5CBFA

Structural and functional characterization of a calcium-activated cation channel from tsukamurella paurometabola
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
b'TLMFKRFFGAVRTSWRDPSTRGAVLSLAIIVTAATIFYTLAEKWSVIDSLFYAVSVGLPMGNGPLSPTLTLSKIFTLVYAILVVGLFVTVGGSLASAIVQNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ion transport 2 domain protein
publication title Structural and functional characterization of a calcium-activated cation channel from Tsukamurella paurometabola.
pubmed doi rcsb
source organism Tsukamurella paurometabola (strain atcc 8368 / dsm 20162 / jcm 10117 / nbrc 1612
molecule tags Transport protein
total genus 30
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5cbfA00
2WLJA 3LDDA 3E8FA 2AHZA 3TCUA 2WLHA 4PA9A 4H37A 4PA3A 1JVMA 3E89A 3RVZA 3LDEA 2EINC 3K08A 2EILC 1J95A 4WFGA 4P9OA 3K0DA 2HFEC 2X6AA 3X2QC 3PJSK 3TETA 3HPLC 4UUJC 3K03A 4R7CA 1KKDA 2IH1C 2WLIB 2DYRC 3RBZA 3ZJZA 4MW8A 3STZC 1LNQA 4MVQA 4EKWA 3F7YC 4RO2A 3K06A 3IFXA 4G27B 2WLNA 4J9YB 4LCUC 2QTOA 4RUFA 4BW5A 4QE9A 1K4DC 2ZXWC 4MVUA 4P9PA 4CBCA 3E8GA 3SYQA 3OGCC 4RUEA 3AG3C 2R9RB 2IH3C 3OUSA 2JK5C 4MTFA 2HVKC 4GX2A 5EBWC 2QKSA 4WFHA 2P7TC 4JTAB 3T2MA 3LUTB 5BZBA 2DYSC 3JYCA 4GX5A 2HG5C 2W0FC 4PA4A 2Q6AA 3STLC 3FB8C 2WLKA 3KG2A 3RVYA 3SJQC 3SYAA 2KB1A 3T1CA 1P7BA 4MSWC 4WFFA 2WLIA 5KUMA 1OCRC 4PDLA 3SYCA 2DWEC 4PA6A 4DXWA 4MW3A 5EK0A 3ASNC 3AG1C 5B1AC 1ZWIC 2EIMC 3LDCA 4P30A 3SPHA 3SYOA 4WFEA 2ITDC 2ITCC 3IGAC 3SPIA 4XDJA 4G28B 1V55C 4ZBMA 3OR6C 4MVOA 4GX1A 4MTOA 1OCZC 4HZ3A 4J9ZB 4JTDB 4R8CA 5E1AC 1G4YB 3ABLC 3T4DA 4HYOA 3WG7C 5B3SC 5CBFA 2HJFC 4X8AA 2Y69C 3E86A 3E8BA 4RAIA 4TWKA 5J9PC 2AHYA 2BOBC 4H33A 1QLEC 3K0GA 2ZD9A 1M56C 3RW0A 1K4CC 2EIKC 4MVMA 3SPGA 3E83A 5B1BC 1OCCC 1XL6A 3UKMA 4MVRA 4PDVA 1S5HC 4LP8A 3AG4C 1R3KC 4X88A 4QE7A 2ATKC 3EFFK 2WLLB 1R3IC 2HVJC 4LBEC 2OCCC 4MTGA 2Q67A 4GX0A 3FB5C 5EBMC 2DWDC 1V54C 3BEHA 5CBGA 3SYPA 3ABKC 4JTCB 3FB6C 1XL4A 4QNHB 2A79B 3OR7C 3OUFA 1R3LC 4R6ZA 4I9WA 4PDMA 3E8HA 4PDRA 2EIJC 4F4LA 5KUKA 2H8PC 3F7VC 4PA7A 3ABMC 3F5WC 4XDLA 2NLJC 3ASOC 2Q68A 3VOUA 3LNMB 1R3JC 2K1EA 1M57C 2YEVA 3SPJA 2A9HA 2WLMA 3AG2C 4MVZA 1ORQC 4MVSA 4P2ZA 5EC1C 3T4ZA 3FB7C 3R65A 3ZRSA 3UM7A 5EBLC 3GB7C 4KFMA 2A0LA 4XDKA 4OXSA 4MS2A 4R50A 5IY5C 2X6CA 5CBHA 2X6BA 4X89A 1OCOC 2WLLA 2Q69A 3K04A 5EC2C 3SPCA 1BL8A 2BOCC
chains in the Genus database with same CATH superfamily
