5CBFA

Structural and functional characterization of a calcium-activated cation channel from tsukamurella paurometabola
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
b'TLMFKRFFGAVRTSWRDPSTRGAVLSLAIIVTAATIFYTLAEKWSVIDSLFYAVSVGLPMGNGPLSPTLTLSKIFTLVYAILVVGLFVTVGGSLASAIVQNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ion transport 2 domain protein
molecule tags Transport protein
source organism Tsukamurella paurometabola (strain atcc 8368 / dsm 20162 / jcm 10117 / nbrc 1612
publication title Structural and functional characterization of a calcium-activated cation channel from Tsukamurella paurometabola.
pubmed doi rcsb
total genus 30
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5cbfA00
3E8FA 2ITCC 3E8GA 2ZD9A 3ABKC 3FB7C 4XDKA 4WFEA 3UM7A 5EC1C 2EIMC 2W0FC 1XL4A 5EBWC 1V54C 3E83A 1KKDA 4J9ZB 4MVMA 3STLC 4QE7A 2R9RB 3K06A 2IH3C 2EILC 2EIKC 4PDLA 5EC2C 4QNHB 1LNQA 2HVJC 4DXWA 2AHZA 2WLNA 4MVZA 2ITDC 2NLJC 3EFFK 4PA6A 3AG3C 4WFGA 4EKWA 3LDDA 3SPGA 1R3KC 1G4YB 4CBCA 4MSWC 2X6CA 4P9PA 3SYPA 1ZWIC 3K08A 4PDRA 4MTFA 3SPHA 4BW5A 4JTAB 3F5WC 4J9YB 3GB7C 3K0GA 2H8PC 5EK0A 4MVOA 3IGAC 4OXSA 4JTDB 3RBZA 2ATKC 3WG7C 2X6AA 2YEVA 5KUMA 1V55C 2WLHA 3LUTB 3ZJZA 3T1CA 4MW3A 4RO2A 3PJSK 1R3JC 3E86A 1M56C 5EBMC 4HYOA 4RUEA 1OCOC 4MTOA 4MTGA 4GX5A 4LBEC 2X6BA 4PA4A 5B3SC 1BL8A 2DWEC 2WLIB 2DYRC 3AG4C 3E89A 3E8BA 4P2ZA 4P30A 3SYOA 5CBFA 4R7CA 1P7BA 2A0LA 2AHYA 4XDLA 3FB5C 4H37A 3F7VC 5BZBA 4R8CA 4TWKA 3SJQC 4MW8A 5EBLC 3SPJA 4UUJC 2A79B 3ASNC 3R65A 4F4LA 2EIJC 1J95A 4R6ZA 2HJFC 3SYQA 1S5HC 4LP8A 3OUFA 4LCUC 3FB8C 1XL6A 4GX1A 3IFXA 5IY5C 4GX2A 3UKMA 2Y69C 3KG2A 3SYCA 3RVYA 5CBGA 1ORQC 3ASOC 2JK5C 2WLMA 3VOUA 4WFFA 4H33A 4PA7A 3JYCA 2ZXWC 2WLIA 1K4DC 4RUFA 2QTOA 3F7YC 1K4CC 1R3LC 4GX0A 1OCRC 3T2MA 4MVQA 2DWDC 4KFMA 2QKSA 3SPIA 5E1AC 2KB1A 2BOCC 3K04A 2HFEC 4HZ3A 4MVSA 3SYAA 2Q68A 3X2QC 5CBHA 4MVRA 1JVMA 2BOBC 4PA9A 4JTCB 3OGCC 4G27B 2A9HA 3ABLC 3TETA 4PA3A 4I9WA 2WLLB 4P9OA 2K1EA 3T4DA 4MS2A 3K0DA 2Q6AA 4PDVA 2DYSC 2OCCC 3E8HA 3TCUA 2WLJA 3K03A 4ZBMA 3HPLC 4PDMA 4X8AA 1QLEC 3LDCA 3ZRSA 3FB6C 3AG2C 2EINC 3OR6C 1OCCC 3OR7C 3LNMB 4MVUA 4WFHA 5B1AC 3RW0A 4G28B 4XDJA 1M57C 2HVKC 2IH1C 3T4ZA 3LDEA 3SPCA 1OCZC 4RAIA 4QE9A 2Q69A 4X88A 3OUSA 4R50A 3ABMC 5B1BC 2WLKA 2Q67A 3AG1C 5J9PC 4X89A 3RVZA 2P7TC 2WLLA 5KUKA 3BEHA 3STZC 2HG5C 1R3IC
chains in the Genus database with same CATH superfamily
4X1KB 4QPJA 1FJGB 3DGEA 3ZMZA 5JWPA 3E83A 3RYIB 2EIJB 1YJ9V 2V7QG 1LNQA 2AHZA 4MVZA 4DR5B 3H1JH 1WN7A 3ZRXA 2EINB 4CH5A 4JTDB 5KUMA 1I94B 3AG1B 4PJ0Z 1M57B 4I55A 2Q0AA 3CSXA 3OW2U 3RFRA 3MHSC 4DUZO 2WLIB 4P2ZA 1Q82W 5C93A 4DV3B 2AHYA 4LFBB 3S3XA 4TWKA 4X1IB 1Z5VA 3L73H 1N33B 4F6EA 2JJ1G 1LUVA 2HJFC 4DRXA 4W4LA 4UVCA 4ZOLA 3IFXA 2OT5A 1MSWD 4IYHA 2XAJA 4DK0A 2JK5C 3E22A 1O9HA 5F2VO 1G8MA 2LP7A 5EIBD 1AROP 2OTLV 2KB1A 4K3AA 3K9AA 1IBMB 4AQYO 4JI7B 4DR2O 2F93B 2WLJA 1OV9A 1GM7A 3ZRSA 2LJ2A 1DF5A 1Z2GA 2BTQA 3LNMB 2ODMA 1VQ5V 2JJ2G 2L6LA 2WA4A 4XDJA 3FFQA 2IH1C 2HJDA 5LXTA 3CD6V 1WA8A 1VQ6V 1HNZO 1N8RW 4BW9A 1PNLA 5J9PC 3OTOB 5B66Z 1GO3F 1GRJA 1XHXA 2F4VB 1HW7A 2ITCC 3K9SA 1AI4A 3UCSC 2X0LA 1XREA 1ZAUA 2OIEA 3ETQA 5EC1C 1WPXA 2HHHO 2F66C 3D3IA 1V54C 2R9AA 2PI5A 2EZPA 4J7KA 3AG3C 3FD9A 4I50B 4UCVA 2UXDO 4ICGA 1GK9A 3D8CA 1TUBB 1XMQB 2UXCO 1E1QG 1YF2A 1GH6A 3ZJZA 4LF8B 3EXAA 2Q5ZA 1N34B 3A0HZ 5IDJA 4HYOA 3JAKA 3W7TA 3N2KB 3ABLB 4WF9V 1I5XA 2Q9LA 2UXBB 1NR1A 3E35A 4LWSB 5BZBA 2XAHA 4MW8A 4YJ3B 3TK1A 4X65B 4KP4A 1EN4A 4DV2B 4AILC 2QKAA 2E3CA 1NS1A 5CA0B 1SF9A 3JD0A 3HR0A 3ASOC 5LYJB 3VOUA 2JGUA 1XNRO 2XTAA 5IYBO 2ZXWC 2DYRB 1PNKA 2UUCO 3WB1A 1GN3A 2IJHA 1XUQA 4ZHQA 2LFSA 3CJHA 4MVSA 1NTZH 2JRIA 2Q7HA 1JR9A 1AJQA 3K79A 4N23A 2ZIOA 1JFFB 3FB6C 2P90A 3HKDB 3AG2C 2EINC 4I5SA 3ZMTA 1FAFA 4YJ3A 4O4LA 1B3QA 3AG3B 4QE9A 2Q69A 3B8NA 5CA0A 1SQBH 1JFFA 3OUSA 1F23A 5LHGA 4ZI7B 3JSNA 1EN5A 4O2BA 3HKDA 3ZN1A 3ZHUA 2E5LB 5JQGB 2JDIG 3E8FA 3ZHQA 4FM0A 1DTOA 4DV1O 2ZNJA 4IHJA 4CZZA 2YSUB 4ZHQB 5EBWC 3FAVA 1OHHG 2IH3C 5B1NA 1F4NA 4WFGA 4X66O 4B7KA 3L70H 4D7SA 1Y74A 3SPGA 4P9PA 1YJWV 1IVSA 1W0KG 3HKEA 4DR4B 4LR3A 3J81N 2ZINA 3RYHA 3CC4V 3RBZA 1YIJV 1U96A 2EBOA 2EZOA 5C8YA 2E76B 4LC1A 1R3JC 5BXZA 5JJJB 2QM4A 5FNVB 4RUEA 1GN4A 2ZE5A 5JQGA 2DYRC 1KU9A 4JI8B 4NKGB 5D5PA 2WA3A 2JGDB 5CMUA 2RJZA 5ITZB 3OAAG 1SQVH 3TXQA 1YTFB 1J95A 5LBQA 1BZKA 1XL6A 3K5NA 1Y66A 4GX2A 4KL1A 3LNNA 4JV5O 3AG2B 3TJTA 3HKEB 3HKCB 1N32O 5HFMA 3HB3B 3SJCC 4DR7B 4MVQA 3JD1A 3CWBH 3AK3A 3SDLA 3W7WA 3ABMB 4DUYO 1IZ3A 1GN6A 2XOKG 4PA9A 5CN0A 3VQXA 4JI4O 3ETGA 1YJNV 4X64B 5HFLA 1XMQO 2P6JA 2H3OA 2JS3A 3ETDA 4Q20A 5KA6A 5IYDO 3ZIAG 4DW1A 4UV9A 1W0JG 2FTKA 2EJRA 5B1AC 4O4IA 4FLVA 4JYAB 4FFBB 3GWKC 1GTOA 2ETNA 1DGSA 1FYJA 4R50A 5LP6C 5KUKA 3OD4A 3DC5A 1LUWA 1YTFD 5LMUO 3OMAB 4J7ZA 4B3SO 4WFEA 2M7WA 4TQFA 2UXCB 1KP3A 2R9RB 5FL7G 3X2QB 2HVJC 2CGNA 2G38A 2Y4TA 4BIZA 3CP1A 2DQ3A 3CRQA 1B6QA 1BQZA 2D2CB 4J9YB 4JYCA 3FYEB 5EYPB 2ZNIA 1V55C 2D3OW 2A3QA 3BA8A 1MOFA 4PV1B 2QWQB 5IJ0A 1TGOA 4GT1A 1X4TA 4P30A 3IAYA 1R73A 1MNGA 3H1IH 2QWPB 1JJ2U 2MK3A 5IT9N 1N33O 1P7GA 1N0NA 3ABKB 1M9NA 1YVWA 2KKWA 2XHBA 2Q4PA 4LF9B 2OYQA 3BRCA 3RYCA 4I9QA 2WLIA 1K4DC 4EB6A 3VQVA 1YZBA 4JZGA 2DWDC 2UUCB 1RSOA 1QVFU 2Q68A 2BOBC 2W0XA 3BABA 3TETA 4O4HB 2F95B 3ZN0A 1ZLZA 1ZL8B 1M4UA 3AG7A 2GDSA 2GUZA 1VQ9V 4RQEA 3E2EA 3OT7A 4U3JB 3HKBB 2QEXV 2P4KA 1H8EG 4G28B 4JYAO 1YHQV 4YHHB 1V9PA 4MTXA 4X88A 2AW9A 4DUZB 2QWNB 5GTIZ 2PUSA 4JAAA 1YEWA 2XNDG 1DK1A 4TV8B 3BEHA 5H5NA 1FXKA 3HKBA 4LF5B 2R72A 3J80N 4LF7O 1BGYH 3B40A 4HBNA 5A9GA 3WFVA 1KUQA 3H1LH 4PDLA 4PI0A 2W6JG 4UCRA 4CBCA 1EM1A 4UVAA 1HNXB 3M7MX 4K8ZA 4X62B 1MSDA 2LW1A 2CTRA 3IGAC 5DECA 3WB2A 3PJSK 4LF7B 2Y0IA 3OMNB 