5CBFA

Structural and functional characterization of a calcium-activated cation channel from tsukamurella paurometabola
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
TLMFKRFFGAVRTSWRDPSTRGAVLSLAIIVTAATIFYTLAEKWSVIDSLFYAVSVGLPMGNGPLSPTLTLSKIFTLVYAILVVGLFVTVGGSLASAIVQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Ion transport 2 domain protein
publication title Structural and functional characterization of a calcium-activated cation channel from Tsukamurella paurometabola.
pubmed doi rcsb
source organism Tsukamurella paurometabola (strain atcc 8368 / dsm 20162 / jcm 10117 / nbrc 1612
total genus 30
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5cbfA00
4TWKA 3FB5C 2A9HA 4PA7A 4XDLA 5B3SC 3IFXA 3JYCA 3ABLC 5CBFA 3EFFK 5B1BC 2QKSA 3STLC 4X89A 2DYSC 4MVOA 5B1AC 5KUMA 3SJQC 3UM7A 3T2MA 2WLIB 3IGAC 2ZXWC 3E86A 4EKWA 2R9RB 4UUJC 4WFHA 3F5WC 3OR7C 3K0GA 2JK5C 3AG3C 3SYOA 1OCCC 4J9YB 4XDJA 2X6BA 4PA6A 2ATKC 3E8FA 1ORQC 2P7TC 4LP8A 3E83A 3R65A 2HFEC 3SPJA 1OCRC 2EILC 4JTDB 4R50A 3SPGA 4HZ3A 2OCCC 4GX1A 3T1CA 2HG5C 3ASNC 2HJFC 1J95A 2BOBC 3AG2C 4LCUC 4MS2A 2IH3C 3F7YC 4MVRA 5E1AC 3T4ZA 3VOUA 4PDMA 4RUEA 4OXSA 4MW3A 3OUSA 1R3IC 2BOCC 1S5HC 3FB6C 4RO2A 1V55C 5KUKA 3OR6C 5J9PC 4JTCB 1JVMA 1M57C 2WLIA 4DXWA 2WLLA 3OUFA 2WLLB 3K06A 3LDDA 1P7BA 2EIMC 4H37A 4MW8A 4ZBMA 5EBLC 3HPLC 2QTOA 3TCUA 3RVYA 2W0FC 3ABMC 4BW5A 2X6CA 2ZD9A 4G28B 1R3JC 3LNMB 2DWDC 3ZJZA 4GX0A 2Q69A 4HYOA 1XL4A 4I9WA 5EBWC 3E8HA 4R6ZA 4PDLA 3T4DA 5BZBA 2WLKA 1ZWIC 3TETA 2HVKC 2K1EA 4CBCA 4X8AA 2WLNA 1R3LC 4MVMA 2NLJC 4MVQA 1M56C 3K03A 3K0DA 1R3KC 1XL6A 3GB7C 2KB1A 3PJSK 4R8CA 3SPCA 3AG1C 3RW0A 3SYQA 5CBHA 1OCOC 3LDCA 2DYRC 4G27B 1KKDA 3OGCC 3BEHA 3ZRSA 3K04A 1QLEC 1V54C 3ASOC 4PDRA 4QNHB 4LBEC 3RBZA 4PA9A 3FB7C 2ITDC 1K4CC 3LUTB 3LDEA 4J9ZB 4QE9A 1K4DC 4P9PA 4RUFA 2WLJA 4MSWC 2YEVA 4RAIA 4PA3A 2EIJC 4JTAB 2WLMA 4MVSA 3FB8C 3SYPA 4F4LA 1G4YB 4MTGA 5EBMC 3SYAA 5EC2C 4MVUA 3ABKC 4PA4A 3SYCA 2AHYA 4P9OA 3WG7C 4KFMA 3F7VC 1BL8A 1OCZC 2EINC 4MTFA 4P30A 4WFFA 5EC1C 4X88A 4GX2A 4P2ZA 3SPIA 4MTOA 2Q68A 3RVZA 4PDVA 2IH1C 3KG2A 2WLHA 1LNQA 4R7CA 3AG4C 2A79B 4H33A 2Q67A 3E8BA 3E8GA 4GX5A 3STZC 2Y69C 4WFEA 2A0LA 4MVZA 2EIKC 5CBGA 5EK0A 2Q6AA 3E89A 3K08A 2ITCC 2X6AA 4XDKA 4QE7A 3UKMA 3X2QC 2AHZA 2HVJC 4WFGA 3SPHA 5IY5C 2H8PC 2DWEC
chains in the Genus database with same CATH superfamily
2ZINA 5LHIA 3ABLC 2DYSC 3FKSG 1XDCA 3P30A 3CC4V 3E86A 4TT3G 1AR1B 1N0JA 5CA0B 4PA6A 4UV8A 4IIJB 2O57A 3M7MX 1DGSA 1SQFA 3TXSA 3AG2C 4RWUA 1EZJA 1XOUA 5LOVB 5IE9A 3FFQA 5JVDB 2ZM6B 1QQCA 5IDJA 1BMFG 2CTRA 3T1YB 3APOA 5K1PA 1I5XA 1S5LZ 1L8DA 1M57C 3OM3B 1D2DA 4O2BA 5IWAB 3N2KB 4AQYO 2YDEA 4J41A 1PKXA 3ABMC 4UFZA 3MAQA 1FXVA 2Q9LA 3FX7A 5EIBC 2D3OW 1IBMB 4I50A 2QR4A 4B7EA 3H1LH 3RYIA 5CN0A 1XMOB 5L3BA 3GB7C 1VQ5V 1NH2B 4TSFG 4EB6B 2QKCA 4OX9O 1ROPA 1G1XB 3CRAA 3K04A 1PPJH 4PDRA 3IC9A 1P49A 3THOA 3FB8C 2F95B 4KFMA 2ZNJA 1OCZC 3JAKA 1VQKV 1ZX3A 4I4TA 5LMUO 3ZRVA 2FMLA 2IH1C 3FD9A 5L3CA 1XNRO 1KYOF 5IJ9A 2QM7A 4GUNA 1MA1A 2ZE7A 2ITCC 5LMNO 1VIBA 2CDYA 3X2QC 1K33A 3CMEV 3ETDA 2QA4V 1WPBA 1YXBA 2A9HA 4UV9A 2CTPA 2WLIB 5J2UB 2LW7A 5JH7A 1OCCC 4DV6O 4NVPA 1O9HA 1CPYA 3J81N 2DN9A 3DXRA 3VQXA 2EINB 1P4RA 2EZOA 1RM1B 1WLEA 3FYEB 1TUBA 1ZLZA 4U3JB 4O4HA 4X1KB 3RYFA 4BW5A 2YS8A 5CA1B 4IL6Z 3VQYA 5JCOA 4RQEA 4K3AA 4DR6O 3GVMA 1K7DA 5BZBA 4ICGA 2UXDO 2OWOA 3M8AA 1Y76B 4I55B 2IJKA 2QGNA 3VQWA 1EN4A 1JFFB 1R6KA 1R3KC 3JAWA 2KB1A 1FD9A 1V54C 3ASOC 4DO2A 4YJ3A 3LUTB 2DJVA 4LWSA 2Q8VA 1OZ0A 2DE0X 3CD6V 3IAYA 2N74A 2DOSA 2UXXA 3OMAB 2YUAA 3E2EA 1N36B 3QF7A 3RYHB 3C3SA 4QPJA 4DV4B 1NI8A 4DV1O 3E8GA 2ZT9B 4YIPA 2KG7A 4NR1A 2EIKC 3B40A 5EK0A 1XI1A 2UUCO 4X20A 2H8PC 3CPWU 4FLUA 1QNMA 4FIPC 4DW0A 3JATB 4AILC 4W4LA 2P6JA 3EFFK 3UM7A 2CTWA 4CH5A 3IGAC 3CB2A 1DK1A 1Y6XA 4WFHA 4UXNA 4DRXB 1TVKA 3AG3C 1NS1A 4B3RB 1VQNV 4JZ2A 3J7AU 1MG1A 3U10A 1AROP 2GBOA 1AI4A 4FFBA 1HNXO 1QLNA 3BABA 4CC6A 4RQFA 2F23A 2D2CB 3OUSA 1BCCH 3BFRA 5FNVB 1THZA 3OUFA 2YIBD 1K3EA 4FPPA 3BCCH 2P67A 1ZL8A 3K57A 4ABMA 3DSQA 4JI2B 5IYCO 3TETA 1AP6A 2K1EA 4X66O 1FJGO 1S72V 2ZXWB 2PUSA 2ZQMA 2QWOB 4LF5B 1XHXA 3OGCC 5LP6B 4DR1B 4DR4O 2ZE5A 3JSNA 2Z0AA 1Q5OA 2OCCB 4YY3B 1NBMG 4J9ZB 1K4DC 4O4IA 4A5UB 2YIDA 3ZMSA 3ABLB 1FFXB 4W4KA 3CS5A 3ABKC 4FLWA 4DV3B 4P9OA 4CC5A 1HR0B 2AGAA 2HKOA 4FLYA 4LF7B 3CRCA 4GKJO 2WLHA 1SESA 4LFAO 2A0LA 1I7FA 3E89A 2GTSA 3L72H 1MABG 4XBFA 1SERA 3UT5B 4TWKA 5CBFA 1GKFA 1M57B 5B1BC 3I5DA 4U7OA 1WB7A 3QVNA 1U97A 1GMGA 4BIOA 5CB4A 3U0ZA 5DN6G 5CA0A 2E5LB 2ZDIC 1YJ9V 1W0KG 1YI2V 4IYHA 1ZSPA 3CRRA 2ZIMA 2QE7G 3A0RA 1US6A 4R50A 1JR9A 1F7YA 2DQ3A 1X4TA 2BOBC 1GRJA 3F7YC 5JVDA 1K9MW 3CCVV 1AVMA 4JI8O 3JD0A 1URFA 4I0XB 2WA3A 3S3WA 1D5AA 2GUZB 2M7WA 4MW8A 3HPLC 2Q7HA 2V7QG 2FKXA 4YJ2B 3S3XA 1RP3B 3RFRA 4G28B 3GWOA 2JS3A 3G80A 5LGTA 1EBOA 2X0LA 5EBWC 5KHKA 1ZTEA 1NT2B 1Q3EA 1OCZB 1KC8W 3CCEV 3K03A 1H2SB 1EN6A 1SQVH 2ZDIA 3BEHA 4BAYA 1BZKA 4JYYA 1PV0A 4RUFA 2UXCB 1BS3A 1VF5B 4LFCB 1SS3A 3CE2A 2EX3A 3MDSA 1AILA 4B3SB 3SR2C 2IJHA 3SYCA 2LQTA 2IBZH 4P30A 2EINC 4P2ZA 4KHPB 1QVFU 3K5NA 3BA8A 1RM1C 1Q43A 3P32A 1QHTA 4DR2B 2DQ0A 1ENVA 2CK3G 1PL0A 3JD3A 4KXRA 4NKGB 3SGIA 4K0KO 4TV8A 4JAUA 1XUQA 4O2AB 1MSDA 5F2VO 4GLXA 2UXBO 3TGUH 3AG1B 4X89A 3ZHTA 2BTOA 5C8YA 1H8EG 4EKWA 5J2UA 3H1IH 3L73H 1I94O 1Q82W 3ZHQA 1G6UA 3CHXA 1YIJV 2GV9A 4B3TB 1S5JA 1KECA 4LC1A 1YJWV 3ZHVA 1M90W 1SETA 2F1MA 4PDMA 5C93A 3IC7A 4DV7B 4DUYB 1E79G 2UUBB 3OR6C 4EFBA 1X59A 1H38A 3BAAA 3ZBHA 4X1KA 1SA0A 4FK5C 4FM0A 4G2KA 5CA1A 2ZD9A 3UO2A 3ZJZA 1K97A 5B3SB 5J2TB 1JPXA 1Y76A 4HAMA 4J7ZA 1JJ2U 4I55A 3ZHRA 1R3LC 2ZM6O 3T1YO 1JFFA 4NB5A 3K0DA 5IWAO 1SRYA 2PTMA 4J11A 1S77D 3JAMN 1FYJA 3FB7C 1KP3A 1N33B 