJ A;  3QNE A;  4XDL A;  1YTF D;  4RUE A;  4I5S A;  4MT8 A;  3ABU A;  2XAG A;  2DYS C;  2ZDI A;  4OXS A;  3LSS A;  4R50 A;  2W6J G;  5B1B C;  4EKW A;  2QA4 V;  1M90 W;  4DXW A;  4LC1 A;  1I5X A;  1K3E A;  2HJF C;  3UM7 A;  3G4S V;  4WFG A;  4UV9 A;  2IJH A;  1ARO P;  1JVM A;  5B3S B;  2EIN C;  1F23 A;  2QKS A;  1F4N A;  1LNQ A;  3ABL C;  1F51 A;  4UVC A;  2QM7 A;  2AHY A;  1GTO A;  1QR9 A;  2WLM A;  3JD1 A;  1K8A W;  1K33 A;  4R7C A;  3K3W A;  1VQN V;  2QM8 A;  2R9I A;  4PDV A;  2D3O W;  3SYO A;  3MD0 A;  2B1G A;  2GSM B;  4X89 A;  4YXW G;  4MW8 A;  2JEX A;  5IDJ A;  3LDE A;  2ZXW B;  1YHQ V;  2Q68 A;  2HR3 A;  1W0K G;  1JCH A;  1K4D C;  1AJN A;  1NVP B;  1FFT B;  1CP9 A;  2XAJ A;  3A0R A;  4UUJ C;  3VBB A;  3SPC A;  4KP4 A;  3DGE A;  1PNK A;  4GCZ A;  4KUM A;  1K73 W;  1Q81 W;  1PNL A;  3ZIA G;  1BMF G;  1KP2 A;  4JAU A;  3CCR V;  3SYP A;  5KUK A;  1R3L C;  3CC2 V;  3ZN1 A;  4UXN A;  4R6Z A;  1FXH A;  4G28 B;  3OEE G;  4RUF A;  4TSF G;  1QCE A;  4RQF A;  1AI5 A;  3F7V C;  2XAQ A;  3CYO A;  4JTD B;  1BHA A;  1VQ6 V;  3ETD A;  1V54 C;  4P30 A;  4RQE A;  4HYO A;  1YTF B;  3X2Q C;  4UVA A;  1RM1 C;  3W7T A;  3WFV A;  5KA6 A;  3CCQ V;  2EIJ C;  1H38 A;  1FS0 G;  4R8C A;  2QEX V;  3HPL C;  4FIP C;  4WFE A;  3EHB B;  2LFR A;  4JTC B;  1AI6 A;  3E83 A;  4FMT A;  1XL6 A;  4CZZ A;  2PI4 A;  3LUT B;  3M99 B;  4MSW C;  4PA4 A;  3ML0 A;  1V54 B;  1UJW B;  1WLE A;  1HWY A;  3JD0 A;  3OM3 B;  4N21 A;  1M56 B;  2DQ0 A;  1YJW V;  1NR7 A;  2H94 A;  2Z5U A;  3X2Q B;  3CME V;  3G71 V;  4KFM A;  1NH2 D;  2EZP A;  2A9H A;  4QPJ A;  3OUS A;  5EK0 A;  2B5U A;  2DW4 A;  4N23 A;  3RVY A;  4GT1 A;  1CPY A;  5IY5 C;  3LDD A;  4MVQ A;  2WAM A;  1ZWI C;  3RVZ A;  1K5Q A;  5LGN A;  1VQL V;  3E8H A;  1GO3 F;  3H01 A;  1S77 D;  4BIU A;  2WPD G;  3FB8 C;  2EIM B;  3K0G A;  1I5Y A;  2IU0 A;  2IJI A;  3ASN C;  3TCU A;  1Q86 W;  3D3I A;  2XAF A;  1KP3 A;  1GK9 A;  3W7S A;  2OTJ V;  4MVZ A;  3T4Z A;  3QO5 A;  4MTF A;  3RW0 A;  1DLB A;  3OMN B;  5CN0 A;  4JYC A;  4JYB A;  4P2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...