3EVKA 4IIJB 2DE0X 4Z2WA 4DR1B 3K58A 1K7DA 1JCHA 3KCXA 2P06A 4PA4A 1FXKB 1I08A 5K1XA 4EB6B 2B1IA 5BR8O 1ZTEA 2FKXA 4AI8A 5LYJA 5KHKA 4YIPA 1N0JA 2ZM6B 3SPJA 1CP9A 4UUJC 2A79B 5H9CA 1B04A 3R65A 1JOYA 1H2LA 4ZKIA 1S5HC 4UCTA 5JH7A 3CCVV 1FFXB 2F4VO 4B3MO 4FLTA 2IJJA 1BQ0A 5BY1A 2ZCEA 4LF4O 5IWAB 1R3LC 3S3WA 1JQ0A 3RN4A 3ZHRA 1SA0A 1KQSU 3OGCC 4DRXB 2N74A 2ZE6A 3H01A 5LMUB 4B3SB 1SQQH 1OCOB 5LGUA 1B06A 1KC8W 1RFYA 2XASA 1EN6A 1SERA 3JCUZ 4Z1MG 2YC0A 5LP6A 3C3TA 1XHZA 2AZ0A 1WB8A 1BMFG 2YICA 5IYZB 3EHBB 5IWAO 1H2NA 4FVMA 1VQKV 1OZ0A 5FNVA 1YI2V 4F6RA 4U7OA 2EX3A 3KG2A 2BCCH 2DOSA 2H94A 4KUMA 5LMNB 1AI5A 1K73W 1Q86W 1YITV 3DTUB 4J41A 4WFAV 3AEIA 5EC2C 5K1PA 5EZYA 4CH3A 4GKJO 3JAKB 2P4VA 2X6CA 3OGIB 1TVKB 1SQGA 2HEPA 3JATA 4ZI7A 4LF6O 1XDCA 2FMLA 3CCLV 5EK0A 1QU7A 1FKAO 3JASB 4JI2B 1H2SB 4JI1B 3RYFB 1S5JA 4IHJB 5JCOA 3CC7V 1L1FA 2VS0A 1HNWO 3N2GB 4MTOA 1K34A 2PYLA 2Q7EA 3JALB 4FLWA 2JVDA 4Z1VA 3ZX6A 4KXRA 1TAEA 3IC7A 4WCEV 5L3CA 1XQ8A 4LF5O 1YXBA 3JAWA 1I0HA 3WG7B 4PA7A 5L3EA 3JYCA 5EIBC 1K9MW 2LGWA 4D6TH 1CEZA 4TV9B 4B3TB 1QLNA 4I7ZB 2YXHA 1JJOA 3K04A 1FFTB 1N4CA 4DV4O 4O2BB 5LGNA 4JGSA 4MS2A 3K0DA 3G4SV 3E8HA 4UB6Z 3CE2A 4J7JA 1N36B 3M99B 1EFRG 3P3NA 4O2AA 4GKKB 1PKXA 1ENVA 1IBKO 1M90W 3B77A 1M57C 2HVKC 1WNSA 1OJHA 4RAIA 4UXNA 3CMEV 1VP7A 4JAVA 1TVKA 3Q4HA 5J2TB 2HG5C 1R3IC 3U10A 3A0RA 4DW0A 2P5OA 2CTWA 3STLC 3UQ8A 4UCUA 4PA6A 2PYJA 1Q90D 4B3TO 1R3KC 4JYBA 4LF4B 4JI6B 4DR1O 3GB7C 2XAQA 4JF3A 1K8AW 2Q73A 2X6AA 4JI4B 3AK2A 2OCCB 2YIBA 4RO2A 1GM9A 1EZJA 2BSKA 3G6BA 5FLXN 2X6BA 2GTSA 2YXYA 4FLYA 4WBNB 4XDLA 4CH4A 2PI4A 1PM9A 3C3SA 3W7XA 1S72V 4B3RO 2Y4UA 4LF8O 1Q8IA 3P32A 2EIJC 1BE3H 4GKKO 4O4JB 1KD1W 4NYKA 1V55B 5C8YB 4LCUC 3NR7A 5IY5C 2DW4A 4EFBA 1HDJA 1L0LH 1K33A 1SQXH 3JARA 4RUFA 1K4CC 1US6A 4FPPA 1ZSPA 2CE4A 1N32B 4LFAO 4NVPA 2HR3A 1NVPB 4JI0B 2EILB 4ZOLB 1SC5B 1FXKC 2CH7A 3C90A 4B08A 1VQOV 1VF6C 3OR6C 1TUEB 4CS4A 1HNZB 4DUYB 1KYOF 1NT2B 1XEQA 1D5NA 3T4ZA 4NXNO 2NNUA 3UO2A 1OCZC 2UXBO 4X9QA 4B7EA 3MHHC 4BR6A 3FB7C 3K57A 1PL0A 1YSCA 3K5LA 4U7NA 2EIMC 4FJCC 4H44B 1KKDA 5GW7A 3K06A 2IM9A 5JJEB 1AI6A 1L0NH 1GAXA 3U11A 2ZDIC 1QQCA 5LOVB 2PGGA 5L3BA 4I4TA 1LR1A 1VF6A 3JD4A 2Y69B 2HLDG 2N05A 1I5YA 2YEVA 5IE9A 4CC6A 1G1XB 3K59A 1R1BA 2OIGA 2RCVA 5BR8B 1HR0B 1SZXA 3B2EE 4X20A 4CC5A 2KG7A 3E89A 1P7BA 2BTOA 1H2KA 3FB8C 5B5EZ 5BMVB 2QM7A 3L74H 3OEEG 4JAUA 4FZ1A 3T2MA 3ZMVA 2QKSA 3SPIA 5E1AC 3G80A 1SS3A 2WPDG 4JI3B 1Y4MA 3T1YB 2EIKB 4TQDA 1VQMV 5AG2A 2UXXA 4FMTA 2UXDB 4FLUA 3RW0A 1VQ7V 1TA8A 2ZDIA 1OCRB 1SZTA 4UCSA 1RSOB 3BHPA 3QO7A 3P30A 1WJZA 1NR7A 1FJGO 2XAFA 1N34O 2QGNA 1XMOO 4QJFB 2GUZB 3IC9A 1SRYA 1AVMA 4MVMA 3ZMSA 3ZMUA 1NH2B 3ZHSA 4J11A 2ITDC 2NLJC 2ZR3A 3J7AU 3K5OA 2YIAA 2QKCA 4PDRA 4PI2A 2X7RB 4JV5B 1BT8A 4LNUA 4MVOA 3T1YO 3RGBA 4UCOA 3ASNB 4ASUG 4JASA 4MT8A 2GSMB 2R70A 1S5LZ 4GX5A 5B3SC 2NN4A 4JI5O 1Q3EA 1H2MA 5B1AB 4I0XB 2FB5A 2LGQA 3LSSA 3MD0A 1WA8B 4DR6B 4H0LB 1EZVH 2FYUH 4AHCA 4LFBO 4H33A 2DQ0A 1AR4A 1IURA 3F7YC 2FL4A 5KX5B 5KHJA 2Q8VA 1DF4A 5IYZA 2JS5A 2JIZG 3ZCCA 4GLXA 1IBKB 3THOA 3ABLC 4DV1B 4I9WA 4UV8A 1JMKC 2VWJA 2V4DA 1L8DA 3OR7C 2A7WA 1UPGA 2UU9O 2ZM6O 1HWYA 2HP8A 5JVDA 3I55V 1COWG 2LO1A 1R6TA 1F51A 2ZIMA 2Q67A 2GHYA 1XI1A 2Z0AA 2RQ6A 3L72H 4B3MB 4JZ2A 3SJBC 3E8GA 4JI5B 1GMGA 2W0FC 1SETA 2KSDA 4J9ZB 3G71V 4DR3B 3ZHTA 4KHPB 5GTHZ 4DXWA 2WLNA 3BFRA 5KAFZ 3W7SA 2KG7B 1Q6IA 3CRRA 3JALA 1ZWIC 2ADQB 3SPHA 4DR5O 5A2QN 1RPRA 3A2FA 3F5WC 1AJNA 4NR1A 4OXSA 4DV2O 2DJVA 5FPOA 3TGUH 4MW3A 4B3RB 4YJ2A 1WAZA 3CEIA 5D5QA 3BPZA 1WB7A 1JX9A 2AXTZ 4DR7O 2CTQA 2CTPA 1Y76A 2YXLA 3A0BZ 4R7CA 1Q43A 4IYIA 1QR9A 1QNMA 2QDOA 3IJ4A 5EYPA 4F4LA 2XT9A 1MMMA 3DC6A 4EEQA 4GX1A 1XMOB 4G2KA 2Y69C 5CA1B 2Y0PA 5GONB 1I7FA 4LF6B 2QTOA 2VQFO 1VQPV 5H2FZ 2UU9B 1IXMA 4KFMA 4FZ0A 3UO3A 2VQEO 2NR5A 4JTCB 3ZBHA 5CA1A 1NVPD 2F1MA 1AP5A 2WLLB 3T1HB 1YDXA 3D36C 4DR4O 4ABMA 5LOVA 1R6NA 1M1KW 2B1GA 2DMXA 4AQYB 4JI7O 4JI3O 1QLEC 3CCQV 3ML0A 3O9OA 4UVBA 2L35A 4OX9B 3ABUA 1VEWA 1K97A 1HP8A 3JAMN 1BSMA 2PF4E 1NBMG 4DV6B 2WLKA 1Y6XA 2HKOA 2RDCA 2P22C 4Q6GA 4O4HA 1S3JA 2QWOB 3B09A 1ZL8A 5LHIA 2E5LO 1XBLA 2ILMA 5IY5B 1FXVA 1XILA 1W2BU 2OWOA 4PELA 4JYYA 4NTYA 2EILC 3H9VA 3DXRA 3N2GA 4OX9O 1FPOA 3SYPA 5KMGA 2F23A 4MTFA 4FFKA 5BMVA 3APQA 4TV8A 1N36O 4QGPA 2H8PC 2OCHA 3CC2V 4LFAB 4C7UA 3LUTB 1Q6UA 3SGIA 2ADPA 3FYIB 4NXMO 5EBMC 3CRMA 4TT3G 2IU3A 1IBLO 1OCOC 4MTGA 3SJAC 3G6EV 4TV9A 1H2GA 2GTAA 3QNEA 3K3WA 3SJQC 5EBLC 1SQFA 4IGGA 4R6ZA 4X1YA 3OUFA 1FS0G 4TUYA 2JEXA 3RVYA 4OGQB 2M6YA 2Z3YA 2OTJV 1JA8A 3H1HH 2BTQB 1SQPH 5B1BB 4GKJB 4LH7A 4GX0A 3B8MA 3TXSA 4MVRA 4TUYB 5J2UA 2UUBO 1G6UA 4PA3A 4GCZA 4U3FH 2Q6AA 1EBOA 3CS5A 3K03A 4X64O 3VQWA 1M56B 5KA5A 4X65O 3QVNA 4YHHO 4DR3O 2N04A 2ZE7A 5LL6Y 2IBZH 1XNQB 3ABMC 4H13B 3JAWB 2P7TC 3CXHF 2QE7G 4FIPC 3OE7G 1AILA 2YIDA 3UM7A 1IBMO 3H1KH 2YI8A 2IW5A 4LNUB 1OCCB 5KLVH 4DK1A 4QNHB 2ZT9B 3EFFK 4EKWA 4I55B 2P67A 2JEUA 4MSWC 1PNMA 1KB9F 5IJ0B 4QPKA 2AZ2A 1U97A 4GYCB 3W7UA 3WG7C 1S76D 4O4JA 2LFRA 1BCCH 3MAQA 4L87A 5EZYB 1H38A 2DWEC 3JARB 1PV0A 1SKVA 1KBHA 3E8BA 1A32A 3FB5C 1W59A 3E22B 2IJKA 1Q6HA 3R66A 4OPAA 3ZS8C 2LW7A 3OM3B 4LP8A 1QCEA 3QO5A 2DYSB 3A8TA 5LA6A 2CH7B 3O65A 4DV4B 4DYLA 4DV5B 3ZHVA 3KKYA 5KHIA 5LGTA 4FM1A 4RWUA 1NH2D 1Q81W 1O9GA 2Q0OC 1QVGU 2A06H 3SYAA 1JVMA 5LA6B 3L71H 2ZE8A 4DV7B 4J80A 2ZR2A 4A5UB 2VWKA 4PDMA 2PTMA 3T1HO 1D2DA 4IT5A 1OCCC 4YXWG 3CCMV 3QF7A 1Y67A 1YCIA 3APOA 3ABTA 1NTMH 4YJ2B 4E4EA 3P3PA 2PZSA 3TCUA 3STZC 1VARA 5JCOC 4HNAA 4O2AB 1XL4A 1TUBA 4BWAA 2RMKB 1ZUQA 5B3SB 4X20B 4F6RB 1UJWB 4HNAB 1IBLB 2B5UA 3N2KA 4U3JA 4X1IA 1QR8A 1FXHA 3ZEDA 3SR2C 1AB3A 2K9PA 2QWRB 2YDEA 1VQ8V 3B4SA 4DV5O 1BHBA 1FFXA 3SYOA 5CBFA 2EJ7A 1KKCA 1NQTA 5DM6V 5L3FA 