4UVCA 1Q6UA 4WBNB 1IBMO 4PJ0Z 1YZBA 1XMOO 3RWRD 1NU1H 4LR3A 4JAVA 3AG3B 3RYHA 3KCXA 3O65A 4LFBB 1F51A 1FXKB 4PD4F 2B5UA 4GYCB 4FLZA 1K73W 2AHZA 3CCUV 1TGOA 3VBBA 4TV9A 3STLC 4GCZA 4MVOA 3SJQC 1GAXA 2ZXWC 4X62B 3F5WC 3OR7C 5IJ0A 1GN3A 2K9PA 4J9YB 1I94B 1ZUQA 5LA6A 3OMNB 2EIJB 2EJ7A 5JJJB 2ATKC 1R1BA 3TXQA 2HFEC 5JQGB 4O4LB 3ETEA 1KQSU 2XNDG 1M1KW 1EZVH 2OCCC 4GX1A 2JGDB 4DR3B 5E1AC 5CA3A 3K5LA 2JJ1G 2DW4A 1VQLV 4LF4B 3Q4HB 2LGQA 5EZYA 2OCHA 5FNVA 5KAIZ 3LDDA 4H0LB 1D5NA 3G6EV 1N32B 4GX0A 2Q69A 3K9AA 3MHSC 1NTZH 1U96A 4N21A 1MZFA 3T4DA 3JSLA 1B06A 3ABKB 5KMGA 1RPOA 4E4EA 4MVMA 1SKVA 1CEZA 2AW9A 3PJSK 1MZEA 1W59A 3SYQA 1VF6C 5LP6A 5BY1A 1Q7YW 4QNHB 4KUMA 1GH6A 4LBEC 2JRIA 2QKAA 2PYLA 1BHAA 1J5EB 3C90A 5DM6V 1FFXA 5B1BB 5D5PA 1HNWO 3SJAC 4TQFA 2Q73A 4MTOA 2NR5A 3CJHA 3CX5F 1WPXA 3P3PA 4DR7B 3BHPA 3FYIB 1AJQA 4IGGA 2F4VB 4ZIBA 1WNSA 3FAVA 3UT5A 5DEDA 2QTSA 2FTKA 1N36O 2HJDA 4X64B 3CMAV 3ETGA 2EBOA 4DV4O 3OE7G 4EEQA 5H9CA 1W0JG 2B9ZA 3E8FA 1B6QA 4LP8A 3CXCU 4JI3B 2B1GA 1OCRC 2ETNA 2UUAB 1JMKC 4LCUC 3A8TA 2P4VA 3WG7B 3ZCCA 1VQOV 1T5EA 4I0XA 1V9PA 2WLLB 2OIGA 3AG7A 5GW7A 3TCUA 4YJ2A 4B3RO 1RSOB 2X6CA 1HDJA 2BTQB 3RYCB 4LF6B 1JX9A 4U7NA 1WB8A 4R6ZA 2QM8A 4ZOLA 3N27A 4I5SA 4IHJB 3WB2A 1Y66A 1AB3A 1YF2A 4WFBV 3AG1C 5L3GA 3E22B 4O4JB 2XAQA 2AZ2A 1LUVA 2LP7A 1YTFD 4JI0B 3NXSA 3ZMVA 3ZN0A 2ITDC 1P84F 3LSUA 2CAZC 4F6RB 3SYPA 5IYBO 2IU0A 4JI2O 4WCEV 3J80N 1BGYH 1K92A 1DTOA 1HNWB 1NZ6A 3D36C 4LNUB 1NVPD 3RVZA 3KG2A 4LF5O 5AG2A 2Q67A 2XHBA 4DR1O 3E8BA 3OTFA 1B04A 4F6EA 3ZS8C 4YY3O 2OIEA 2CH7B 5E79Z 3UQ8A 4QPKA 3UKMA 1VQ7V 4WFGA 5IT9N 4O2AA 5LYJA 5LHGA 5B3SC 2QKSA 4DV3O 4OPHA 1HR0O 4X1YA 4LF7O 5FL7G 3K5OA 5LGNA 2XTAA 1SZTA 2Y0IA 4FM1A 4JI7B 4HZ3A 5KX5B 1BE3H 1B3QA 5HFMA 3CRQA 1YITV 5GTHZ 2F43G 1SQQH 4L8JA 3RGBA 2QDOA 3OT7A 2ZIOA 1DLBA 4DXWA 3ZN1A 3AK1A 4KP4A 2E5LO 2GSMB 2RN9A 1FXKC 2Q4PA 3CEIA 3W7UA 4FLTA 3MD0A 2M6YA 3JD1A 2XAFA 1KBHA 5CBHA 3LDCA 1YDXA 2MW2B 3ZRSA 3H1JH 2CGNA 1TUEB 3SJBC 3HKCB 4MSWC 2EIJC 4JTAB 4Z1VA 1V55B 3QNEA 1IBLB 4PA4A 3OAAG 1XILA 4CH4A 3WB0A 3L74H 1VQPV 3CP1A 4JZGA 3W7XA 4UCOA 5LXTB 4R7CA 5GONA 4LH6A 1FXKA 2Q0AA 1Q6HA 2VWKA 2UXCO 4LFCO 5BR8B 2X6AA 4QIWF 4J42A 3CCQV 4B3SO 1Q6IA 3LSQA 1JOYA 4UCUA 4MTXA 4IT5A 1S3JA 2W0XA 2ZR2A 2R9RB 3K3WA 4KHPO 1AJPA 2GDSA 2XAGA 3SYOA 4JI4O 2R70A 2BCCH 4DR2O 2YXHA 3BY6A 3K9SA 2NNUA 5H6QA 1FKAO 5EYPA 5CMUA 1K5QA 1SC5B 1F23A 2JGDA 3ML0A 4NXMB 4I50B 3Q4HA 1N4CA 2Q5ZA 4RO2A 3A0HZ 1QCEA 1FPOA 1JVMA 3RT3C 3K06A 3KCYA 5LGUA 4EFEA 2YIAA 1OJHA 3JASB 4B7KA 2AXTZ 2N05A 2KKWA 3LNMB 3WU2Z 4IIJA 4B3TO 2QSAA 2YXLA 4HYOA 3L9DA 1KD1W 2P4KA 5LOVA 2QEXV 3PN1A 5HFLA 1HW7A 4DV7O 3JAKB 4TQDA 4DUYO 2UUBO 2ZE8A 1XL6A 4R8CA 4K35A 1KKDA 1XNQB 3N2KA 4PV1B 1MNGA 1MSWD 4RAIA 4PA3A 1E1QG 1M93A 1M5IA 1WJZA 1G4YB 3HR0A 1VQ8V 1S0VA 4MVUA 5H5NA 1GM9A 4UCTA 2CTQA 1SQXH 1FAFA 3WG7C 4WFFA 3T1HB 4KL1A 4EB6A 3D3QA 1LNQA 5JH7B 5KA5A 1XBLA 4HBNA 2A79B 1SQBH 1OCRB 3W7SA 1KKCA 4GX5A 1O9GA 1N33O 3JARB 2VRZA 2IU3A 2DWEC 4JYAB 1MOFA 3D3IA 1I0HA 1UPGA 3LNNA 1QLEB 3JALB 2Y4TA 2IW5A 3SDLA 5KHIA 1NJIW 4JI4B 3RYFB 4LFBO 1HNZB 4XDJA 1ORQC 3E83A 1GM8A 1S76D 4FVMA 1JA8A 3DC5A 3ETQA 3CXHF 3FB6C 3ZHUA 3LSSA 4JTCB 4DV2O 1VF7A 2WLIA 5FLXN 4H13B 2WLLA 4PHZA 2Z3YA 4LF8B 4X62O 5A9GA 2VS0A 3L75H 2VQFB 3RVYA 4J80A 1KP2A 1XEQA 1QBZA 1BQ0A 2BTQA 2WA4A 1VQMV 2ILMA 4UCVA 1CP9A 1GM7A 1NTKH 4I9WA 4B08A 4K8XA 3HKDB 4DR3O 4X8AA 1GN4A 2GHYA 4FM2A 2CE4A 4LF4O 4X65B 2NLJC 2C2AA 1XQ8A 2V1DA 3DGEA 3E22A 3JD2A 3JCUZ 4O4JA 4U3JA 1BSMA 2XAJA 2KG7B 4LF9B 4CS3A 2PYJA 4DR5B 1N32O 4F6RA 1TA8A 1IZ3A 3H1KH 3ABTA 5K1XA 1L0NH 2HEPA 1Y74B 3R66A 4UCSA 3WFVA 3ABUA 3A0BZ 1TVKB 4H33A 2PZSA 2HHHB 4X1IB 3B8NA 4GT1A 5FPOA 1KUQA 2Q0OC 2OT5A 2RMKB 3K08A 1VEWA 1J5EO 2RJZA 1PP9H 2B1IA 2LFRA 3FB5C 1PM9A 1IXBA 2EULA 1HWYA 2LJ2A 3P3NA 2LFSA 3BPZA 1R6NA 3UO3A 2JK5C 2JS5A 5B1NA 4DR7O 3K58A 2YIBA 1ZL8B 1QU7A 3SPJA 2F4VO 2EILC 4B3MB 3ZRWB 3SPGA 5KX5A 1VQ6V 5KAFZ 2HJFC 1MMMA 3OTOB 4E2LA 5JJNB 3CC7V 1FS0G 3JATA 2QM4A 1V55C 5J9PC 4X64O 2IM9A 4DV2B 1A32A 3CWBH 4FFKA 3KKYA 4DRXA 4D7SA 2Y69B 2W0FC 3OEHG 1QR9A 3HKEB 3AEIA 4JI3O 4O4IB 3QO7A 1DF4A 4NXNO 4PDLA 2UUAO 1ZWIC 1DF5A 3HKBB 4GKKB 1BT8A 3F5TA 4Q20A 4WF9V 4HNAB 4X9QA 1RPRA 1L1FA 4G27B 4JAAA 1VQ4V 2HP8A 3L71H 3CCJV 3AK2A 1YJNV 3LDEA 4QE9A 3HKCA 1NKDA 3B8MA 4LF6O 1WA8B 3HB3B 4TUYB 1EM1A 4YXWG 2XUMA 4FJCC 5GTIZ 2E3CA 5A2QN 4FZ1A 3H01A 4JI6B 2HR3A 2Q68A 2F66C 2YC0A 3N2GB 5L3DA 3WB1A 1I08A 5CB4B 5LXTA 3NR7A 4L87A 4JI0O 1WAZA 4J10A 2IJIA 5CBGA 1AI7A 4CZZA 1Z5WA 3IFXA 2BE3A 1SF9A 2DYRB 2G38A 4DUZB 1Z2GA 2A7WA 2KSDA 4U3FH 1FXHA 2RNBA 2XASA 3R65A 4NTYA 4YHHB 1XMQB 4JYBA 4JPRA 2UU9B 4MS2A 2ADPA 2IH3C 2NN4A 4Z2WA 1WN7A 1FFTB 1AP5A 4RUEA 1R3IC 1VF6A 2BSKB 1HP8A 3CRMA 3EHBB 3TJTA 3EXAA 4DV5B 2EIMC 4H37A 2VQEB 3CCRV 3JASA 4K8ZA 4JI1B 2W6JG 5KHGA 2DWDC 2WSSG 1YTFB 3W7TA 4JI7O 1SZXA 4NXNB 2VWJA 3D8CA 3I55V 3G6BA 2QWQB 4UVAA 1N34B 1Q86W 2GUZA 2Y48A 1QLEC 4QGPA 1PL4A 4UB8Z 1NVPB 3JD4A 1YVWA 2LO1A 1R73A 1I5YA 4FLVA 1YHQV 2QWRB 2YEVB 4TV8B 4MVSA 5JCOC 2A06H 5EBMC 1NH2D 3SJCC 5C8YB 3F7VC 2V4DA 4FZ0A 1OV9A 3CCSV 2W6IG 2WWWA 4GX2A 4H44B 2ADQB 4YIOA 5IYDO 2P22C 3G71V 3STZC 4MVZA 2Q7EA 3JARA 2EZPA 4QE7A 2HVJC 1IDSA 3VQVA 2E76B 1Q81W 4NTXA 1IBLO 3JYCA 3JCZA 5L3EA 4JI5O 5B1AC 1M9NA 2ARHA 3JALA 5LL6Y 4AQYB 3K0GA 1GK9A 1SA0B 2ZE6A 1TAEA 5JJEB 2X6BA 1K8AW 1VARA 5ITZB 2X7RB 1YCIA 3T1CA 5BR8O 2HG5C 3MHHC 2UXNA 3H9VA 2ZCEA 1SQGA 4FLXA 5D5QA 2GTAA 4BR6A 5KUKA 2QWNB 1W2BU 1YEWA 2RCVA 4OX9B 1P7BA 1Q90D 5EBLC 2P90A 2QTOA 3OD4A 3OFNG 3RN4A 3AK3A 3OEEG 1Q8IA 2F93B 3C3TA 2WLKA 3HKDA 1GO3F 2HVKC 4NXMO 3D36A 2YICA 4CH3A 4PELA 3K5MA 4MVQA 2PI5A 5LMUB 2YSUB 1OCOC 3CYOA 1XNRB 3ZHSA 3RBZA 4PA9A 2JGUA 1BHBA 1AI5A 3APQA 3ASNB 4ASUG 4I9QA 3BVOA 5LMNB 3SYAA 5J2TA 3I56V 3CCMV 5BMVB 4TV9B 3B09A 4ZHQB 1Y74A 3E35A 2FYUH 1AI6A 4MTFA 1VQ9V 1P7GA 3ZEDA 4MT8A 5IJ0B 2XOKG 1XNQO 5LA6B 5IYZB 4C7UA 2EILB 4DV6B 3M99B 1XREA 4ZI7B 5B5EZ 2Q7GA 2YI8A 2Y69C 4WFEA 4X1IA 3UCSC 2OYQA 4DK1A 4DYLA 4XDKA 1K5SA 4BW9A 3DTUB 3QG5A 1M56B 2PF4E 4WBNA 2OTJV 5FPRA 5EZYB 4PI0A 5BXZA 4JI5B 4BWAA 3T1HO 2FL4A 1M4UA 4QJFB 4DR6B 2P7TC 2WAMA 4JTDB 2Z5UA 4UVBA 3QO5A 3ZRWA 2UXDB 1RFYA 4PI2A 1Y67A 4BIZA 3QTCA 5KMGB 1IVSA 3T4ZA 2JDIG 1H2NA 3VOUA 2MK3A 4OXSA 4JYAO 1S5HC 4D6TH 2P5OA 1NR7A 1IBKO 3AG4B 4UB6Z 4O2BB 1QR8A 4ZBMA 5KHHA 1XHZA 1GN2A 4IYIA 4J7JA 3BRCA 1HNZO 3HKEA 1BQZA 5KLVH 5IY5B 3ZMZA 4NYKA 5JQGA 2XAHA 4O4LA 2ZKOA 3E8HA 3DC6A 3HKBA 2DYSB 2CGOA 3ZX6A 3RYIB 3OGIB 1WP8A 4HNAA 3RW0A 3CJHB 2DYRC 4LF8O 4JASA 2VQFO 3CCLV 3CSXA 4DV1B 1ZAUA 4AI8A 4AHCA 4UCRA 3AG2B 2WLJA 1YSCA 1UJWB 3OW2U 2UUCB 2AZ0A 1COWG 1WA8A 4MTGA 4TUYA 3FAVB 1IURA 1NR1A 2CUGA 3G67A 4D7TA 2AHYA 2LW1A 4X65O 1BL8A 4JF3A 4I4TB 3ABMB 2JIZG 3N2GA 5IJ9B 2WPDG 5L3FA 1PD3A 4DW1A 1PNKA 4LF9O 4DR5O 1WP7A 2DMXA 2Q6AA 1HNXB 2ZNIA 4JGSA 1NQTA 4N23A 4PA7A 4XDLA 1H2KA 5KUMA 3T2MA 2EIMB 4UUJC 1JQ0A 2OTLV 5KA6A 1N8RW 4BIUA 3ICXA 2HHHO 1AJNA 2LGWA 3A2FA 1JJOA 3IJ4A 1J95A 4ZOLB 4X66B 3DXRB 3ZRXA 1FJGB 1F4MA 4MW3A 1QVGU 3ZMUA 2EJRA 2BSKA 2KQXA 5H6RA 1H2MA 1IBKB 2IJJA 1TUBB 4J7KA 4DR4B 4O4HB 5EIBD 1JCHA 5B1OA 5LHHA 1KMIZ 3K79A 1R3JC 2FB5A 1E1RG 1EN5A 3X2QB 2R9IA 2QWPB 4B3MO 3TK1A 2R9AA 3OTOO 4Z1MG 4DV0O 1OCCB 3JAWB 3SPCA 4GKJB 1VP7A 1F4NA 2P06A 4LFAB 4ZKIA 1RSOA 2L35A 4YJ3B 1K4CC 3BA9A 2XT9A 2ODMA 4P9PA 2YEVA 4LWSB 4CH6A 3RYCA 1R6TA 1VMGA 1PNLA 2WLMA 1H2LA 1L0LH 3B4SA 1Z5VA 5LYJB 5H2FZ 1SQPH 5B1AB 4GKKO 5LBQA 4IHJA 4X1YB 2H3OA 5TISZ 5EC1C 1N0NA 2JJ2G 4JV5O 2YXYA 1KU9A 1NTMH 3U11A 3K59A 1AR5A 5B66Z 2L6LA 5DECA 2RQ6A 3SPHA 4X20B 4JI8B 1EFRG 1H8HG 1H2GA 2E74B 4LNUA 1V54B 4DK0A 2ZR3A 3ASOB 4JI6O 2RDCA 1LUWA 3B2EE 5JWPA 3CC2V 2PY5A 3O9OA 4FMTA 4I7ZB 2HLDG 1PNMA 5ITZA 3QO8A 2A3QA 5KHJA 4OGQB 2CH7A 4CS4A 3ASNC 4FFBB 4MVRA 4NTWA 2BOCC 1OCOB 4DUZO 2YI9A 3B77A 1AR4A 2EIKB 1K34A 1OHHG 3ZMTA 4YHHO 2R72A 1XMQO 1Y4MA 1XL4A 2Y4UA 4OPAA 1CXZB 4TOIA 2UU9O 2N04A 4CBCA 2WLNA 1LR1A 1GN6A 1GTOA 1M56C 4DV0B 3L70H 3H1HH 4LH7A 2JEXA 2Y0PA 4DV5O 5GONB 2VQEO 1KB9F 1IX9A 4JI1O 3GWKC 4WFAV 2E75B 3ZIAG 1IXMA 4JYCA 4K0KB 4F4LA 3OMIB 3G4SV 5EC2C 5BMVA 4Q6GA 2UXBB 4ZHQA 3EVKA 2JVDA 4X88A 3KZIZ 2JEUA 3SPIA 4PDVA 4JV5B 1N34O 3AG4C 5IYZA 2H94A 5LP6C 4ZI7A 1G8MA 4CS2A 4GZRB 5EYPB 2QJ1A 5IY5C 2PI4A 2PGGA 3W7WA 1UFIA
chains in the Genus database with same CATH topology
3LSQA 1JOYA 1Q81W 5LHIA 3JYCA 3ABLC 3AG1B 4MTXA 3JCZA 4X89A 5L3EA 2DYSC 3FKSG 5B1AC 1S3JA 2ZR2A 1M9NA 1H8EG 3P30A 3CC4V 4EKWA 3E86A 4TT3G 2R9RB 1AR1B 3K3WA 3K0GA 1AJPA 2XAGA 3SYOA 1GK9A 1Q82W 2X6BA 4PA6A 1YIJV 1K8AW 4UV8A 2X7RB 3BY6A 1KECA 2NNUA 5H6QA 4LC1A 3T1CA 1YJWV 2HG5C 3MHHC 5CMUA 2UXNA 3AG2C 1K5QA 1EZJA 1F23A 3ML0A 1M90W 1SETA 4PDMA 5C93A 5IDJA 1BMFG 3IC7A 4RO2A 1E79G 1QCEA 5KUKA 1I5XA 3OR6C 1W2BU 1JVMA 1M57C 3OM3B 1H38A 3K06A 5LGUA 1P7BA 5EBLC 2P90A 2QTOA 3OFNG 1PKXA 3OEEG 3ABMC 4FK5C 4G2KA 2ZD9A 3LNMB 3ZJZA 1FXVA 1K97A 4HYOA 5B3SB 2WLKA 1JPXA 1GO3F 2HVKC 2D3OW 1KD1W 4HAMA 2QEXV 3D36A 1JJ2U 1R3LC 5HFLA 4PELA 4MVQA 5CN0A 5L3BA 2PI5A 3K0DA 1XL6A 3GB7C 4R8CA 1VQ5V 2YSUB 1OCOC 3CYOA 4TSFG 1NH2B 1KKDA 1ROPA 1SRYA 1KQSU 3K04A 1S77D 4PDRA 3RBZA 4PA9A 3FB7C 1MSWD 1KP3A 1BHBA 1AI5A 3ASNB 4ASUG 4RAIA 4PA3A 1E1QG 4UVCA 3FB8C 1G4YB 1VQ8V 3SYAA 1S0VA 3I56V 3CCMV 4MVUA 1GM9A 3E35A 3WG7C 4KFMA 1AI6A 4MTFA 1OCZC 1VQ9V 1VQKV 4WFFA 4JAVA 3AG3B 3ZRVA 4MT8A 2XOKG 2IH1C 5KA5A 1LNQA 5L3CA 2A79B 2QM7A 1OCRB 1F51A 1FXKB 2EILB 3W7SA 3M99B 4GX5A 2B5UA 2Y69C 4WFEA 2ITCC 4XDKA 1K5SA 2IU3A 3X2QC 2AHZA 1K33A 3DTUB 1M56B 3ETDA 3CMEV 3CCUV 2QA4V 1K73W 2DWEC 3VBBA 1MOFA 3D3IA 2OTJV 2A9HA 4UV9A 3STLC 4GCZA 4MVOA 3SJQC 2WLIB 1QLEB 2ZXWC 2IW5A 3F5WC 3OR7C 1NJIW 1OCCC 4J9YB 4XDJA 3OMNB 2EIJB 2ATKC 4QJFB 1ORQC 2P7TC 3E83A 2HFEC 2WAMA 3ETEA 2Z5UA 4JTDB 2XNDG 3QO5A 1CPYA 1GM8A 4UVBA 2OCCC 4GX1A 1M1KW 4BIZA 3T4ZA 2JDIG 5E1AC 3VOUA 2MK3A 5CA3A 2EINB 1S76D 2JJ1G 2DW4A 4OXSA 1VQLV 1S5HC 1P4RA 2EZOA 3FB6C 1RM1B 3LSSA 1NR7A 4JTCB 2WLIA 3AG4B 2WLLA 1WLEA 3FYEB 2Z3YA 3LDDA 1QR8A 4ZBMA 3RVYA 1KP2A 4BW5A 1QBZA 3G6EV 4RQEA 1VQMV 5IY5B 3ZMZA 4GX0A 2Q69A 1CP9A 3K9AA 2XAHA 1GM7A 3MHSC 1K7DA 4N21A 4I9WA 5BZBA 3E8HA 3T4DA 3ABKB 1RPOA 2DYSB 4X8AA 2GHYA 2IJKA 4MVMA 2NLJC 1CEZA 2C2AA 1R6KA 1R3KC 3PJSK 2KB1A 3RW0A 2V1DA 3DGEA 3SYQA 3JD2A 2DYRC 4JASA 1V54C 3CCLV 1Q7YW 3ASOC 4QNHB 4KUMA 2XAJA 4LBEC 4DO2A 3LUTB 3AG2B 2WLJA 1YSCA 1UJWB 3OW2U 1BHAA 1COWG 1OZ0A 3CD6V 3ABTA 4MTGA 5DM6V 5B1BB 1NR1A 2UXXA 3OMAB 3E2EA 2AHYA 3WFVA 1BL8A 4JF3A 3ABUA 3ABMB 4MTOA 2JIZG 4QPJA 1WPXA 2WPDG 4H33A 5L3FA 1PD3A 3E8GA 3FYIB 1PNKA 1AJQA 3B8NA 4GT1A 2EIKC 5EK0A 2OT5A 2Q6AA 3K08A 2H8PC 3CPWU 2B1IA 2LFRA 1NQTA 3FB5C 4FIPC 4JGSA 4N23A 4PA7A 4XDLA 2P6JA 3EFFK 2FTKA 1HWYA 5KUMA 3UM7A 3T2MA 2EIMB 2LFSA 3IGAC 3CMAV 1R6NA 3ETGA 4UUJC 4WFHA 1JQ0A 4UXNA 2OTLV 2JK5C 2EBOA 3AG3C 5B1NA 5KA6A 1N8RW 1VQNV 3OE7G 5H9CA 1W0JG 4BIUA 3E8FA 1B6QA 4LP8A 3CXCU 1MG1A 1AJNA 3SPJA 2B1GA 1OCRC 2EILC 3ZRWB 3SPGA 1AROP 1VQ6V 1AI4A 2HJFC 1J95A 4LCUC 3WG7B 1QLNA 3ZRXA 4E2LA 3CC7V 1F4MA 3ZCCA 4RQFA 1VQOV 4MW3A 3OUSA 1QVGU 1FS0G 3ZMUA 2EJRA 1V55C 5J9PC 5H6RA 1THZA 2IJJA 3OUFA 1K3EA 2WLLB 4FPPA 5GW7A 3ZRWA 3TCUA 2Y69B 2W0FC 3OEHG 1JCHA 2P67A 5B1OA 5LHHA 2X6CA 1QR9A 3K79A 1R3JC 1E1RG 3AEIA 3X2QB 2R9IA 3QO7A 1DF4A 1JX9A 4U7NA 4R6ZA 4PDLA 5IYCO 2QM8A 3TK1A 1ZWIC 3TETA 1DF5A 2K1EA 4I5SA 4Z1MG 1S72V 2ZXWB 1Y66A 4Q20A 4WFBV 4WF9V 2ZQMA 1OCCB 3SPCA 3AG1C 5L3GA 1RPRA 2XAQA 1F4NA 4G27B 1L1FA 3OGCC 1VQ4V 2LP7A 4ZKIA 1YTFD 3NXSA 