2QR4A 4KHPO 4R8CA 3CRAA 5LP6B 1THZA 1AJPA 3ASNC 2CUGA 1K5SA 3CJHB 3VBBA 5CBGA 1NI8A 3OTOO 5KHGA 2BSKB 2WLMA 2F43G 3AG4B 1OCRC 1QBZA 1WLEA 1AI7A 3X2QC 2IJIA 4O4LB 3ZRWA 4LH6A 4P9OA 2K1EA 4NTWA 4PDVA 2OCCC 4ZBMA 1MZEA 3CCEV 2VQEB 3RYHB 4IL6Z 2Z5UA 3MDSA 1GM8A 1H8HG 1T5EA 3SPCA 1XOUA 1F4MA 3RT3C 2VQFB 1D5AA 4FK5C 5JH7B 2CK3G 1URFA 1K5QA 2LQTA 5B1BC 3JCZA 1XNRB 2ZKOA 3AG1C 5L3DA 1AR5A 2UUAB 4XDKA 2JGDA 3ASOB 4QE7A 5B1OA 4E2LA 2DN9A 4BIUA 2Y48A 1RM1B 1VQNV 1X59A 1E1RG 4N21A 4LFCB 3D36A 5KHHA 5H6QA 4JPRA 2WSSG 2YUAA 4JI1O 2WLHA 3T1CA 3E86A 2WWWA 1GN2A 5J2UB 3JATB 3NXSA 1M5IA 4K8XA 3RYCB 1KMIZ 3AG4C 3CCSV 2IU0A 2ARHA 3HKCA 2KQXA 1F7YA 2YEVB 2B9ZA 5LHHA 4JI2O 3GVMA 4FLZA 4ZIBA 3Q4HB 1ORQC 4QIWF 4D7TA 1VQ4V 4K0KB 2W6IG 1R6KA 4YY3O 2QM8A 1DLBA 1PL4A 1MABG 2RN9A 4LWSA 3G67A 4NXMB 2BOCC 1AP6A 2XAGA 4G27B 2A9HA 1M93A 3T4DA 2QA4V 1PPJH 2CDYA 3HPLC 3CYOA 3OFNG 1NU1H 5J2TA 3CX5F 1J5EB 4WFHA 4UFZA 1VF7A 3DXRB 3LDEA 3OMIB 4BIOA 1Y74B 4FLXA 1PP9H 1K92A 3RVZA 1IXBA 2EULA 1Q7YW 1SESA 2O57A 3ABKC 4L8JA 3JASA 2C2AA 3RYFA 5JVDB 2MW2B 3OTFA 1PD3A 1XNQO 1MA1A 3LSQA 5CA3A 1NKDA 1UFIA 5E79Z 4EFEA 3CCJV 2AGAA 4DV3O 4JI6O 3LSUA 1G4YB 1FD9A 3K08A 2V1DA 4BW5A 3CPWU 4JTAB 4W4KA 3WB0A 5DN6G 5IJ9B 3K0GA 3BCCH 3D3QA 1VF5B 5H6RA 2UUBB 2QTSA 4OPHA 3F5TA 3KZIZ 4I50A 3RYIA 5JJNB 3ZRVA 4FM2A 4TOIA 3PN1A 3CXCU 3QG5A 5KMGB 1AR1B 4YY3B 3K5MA 4H37A 1SA0B 2CGOA 1IDSA 4PD4F 1P4RA 3CCRV 4RQFA 1NTKH 4XBFA 3SYCA 4WBNA 3GWOA 3QO8A 4WFFA 4WFBV 4HAMA 3CHXA 3FX7A 1HNWB 4NXNB 4GZRB 5ITZA 4I0XA 5CBHA 4HZ3A 1WP8A 1V54B 3ETEA 4X1YB 2PY5A 1RP3B 4J42A 1WP7A 1JPXA 1Y76B 2YI9A 4CS2A 3LDCA 1Q5OA 4CH6A 3L75H 3QTCA 1NZ6A 1VMGA 4X66B 3M8AA 4DV0B 2YS8A 2E75B 5KX5A 1NJIW 5IYCO 5KAIZ 3BAAA 3FKSG 1P84F 4X89A 1WPBA 5GONA 1S0VA 4DO2A 3AK1A 4DV7O 1ROPA 2GBOA 2ZD9A 3JD3A 2UXNA 4LFCO 3UT5B 2EIKC 3CRCA 1GKFA 1CPYA 4FFBA 3LDDA 4JI8O 5LXTB 2R9IA 4IIJA 1HR0O 4LF9O 1S77D 1VQLV 3I5DA 1QLEB 4DR2B 1K3EA 4DR6O 1QHTA 1ZX3A 2WAMA 1MZFA 4J10A 2HHHB 2ATKC 4TSFG 4NB5A 3BY6A 2ZXWB 2UUAO 5LMNO 1M56C 3ZRWB 3ICXA 4BAYA 2Q7GA 2VRZA 4UB8Z 3N27A 4LBEC 1BL8A 3JD2A 5L3GA 1BHAA 1E79G 2A0LA 4K0KO 4CS3A 3JSLA 4PHZA 3F7VC 3I56V 2CAZC 3FAVB 1IX9A 5DEDA 3UT5A 1CXZB 1I94O 3SYQA 2ZQMA 3RWRD 1RPOA 3U0ZA 3UKMA 5CB4A 4I4TB 3WU2Z 1HNXO 3L9DA 2GV9A 3BA9A 4DV6O 4O4IB 3BVOA 4YIOA 1OCZB 2E74B 4DV0O 1J5EO 2HFEC 4K35A 5CB4B 3CB2A 1KECA 2YIBD 1RM1C 2DYSC 2XUMA 4JI0O 3DSQA 4X62O 4X8AA 2QSAA 1KP2A 2EIMB 3KCYA 2RNBA 3CMAV 4NTXA 3OEHG 2QJ1A 4MVUA 4X1KA 1BS3A 1VIBA 2BE3A 3VQYA 1P49A 5TISZ 3CCUV 5FPRA 4GUNA 1MG1A 2WLLA 1Z5WA 5IJ9A
chains in the Genus database with same CATH topology
4QPJA 4QJFB 3DGEA 1SRYA 1XL4A 3ZMZA 3E83A 3WFVA 2EIJB 1YJ9V 4MVMA 2V7QG 4PDLA 3ZMSA 3ZMUA 1NH2B 1LNQA 2AHZA 4MVZA 2ITDC 2NLJC 2W6JG 2ZR3A 5B3SB 4CBCA 3ZRXA 4PDRA 1UJWB 2X7RB 4UVAA 2B5UA 4MVOA 3IGAC 2EINB 3ASNB 4JTDB 1QR8A 4ASUG 5KUMA 1FXHA 3AG1B 4JASA 1M57B 3PJSK 3OMNB 4MT8A 2GSMB 3OW2U 1K7DA 1JCHA 4GX5A 1VQ8V 3MHSC 4PA4A 1FXKB 5B3SC 2WLIB 1BHBA 4P2ZA 1Q82W 3SYOA 5C93A 5CBFA 2B1IA 1NQTA 2AHYA 5DM6V 5L3FA 5B1AB 4R8CA 4TWKA 3SPJA 1CP9A 1THZA 1AJPA 4UUJC 2A79B 5H9CA 3ASNC 3LSSA 3R65A 1JOYA 2JJ1G 2HJFC 4ZKIA 3MD0A 1K5SA 1S5HC 4UVCA 3IFXA 3CCVV 2OT5A 1MSWD 3VBBA 5CBGA 2XAJA 2IJJA 2JK5C 2WLMA 4H33A 2DQ0A 1G8MA 2LP7A 2F43G 3AG4B 3F7YC 1R3LC 1JQ0A 1OCRC 1QBZA 1KQSU 1AROP 1DF4A 1WLEA 1AI7A 2OTLV 2KB1A 3X2QC 2IJIA 2JIZG 3ZCCA 3ZRWA 3K9AA 3OGCC 3ABLC 4P9OA 4I9WA 2K1EA 4UV8A 3H01A 4PDVA 2OCCC 1OCOB 2WLJA 5LGUA 4ZBMA 1GM7A 3ZRSA 1KC8W 2XASA 3CCEV 3OR7C 1DF5A 1SERA 3LNMB 4Z1MG 1VQ5V 2JJ2G 4XDJA 1HWYA 2Z5UA 1GM8A 1H8HG 2IH1C 3SPCA 1BMFG 1F4MA 3EHBB 4FK5C 2CK3G 3I55V 3CD6V 1COWG 1VQKV 1VQ6V 1OZ0A 1K5QA 5B1BC 3JCZA 1F51A 1YI2V 1N8RW 2Q67A 3AG1C 1PNLA 2GHYA 4U7OA 5J9PC 3KG2A 1GO3F 2H94A 4KUMA 1AI5A 5L3DA 2ITCC 1AI4A 3E8GA 1K73W 2X0LA 4XDKA 1Q86W 1GMGA 5EC1C 1WPXA 2W0FC 3ASOB 3D3IA 1V54C 1YITV 1SETA 3DTUB 4J9ZB 4WFAV 3AEIA 4QE7A 2PI5A 5B1OA 5EC2C 2EZPA 3G71V 4DXWA 2WLNA 3AG3C 4E2LA 3W7SA 4BIUA 2X6CA 1GK9A 1ZWIC 2Y48A 3SPHA 1RM1B 1VQNV 1RPRA 1E1RG 3F5WC 3CCLV 4N21A 5EK0A 1AJNA 1E1QG 4OXSA 3D36A 5H6QA 4JPRA 2WSSG 3CC7V 2WLHA 3ZJZA 3T1CA 4MW3A 3E86A 2WWWA 1L1FA 5IDJA 4HYOA 3NXSA 1JX9A 4MTOA 1K34A 3W7TA 3AG4C 3ABLB 4WF9V 1I5XA 4R7CA 1NR1A 3CCSV 3E35A 2IU0A 5BZBA 2XAHA 1QR9A 4MW8A 3TK1A 3IC7A 4F4LA 4KP4A 2YEVB 4WCEV 5LHHA 4GX1A 5L3CA 4G2KA 2Y69C 3JD0A 1ORQC 3ASOC 4QIWF 1VQ4V 2W6IG 1R6KA 3VOUA 3WG7B 4PA7A 1FXKA 3JYCA 5IYBO 5L3EA 2QM8A 2ZXWC 1DLBA 1K9MW 2DYRB 2QTOA 1PNKA 1CEZA 1MABG 1QLNA 1VQPV 2IJHA 2LFSA 1IXMA 4KFMA 4MVSA 2BOCC 3K04A 1FFTB 2XAGA 1AJQA 4JTCB 3K79A 4G27B 2A9HA 1NVPD 2WLLB 4N23A 5LGNA 4JGSA 4MS2A 3T4DA 3K0DA 3G4SV 3E8HA 1R6NA 3TCUA 2QA4V 2B1GA 1M1KW 3M99B 3HPLC 3CYOA 1EFRG 1QLEC 3OFNG 3FB6C 2P90A 3CCQV 3AG2C 2EINC 3ML0A 4I5SA 3ZMTA 1PKXA 4UVBA 1ENVA 4WFHA 3ABUA 1M90W 3B77A 1M57C 2HVKC 3AG3B 1K97A 3LDEA 3OMIB 4RAIA 4QE9A 4UXNA 2Q69A 3CMEV 3B8NA 1NBMG 3OUSA 4JAVA 5LHGA 1F23A 2WLKA 2HKOA 1K92A 3RVZA 3ZN1A 1S3JA 2HG5C 1R3IC 2JDIG 3E8FA 1Q7YW 1SESA 5LHIA 3A0RA 3ABKC 5IY5B 1DTOA 1FXVA 2C2AA 1W2BU 4CZZA 4PELA 2YSUB 5EBWC 1PD3A 1OHHG 3STLC 3LSQA 5CA3A 2IH3C 1NKDA 1F4NA 2EILC 5B1NA 3CCJV 4PA6A 4WFGA 3SPGA 1R3KC 4JYBA 1G4YB 4P9PA 3SYPA 3K08A 1YJWV 4MTFA 2V1DA 1W0KG 4BW5A 3CPWU 4JTAB 5DN6G 3GB7C 3K0GA 2H8PC 3CC2V 2XAQA 4JF3A 3CC4V 1K8AW 3RBZA 5H6RA 1YIJV 2X6AA 2EBOA 2EZOA 3LUTB 2OCCB 4RO2A 1GM9A 3FYIB 4LC1A 1R3JC 3ZRVA 5EBMC 4TT3G 1EZJA 4RUEA 3CXCU 2IU3A 1OCOC 4MTGA 2X6BA 3G6EV 2DYRC 1AR1B 1H2GA 4XDLA 3QNEA 3K3WA 4H37A 5CMUA 2PI4A 3SJQC 3OAAG 5EBLC 3W7XA 1S72V 3P32A 1YTFB 2EIJC 1J95A 4R6ZA 1KD1W 1V55B 5LBQA 3OUFA 1P4RA 4LCUC 3CCRV 4RQFA 1XL6A 4XBFA 1FS0G 1Y66A 5IY5C 2DW4A 4GX2A 2JEXA 3SYCA 3GWOA 3RVYA 2Z3YA 3QO8A 2OTJV 3AG2B 1K33A 4WFFA 4WFBV 5HFMA 5B1BB 3HB3B 4HAMA 4RUFA 1K4CC 4FPPA 4GX0A 4MVQA 3JD1A 3B8MA 5CBHA 4HZ3A 3W7WA 3ABMB 4MVRA 2XOKG 4PA9A 5CN0A 3ETGA 1YJNV 1V54B 3ETEA 4GCZA 4PA3A 2HR3A 1NVPB 2Q6AA 5HFLA 2EILB 2P6JA 1EBOA 1JPXA 3K03A 3LDCA 1FXKC 1M56B 5KA5A 3ETDA 4Q20A 1VQOV 5KA6A 5IYDO 3OR6C 1TUEB 3ZIAG 4UV9A 1W0JG 2FTKA 2EJRA 5B1AC 3T4ZA 1NJIW 2NNUA 1OCZC 5IYCO 1GTOA 4R50A 3ABMC 3FKSG 4X89A 2P7TC 5KUKA 2QE7G 1S0VA 4FIPC 4DO2A 1YTFD 3MHHC 3OMAB 3OE7G 1ROPA 2ZD9A 3FB7C 3JD3A 1PL0A 4WFEA 1YSCA 3UM7A 4U7NA 2EIMC 2M7WA 2UXNA 4FJCC 2IW5A 1OCCB 1KKDA 5GW7A 1KP3A 2R9RB 3K06A 2EIKC 4QNHB 2HVJC 1AI6A 1GKFA 1CPYA 5FL7G 3X2QB 3EFFK 4EKWA 4BIZA 3LDDA 2ZDIC 2DQ3A 2P67A 3CP1A 2JEUA 1B6QA 4MSWC 1PNMA 2R9IA 5L3BA 1S77D 3JD4A 1VQLV 4QPKA 4J9YB 1QLEB 2Y69B 1K3EA 2WAMA 4JYCA 3FYEB 2HLDG 2ATKC 1I5YA 3WG7C 2YEVA 4TSFG 3W7UA 1S76D 1V55C 2LFRA 2ZXWB 3BY6A 2D3OW 1MOFA 1M56C 3ZRWB 4BAYA 4L87A 4GT1A 4LBEC 1H38A 1BL8A 2DWEC 3E89A 3JD2A 3E8BA 4P30A 5L3GA 1BHAA 1E79G 1P7BA 2A0LA 3FB5C 1R73A 3F7VC 3I56V 2IJKA 1JJ2U 2MK3A 3SYQA 3OM3B 4LP8A 1QCEA 3QO5A 3FB8C 2DYSB 2ZQMA 1M9NA 3ABKB 1RPOA 3UKMA 2QM7A 3OEEG 2WLIA 1K4DC 5LGTA 4JAUA 1NH2D 1Q81W 3T2MA 3ZMVA 1QVGU 1OCZB 2DWDC 2QKSA 3SPIA 5E1AC 3SYAA 2HFEC 1QVFU 2Q68A 1JVMA 2BOBC 2WPDG 3TETA 1KECA 3ZN0A 1Y4MA 1RM1C 2DYSC 2EIKB 1VQMV 2ZR2A 4PDMA 4X8AA 1KP2A 2EIMB 2UXXA 4RQEA 1VQ9V 3E2EA 4FMTA 1OCCC 4YXWG 3CMAV 2QEXV 3OEHG 3CCMV 4MVUA 3RW0A 1H8EG 1VQ7V 4G28B 2ZDIA 1OCRB 1YHQV 1SZTA 3ABTA 4MTXA 3QO7A 3P30A 4X88A 3CCUV 1NR7A 1MG1A 2XNDG 2WLLA 3BEHA 3STZC 2XAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E8F A;  2ITC C;  3E8G A;  2ZD9 A;  3ABK C;  3FB7 C;  4XDK A;  4WFE A;  3UM7 A;  5EC1 C;  2EIM C;  2W0F C;  1XL4 A;  5EBW C;  1V54 C;  3E83 A;  1KKD A;  4J9Z B;  4MVM A;  3STL C;  4QE7 A;  2R9R B;  3K06 A;  2IH3 C;  2EIL C;  2EIK C;  4PDL A;  5EC2 C;  4QNH B;  1LNQ A;  2HVJ C;  4DXW A;  2AHZ A;  2WLN A;  4MVZ A;  2ITD C;  2NLJ C;  3EFF K;  4PA6 A;  3AG3 C;  4WFG A;  4EKW A;  3LDD A;  3SPG A;  1R3K C;  1G4Y B;  4CBC A;  4MSW C;  2X6C A;  4P9P A;  3SYP A;  1ZWI C;  3K08 A;  4PDR A;  4MTF A;  3SPH A;  4BW5 A;  4JTA B;  3F5W C;  4J9Y B;  3GB7 C;  3K0G A;  2H8P C;  5EK0 A;  4MVO A;  3IGA C;  4OXS A;  4JTD B;  3RBZ A;  2ATK C;  3WG7 C;  2X6A A;  2YEV A;  5KUM A;  1V55 C;  2WLH A;  3LUT B;  3ZJZ A;  3T1C A;  4MW3 A;  4RO2 A;  3PJS K;  1R3J C;  3E86 A;  1M56 C;  5EBM C;  4HYO A;  4RUE A;  1OCO C;  4MTO A;  4MTG A;  4GX5 A;  4LBE C;  2X6B A;  4PA4 A;  5B3S C;  1BL8 A;  2DWE C;  2WLI B;  2DYR C;  3AG4 C;  3E89 A;  3E8B A;  4P2Z A;  4P30 A;  3SYO A;  5CBF A;  4R7C A;  1P7B A;  2A0L A;  2AHY A;  4XDL A;  3FB5 C;  4H37 A;  3F7V C;  5BZB A;  4R8C A;  4TWK A;  3SJQ C;  4MW8 A;  5EBL C;  3SPJ A;  4UUJ C;  2A79 B;  3ASN C;  3R65 A;  4F4L A;  2EIJ C;  1J95 A;  4R6Z A;  2HJF C;  3SYQ A;  1S5H C;  4LP8 A;  3OUF A;  4LCU C;  3FB8 C;  1XL6 A;  4GX1 A;  3IFX A;  5IY5 C;  4GX2 A;  3UKM A;  2Y69 C;  3KG2 A;  3SYC A;  3RVY A;  5CBG A;  1ORQ C;  3ASO C;  2JK5 C;  2WLM A;  3VOU A;  4WFF A;  4H33 A;  4PA7 A;  3JYC A;  2ZXW C;  2WLI A;  1K4D C;  4RUF A;  2QTO A;  3F7Y C;  1K4C C;  1R3L C;  4GX0 A;  1OCR C;  3T2M A;  4MVQ A;  2DWD C;  4KFM A;  2QKS A;  3SPI A;  5E1A C;  2KB1 A;  2BOC C;  3K04 A;  2HFE C;  4HZ3 A;  4MVS A;  3SYA A;  2Q68 A;  3X2Q C;  5CBH A;  4MVR A;  1JVM A;  2BOB C;  4PA9 A;  4JTC B;  3OGC C;  4G27 B;  2A9H A;  3ABL C;  3TET A;  4PA3 A;  4I9W A;  2WLL B;  4P9O A;  2K1E A;  3T4D A;  4MS2 A;  3K0D A;  2Q6A A;  4PDV A;  2DYS C;  2OCC C;  3E8H A;  3TCU A;  2WLJ A;  3K03 A;  4ZBM A;  3HPL C;  4PDM A;  4X8A A;  1QLE C;  3LDC A;  3ZRS A;  3FB6 C;  3AG2 C;  2EIN C;  3OR6 C;  1OCC C;  3OR7 C;  3LNM B;  4MVU A;  4WFH A;  5B1A C;  3RW0 A;  4G28 B;  4XDJ A;  1M57 C;  2HVK C;  2IH1 C;  3T4Z A;  3LDE A;  3SPC A;  1OCZ C;  4RAI A;  4QE9 A;  2Q69 A;  4X88 A;  3OUS A;  4R50 A;  3ABM C;  5B1B C;  2WLK A;  2Q67 A;  3AG1 C;  5J9P C;  4X89 A;  3RVZ A;  2P7T C;  2WLL A;  5KUK A;  3BEH A;  3STZ C;  2HG5 C;  1R3I C; 
#chains in the Genus database with same CATH topology
 4X1K B;  4QPJ A;  1FJG B;  3DGE A;  3ZMZ A;  5JWP A;  3E83 A;  3RYI B;  2EIJ B;  1YJ9 V;  2V7Q G;  1LNQ A;  2AHZ A;  4MVZ A;  4DR5 B;  3H1J H;  1WN7 A;  3ZRX A;  2EIN B;  4CH5 A;  4JTD B;  5KUM A;  1I94 B;  3AG1 B;  4PJ0 Z;  1M57 B;  4I55 A;  2Q0A A;  3CSX A;  3OW2 U;  3RFR A;  3MHS C;  4DUZ O;  2WLI B;  4P2Z A;  1Q82 W;  5C93 A;  4DV3 B;  2AHY A;  4LFB B;  3S3X A;  4TWK A;  4X1I B;  1Z5V A;  3L73 H;  1N33 B;  4F6E A;  2JJ1 G;  1LUV A;  2HJF C;  4DRX A;  4W4L A;  4UVC A;  4ZOL A;  3IFX A;  2OT5 A;  1MSW D;  4IYH A;  2XAJ A;  4DK0 A;  2JK5 C;  3E22 A;  1O9H A;  5F2V O;  1G8M A;  2LP7 A;  5EIB D;  1ARO P;  2OTL V;  2KB1 A;  4K3A A;  3K9A A;  1IBM B;  4AQY O;  4JI7 B;  4DR2 O;  2F93 B;  2WLJ A;  1OV9 A;  1GM7 A;  3ZRS A;  2LJ2 A;  1DF5 A;  1Z2G A;  2BTQ A;  3LNM B;  2ODM A;  1VQ5 V;  2JJ2 G;  2L6L A;  2WA4 A;  4XDJ A;  3FFQ A;  2IH1 C;  2HJD A;  5LXT A;  3CD6 V;  1WA8 A;  1VQ6 V;  1HNZ O;  1N8R W;  4BW9 A;  1PNL A;  5J9P C;  3OTO B;  5B66 Z;  1GO3 F;  1GRJ A;  1XHX A;  2F4V B;  1HW7 A;  2ITC C;  3K9S A;  1AI4 A;  3UCS C;  2X0L A;  1XRE A;  1ZAU A;  2OIE A;  3ETQ A;  5EC1 C;  1WPX A;  2HHH O;  2F66 C;  3D3I A;  1V54 C;  2R9A A;  2PI5 A;  2EZP A;  4J7K A;  3AG3 C;  3FD9 A;  4I50 B;  4UCV A;  2UXD O;  4ICG A;  1GK9 A;  3D8C A;  1TUB B;  1XMQ B;  2UXC O;  1E1Q G;  1YF2 A;  1GH6 A;  3ZJZ A;  4LF8 B;  3EXA A;  2Q5Z A;  1N34 B;  3A0H Z;  5IDJ A;  4HYO A;  3JAK A;  3W7T A;  3N2K B;  3ABL B;  4WF9 V;  1I5X A;  2Q9L A;  2UXB B;  1NR1 A;  3E35 A;  4LWS B;  5BZB A;  2XAH A;  4MW8 A;  4YJ3 B;  3TK1 A;  4X65 B;  