3CCJV 3ZMVA 3ZN0A 2OCCB 1YJNV 1NBMG 1K4CC 2ITDC 3LDEA 4J9ZB 4QE9A 1K4DC 4P9PA 1NKDA 2YEVA 3B8MA 1PNLA 2WLMA 3SYPA 5IYBO 3HB3B 2IU0A 3ZMSA 3ABLB 4YXWG 4WCEV 5B1AB 1K92A 4FJCC 5LBQA 3ABKC 4P9OA 1DTOA 5EC1C 2HKOA 3H01A 2HR3A 1NVPD 2JJ2G 2Q68A 5L3DA 3RVZA 3KG2A 2WLHA 1SESA 4L87A 2Q67A 3E8BA 2A0LA 2IJIA 5CBGA 1AI7A 3E89A 4QPKA 3UKMA 1VQ7V 4WFGA 1MABG 4CZZA 3SPHA 4XBFA 1SERA 4TWKA 5LHGA 5B3SC 3IFXA 5CBFA 1GKFA 1M57B 5B1BC 1EFRG 1H8HG 2QKSA 4U7OA 2DYRB 1H2GA 1V54B 2ZR3A 3ASOB 5FL7G 1GMGA 3CC2V 5LGNA 1SZTA 5DN6G 4FMTA 2HLDG 1PNMA 3QO8A 2ZDIC 1YJ9V 1FXHA 3R65A 1W0KG 2XASA 1YI2V 3A0RA 2QE7G 4R50A 4JYBA 4HZ3A 2DQ3A 4JPRA 3ASNC 2BOBC 4MS2A 4MVRA 2IH3C 3F7YC 1FFTB 5HFMA 1YITV 1K9MW 4RUEA 3CCVV 2F43G 1R3IC 2BOCC 3JD0A 1OCOB 1DLBA 3EHBB 4DXWA 3B77A 3ZN1A 2M7WA 2EIMC 4H37A 4MW8A 3CCRV 3HPLC 2V7QG 2EIKB 1K34A 2W6JG 1OHHG 4KP4A 4G28B 3ZMTA 3GWOA 2GSMB 2DWDC 2WSSG 1YTFB 3W7TA 5LGTA 1EBOA 1FXKC 1XL4A 1Y4MA 2X0LA 5EBWC 4CBCA 2WLNA 3W7UA 1OCZB 1KC8W 3MD0A 3I55V 3CCEV 1GTOA 1M56C 3JD1A 3K03A 4UVAA 2XAFA 5CBHA 3LDCA 2JEXA 1Q86W 2ZDIA 3BEHA 3ZRSA 2Y48A 4BAYA 1QLEC 1NVPB 3JD4A 4RUFA 1R73A 1I5YA 1TUEB 1YHQV 4MSWC 3ZIAG 4WFAV 2YEVB 1IXMA 2EIJC 4JYCA 4JTAB 4MVSA 4F4LA 5EBMC 3OMIB 3G4SV 5EC2C 1V55B 3QNEA 2IJHA 4PA4A 3SYCA 1NH2D 3F7VC 3OAAG 4P30A 2EINC 4X88A 2JEUA 3CCSV 2W6IG 2WWWA 4GX2A 4P2ZA 3SPIA 1VQPV 1QVFU 3CP1A 4PDVA 3W7XA 1RM1C 4R7CA 3P32A 3AG4C 2H94A 1FXKA 2DQ0A 1ENVA 1G8MA 2CK3G 5IYDO 3G71V 1PL0A 3JD3A 3STZC 4MVZA 2X6AA 4JAUA 2EZPA 4QE7A 4QIWF 5IY5C 2HVJC 2PI4A 3W7WA 3CCQV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TWK A;  3FB5 C;  2A9H A;  4PA7 A;  4XDL A;  5B3S C;  3IFX A;  3JYC A;  3ABL C;  5CBF A;  3EFF K;  5B1B C;  2QKS A;  3STL C;  4X89 A;  2DYS C;  4MVO A;  5B1A C;  5KUM A;  3SJQ C;  3UM7 A;  3T2M A;  2WLI B;  3IGA C;  2ZXW C;  3E86 A;  4EKW A;  2R9R B;  4UUJ C;  4WFH A;  3F5W C;  3OR7 C;  3K0G A;  2JK5 C;  3AG3 C;  3SYO A;  1OCC C;  4J9Y B;  4XDJ A;  2X6B A;  4PA6 A;  2ATK C;  3E8F A;  1ORQ C;  2P7T C;  4LP8 A;  3E83 A;  3R65 A;  2HFE C;  3SPJ A;  1OCR C;  2EIL C;  4JTD B;  4R50 A;  3SPG A;  4HZ3 A;  2OCC C;  4GX1 A;  3T1C A;  2HG5 C;  3ASN C;  2HJF C;  1J95 A;  2BOB C;  3AG2 C;  4LCU C;  4MS2 A;  2IH3 C;  3F7Y C;  4MVR A;  5E1A C;  3T4Z A;  3VOU A;  4PDM A;  4RUE A;  4OXS A;  4MW3 A;  3OUS A;  1R3I C;  2BOC C;  1S5H C;  3FB6 C;  4RO2 A;  1V55 C;  5KUK A;  3OR6 C;  5J9P C;  4JTC B;  1JVM A;  1M57 C;  2WLI A;  4DXW A;  2WLL A;  3OUF A;  2WLL B;  3K06 A;  3LDD A;  1P7B A;  2EIM C;  4H37 A;  4MW8 A;  4ZBM A;  5EBL C;  3HPL C;  2QTO A;  3TCU A;  3RVY A;  2W0F C;  3ABM C;  4BW5 A;  2X6C A;  2ZD9 A;  4G28 B;  1R3J C;  3LNM B;  2DWD C;  3ZJZ A;  4GX0 A;  2Q69 A;  4HYO A;  1XL4 A;  4I9W A;  5EBW C;  3E8H A;  4R6Z A;  4PDL A;  3T4D A;  5BZB A;  2WLK A;  1ZWI C;  3TET A;  2HVK C;  2K1E A;  4CBC A;  4X8A A;  2WLN A;  1R3L C;  4MVM A;  2NLJ C;  4MVQ A;  1M56 C;  3K03 A;  3K0D A;  1R3K C;  1XL6 A;  3GB7 C;  2KB1 A;  3PJS K;  4R8C A;  3SPC A;  3AG1 C;  3RW0 A;  3SYQ A;  5CBH A;  1OCO C;  3LDC A;  2DYR C;  4G27 B;  1KKD A;  3OGC C;  3BEH A;  3ZRS A;  3K04 A;  1QLE C;  1V54 C;  3ASO C;  4PDR A;  4QNH B;  4LBE C;  3RBZ A;  4PA9 A;  3FB7 C;  2ITD C;  1K4C C;  3LUT B;  3LDE A;  4J9Z B;  4QE9 A;  1K4D C;  4P9P A;  4RUF A;  2WLJ A;  4MSW C;  2YEV A;  4RAI A;  4PA3 A;  2EIJ C;  4JTA B;  2WLM A;  4MVS A;  3FB8 C;  3SYP A;  4F4L A;  1G4Y B;  4MTG A;  5EBM C;  3SYA A;  5EC2 C;  4MVU A;  3ABK C;  4PA4 A;  3SYC A;  2AHY A;  4P9O A;  3WG7 C;  4KFM A;  3F7V C;  1BL8 A;  1OCZ C;  2EIN C;  4MTF A;  4P30 A;  4WFF A;  5EC1 C;  4X88 A;  4GX2 A;  4P2Z A;  3SPI A;  4MTO A;  2Q68 A;  3RVZ A;  4PDV A;  2IH1 C;  3KG2 A;  2WLH A;  1LNQ A;  4R7C A;  3AG4 C;  2A79 B;  4H33 A;  2Q67 A;  3E8B A;  3E8G A;  4GX5 A;  3STZ C;  2Y69 C;  4WFE A;  2A0L A;  4MVZ A;  2EIK C;  5CBG A;  5EK0 A;  2Q6A A;  3E89 A;  3K08 A;  2ITC C;  2X6A A;  4XDK A;  4QE7 A;  3UKM A;  3X2Q C;  2AHZ A;  2HVJ C;  4WFG A;  3SPH A;  5IY5 C;  2H8P C;  2DWE C; 
#chains in the Genus database with same CATH topology
 2ZIN A;  5LHI A;  3ABL C;  2DYS C;  3FKS G;  1XDC A;  3P30 A;  3CC4 V;  3E86 A;  4TT3 G;  1AR1 B;  1N0J A;  5CA0 B;  4PA6 A;  4UV8 A;  4IIJ B;  2O57 A;  3M7M X;  1DGS A;  1SQF A;  3TXS A;  3AG2 C;  4RWU A;  1EZJ A;  1XOU A;  5LOV B;  5IE9 A;  3FFQ A;  5JVD B;  2ZM6 B;  1QQC A;  5IDJ A;  1BMF G;  2CTR A;  3T1Y B;  3APO A;  5K1P A;  1I5X A;  1S5L Z;  1L8D A;  1M57 C;  3OM3 B;  1D2D A;  4O2B A;  5IWA B;  3N2K B;  4AQY O;  2YDE A;  4J41 A;  1PKX A;  3ABM C;  4UFZ A;  3MAQ A;  1FXV A;  2Q9L A;  3FX7 A;  5EIB C;  2D3O W;  1IBM B;  4I50 A;  2QR4 A;  4B7E A;  3H1L H;  3RYI A;  5CN0 A;  1XMO B;  5L3B A;  3GB7 C;  1VQ5 V;  1NH2 B;  4TSF G;  4EB6 B;  2QKC A;  4OX9 O;  1ROP A;  1G1X B;  3CRA A;  3K04 A;  1PPJ H;  4PDR A;  3IC9 A;  1P49 A;  3THO A;  3FB8 C;  2F95 B;  4KFM A;  2ZNJ A;  1OCZ C;  3JAK A;  1VQK V;  1ZX3 A;  4I4T A;  5LMU O;  3ZRV A;  2FML A;  2IH1 C;  3FD9 A;  5L3C A;  1XNR O;  1KYO F;  5IJ9 A;  2QM7 A;  4GUN A;  1MA1 A;  2ZE7 A;  2ITC C;  5LMN O;  1VIB A;  2CDY A;  3X2Q C;  1K33 A;  3CME V;  3ETD A;  2QA4 V;  1WPB A;  1YXB A;  2A9H A;  4UV9 A;  2CTP A;  2WLI B;  5J2U B;  2LW7 A;  5JH7 A;  1OCC C;  4DV6 O;  4NVP A;  1O9H A;  1CPY A;  3J81 N;  2DN9 A;  3DXR A;  3VQX A;  2EIN B;  1P4R A;  2EZO A;  1RM1 B;  1WLE A;  3FYE B;  1TUB A;  1ZLZ A;  4U3J B;  4O4H A;  4X1K B;  3RYF A;  4BW5 A;  2YS8 A;  5CA1 B;  4IL6 Z;  3VQY A;  5JCO A;  4RQE A;  4K3A A;  4DR6 O;  3GVM A;  1K7D A;  5BZB A;  4ICG A;  2UXD O;  2OWO A;  3M8A A;  1Y76 B;  4I55 B;  2IJK A;  2QGN A;  3VQW A;  1EN4 A;  1JFF B;  1R6K A;  1R3K C;  3JAW A;  2KB1 A;  