4KP4 A;  1EN4 A;  4DV2 B;  4AIL C;  2QKA A;  2E3C A;  1NS1 A;  5CA0 B;  1SF9 A;  3JD0 A;  3HR0 A;  3ASO C;  5LYJ B;  3VOU A;  2JGU A;  1XNR O;  2XTA A;  5IYB O;  2ZXW C;  2DYR B;  1PNK A;  2UUC O;  3WB1 A;  1GN3 A;  2IJH A;  1XUQ A;  4ZHQ A;  2LFS A;  3CJH A;  4MVS A;  1NTZ H;  2JRI A;  2Q7H A;  1JR9 A;  1AJQ A;  3K79 A;  4N23 A;  2ZIO A;  1JFF B;  3FB6 C;  2P90 A;  3HKD B;  3AG2 C;  2EIN C;  4I5S A;  3ZMT A;  1FAF A;  4YJ3 A;  4O4L A;  1B3Q A;  3AG3 B;  4QE9 A;  2Q69 A;  3B8N A;  5CA0 A;  1SQB H;  1JFF A;  3OUS A;  1F23 A;  5LHG A;  4ZI7 B;  3JSN A;  1EN5 A;  4O2B A;  3HKD A;  3ZN1 A;  3ZHU A;  2E5L B;  5JQG B;  2JDI G;  3E8F A;  3ZHQ A;  4FM0 A;  1DTO A;  4DV1 O;  2ZNJ A;  4IHJ A;  4CZZ A;  2YSU B;  4ZHQ B;  5EBW C;  3FAV A;  1OHH G;  2IH3 C;  5B1N A;  1F4N A;  4WFG A;  4X66 O;  4B7K A;  3L70 H;  4D7S A;  1Y74 A;  3SPG A;  4P9P A;  1YJW V;  1IVS A;  1W0K G;  3HKE A;  4DR4 B;  4LR3 A;  3J81 N;  2ZIN A;  3RYH A;  3CC4 V;  3RBZ A;  1YIJ V;  1U96 A;  2EBO A;  2EZO A;  5C8Y A;  2E76 B;  4LC1 A;  1R3J C;  5BXZ A;  5JJJ B;  2QM4 A;  5FNV B;  4RUE A;  1GN4 A;  2ZE5 A;  5JQG A;  2DYR C;  1KU9 A;  4JI8 B;  4NKG B;  5D5P A;  2WA3 A;  2JGD B;  5CMU A;  2RJZ A;  5ITZ B;  3OAA G;  1SQV H;  3TXQ A;  1YTF B;  1J95 A;  5LBQ A;  1BZK A;  1XL6 A;  3K5N A;  1Y66 A;  4GX2 A;  4KL1 A;  3LNN A;  4JV5 O;  3AG2 B;  3TJT A;  3HKE B;  3HKC B;  1N32 O;  5HFM A;  3HB3 B;  3SJC C;  4DR7 B;  4MVQ A;  3JD1 A;  3CWB H;  3AK3 A;  3SDL A;  3W7W A;  3ABM B;  4DUY O;  1IZ3 A;  1GN6 A;  2XOK G;  4PA9 A;  5CN0 A;  3VQX A;  4JI4 O;  3ETG A;  1YJN V;  4X64 B;  5HFL A;  1XMQ O;  2P6J A;  2H3O A;  2JS3 A;  3ETD A;  4Q20 A;  5KA6 A;  5IYD O;  3ZIA G;  4DW1 A;  4UV9 A;  1W0J G;  2FTK A;  2EJR A;  5B1A C;  4O4I A;  4FLV A;  4JYA B;  4FFB B;  3GWK C;  1GTO A;  2ETN A;  1DGS A;  1FYJ A;  4R50 A;  5LP6 C;  5KUK A;  3OD4 A;  3DC5 A;  1LUW A;  1YTF D;  5LMU O;  3OMA B;  4J7Z A;  4B3S O;  4WFE A;  2M7W A;  4TQF A;  2UXC B;  1KP3 A;  2R9R B;  5FL7 G;  3X2Q B;  2HVJ C;  2CGN A;  2G38 A;  2Y4T A;  4BIZ A;  3CP1 A;  2DQ3 A;  3CRQ A;  1B6Q A;  1BQZ A;  2D2C B;  4J9Y B;  4JYC A;  3FYE B;  5EYP B;  2ZNI A;  1V55 C;  2D3O W;  2A3Q A;  3BA8 A;  1MOF A;  4PV1 B;  2QWQ B;  5IJ0 A;  1TGO A;  4GT1 A;  1X4T A;  4P30 A;  3IAY A;  1R73 A;  1MNG A;  3H1I H;  2QWP B;  1JJ2 U;  2MK3 A;  5IT9 N;  1N33 O;  1P7G A;  1N0N A;  3ABK B;  1M9N A;  1YVW A;  2KKW A;  2XHB A;  2Q4P A;  4LF9 B;  2OYQ A;  3BRC A;  3RYC A;  4I9Q A;  2WLI A;  1K4D C;  4EB6 A;  3VQV A;  1YZB A;  4JZG A;  2DWD C;  2UUC B;  1RSO A;  1QVF U;  2Q68 A;  2BOB C;  2W0X A;  3BAB A;  3TET A;  4O4H B;  2F95 B;  3ZN0 A;  1ZLZ A;  1ZL8 B;  1M4U A;  3AG7 A;  2GDS A;  2GUZ A;  1VQ9 V;  4RQE A;  3E2E A;  3OT7 A;  4U3J B;  3HKB B;  2QEX V;  2P4K A;  1H8E G;  4G28 B;  4JYA O;  1YHQ V;  4YHH B;  1V9P A;  4MTX A;  4X88 A;  2AW9 A;  4DUZ B;  2QWN B;  5GTI Z;  2PUS A;  4JAA A;  1YEW A;  2XND G;  1DK1 A;  4TV8 B;  3BEH A;  5H5N A;  1FXK A;  3HKB A;  4LF5 B;  2R72 A;  3J80 N;  4LF7 O;  1BGY H;  3B40 A;  4HBN A;  5A9G A;  3WFV A;  1KUQ A;  3H1L H;  4PDL A;  4PI0 A;  2W6J G;  4UCR A;  4CBC A;  1EM1 A;  4UVA A;  1HNX B;  3M7M X;  4K8Z A;  4X62 B;  1MSD A;  2LW1 A;  2CTR A;  3IGA C;  5DEC A;  3WB2 A;  3PJS K;  4LF7 B;  2Y0I A;  3OMN B;  3EVK A;  4IIJ B;  2DE0 X;  4Z2W A;  4DR1 B;  3K58 A;  1K7D A;  1JCH A;  3KCX A;  2P06 A;  4PA4 A;  1FXK B;  1I08 A;  5K1X A;  4EB6 B;  2B1I A;  5BR8 O;  1ZTE A;  2FKX A;  4AI8 A;  5LYJ A;  5KHK A;  4YIP A;  1N0J A;  2ZM6 B;  3SPJ A;  1CP9 A;  4UUJ C;  2A79 B;  5H9C A;  1B04 A;  3R65 A;  1JOY A;  1H2L A;  4ZKI A;  1S5H C;  4UCT A;  5JH7 A;  3CCV V;  1FFX B;  2F4V O;  4B3M O;  4FLT A;  2IJJ A;  1BQ0 A;  5BY1 A;  2ZCE A;  4LF4 O;  5IWA B;  1R3L C;  3S3W A;  1JQ0 A;  3RN4 A;  3ZHR A;  1SA0 A;  1KQS U;  3OGC C;  4DRX B;  2N74 A;  2ZE6 A;  3H01 A;  5LMU B;  4B3S B;  1SQQ H;  1OCO B;  5LGU A;  1B06 A;  1KC8 W;  1RFY A;  2XAS A;  1EN6 A;  1SER A;  3JCU Z;  4Z1M G;  2YC0 A;  5LP6 A;  3C3T A;  1XHZ A;  2AZ0 A;  1WB8 A;  1BMF G;  2YIC A;  5IYZ B;  3EHB B;  5IWA O;  1H2N A;  4FVM A;  1VQK V;  1OZ0 A;  5FNV A;  1YI2 V;  4F6R A;  4U7O A;  2EX3 A;  3KG2 A;  2BCC H;  2DOS A;  2H94 A;  4KUM A;  5LMN B;  1AI5 A;  1K73 W;  1Q86 W;  1YIT V;  3DTU B;  4J41 A;  4WFA V;  3AEI A;  5EC2 C;  5K1P A;  5EZY A;  4CH3 A;  4GKJ O;  3JAK B;  2P4V A;  2X6C A;  3OGI B;  1TVK B;  1SQG A;  2HEP A;  3JAT A;  4ZI7 A;  4LF6 O;  1XDC A;  2FML A;  3CCL V;  5EK0 A;  1QU7 A;  1FKA O;  3JAS B;  4JI2 B;  1H2S B;  4JI1 B;  3RYF B;  1S5J A;  4IHJ B;  5JCO A;  3CC7 V;  1L1F A;  2VS0 A;  1HNW O;  3N2G B;  4MTO A;  1K34 A;  2PYL A;  2Q7E A;  3JAL B;  4FLW A;  2JVD A;  4Z1V A;  3ZX6 A;  4KXR A;  1TAE A;  3IC7 A;  4WCE V;  5L3C A;  1XQ8 A;  4LF5 O;  1YXB A;  3JAW A;  1I0H A;  3WG7 B;  4PA7 A;  5L3E A;  3JYC A;  5EIB C;  1K9M W;  2LGW A;  4D6T H;  1CEZ A;  4TV9 B;  4B3T B;  1QLN A;  4I7Z B;  2YXH A;  1JJO A;  3K04 A;  1FFT B;  1N4C A;  4DV4 O;  4O2B B;  5LGN A;  4JGS A;  4MS2 A;  3K0D A;  3G4S V;  3E8H A;  4UB6 Z;  3CE2 A;  4J7J A;  1N36 B;  3M99 B;  1EFR G;  3P3N A;  4O2A A;  4GKK B;  1PKX A;  1ENV A;  1IBK O;  1M90 W;  3B77 A;  1M57 C;  2HVK C;  1WNS A;  1OJH A;  4RAI A;  4UXN A;  3CME V;  1VP7 A;  4JAV A;  1TVK A;  3Q4H A;  5J2T B;  2HG5 C;  1R3I C;  3U10 A;  3A0R A;  4DW0 A;  2P5O A;  2CTW A;  3STL C;  3UQ8 A;  4UCU A;  4PA6 A;  2PYJ A;  1Q90 D;  4B3T O;  1R3K C;  4JYB A;  4LF4 B;  4JI6 B;  4DR1 O;  3GB7 C;  2XAQ A;  4JF3 A;  1K8A W;  2Q73 A;  2X6A A;  4JI4 B;  3AK2 A;  2OCC B;  2YIB A;  4RO2 A;  1GM9 A;  1EZJ A;  2BSK A;  3G6B A;  5FLX N;  2X6B A;  2GTS A;  2YXY A;  4FLY A;  4WBN B;  4XDL A;  4CH4 A;  2PI4 A;  1PM9 A;  3C3S A;  3W7X A;  1S72 V;  4B3R O;  2Y4U A;  4LF8 O;  1Q8I A;  3P32 A;  2EIJ C;  1BE3 H;  4GKK O;  4O4J B;  1KD1 W;  4NYK A;  1V55 B;  5C8Y B;  4LCU C;  3NR7 A;  5IY5 C;  2DW4 A;  4EFB A;  1HDJ A;  1L0L H;  1K33 A;  1SQX H;  3JAR A;  4RUF A;  1K4C C;  1US6 A;  4FPP A;  1ZSP A;  2CE4 A;  1N32 B;  4LFA O;  4NVP A;  2HR3 A;  1NVP B;  4JI0 B;  2EIL B;  4ZOL B;  1SC5 B;  1FXK C;  2CH7 A;  3C90 A;  4B08 A;  1VQO V;  1VF6 C;  3OR6 C;  1TUE B;  4CS4 A;  1HNZ B;  4DUY B;  1KYO F;  1NT2 B;  1XEQ A;  1D5N A;  3T4Z A;  4NXN O;  2NNU A;  3UO2 A;  1OCZ C;  2UXB O;  4X9Q A;  4B7E A;  3MHH C;  4BR6 A;  3FB7 C;  3K57 A;  1PL0 A;  1YSC A;  3K5L A;  4U7N A;  2EIM C;  4FJC C;  4H44 B;  1KKD A;  5GW7 A;  3K06 A;  2IM9 A;  5JJE B;  1AI6 A;  1L0N H;  1GAX A;  3U11 A;  2ZDI C;  1QQC A;  5LOV B;  2PGG A;  5L3B A;  4I4T A;  1LR1 A;  1VF6 A;  3JD4 A;  2Y69 B;  2HLD G;  2N05 A;  1I5Y A;  2YEV A;  5IE9 A;  4CC6 A;  1G1X B;  3K59 A;  1R1B A;  2OIG A;  2RCV A;  5BR8 B;  1HR0 B;  1SZX A;  3B2E E;  4X20 A;  4CC5 A;  2KG7 A;  3E89 A;  1P7B A;  2BTO A;  1H2K A;  3FB8 C;  5B5E Z;  5BMV B;  2QM7 A;  3L74 H;  3OEE G;  4JAU A;  4FZ1 A;  3T2M A;  3ZMV A;  2QKS A;  3SPI A;  5E1A C;  3G80 A;  1SS3 A;  2WPD G;  4JI3 B;  1Y4M A;  3T1Y B;  2EIK B;  4TQD A;  1VQM V;  5AG2 A;  2UXX A;  4FMT A;  2UXD B;  4FLU A;  3RW0 A;  1VQ7 V;  1TA8 A;  2ZDI A;  1OCR B;  1SZT A;  4UCS A;  1RSO B;  3BHP A;  3QO7 A;  3P30 A;  1WJZ A;  1NR7 A;  1FJG O;  2XAF A;  1N34 O;  2QGN A;  1XMO O;  4QJF B;  2GUZ B;  3IC9 A;  1SRY A;  1AVM A;  4MVM A;  3ZMS A;  3ZMU A;  1NH2 B;  3ZHS A;  4J11 A;  2ITD C;  2NLJ C;  2ZR3 A;  3J7A U;  3K5O A;  2YIA A;  2QKC A;  4PDR A;  4PI2 A;  2X7R B;  4JV5 B;  1BT8 A;  4LNU A;  4MVO A;  3T1Y O;  3RGB A;  4UCO A;  3ASN B;  4ASU G;  4JAS A;  4MT8 A;  2GSM B;  2R70 A;  1S5L Z;  4GX5 A;  5B3S C;  2NN4 A;  4JI5 O;  1Q3E A;  1H2M A;  5B1A B;  4I0X B;  2FB5 A;  2LGQ A;  3LSS A;  3MD0 A;  1WA8 B;  4DR6 B;  4H0L B;  1EZV H;  2FYU H;  4AHC A;  4LFB O;  4H33 A;  2DQ0 A;  1AR4 A;  1IUR A;  3F7Y C;  2FL4 A;  5KX5 B;  5KHJ A;  2Q8V A;  1DF4 A;  5IYZ A;  2JS5 A;  2JIZ G;  3ZCC A;  4GLX A;  1IBK B;  3THO A;  3ABL C;  4DV1 B;  4I9W A;  4UV8 A;  1JMK C;  2VWJ A;  2V4D A;  1L8D A;  3OR7 C;  2A7W A;  1UPG A;  2UU9 O;  2ZM6 O;  1HWY A;  2HP8 A;  5JVD A;  3I55 V;  1COW G;  2LO1 A;  1R6T A;  1F51 A;  2ZIM A;  2Q67 A;  2GHY A;  1XI1 A;  2Z0A A;  2RQ6 A;  3L72 H;  4B3M B;  4JZ2 A;  3SJB C;  3E8G A;  4JI5 B;  1GMG A;  2W0F C;  1SET A;  2KSD A;  4J9Z B;  3G71 V;  4DR3 B;  3ZHT A;  4KHP B;  5GTH Z;  4DXW A;  2WLN A;  3BFR A;  5KAF Z;  3W7S A;  2KG7 B;  1Q6I A;  3CRR A;  3JAL A;  1ZWI C;  2ADQ B;  3SPH A;  4DR5 O;  5A2Q N;  1RPR A;  3A2F A;  3F5W C;  1AJN A;  4NR1 A;  4OXS A;  4DV2 O;  2DJV A;  5FPO A;  3TGU H;  4MW3 A;  4B3R B;  4YJ2 A;  1WAZ A;  3CEI A;  5D5Q A;  3BPZ A;  1WB7 A;  1JX9 A;  2AXT Z;  4DR7 O;  2CTQ A;  2CTP A;  1Y76 A;  2YXL A;  3A0B Z;  4R7C A;  1Q43 A;  4IYI A;  1QR9 A;  1QNM A;  2QDO A;  3IJ4 A;  5EYP A;  4F4L A;  2XT9 A;  1MMM A;  3DC6 A;  4EEQ A;  4GX1 A;  1XMO B;  4G2K A;  2Y69 C;  5CA1 B;  2Y0P A;  5GON B;  1I7F A;  4LF6 B;  2QTO A;  2VQF O;  1VQP V;  5H2F Z;  2UU9 B;  1IXM A;  4KFM A;  4FZ0 A;  3UO3 A;  2VQE O;  2NR5 A;  4JTC B;  3ZBH A;  5CA1 A;  1NVP D;  2F1M A;  1AP5 A;  2WLL B;  3T1H B;  1YDX A;  3D36 C;  4DR4 O;  4ABM A;  5LOV A;  1R6N A;  1M1K W;  2B1G A;  2DMX A;  4AQY B;  4JI7 O;  4JI3 O;  1QLE C;  3CCQ V;  3ML0 A;  3O9O A;  4UVB A;  2L35 A;  4OX9 B;  3ABU A;  1VEW A;  1K97 A;  1HP8 A;  3JAM N;  1BSM A;  2PF4 E;  1NBM G;  4DV6 B;  2WLK A;  1Y6X A;  2HKO A;  2RDC A;  2P22 C;  4Q6G A;  4O4H A;  1S3J A;  2QWO B;  3B09 A;  1ZL8 A;  5LHI A;  2E5L O;  1XBL A;  2ILM A;  5IY5 B;  1FXV A;  1XIL A;  1W2B U;  2OWO A;  4PEL A;  4JYY A;  4NTY A;  2EIL C;  3H9V A;  3DXR A;  3N2G A;  4OX9 O;  1FPO A;  3SYP A;  5KMG A;  2F23 A;  4MTF A;  4FFK A;  5BMV A;  3APQ A;  4TV8 A;  1N36 O;  4QGP A;  2H8P C;  2OCH A;  3CC2 V;  4LFA B;  4C7U A;  3LUT B;  1Q6U A;  3SGI A;  2ADP A;  3FYI B;  4NXM O;  5EBM C;  3CRM A;  4TT3 G;  2IU3 A;  1IBL O;  1OCO C;  4MTG A;  3SJA C;  3G6E V;  4TV9 A;  1H2G A;  2GTA A;  3QNE A;  3K3W A;  3SJQ C;  5EBL C;  1SQF A;  4IGG A;  4R6Z A;  4X1Y A;  3OUF A;  1FS0 G;  4TUY A;  2JEX A;  3RVY A;  4OGQ B;  2M6Y A;  2Z3Y A;  2OTJ V;  1JA8 A;  3H1H H;  2BTQ B;  1SQP H;  5B1B B;  4GKJ B;  4LH7 A;  4GX0 A;  3B8M A;  3TXS A;  4MVR A;  4TUY B;  5J2U A;  2UUB O;  1G6U A;  4PA3 A;  4GCZ A;  4U3F H;  2Q6A A;  1EBO A;  3CS5 A;  3K03 A;  4X64 O;  3VQW A;  1M56 B;  5KA5 A;  4X65 O;  3QVN A;  4YHH O;  4DR3 O;  2N04 A;  2ZE7 A;  5LL6 Y;  2IBZ H;  1XNQ B;  3ABM C;  4H13 B;  3JAW B;  2P7T C;  3CXH F;  2QE7 G;  4FIP C;  3OE7 G;  1AIL A;  2YID A;  3UM7 A;  1IBM O;  3H1K H;  2YI8 A;  2IW5 A;  4LNU B;  1OCC B;  5KLV H;  4DK1 A;  4QNH B;  2ZT9 B;  3EFF K;  4EKW A;  4I55 B;  2P67 A;  2JEU A;  4MSW C;  1PNM A;  1KB9 F;  5IJ0 B;  4QPK A;  2AZ2 A;  1U97 A;  4GYC B;  3W7U A;  3WG7 C;  1S76 D;  4O4J A;  2LFR A;  1BCC H;  3MAQ A;  4L87 A;  5EZY B;  1H38 A;  2DWE C;  3JAR B;  1PV0 A;  1SKV A;  1KBH A;  3E8B A;  1A32 A;  3FB5 C;  1W59 A;  3E22 B;  2IJK A;  1Q6H A;  3R66 A;  4OPA A;  3ZS8 C;  2LW7 A;  3OM3 B;  4LP8 A;  1QCE A;  3QO5 A;  2DYS B;  3A8T A;  5LA6 A;  2CH7 B;  3O65 A;  4DV4 B;  4DYL A;  4DV5 B;  3ZHV A;  3KKY A;  5KHI A;  5LGT A;  4FM1 A;  4RWU A;  1NH2 D;  1Q81 W;  1O9G A;  2Q0O C;  1QVG U;  2A06 H;  3SYA A;  1JVM A;  5LA6 B;  3L71 H;  2ZE8 A;  4DV7 B;  4J80 A;  2ZR2 A;  4A5U B;  2VWK A;  4PDM A;  2PTM A;  3T1H O;  1D2D A;  4IT5 A;  1OCC C;  4YXW G;  3CCM V;  3QF7 A;  1Y67 