1FD9 A;  1V54 C;  3ASO C;  4DO2 A;  4YJ3 A;  3LUT B;  2DJV A;  4LWS A;  2Q8V A;  1OZ0 A;  2DE0 X;  3CD6 V;  3IAY A;  2N74 A;  2DOS A;  2UXX A;  3OMA B;  2YUA A;  3E2E A;  1N36 B;  3QF7 A;  3RYH B;  3C3S A;  4QPJ A;  4DV4 B;  1NI8 A;  4DV1 O;  3E8G A;  2ZT9 B;  4YIP A;  2KG7 A;  4NR1 A;  2EIK C;  3B40 A;  5EK0 A;  1XI1 A;  2UUC O;  4X20 A;  2H8P C;  3CPW U;  4FLU A;  1QNM A;  4FIP C;  4DW0 A;  3JAT B;  4AIL C;  4W4L A;  2P6J A;  3EFF K;  3UM7 A;  2CTW A;  4CH5 A;  3IGA C;  3CB2 A;  1DK1 A;  1Y6X A;  4WFH A;  4UXN A;  4DRX B;  1TVK A;  3AG3 C;  1NS1 A;  4B3R B;  1VQN V;  4JZ2 A;  3J7A U;  1MG1 A;  3U10 A;  1ARO P;  2GBO A;  1AI4 A;  4FFB A;  1HNX O;  1QLN A;  3BAB A;  4CC6 A;  4RQF A;  2F23 A;  2D2C B;  3OUS A;  1BCC H;  3BFR A;  5FNV B;  1THZ A;  3OUF A;  2YIB D;  1K3E A;  4FPP A;  3BCC H;  2P67 A;  1ZL8 A;  3K57 A;  4ABM A;  3DSQ A;  4JI2 B;  5IYC O;  3TET A;  1AP6 A;  2K1E A;  4X66 O;  1FJG O;  1S72 V;  2ZXW B;  2PUS A;  2ZQM A;  2QWO B;  4LF5 B;  1XHX A;  3OGC C;  5LP6 B;  4DR1 B;  4DR4 O;  2ZE5 A;  3JSN A;  2Z0A A;  1Q5O A;  2OCC B;  4YY3 B;  1NBM G;  4J9Z B;  1K4D C;  4O4I A;  4A5U B;  2YID A;  3ZMS A;  3ABL B;  1FFX B;  4W4K A;  3CS5 A;  3ABK C;  4FLW A;  4DV3 B;  4P9O A;  4CC5 A;  1HR0 B;  2AGA A;  2HKO A;  4FLY A;  4LF7 B;  3CRC A;  4GKJ O;  2WLH A;  1SES A;  4LFA O;  2A0L A;  1I7F A;  3E89 A;  2GTS A;  3L72 H;  1MAB G;  4XBF A;  1SER A;  3UT5 B;  4TWK A;  5CBF A;  1GKF A;  1M57 B;  5B1B C;  3I5D A;  4U7O A;  1WB7 A;  3QVN A;  1U97 A;  1GMG A;  4BIO A;  5CB4 A;  3U0Z A;  5DN6 G;  5CA0 A;  2E5L B;  2ZDI C;  1YJ9 V;  1W0K G;  1YI2 V;  4IYH A;  1ZSP A;  3CRR A;  2ZIM A;  2QE7 G;  3A0R A;  1US6 A;  4R50 A;  1JR9 A;  1F7Y A;  2DQ3 A;  1X4T A;  2BOB C;  1GRJ A;  3F7Y C;  5JVD A;  1K9M W;  3CCV V;  1AVM A;  4JI8 O;  3JD0 A;  1URF A;  4I0X B;  2WA3 A;  3S3W A;  1D5A A;  2GUZ B;  2M7W A;  4MW8 A;  3HPL C;  2Q7H A;  2V7Q G;  2FKX A;  4YJ2 B;  3S3X A;  1RP3 B;  3RFR A;  4G28 B;  3GWO A;  2JS3 A;  3G80 A;  5LGT A;  1EBO A;  2X0L A;  5EBW C;  5KHK A;  1ZTE A;  1NT2 B;  1Q3E A;  1OCZ B;  1KC8 W;  3CCE V;  3K03 A;  1H2S B;  1EN6 A;  1SQV H;  2ZDI A;  3BEH A;  4BAY A;  1BZK A;  4JYY A;  1PV0 A;  4RUF A;  2UXC B;  1BS3 A;  1VF5 B;  4LFC B;  1SS3 A;  3CE2 A;  2EX3 A;  3MDS A;  1AIL A;  4B3S B;  3SR2 C;  2IJH A;  3SYC A;  2LQT A;  2IBZ H;  4P30 A;  2EIN C;  4P2Z A;  4KHP B;  1QVF U;  3K5N A;  3BA8 A;  1RM1 C;  1Q43 A;  3P32 A;  1QHT A;  4DR2 B;  2DQ0 A;  1ENV A;  2CK3 G;  1PL0 A;  3JD3 A;  4KXR A;  4NKG B;  3SGI A;  4K0K O;  4TV8 A;  4JAU A;  1XUQ A;  4O2A B;  1MSD A;  5F2V O;  4GLX A;  2UXB O;  3TGU H;  3AG1 B;  4X89 A;  3ZHT A;  2BTO A;  5C8Y A;  1H8E G;  4EKW A;  5J2U A;  3H1I H;  3L73 H;  1I94 O;  1Q82 W;  3ZHQ A;  1G6U A;  3CHX A;  1YIJ V;  2GV9 A;  4B3T B;  1S5J A;  1KEC A;  4LC1 A;  1YJW V;  3ZHV A;  1M90 W;  1SET A;  2F1M A;  4PDM A;  5C93 A;  3IC7 A;  4DV7 B;  4DUY B;  1E79 G;  2UUB B;  3OR6 C;  4EFB A;  1X59 A;  1H38 A;  3BAA A;  3ZBH A;  4X1K A;  1SA0 A;  4FK5 C;  4FM0 A;  4G2K A;  5CA1 A;  2ZD9 A;  3UO2 A;  3ZJZ A;  1K97 A;  5B3S B;  5J2T B;  1JPX A;  1Y76 A;  4HAM A;  4J7Z A;  1JJ2 U;  4I55 A;  3ZHR A;  1R3L C;  2ZM6 O;  3T1Y O;  1JFF A;  4NB5 A;  3K0D A;  5IWA O;  1SRY A;  2PTM A;  4J11 A;  1S77 D;  3JAM N;  1FYJ A;  3FB7 C;  1KP3 A;  1N33 B;  4UVC A;  1Q6U A;  4WBN B;  1IBM O;  4PJ0 Z;  1YZB A;  1XMO O;  3RWR D;  1NU1 H;  4LR3 A;  4JAV A;  3AG3 B;  3RYH A;  3KCX A;  3O65 A;  4LFB B;  1F51 A;  1FXK B;  4PD4 F;  2B5U A;  4GYC B;  4FLZ A;  1K73 W;  2AHZ A;  3CCU V;  1TGO A;  3VBB A;  4TV9 A;  3STL C;  4GCZ A;  4MVO A;  3SJQ C;  1GAX A;  2ZXW C;  4X62 B;  3F5W C;  3OR7 C;  5IJ0 A;  1GN3 A;  2K9P A;  4J9Y B;  1I94 B;  1ZUQ A;  5LA6 A;  3OMN B;  2EIJ B;  2EJ7 A;  5JJJ B;  2ATK C;  1R1B A;  3TXQ A;  2HFE C;  5JQG B;  4O4L B;  3ETE A;  1KQS U;  2XND G;  1M1K W;  1EZV H;  2OCC C;  4GX1 A;  2JGD B;  4DR3 B;  5E1A C;  5CA3 A;  3K5L A;  2JJ1 G;  2DW4 A;  1VQL V;  4LF4 B;  3Q4H B;  2LGQ A;  5EZY A;  2OCH A;  5FNV A;  5KAI Z;  3LDD A;  4H0L B;  1D5N A;  3G6E V;  1N32 B;  4GX0 A;  2Q69 A;  3K9A A;  3MHS C;  1NTZ H;  1U96 A;  4N21 A;  1MZF A;  3T4D A;  3JSL A;  1B06 A;  3ABK B;  5KMG A;  1RPO A;  4E4E A;  4MVM A;  1SKV A;  1CEZ A;  2AW9 A;  3PJS K;  1MZE A;  1W59 A;  3SYQ A;  1VF6 C;  5LP6 A;  5BY1 A;  1Q7Y W;  4QNH B;  4KUM A;  1GH6 A;  4LBE C;  2JRI A;  2QKA A;  2PYL A;  1BHA A;  1J5E B;  3C90 A;  5DM6 V;  1FFX A;  5B1B B;  5D5P A;  1HNW O;  3SJA C;  4TQF A;  2Q73 A;  4MTO A;  2NR5 A;  3CJH A;  3CX5 F;  1WPX A;  3P3P A;  4DR7 B;  3BHP A;  3FYI B;  1AJQ A;  4IGG A;  2F4V B;  4ZIB A;  1WNS A;  3FAV A;  3UT5 A;  5DED A;  2QTS A;  2FTK A;  1N36 O;  2HJD A;  4X64 B;  3CMA V;  3ETG A;  2EBO A;  4DV4 O;  3OE7 G;  4EEQ A;  5H9C A;  1W0J G;  2B9Z A;  3E8F A;  1B6Q A;  4LP8 A;  3CXC U;  4JI3 B;  2B1G A;  1OCR C;  2ETN A;  2UUA B;  1JMK C;  4LCU C;  3A8T A;  2P4V A;  3WG7 B;  3ZCC A;  1VQO V;  1T5E A;  4I0X A;  1V9P A;  2WLL B;  2OIG A;  3AG7 A;  5GW7 A;  3TCU A;  4YJ2 A;  4B3R O;  1RSO B;  2X6C A;  1HDJ A;  2BTQ B;  3RYC B;  4LF6 B;  1JX9 A;  4U7N A;  1WB8 A;  4R6Z A;  2QM8 A;  4ZOL A;  3N27 A;  4I5S A;  4IHJ B;  3WB2 A;  1Y66 A;  1AB3 A;  1YF2 A;  4WFB V;  3AG1 C;  5L3G A;  3E22 B;  4O4J B;  2XAQ A;  2AZ2 A;  1LUV A;  2LP7 A;  1YTF D;  4JI0 B;  3NXS A;  3ZMV A;  3ZN0 A;  2ITD C;  1P84 F;  3LSU A;  2CAZ C;  4F6R B;  3SYP A;  5IYB O;  2IU0 A;  4JI2 O;  4WCE V;  3J80 N;  1BGY H;  1K92 A;  1DTO A;  1HNW B;  1NZ6 A;  3D36 C;  4LNU B;  1NVP D;  3RVZ A;  3KG2 A;  4LF5 O;  5AG2 A;  2Q67 A;  2XHB A;  4DR1 O;  3E8B A;  3OTF A;  1B04 A;  4F6E A;  3ZS8 C;  4YY3 O;  2OIE A;  2CH7 B;  5E79 Z;  3UQ8 A;  4QPK A;  3UKM A;  1VQ7 V;  4WFG A;  5IT9 N;  4O2A A;  5LYJ A;  5LHG A;  5B3S C;  2QKS A;  4DV3 O;  4OPH A;  1HR0 O;  4X1Y A;  4LF7 O;  5FL7 G;  3K5O A;  5LGN A;  2XTA A;  1SZT A;  2Y0I A;  4FM1 A;  4JI7 B;  4HZ3 A;  5KX5 B;  1BE3 H;  1B3Q A;  5HFM A;  3CRQ A;  1YIT V;  5GTH Z;  2F43 G;  1SQQ H;  4L8J A;  3RGB A;  2QDO A;  3OT7 A;  2ZIO A;  1DLB A;  4DXW A;  3ZN1 A;  3AK1 A;  4KP4 A;  2E5L O;  2GSM B;  2RN9 A;  1FXK C;  2Q4P A;  3CEI A;  3W7U A;  4FLT A;  3MD0 A;  2M6Y A;  3JD1 A;  2XAF A;  1KBH A;  5CBH A;  3LDC A;  1YDX A;  2MW2 B;  3ZRS A;  3H1J H;  2CGN A;  1TUE B;  3SJB C;  3HKC B;  4MSW C;  2EIJ C;  4JTA B;  4Z1V A;  1V55 B;  3QNE A;  1IBL B;  4PA4 A;  3OAA G;  1XIL A;  4CH4 A;  3WB0 A;  3L74 H;  1VQP V;  3CP1 A;  4JZG A;  3W7X A;  4UCO A;  5LXT B;  4R7C A;  5GON A;  4LH6 A;  1FXK A;  2Q0A A;  1Q6H A;  2VWK A;  2UXC O;  4LFC O;  5BR8 B;  2X6A A;  4QIW F;  4J42 A;  3CCQ V;  4B3S O;  1Q6I A;  3LSQ A;  1JOY A;  4UCU A;  4MTX A;  4IT5 A;  1S3J A;  2W0X A;  2ZR2 A;  2R9R B;  3K3W A;  4KHP O;  1AJP A;  2GDS A;  2XAG A;  3SYO A;  4JI4 O;  2R70 A;  2BCC H;  4DR2 O;  2YXH A;  3BY6 A;  3K9S A;  2NNU A;  5H6Q A;  1FKA O;  5EYP A;  5CMU A;  1K5Q A;  1SC5 B;  1F23 A;  2JGD A;  3ML0 A;  4NXM B;  4I50 B;  3Q4H A;  1N4C A;  2Q5Z A;  4RO2 A;  3A0H Z;  1QCE A;  1FPO A;  1JVM A;  3RT3 C;  3K06 A;  3KCY A;  5LGU A;  4EFE A;  2YIA A;  1OJH A;  3JAS B;  4B7K A;  2AXT Z;  2N05 A;  2KKW A;  3LNM B;  3WU2 Z;  4IIJ A;  4B3T O;  2QSA A;  2YXL A;  4HYO A;  3L9D A;  1KD1 W;  2P4K A;  5LOV A;  2QEX V;  3PN1 A;  5HFL A;  1HW7 A;  4DV7 O;  3JAK B;  4TQD A;  4DUY O;  2UUB O;  2ZE8 A;  1XL6 A;  4R8C A;  4K35 A;  1KKD A;  1XNQ B;  3N2K A;  4PV1 B;  1MNG A;  1MSW D;  4RAI A;  4PA3 A;  1E1Q G;  1M93 A;  1M5I A;  1WJZ A;  1G4Y B;  3HR0 A;  1VQ8 V;  1S0V A;  4MVU A;  5H5N A;  1GM9 A;  4UCT A;  2CTQ A;  1SQX H;  1FAF A;  3WG7 C;  4WFF A;  3T1H B;  4KL1 A;  4EB6 A;  3D3Q A;  1LNQ A;  5JH7 B;  5KA5 A;  1XBL A;  4HBN A;  2A79 B;  1SQB H;  1OCR B;  3W7S A;  1KKC A;  4GX5 A;  1O9G A;  1N33 O;  3JAR B;  2VRZ A;  2IU3 A;  2DWE C;  4JYA B;  1MOF A;  3D3I A;  1I0H A;  1UPG A;  3LNN A;  1QLE B;  3JAL B;  2Y4T A;  2IW5 A;  3SDL A;  5KHI A;  1NJI W;  4JI4 B;  3RYF B;  4LFB O;  1HNZ B;  4XDJ A;  1ORQ C;  3E83 A;  1GM8 A;  1S76 D;  4FVM A;  1JA8 A;  3DC5 A;  3ETQ A;  3CXH F;  3FB6 C;  3ZHU A;  3LSS A;  4JTC B;  4DV2 O;  1VF7 A;  2WLI A;  5FLX N;  4H13 B;  2WLL A;  4PHZ A;  2Z3Y A;  4LF8 B;  4X62 O;  5A9G A;  2VS0 A;  3L75 H;  2VQF B;  3RVY A;  4J80 A;  1KP2 A;  1XEQ A;  1QBZ A;  1BQ0 A;  2BTQ A;  2WA4 A;  1VQM V;  2ILM A;  4UCV A;  1CP9 A;  1GM7 A;  1NTK H;  4I9W A;  4B08 A;  4K8X A;  3HKD B;  4DR3 O;  4X8A A;  1GN4 A;  2GHY A;  4FM2 A;  2CE4 A;  4LF4 O;  4X65 B;  2NLJ C;  2C2A A;  1XQ8 A;  2V1D A;  3DGE A;  3E22 A;  3JD2 A;  3JCU Z;  4O4J A;  4U3J A;  1BSM A;  2XAJ A;  2KG7 B;  4LF9 B;  4CS3 A;  2PYJ A;  4DR5 B;  1N32 O;  4F6R A;  1TA8 A;  1IZ3 A;  3H1K H;  3ABT A;  5K1X A;  1L0N H;  2HEP A;  1Y74 B;  3R66 A;  4UCS A;  3WFV A;  3ABU A;  3A0B Z;  1TVK B;  4H33 A;  2PZS A;  2HHH B;  4X1I B;  3B8N A;  4GT1 A;  5FPO A;  1KUQ A;  2Q0O C;  2OT5 A;  2RMK B;  3K08 A;  1VEW A;  1J5E O;  2RJZ A;  1PP9 H;  2B1I A;  2LFR A;  3FB5 C;  1PM9 A;  1IXB A;  2EUL A;  1HWY A;  2LJ2 A;  3P3N A;  2LFS A;  3BPZ A;  1R6N A;  3UO3 A;  2JK5 C;  2JS5 A;  5B1N A;  4DR7 O;  3K58 A;  2YIB A;  1ZL8 B;  1QU7 A;  3SPJ A;  2F4V O;  2EIL C;  4B3M B;  3ZRW B;  3SPG A;  5KX5 A;  1VQ6 V;  5KAF Z;  2HJF C;  1MMM A;  3OTO B;  4E2L A;  5JJN B;  3CC7 V;  1FS0 G;  3JAT A;  2QM4 A;  1V55 C;  5J9P C;  4X64 O;  2IM9 A;  4DV2 B;  1A32 A;  3CWB H;  4FFK A;  3KKY A;  4DRX A;  4D7S A;  2Y69 B;  2W0F C;  3OEH G;  1QR9 A;  3HKE B;  3AEI A;  4JI3 O;  4O4I B;  3QO7 A;  1DF4 A;  4NXN O;  4PDL A;  2UUA O;  1ZWI C;  1DF5 A;  3HKB B;  4GKK B;  1BT8 A;  3F5T A;  4Q20 A;  4WF9 V;  4HNA B;  4X9Q A;  1RPR A;  1L1F A;  4G27 B;  4JAA A;  1VQ4 V;  2HP8 A;  3L71 H;  3CCJ V;  3AK2 A;  1YJN V;  3LDE A;  4QE9 A;  3HKC A;  1NKD A;  3B8M A;  4LF6 O;  1WA8 B;  3HB3 B;  4TUY B;  1EM1 A;  4YXW G;  2XUM A;  4FJC C;  5GTI Z;  2E3C A;  5A2Q N;  4FZ1 A;  3H01 A;  4JI6 B;  2HR3 A;  2Q68 A;  2F66 C;  2YC0 A;  3N2G B;  5L3D A;  3WB1 A;  1I08 A;  5CB4 B;  5LXT A;  3NR7 A;  4L87 A;  4JI0 O;  1WAZ A;  4J10 A;  2IJI A;  5CBG A;  1AI7 A;  4CZZ A;  1Z5W A;  3IFX A;  2BE3 A;  1SF9 A;  2DYR B;  2G38 A;  4DUZ B;  1Z2G A;  2A7W A;  2KSD A;  4U3F H;  1FXH A;  2RNB A;  2XAS A;  3R65 A;  4NTY A;  4YHH B;  1XMQ B;  4JYB A;  4JPR A;  2UU9 B;  4MS2 A;  2ADP A;  2IH3 C;  2NN4 A;  4Z2W A;  1WN7 A;  1FFT B;  1AP5 A;  4RUE A;  1R3I C;  1VF6 A;  2BSK B;  1HP8 A;  3CRM A;  3EHB B;  3TJT A;  3EXA A;  4DV5 B;  2EIM C;  4H37 A;  2VQE B;  3CCR V;  3JAS A;  4K8Z A;  4JI1 B;  2W6J G;  5KHG A;  2DWD C;  2WSS G;  1YTF B;  3W7T A;  4JI7 O;  1SZX A;  4NXN B;  2VWJ A;  3D8C A;  3I55 V;  3G6B A;  2QWQ B;  4UVA A;  1N34 B;  1Q86 W;  2GUZ A;  2Y48 A;  1QLE C;  4QGP A;  1PL4 A;  4UB8 Z;  1NVP B;  3JD4 A;  1YVW A;  2LO1 A;  1R73 A;  1I5Y A;  4FLV A;  1YHQ V;  2QWR B;  2YEV B;  4TV8 B;  4MVS A;  5JCO C;  2A06 H;  5EBM C;  1NH2 D;  3SJC C;  5C8Y B;  3F7V C;  2V4D A;  4FZ0 A;  1OV9 A;  3CCS V;  2W6I G;  2WWW A;  4GX2 A;  4H44 B;  2ADQ B;  4YIO A;  5IYD O;  2P22 C;  3G71 V;  3STZ C;  4MVZ A;  2Q7E A;  3JAR A;  2EZP A;  4QE7 A;  2HVJ C;  1IDS A;  3VQV A;  2E76 B;  1Q81 W;  4NTX A;  1IBL O;  3JYC A;  3JCZ A;  5L3E A;  4JI5 O;  5B1A C;  1M9N A;  2ARH A;  3JAL A;  5LL6 Y;  4AQY B;  3K0G A;  1GK9 A;  1SA0 B;  2ZE6 A;  1TAE A;  5JJE B;  2X6B A;  1K8A W;  1VAR A;  5ITZ B;  2X7R B;  1YCI