A;  1YCI A;  3APO A;  3ABT A;  1NTM H;  4YJ2 B;  4E4E A;  3P3P A;  2PZS A;  3TCU A;  3STZ C;  1VAR A;  5JCO C;  4HNA A;  4O2A B;  1XL4 A;  1TUB A;  4BWA A;  2RMK B;  1ZUQ A;  5B3S B;  4X20 B;  4F6R B;  1UJW B;  4HNA B;  1IBL B;  2B5U A;  3N2K A;  4U3J A;  4X1I A;  1QR8 A;  1FXH A;  3ZED A;  3SR2 C;  1AB3 A;  2K9P A;  2QWR B;  2YDE A;  1VQ8 V;  3B4S A;  4DV5 O;  1BHB A;  1FFX A;  3SYO A;  5CBF A;  2EJ7 A;  1KKC A;  1NQT A;  5DM6 V;  5L3F A;  2QR4 A;  4KHP O;  4R8C A;  3CRA A;  5LP6 B;  1THZ A;  1AJP A;  3ASN C;  2CUG A;  1K5S A;  3CJH B;  3VBB A;  5CBG A;  1NI8 A;  3OTO O;  5KHG A;  2BSK B;  2WLM A;  2F43 G;  3AG4 B;  1OCR C;  1QBZ A;  1WLE A;  1AI7 A;  3X2Q C;  2IJI A;  4O4L B;  3ZRW A;  4LH6 A;  4P9O A;  2K1E A;  4NTW A;  4PDV A;  2OCC C;  4ZBM A;  1MZE A;  3CCE V;  2VQE B;  3RYH B;  4IL6 Z;  2Z5U A;  3MDS A;  1GM8 A;  1H8H G;  1T5E A;  3SPC A;  1XOU A;  1F4M A;  3RT3 C;  2VQF B;  1D5A A;  4FK5 C;  5JH7 B;  2CK3 G;  1URF A;  1K5Q A;  2LQT A;  5B1B C;  3JCZ A;  1XNR B;  2ZKO A;  3AG1 C;  5L3D A;  1AR5 A;  2UUA B;  4XDK A;  2JGD A;  3ASO B;  4QE7 A;  5B1O A;  4E2L A;  2DN9 A;  4BIU A;  2Y48 A;  1RM1 B;  1VQN V;  1X59 A;  1E1R G;  4N21 A;  4LFC B;  3D36 A;  5KHH A;  5H6Q A;  4JPR A;  2WSS G;  2YUA A;  4JI1 O;  2WLH A;  3T1C A;  3E86 A;  2WWW A;  1GN2 A;  5J2U B;  3JAT B;  3NXS A;  1M5I A;  4K8X A;  3RYC B;  1KMI Z;  3AG4 C;  3CCS V;  2IU0 A;  2ARH A;  3HKC A;  2KQX A;  1F7Y A;  2YEV B;  2B9Z A;  5LHH A;  4JI2 O;  3GVM A;  4FLZ A;  4ZIB A;  3Q4H B;  1ORQ C;  4QIW F;  4D7T A;  1VQ4 V;  4K0K B;  2W6I G;  1R6K A;  4YY3 O;  2QM8 A;  1DLB A;  1PL4 A;  1MAB G;  2RN9 A;  4LWS A;  3G67 A;  4NXM B;  2BOC C;  1AP6 A;  2XAG A;  4G27 B;  2A9H A;  1M93 A;  3T4D A;  2QA4 V;  1PPJ H;  2CDY A;  3HPL C;  3CYO A;  3OFN G;  1NU1 H;  5J2T A;  3CX5 F;  1J5E B;  4WFH A;  4UFZ A;  1VF7 A;  3DXR B;  3LDE A;  3OMI B;  4BIO A;  1Y74 B;  4FLX A;  1PP9 H;  1K92 A;  3RVZ A;  1IXB A;  2EUL A;  1Q7Y W;  1SES A;  2O57 A;  3ABK C;  4L8J A;  3JAS A;  2C2A A;  3RYF A;  5JVD B;  2MW2 B;  3OTF A;  1PD3 A;  1XNQ O;  1MA1 A;  3LSQ A;  5CA3 A;  1NKD A;  1UFI A;  5E79 Z;  4EFE A;  3CCJ V;  2AGA A;  4DV3 O;  4JI6 O;  3LSU A;  1G4Y B;  1FD9 A;  3K08 A;  2V1D A;  4BW5 A;  3CPW U;  4JTA B;  4W4K A;  3WB0 A;  5DN6 G;  5IJ9 B;  3K0G A;  3BCC H;  3D3Q A;  1VF5 B;  5H6R A;  2UUB B;  2QTS A;  4OPH A;  3F5T A;  3KZI Z;  4I50 A;  3RYI A;  5JJN B;  3ZRV A;  4FM2 A;  4TOI A;  3PN1 A;  3CXC U;  3QG5 A;  5KMG B;  1AR1 B;  4YY3 B;  3K5M A;  4H37 A;  1SA0 B;  2CGO A;  1IDS A;  4PD4 F;  1P4R A;  3CCR V;  4RQF A;  1NTK H;  4XBF A;  3SYC A;  4WBN A;  3GWO A;  3QO8 A;  4WFF A;  4WFB V;  4HAM A;  3CHX A;  3FX7 A;  1HNW B;  4NXN B;  4GZR B;  5ITZ A;  4I0X A;  5CBH A;  4HZ3 A;  1WP8 A;  1V54 B;  3ETE A;  4X1Y B;  2PY5 A;  1RP3 B;  4J42 A;  1WP7 A;  1JPX A;  1Y76 B;  2YI9 A;  4CS2 A;  3LDC A;  1Q5O A;  4CH6 A;  3L75 H;  3QTC A;  1NZ6 A;  1VMG A;  4X66 B;  3M8A A;  4DV0 B;  2YS8 A;  2E75 B;  5KX5 A;  1NJI W;  5IYC O;  5KAI Z;  3BAA A;  3FKS G;  1P84 F;  4X89 A;  1WPB A;  5GON A;  1S0V A;  4DO2 A;  3AK1 A;  4DV7 O;  1ROP A;  2GBO A;  2ZD9 A;  3JD3 A;  2UXN A;  4LFC O;  3UT5 B;  2EIK C;  3CRC A;  1GKF A;  1CPY A;  4FFB A;  3LDD A;  4JI8 O;  5LXT B;  2R9I A;  4IIJ A;  1HR0 O;  4LF9 O;  1S77 D;  1VQL V;  3I5D A;  1QLE B;  4DR2 B;  1K3E A;  4DR6 O;  1QHT A;  1ZX3 A;  2WAM A;  1MZF A;  4J10 A;  2HHH B;  2ATK C;  4TSF G;  4NB5 A;  3BY6 A;  2ZXW B;  2UUA O;  5LMN O;  1M56 C;  3ZRW B;  3ICX A;  4BAY A;  2Q7G A;  2VRZ A;  4UB8 Z;  3N27 A;  4LBE C;  1BL8 A;  3JD2 A;  5L3G A;  1BHA A;  1E79 G;  2A0L A;  4K0K O;  4CS3 A;  3JSL A;  4PHZ A;  3F7V C;  3I56 V;  2CAZ C;  3FAV B;  1IX9 A;  5DED A;  3UT5 A;  1CXZ B;  1I94 O;  3SYQ A;  2ZQM A;  3RWR D;  1RPO A;  3U0Z A;  3UKM A;  5CB4 A;  4I4T B;  3WU2 Z;  1HNX O;  3L9D A;  2GV9 A;  3BA9 A;  4DV6 O;  4O4I B;  3BVO A;  4YIO A;  1OCZ B;  2E74 B;  4DV0 O;  1J5E O;  2HFE C;  4K35 A;  5CB4 B;  3CB2 A;  1KEC A;  2YIB D;  1RM1 C;  2DYS C;  2XUM A;  4JI0 O;  3DSQ A;  4X62 O;  4X8A A;  2QSA A;  1KP2 A;  2EIM B;  3KCY A;  2RNB A;  3CMA V;  4NTX A;  3OEH G;  2QJ1 A;  4MVU A;  4X1K A;  1BS3 A;  1VIB A;  2BE3 A;  3VQY A;  1P49 A;  5TIS Z;  3CCU V;  5FPR A;  4GUN A;  1MG1 A;  2WLL A;  1Z5W A;  5IJ9 A; 
#chains in the Genus database with same CATH homology
 4QPJ A;  4QJF B;  3DGE A;  1SRY A;  1XL4 A;  3ZMZ A;  3E83 A;  3WFV A;  2EIJ B;  1YJ9 V;  4MVM A;  2V7Q G;  4PDL A;  3ZMS A;  3ZMU A;  1NH2 B;  1LNQ A;  2AHZ A;  4MVZ A;  2ITD C;  2NLJ C;  2W6J G;  2ZR3 A;  5B3S B;  4CBC A;  3ZRX A;  4PDR A;  1UJW B;  2X7R B;  4UVA A;  2B5U A;  4MVO A;  3IGA C;  2EIN B;  3ASN B;  4JTD B;  1QR8 A;  4ASU G;  5KUM A;  1FXH A;  3AG1 B;  4JAS A;  1M57 B;  3PJS K;  3OMN B;  4MT8 A;  2GSM B;  3OW2 U;  1K7D A;  1JCH A;  4GX5 A;  1VQ8 V;  3MHS C;  4PA4 A;  1FXK B;  5B3S C;  2WLI B;  1BHB A;  4P2Z A;  1Q82 W;  3SYO A;  5C93 A;  5CBF A;  2B1I A;  1NQT A;  2AHY A;  5DM6 V;  5L3F A;  5B1A B;  4R8C A;  4TWK A;  3SPJ A;  1CP9 A;  1THZ A;  1AJP A;  4UUJ C;  2A79 B;  5H9C A;  3ASN C;  3LSS A;  3R65 A;  1JOY A;  2JJ1 G;  2HJF C;  4ZKI A;  3MD0 A;  1K5S A;  1S5H C;  4UVC A;  3IFX A;  3CCV V;  2OT5 A;  1MSW D;  3VBB A;  5CBG A;  2XAJ A;  2IJJ A;  2JK5 C;  2WLM A;  4H33 A;  2DQ0 A;  1G8M A;  2LP7 A;  2F43 G;  3AG4 B;  3F7Y C;  1R3L C;  1JQ0 A;  1OCR C;  1QBZ A;  1KQS U;  1ARO P;  1DF4 A;  1WLE A;  1AI7 A;  2OTL V;  2KB1 A;  3X2Q C;  2IJI A;  2JIZ G;  3ZCC A;  3ZRW A;  3K9A A;  3OGC C;  3ABL C;  4P9O A;  4I9W A;  2K1E A;  4UV8 A;  3H01 A;  4PDV A;  2OCC C;  1OCO B;  2WLJ A;  5LGU A;  4ZBM A;  1GM7 A;  3ZRS A;  1KC8 W;  2XAS A;  3CCE