A;  3T1C A;  5BR8 O;  2HG5 C;  3MHH C;  2UXN A;  3H9V A;  2ZCE A;  1SQG A;  4FLX A;  5D5Q A;  2GTA A;  4BR6 A;  5KUK A;  2QWN B;  1W2B U;  1YEW A;  2RCV A;  4OX9 B;  1P7B A;  1Q90 D;  5EBL C;  2P90 A;  2QTO A;  3OD4 A;  3OFN G;  3RN4 A;  3AK3 A;  3OEE G;  1Q8I A;  2F93 B;  3C3T A;  2WLK A;  3HKD A;  1GO3 F;  2HVK C;  4NXM O;  3D36 A;  2YIC A;  4CH3 A;  4PEL A;  3K5M A;  4MVQ A;  2PI5 A;  5LMU B;  2YSU B;  1OCO C;  3CYO A;  1XNR B;  3ZHS A;  3RBZ A;  4PA9 A;  2JGU A;  1BHB A;  1AI5 A;  3APQ A;  3ASN B;  4ASU G;  4I9Q A;  3BVO A;  5LMN B;  3SYA A;  5J2T A;  3I56 V;  3CCM V;  5BMV B;  4TV9 B;  3B09 A;  4ZHQ B;  1Y74 A;  3E35 A;  2FYU H;  1AI6 A;  4MTF A;  1VQ9 V;  1P7G A;  3ZED A;  4MT8 A;  5IJ0 B;  2XOK G;  1XNQ O;  5LA6 B;  5IYZ B;  4C7U A;  2EIL B;  4DV6 B;  3M99 B;  1XRE A;  4ZI7 B;  5B5E Z;  2Q7G A;  2YI8 A;  2Y69 C;  4WFE A;  4X1I A;  3UCS C;  2OYQ A;  4DK1 A;  4DYL A;  4XDK A;  1K5S A;  4BW9 A;  3DTU B;  3QG5 A;  1M56 B;  2PF4 E;  4WBN A;  2OTJ V;  5FPR A;  5EZY B;  4PI0 A;  5BXZ A;  4JI5 B;  4BWA A;  3T1H O;  2FL4 A;  1M4U A;  4QJF B;  4DR6 B;  2P7T C;  2WAM A;  4JTD B;  2Z5U A;  4UVB A;  3QO5 A;  3ZRW A;  2UXD B;  1RFY A;  4PI2 A;  1Y67 A;  4BIZ A;  3QTC A;  5KMG B;  1IVS A;  3T4Z A;  2JDI G;  1H2N A;  3VOU A;  2MK3 A;  4OXS A;  4JYA O;  1S5H C;  4D6T H;  2P5O A;  1NR7 A;  1IBK O;  3AG4 B;  4UB6 Z;  4O2B B;  1QR8 A;  4ZBM A;  5KHH A;  1XHZ A;  1GN2 A;  4IYI A;  4J7J A;  3BRC A;  1HNZ O;  3HKE A;  1BQZ A;  5KLV H;  5IY5 B;  3ZMZ A;  4NYK A;  5JQG A;  2XAH A;  4O4L A;  2ZKO A;  3E8H A;  3DC6 A;  3HKB A;  2DYS B;  2CGO A;  3ZX6 A;  3RYI B;  3OGI B;  1WP8 A;  4HNA A;  3RW0 A;  3CJH B;  2DYR C;  4LF8 O;  4JAS A;  2VQF O;  3CCL V;  3CSX A;  4DV1 B;  1ZAU A;  4AI8 A;  4AHC A;  4UCR A;  3AG2 B;  2WLJ A;  1YSC A;  1UJW B;  3OW2 U;  2UUC B;  2AZ0 A;  1COW G;  1WA8 A;  4MTG A;  4TUY A;  3FAV B;  1IUR A;  1NR1 A;  2CUG A;  3G67 A;  4D7T A;  2AHY A;  2LW1 A;  4X65 O;  1BL8 A;  4JF3 A;  4I4T B;  3ABM B;  2JIZ G;  3N2G A;  5IJ9 B;  2WPD G;  5L3F A;  1PD3 A;  4DW1 A;  1PNK A;  4LF9 O;  4DR5 O;  1WP7 A;  2DMX A;  2Q6A A;  1HNX B;  2ZNI A;  4JGS A;  1NQT A;  4N23 A;  4PA7 A;  4XDL A;  1H2K A;  5KUM A;  3T2M A;  2EIM B;  4UUJ C;  1JQ0 A;  2OTL V;  5KA6 A;  1N8R W;  4BIU A;  3ICX A;  2HHH O;  1AJN A;  2LGW A;  3A2F A;  1JJO A;  3IJ4 A;  1J95 A;  4ZOL B;  4X66 B;  3DXR B;  3ZRX A;  1FJG B;  1F4M A;  4MW3 A;  1QVG U;  3ZMU A;  2EJR A;  2BSK A;  2KQX A;  5H6R A;  1H2M A;  1IBK B;  2IJJ A;  1TUB B;  4J7K A;  4DR4 B;  4O4H B;  5EIB D;  1JCH A;  5B1O A;  5LHH A;  1KMI Z;  3K79 A;  1R3J C;  2FB5 A;  1E1R G;  1EN5 A;  3X2Q B;  2R9I A;  2QWP B;  4B3M O;  3TK1 A;  2R9A A;  3OTO O;  4Z1M G;  4DV0 O;  1OCC B;  3JAW B;  3SPC A;  4GKJ B;  1VP7 A;  1F4N A;  2P06 A;  4LFA B;  4ZKI A;  1RSO A;  2L35 A;  4YJ3 B;  1K4C C;  3BA9 A;  2XT9 A;  2ODM A;  4P9P A;  2YEV A;  4LWS B;  4CH6 A;  3RYC A;  1R6T A;  1VMG A;  1PNL A;  2WLM A;  1H2L A;  1L0L H;  3B4S A;  1Z5V A;  5LYJ B;  5H2F Z;  1SQP H;  5B1A B;  4GKK O;  5LBQ A;  4IHJ A;  4X1Y B;  2H3O A;  5TIS Z;  5EC1 C;  1N0N A;  2JJ2 G;  4JV5 O;  2YXY A;  1KU9 A;  1NTM H;  3U11 A;  3K59 A;  1AR5 A;  5B66 Z;  2L6L A;  5DEC A;  2RQ6 A;  3SPH A;  4X20 B;  4JI8 B;  1EFR G;  1H8H G;  1H2G A;  2E74 B;  4LNU A;  1V54 B;  4DK0 A;  2ZR3 A;  3ASO B;  4JI6 O;  2RDC A;  1LUW A;  3B2E E;  5JWP A;  3CC2 V;  2PY5 A;  3O9O A;  4FMT A;  4I7Z B;  2HLD G;  1PNM A;  5ITZ A;  3QO8 A;  2A3Q A;  5KHJ A;  4OGQ B;  2CH7 A;  4CS4 A;  3ASN C;  4FFB B;  4MVR A;  4NTW A;  2BOC C;  1OCO B;  4DUZ O;  2YI9 A;  3B77 A;  1AR4 A;  2EIK B;  1K34 A;  1OHH G;  3ZMT A;  4YHH O;  2R72 A;  1XMQ O;  1Y4M A;  1XL4 A;  2Y4U A;  4OPA A;  1CXZ B;  4TOI A;  2UU9 O;  2N04 A;  4CBC A;  2WLN A;  1LR1 A;  1GN6 A;  1GTO A;  1M56 C;  4DV0 B;  3L70 H;  3H1H H;  4LH7 A;  2JEX A;  2Y0P A;  4DV5 O;  5GON B;  2VQE O;  1KB9 F;  1IX9 A;  4JI1 O;  3GWK C;  4WFA V;  2E75 B;  3ZIA G;  1IXM A;  4JYC A;  4K0K B;  4F4L A;  3OMI B;  3G4S V;  5EC2 C;  5BMV A;  4Q6G A;  2UXB B;  4ZHQ A;  3EVK A;  2JVD A;  4X88 A;  3KZI Z;  2JEU A;  3SPI A;  4PDV A;  4JV5 B;  1N34 O;  3AG4 C;  5IYZ A;  2H94 A;  5LP6 C;  4ZI7 A;  1G8M A;  4CS2 A;  4GZR B;  5EYP B;  2QJ1 A;  5IY5 C;  2PI4 A;  2PGG A;  3W7W A;  1UFI A; 
#chains in the Genus database with same CATH homology
 3LSQ A;  1JOY A;  1Q81 W;  5LHI A;  3JYC A;  3ABL C;  3AG1 B;  4MTX A;  3JCZ A;  4X89 A;  5L3E A;  2DYS C;  3FKS G;  5B1A C;  1S3J A;  2ZR2 A;  1M9N A;  1H8E G;  3P30 A;  3CC4 V;  4EKW A;  3E86 A;  4TT3 G;  2R9R B;  1AR1 B;  3K3W A;  3K0G A;  1AJP A;  2XAG A;  3SYO A;  1GK9 A;  1Q82 W;  2X6B A;  4PA6 A;  1YIJ V;  1K8A W;  4UV8 A;  2X7R B;  3BY6 A;  1KEC A;  2NNU A;  5H6Q A;  4LC1 A;  3T1C A;  1YJW V;  2HG5 C;  3MHH C;  5CMU A;  2UXN A;  3AG2 C;  1K5Q A;  1EZJ A;  1F23 A;  3ML0 A;  1M90 W;  1SET A;  4PDM A;  5C93 A;  5IDJ A;  1BMF G;  3IC7 A;  4RO2 A;  1E79 G;  1QCE A;  5KUK A;  1I5X A;  3OR6 C;  1W2B U;  1JVM A;  1M57 C;  3OM3 B;  1H38 A;  3K06 A;  5LGU A;  1P7B A;  5EBL C;  2P90 A;  2QTO A;  3OFN G;  1PKX A;  3OEE G;  3ABM C;  4FK5 C;  4G2K A;  2ZD9 A;  3LNM B;  3ZJZ A;  1FXV A;  1K97 A;  4HYO A;  5B3S B;  2WLK A;  1JPX A;  1GO3 F;  2HVK C;  2D3O W;  1KD1 W;  4HAM A;  2QEX V;  3D36 A;  1JJ2 U;  1R3L C;  5HFL A;  4PEL A;  4MVQ A;  5CN0 A;  5L3B A;  2PI5 A;  3K0D A;  1XL6 A;  3GB7 C;  4R8C A;  1VQ5 V;  2YSU B;  1OCO C;  3CYO A;  4TSF G;  1NH2 B;  1KKD A;  1ROP A;  1SRY A;  1KQS U;  3K04 A;  1S77 D;  4PDR A;  3RBZ A;  4PA9 A;  3FB7 C;  1MSW D;  1KP3 A;  1BHB A;  1AI5 A;  3ASN B;  4ASU G;  4RAI A;  4PA3 A;  1E1Q G;  4UVC A;  3FB8 C;  1G4Y B;  1VQ8 V;  3SYA A;  1S0V A;  3I56 V;  3CCM V;  4MVU A;  1GM9 A;  3E35 A;  3WG7 C;  4KFM A;  1AI6 A;  4MTF A;  1OCZ C;  1VQ9 V;  1VQK V;  4WFF A;  4JAV A;  3AG3 B;  3ZRV A;  4MT8 A;  2XOK G;  2IH1 C;  5KA5 A;  1LNQ A;  5L3C A;  2A79 B;  2QM7 A;  1OCR B;  1F51 A;  1FXK B;  2EIL B;  3W7S A;  3M99 B;  4GX5 A;  2B5U A;  2Y69 C;  4WFE A;  2ITC C;  4XDK A;  1K5S A;  2IU3 A;  3X2Q C;  2AHZ A;  1K33 A;  3DTU B;  1M56 B;  3ETD A;  3CME V;  3CCU V;  2QA4 V;  1K73 W;  2DWE C;  3VBB A;  1MOF A;  3D3I A;  2OTJ V;  2A9H A;  4UV9 A;  3STL C;  4GCZ A;  4MVO A;  3SJQ C;  2WLI B;  1QLE B;  2ZXW C;  2IW5 A;  3F5W C;  3OR7 C;  1NJI W;  1OCC C;  4J9Y B;  4XDJ A;  3OMN B;  2EIJ B;  2ATK C;  4QJF B;  1ORQ C;  2P7T C;  3E83 A;  2HFE C;  2WAM A;  3ETE A;  2Z5U A;  4JTD B;  2XND G;  3QO5 A;  1CPY A;  1GM8 A;  4UVB A;  2OCC C;  4GX1 A;  1M1K W;  4BIZ A;  3T4Z A;  2JDI G;  5E1A C;  3VOU A;  2MK3 A;  5CA3 A;  2EIN B;  1S76 D;  2JJ1 G;  2DW4 A;  4OXS A;  1VQL V;  1S5H C;  1P4R A;  2EZO A;  3FB6 C;  1RM1 B;  3LSS A;  1NR7 A;  4JTC B;  2WLI A;  3AG4 B;  2WLL A;  1WLE A;  3FYE B;  2Z3Y A;  3LDD A;  1QR8 A;  4ZBM A;  3RVY A;  1KP2 A;  4BW5 A;  1QBZ A;  3G6E V;  4RQE A;  1VQM V;  5IY5 B;  3ZMZ A;  4GX0 A;  2Q69 A;  1CP9 A;  3K9A A;  2XAH A;  1GM7 A;  3MHS C;  1K7D A;  4N21 A;  4I9W A;  5BZB A;  3E8H A;  3T4D A;  3ABK B;  1RPO A;  2DYS B;  4X8A A;  2GHY A;  2IJK A;  4MVM A;  2NLJ C;  1CEZ A;  2C2A A;  1R6K A;  1R3K C;  3PJS K;  2KB1 A;  3RW0 A;  2V1D A;  3DGE A;  3SYQ A;  3JD2 A;  2DYR C;  4JAS A;  1V54 C;  3CCL V;  1Q7Y W;  3ASO C;  4QNH B;  4KUM A;  2XAJ A;  4LBE C;  4DO2 A;  3LUT B;  3AG2 B;  2WLJ A;  1YSC A;  1UJW B;  3OW2 U;  1BHA A;  1COW G;  1OZ0 A;  3CD6 V;  3ABT A;  4MTG A;  5DM6 V;  5B1B B;  1NR1 A;  2UXX A;  3OMA B;  3E2E A;  2AHY A;  3WFV A;  1BL8 A;  4JF3 A;  3ABU A;  3ABM B;  4MTO A;  2JIZ G;  4QPJ A;  1WPX A;  2WPD G;  4H33 A;  5L3F A;  1PD3 A;  3E8G A;  3FYI B;  1PNK A;  1AJQ A;  3B8N A;  4GT1 A;  2EIK C;  5EK0 A;  2OT5 A;  2Q6A A;  3K08 A;  2H8P C;  3CPW U;  2B1I A;  2LFR A;  1NQT A;  3FB5 C;  4FIP C;  4JGS A;  4N23 A;  4PA7 A;  4XDL A;  2P6J A;  3EFF K;  2FTK A;  1HWY A;  5KUM A;  3UM7 A;  3T2M A;  2EIM B;  2LFS A;  3IGA C;  3CMA V;  1R6N A;  3ETG A;  4UUJ C;  4WFH A;  1JQ0 A;  4UXN A;  2OTL V;  2JK5 C;  2EBO A;  3AG3 C;  5B1N A;  5KA6 A;  1N8R W;  1VQN V;  3OE7 G;  5H9C A;  1W0J G;  4BIU A;  3E8F A;  1B6Q A;  4LP8 A;  3CXC U;  1MG1 A;  1AJN A;  3SPJ A;  2B1G A;  1OCR C;  2EIL C;  3ZRW B;  3SPG A;  1ARO P;  1VQ6 V;  1AI4 A;  2HJF C;  1J95 A;  4LCU C;  3WG7 B;  1QLN A;  3ZRX A;  4E2L A;  3CC7 V;  1F4M A;  3ZCC A;  4RQF A;  1VQO V;  4MW3 A;  3OUS A;  1QVG U;  1FS0 G;  3ZMU A;  2EJR A;  1V55 C;  5J9P C;  5H6R A;  1THZ A;  2IJJ A;  3OUF A;  1K3E A;  2WLL B;  4FPP A;  5GW7 A;  3ZRW A;  3TCU A;  2Y69 B;  2W0F C;  3OEH G;  1JCH A;  2P67 A;  5B1O A;  5LHH A;  2X6C A;  1QR9 A;  3K79 A;  1R3J C;  1E1R G;  3AEI A;  3X2Q B;  2R9I A;  3QO7 A;  1DF4 A;  1JX9 A;  4U7N A;  4R6Z A;  4PDL A;  5IYC O;  2QM8 A;  3TK1 A;  1ZWI C;  3TET A;  1DF5 A;  2K1E A;  4I5S A;  4Z1M G;  1S72 V;  2ZXW B;  1Y66 A;  4Q20 A;  4WFB V;  4WF9 V;  2ZQM A;  1OCC B;  3SPC A;  3AG1 C;  5L3G A;  1RPR A;  2XAQ A;  1F4N A;  4G27 B;  1L1F A;  3OGC C;  1VQ4 V;  2LP7 A;  4ZKI A;  1YTF D;  3NXS A;  3CCJ V;  3ZMV A;  3ZN0 A;  2OCC B;  1YJN V;  1NBM G;  1K4C C;  2ITD C;  3LDE A;  4J9Z B;  4QE9 A;  1K4D C;  4P9P A;  1NKD A;  2YEV A;  3B8M A;  1PNL A;  2WLM A;  3SYP A;  5IYB O;  3HB3 B;  2IU0 A;  3ZMS A;  3ABL B;  4YXW G;  4WCE V;  5B1A B;  1K92 A;  4FJC C;  5LBQ A;  3ABK C;  4P9O A;  1DTO A;  5EC1 C;  2HKO A;  3H01 A;  2HR3 A;  1NVP D;  2JJ2 G;  2Q68 A;  5L3D A;  3RVZ A;  3KG2 A;  2WLH A;  1SES A;  4L87 A;  2Q67 A;  3E8B A;  2A0L A;  2IJI A;  5CBG A;  1AI7 A;  3E89 A;  4QPK A;  3UKM A;  1VQ7 V;  4WFG A;  1MAB G;  4CZZ A;  3SPH A;  4XBF A;  1SER A;  4TWK A;  5LHG A;  5B3S C;  3IFX A;  5CBF A;  1GKF A;  1M57 B;  5B1B C;  1EFR G;  1H8H G;  2QKS A;  4U7O A;  2DYR B;  1H2G A;  1V54 B;  2ZR3 A;  3ASO B;  5FL7 G;  1GMG A;  3CC2 V;  5LGN A;  1SZT A;  5DN6 G;  4FMT A;  2HLD G;  1PNM A;  3QO8 A;  2ZDI C;  1YJ9 V;  1FXH A;  3R65 A;  1W0K G;  2XAS A;  1YI2 V;  3A0R A;  2QE7 G;  4R50 A;  4JYB A;  4HZ3 A;  2DQ3 A;  4JPR A;  3ASN C;  2BOB C;  4MS2 A;  4MVR A;  2IH3 C;  3F7Y C;  1FFT B;  5HFM A;  1YIT V;  1K9M W;  4RUE A;  3CCV V;  2F43 G;  1R3I C;  2BOC C;  3JD0 A;  1OCO B;  1DLB A;  3EHB B;  4DXW A;  3B77 A;  3ZN1 A;  2M7W A;  2EIM C;  4H37 A;  4MW8 A;  3CCR V;  3HPL C;  2V7Q G;  2EIK B;  1K34 A;  2W6J G;  1OHH G;  4KP4 A;  4G28 B;  3ZMT A;  3GWO A;  2GSM B;  2DWD C;  2WSS G;  1YTF B;  3W7T A;  5LGT A;  1EBO A;  1FXK C;  1XL4 A;  1Y4M A;  2X0L A;  5EBW C;  4CBC A;  2WLN A;  3W7U A;  1OCZ B;  1KC8 W;  3MD0 A;  3I55 V;  3CCE V;  1GTO A;  1M56 C;  3JD1 A;  3K03 A;  4UVA A;  2XAF A;  5CBH A;  3LDC A;  2JEX A;  1Q86 W;  2ZDI A;  3BEH A;  3ZRS A;  2Y48 A;  4BAY A;  1QLE C;  1NVP B;  3JD4 A;  4RUF A;  1R73 A;  1I5Y A;  1TUE B;  1YHQ V;  4MSW C;  3ZIA G;  4WFA V;  2YEV B;  1IXM A;  2EIJ C;  4JYC A;  4JTA B;  4MVS A;  4F4L A;  5EBM C;  3OMI B;  3G4S V;  5EC2 C;  1V55 B;  3QNE A;  2IJH A;  4PA4 A;  3SYC A;  1NH2 D;  3F7V C;  3OAA G;  4P30 A;  2EIN C;  4X88 A;  2JEU A;  3CCS V;  2W6I G;  2WWW A;  4GX2 A;  4P2Z A;  3SPI A;  1VQP V;  1QVF U;  3CP1 A;  4PDV A;  3W7X A;  1RM1 C;  4R7C A;  3P32 A;  3AG4 C;  2H94 A;  1FXK A;  2DQ0 A;  1ENV A;  1G8M A;  2CK3 G;  5IYD O;  3G71 V;  1PL0 A;  3JD3 A;  3STZ C;  4MVZ A;  2X6A A;  4JAU A;  2EZP A;  4QE7 A;  4QIW F;  5IY5 C;  2HVJ C;  2PI4 A;  3W7W A;  3CCQ V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...