V;  3OR7 C;  1DF5 A;  1SER A;  3LNM B;  4Z1M G;  1VQ5 V;  2JJ2 G;  4XDJ A;  1HWY A;  2Z5U A;  1GM8 A;  1H8H G;  2IH1 C;  3SPC A;  1BMF G;  1F4M A;  3EHB B;  4FK5 C;  2CK3 G;  3I55 V;  3CD6 V;  1COW G;  1VQK V;  1VQ6 V;  1OZ0 A;  1K5Q A;  5B1B C;  3JCZ A;  1F51 A;  1YI2 V;  1N8R W;  2Q67 A;  3AG1 C;  1PNL A;  2GHY A;  4U7O A;  5J9P C;  3KG2 A;  1GO3 F;  2H94 A;  4KUM A;  1AI5 A;  5L3D A;  2ITC C;  1AI4 A;  3E8G A;  1K73 W;  2X0L A;  4XDK A;  1Q86 W;  1GMG A;  5EC1 C;  1WPX A;  2W0F C;  3ASO B;  3D3I A;  1V54 C;  1YIT V;  1SET A;  3DTU B;  4J9Z B;  4WFA V;  3AEI A;  4QE7 A;  2PI5 A;  5B1O A;  5EC2 C;  2EZP A;  3G71 V;  4DXW A;  2WLN A;  3AG3 C;  4E2L A;  3W7S A;  4BIU A;  2X6C A;  1GK9 A;  1ZWI C;  2Y48 A;  3SPH A;  1RM1 B;  1VQN V;  1RPR A;  1E1R G;  3F5W C;  3CCL V;  4N21 A;  5EK0 A;  1AJN A;  1E1Q G;  4OXS A;  3D36 A;  5H6Q A;  4JPR A;  2WSS G;  3CC7 V;  2WLH A;  3ZJZ A;  3T1C A;  4MW3 A;  3E86 A;  2WWW A;  1L1F A;  5IDJ A;  4HYO A;  3NXS A;  1JX9 A;  4MTO A;  1K34 A;  3W7T A;  3AG4 C;  3ABL B;  4WF9 V;  1I5X A;  4R7C A;  1NR1 A;  3CCS V;  3E35 A;  2IU0 A;  5BZB A;  2XAH A;  1QR9 A;  4MW8 A;  3TK1 A;  3IC7 A;  4F4L A;  4KP4 A;  2YEV B;  4WCE V;  5LHH A;  4GX1 A;  5L3C A;  4G2K A;  2Y69 C;  3JD0 A;  1ORQ C;  3ASO C;  4QIW F;  1VQ4 V;  2W6I G;  1R6K A;  3VOU A;  3WG7 B;  4PA7 A;  1FXK A;  3JYC A;  5IYB O;  5L3E A;  2QM8 A;  2ZXW C;  1DLB A;  1K9M W;  2DYR B;  2QTO A;  1PNK A;  1CEZ A;  1MAB G;  1QLN A;  1VQP V;  2IJH A;  2LFS A;  1IXM A;  4KFM A;  4MVS A;  2BOC C;  3K04 A;  1FFT B;  2XAG A;  1AJQ A;  4JTC B;  3K79 A;  4G27 B;  2A9H A;  1NVP D;  2WLL B;  4N23 A;  5LGN A;  4JGS A;  4MS2 A;  3T4D A;  3K0D A;  3G4S V;  3E8H A;  1R6N A;  3TCU A;  2QA4 V;  2B1G A;  1M1K W;  3M99 B;  3HPL C;  3CYO A;  1EFR G;  1QLE C;  3OFN G;  3FB6 C;  2P90 A;  3CCQ V;  3AG2 C;  2EIN C;  3ML0 A;  4I5S A;  3ZMT A;  1PKX A;  4UVB A;  1ENV A;  4WFH A;  3ABU A;  1M90 W;  3B77 A;  1M57 C;  2HVK C;  3AG3 B;  1K97 A;  3LDE A;  3OMI B;  4RAI A;  4QE9 A;  4UXN A;  2Q69 A;  3CME V;  3B8N A;  1NBM G;  3OUS A;  4JAV A;  5LHG A;  1F23 A;  2WLK A;  2HKO A;  1K92 A;  3RVZ A;  3ZN1 A;  1S3J A;  2HG5 C;  1R3I C;  2JDI G;  3E8F A;  1Q7Y W;  1SES A;  5LHI A;  3A0R A;  3ABK C;  5IY5 B;  1DTO A;  1FXV A;  2C2A A;  1W2B U;  4CZZ A;  4PEL A;  2YSU B;  5EBW C;  1PD3 A;  1OHH G;  3STL C;  3LSQ A;  5CA3 A;  2IH3 C;  1NKD A;  1F4N A;  2EIL C;  5B1N A;  3CCJ V;  4PA6 A;  4WFG A;  3SPG A;  1R3K C;  4JYB A;  1G4Y B;  4P9P A;  3SYP A;  3K08 A;  1YJW V;  4MTF A;  2V1D A;  1W0K G;  4BW5 A;  3CPW U;  4JTA B;  5DN6 G;  3GB7 C;  3K0G A;  2H8P C;  3CC2 V;  2XAQ A;  4JF3 A;  3CC4 V;  1K8A W;  3RBZ A;  5H6R A;  1YIJ V;  2X6A A;  2EBO A;  2EZO A;  3LUT B;  2OCC B;  4RO2 A;  1GM9 A;  3FYI B;  4LC1 A;  1R3J C;  3ZRV A;  5EBM C;  4TT3 G;  1EZJ A;  4RUE A;  3CXC U;  2IU3 A;  1OCO C;  4MTG A;  2X6B A;  3G6E V;  2DYR C;  1AR1 B;  1H2G A;  4XDL A;  3QNE A;  3K3W A;  4H37 A;  5CMU A;  2PI4 A;  3SJQ C;  3OAA G;  5EBL C;  3W7X A;  1S72 V;  3P32 A;  1YTF B;  2EIJ C;  1J95 A;  4R6Z A;  1KD1 W;  1V55 B;  5LBQ A;  3OUF A;  1P4R A;  4LCU C;  3CCR V;  4RQF A;  1XL6 A;  4XBF A;  1FS0 G;  1Y66 A;  5IY5 C;  2DW4 A;  4GX2 A;  2JEX A;  3SYC A;  3GWO A;  3RVY A;  2Z3Y A;  3QO8 A;  2OTJ V;  3AG2 B;  1K33 A;  4WFF A;  4WFB V;  5HFM A;  5B1B B;  3HB3 B;  4HAM A;  4RUF A;  1K4C C;  4FPP A;  4GX0 A;  4MVQ A;  3JD1 A;  3B8M A;  5CBH A;  4HZ3 A;  3W7W A;  3ABM B;  4MVR A;  2XOK G;  4PA9 A;  5CN0 A;  3ETG A;  1YJN V;  1V54 B;  3ETE A;  4GCZ A;  4PA3 A;  2HR3 A;  1NVP B;  2Q6A A;  5HFL A;  2EIL B;  2P6J A;  1EBO A;  1JPX A;  3K03 A;  3LDC A;  1FXK C;  1M56 B;  5KA5 A;  3ETD A;  4Q20 A;  1VQO V;  5KA6 A;  5IYD O;  3OR6 C;  1TUE B;  3ZIA G;  4UV9 A;  1W0J G;  2FTK A;  2EJR A;  5B1A C;  3T4Z A;  1NJI W;  2NNU A;  1OCZ C;  5IYC O;  1GTO A;  4R50 A;  3ABM C;  3FKS G;  4X89 A;  2P7T C;  5KUK A;  2QE7 G;  1S0V A;  4FIP C;  4DO2 A;  1YTF D;  3MHH C;  3OMA B;  3OE7 G;  1ROP A;  2ZD9 A;  3FB7 C;  3JD3 A;  1PL0 A;  4WFE A;  1YSC A;  3UM7 A;  4U7N A;  2EIM C;  2M7W A;  2UXN A;  4FJC C;  2IW5 A;  1OCC B;  1KKD A;  5GW7 A;  1KP3 A;  2R9R B;  3K06 A;  2EIK C;  4QNH B;  2HVJ C;  1AI6 A;  1GKF A;  1CPY A;  5FL7 G;  3X2Q B;  3EFF K;  4EKW A;  4BIZ A;  3LDD A;  2ZDI C;  2DQ3 A;  2P67 A;  3CP1 A;  2JEU A;  1B6Q A;  4MSW C;  1PNM A;  2R9I A;  5L3B A;  1S77 D;  3JD4 A;  1VQL V;  4QPK A;  4J9Y B;  1QLE B;  2Y69 B;  1K3E A;  2WAM A;  4JYC A;  3FYE B;  2HLD G;  2ATK C;  1I5Y A;  3WG7 C;  2YEV A;  4TSF G;  3W7U A;  1S76 D;  1V55 C;  2LFR A;  2ZXW B;  3BY6 A;  2D3O W;  1MOF A;  1M56 C;  3ZRW B;  4BAY A;  4L87 A;  4GT1 A;  4LBE C;  1H38 A;  1BL8 A;  2DWE C;  3E89 A;  3JD2 A;  3E8B A;  4P30 A;  5L3G A;  1BHA A;  1E79 G;  1P7B A;  2A0L A;  3FB5 C;  1R73 A;  3F7V C;  3I56 V;  2IJK A;  1JJ2 U;  2MK3 A;  3SYQ A;  3OM3 B;  4LP8 A;  1QCE A;  3QO5 A;  3FB8 C;  2DYS B;  2ZQM A;  1M9N A;  3ABK B;  1RPO A;  3UKM A;  2QM7 A;  3OEE G;  2WLI A;  1K4D C;  5LGT A;  4JAU A;  1NH2 D;  1Q81 W;  3T2M A;  3ZMV A;  1QVG U;  1OCZ B;  2DWD C;  2QKS A;  3SPI A;  5E1A C;  3SYA A;  2HFE C;  1QVF U;  2Q68 A;  1JVM A;  2BOB C;  2WPD G;  3TET A;  1KEC A;  3ZN0 A;  1Y4M A;  1RM1 C;  2DYS C;  2EIK B;  1VQM V;  2ZR2 A;  4PDM A;  4X8A A;  1KP2 A;  2EIM B;  2UXX A;  4RQE A;  1VQ9 V;  3E2E A;  4FMT A;  1OCC C;  4YXW G;  3CMA V;  2QEX V;  3OEH G;  3CCM V;  4MVU A;  3RW0 A;  1H8E G;  1VQ7 V;  4G28 B;  2ZDI A;  1OCR B;  1YHQ V;  1SZT A;  3ABT A;  4MTX A;  3QO7 A;  3P30 A;  4X88 A;  3CCU V;  1NR7 A;  1MG1 A;  2XND G;  2WLL A;  3BEH A;  3STZ C;  2XAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...