4JI0O 3LDDA 2P06A 1KECA 2Y0PA 2LGWA 3RT3C 1Y4MA 4J7ZA 4JYAB 3FAVA 3WB2A 4WFGA 2EJ7A 3RYIB 3HPLC 4O2BB 3UQ8A 2DYRC 3ZJZA 3STZC 1NVPB 4BIZA 1Q90D 1LNQA 4UXNA 2UUBB 2KG7A 4D6TH 1XOUA 4J9YB 1K4DC 4DR5O 1RFYA 4X1YA 5IE9A 1COWG 3THOA 1OZ0A 1JOYA 3H1IH 1TVKB 2UXBB 5BZBA 1M1KW 1ZSPA 2GUZB 4GKKO 5EIBC 4DYLA 2HKOA 2KB1A 4X62O 4MSWC 3MHHC 2D2CB 1XDCA 1HNXB 1N34O 1OCRC 2YICA 1IURA 2F1MA 4I5SA 4X1KA 1WNSA 2ADPA 3JD1A 4R8CA 3ZMUA 1VF7A 1VQ4V 1K97A 3CHXA 4CH5A 1S5JA 5H6QA 1VQ7V 5KAFZ 2QM4A 1VQ8V 1XQ8A 2JIZG 4UV9A 3SPGA 2QKCA 2AGAA 1PNMA 2CGNA 1TAEA 3OD4A 4DR7O 3JAWB 2F23A 2HVJC 2BTQA 4LBEC 3L9DA 1VQOV 5K1PA 2LFSA 3APOA 3DC5A 5KX5A 1PL0A 4QNHB 2VQFO 4DV6B 4B3TB 4PDRA 1GAXA 1URFA 3KCYA 5CB4B 2P90A 2H8PC 5EZYB 2Q8VA 4FM1A 4LFBB 1VMGA 4I7ZB 3ZHUA 2BOCC 3JARB 4L8JA 2QGNA 2GDSA 4JI2B 3K08A 1RSOA 4HNAA 2CE4A 4DV1B 2JEUA 4R7CA 2IH1C 3I56V 1YI2V 3R66A 5IJ0A 4DO2A 3CCQV 4DR2B 1US6A 4EKWA 4QJFB 2PTMA 1PM9A 3K59A 4LCUC 4KHPO 4IYIA 2ZXWC 1XHXA 1VARA 4YJ3B 4K3AA 1F4NA 3OGCC 3O9OA 3JATB 3JALA 5EBWC 3CRCA 3JYCA 5F2VO 5JQGA 2Y4TA 2B1GA 1VQLV 2GV9A 4GX5A 2DE0X 3STLC 3W7WA 2JDIG 3AG2B 5H9CA 2L6LA 2Y0IA 5LHIA 1NTZH 2QM8A 3G67A 4B3RO 4JAUA 1PNLA 1B04A 2Q0AA 2W6IG 5GONB 3BHPA 4NKGB 4TQFA 4NB5A 1EN5A 4GX1A 4J9ZB 3CB2A 3BPZA 4UVCA 4NR1A 3DC6A 3HKEA 3RYHB 2QWPB 5E79Z 1WAZA 4OX9B 1X4TA 1NKDA 3CC2V 5JJEB 5LYJB 1AILA 4JZGA 4AI8A 3AG4C 1R3KC 4QE7A 3BCCH 3UCSC 5FNVB 3CRQA 3WFVA 3QNEA 3FB5C 1SQXH 2B1IA 2XNDG 4JGSA 3FB6C 1RM1C 4F4LA 4YHHO 3CD6V 3K9SA 3JD0A 4O2AA 2ADQB 1K34A 3K79A 2KG7B 2XAJA 3CRAA 4JV5B 5LP6C 5CBHA 3CXHF 4KXRA 4IIJA 3JD3A 3N27A 1XMOB 3D36C 2JGDA 1OCZB 3CE2A 1K3EA 2UXXA 3ZMSA 4G2KA 2PY5A 1JVMA 1SZTA 1SQVH 2EINC 3BVOA 2DYSB 2EZPA 3BA8A 3X2QC 4O4LA 2Q0OC 1K92A 3J80N 1OCCB 4DR1B 2PGGA 4X1IA 3LSUA 3J7AU 2WLNA 2R9AA 1FKAO 4X1KB 4MVUA 4JI7O 2AZ2A 4ZIBA 4IHJB 4GX2A 1M93A 3T1YB 2ZM6B 1N32B 5LMNB 1S72V 5BR8B 2X0LA 1S3JA 2GTSA 2QKAA 4LF5B 2HHHO 3LNNA 1IXBA 5KUMA 4GLXA 1JJOA 3QVNA 4PA6A 3CCSV 2R70A 2ZQMA 5KX5B 2YIDA 4QPJA 3JD2A 3ABLC 5CBFA 1U97A 2Y69C 3E8BA 2UXNA 2HP8A 2IBZH 3L74H 5LHGA 1XL6A 2DW4A 4TQDA 2UU9O 4LF9O 3BABA 2ATKC 5EBMC 1N33O 3TXQA 2RDCA 3AK1A 3ABKC 1XL4A 1NH2D 1YJWV 1PV0A 4I9WA 1RSOB 3JASB 2YXHA 4HNAB 3C90A 3F7VC 1E1RG 5FPOA 2P67A 2NLJC 1MSDA 3B8MA 5IJ0B 4Z1VA 4W4LA 3HKDB 1Q8IA 4JI5O 2DQ3A 2EBOA 4TUYA 4OXSA 3VBBA 1IBLO 1NBMG 2Q69A 3AG3B 1AB3A 4U7OA 3JALB 5EIBD 3CC7V 3SJBC 4D7SA 4UFZA 1Q3EA 4OPAA 3RYFB 4LNUB 3K03A 1N0NA 2V7QG 4X64O 1SZXA 4I0XB 3CP1A 3FD9A 3AEIA 5JWPA 4DUYO 2OCCB 4RUEA 1I94B 3ABUA 3HKEB 5TISZ 4TV9A 4WFHA 3ZCCA 4LF4B 2E5LB 3LUTB 3OTOO 1AP5A 3ZHSA 5JH7A 2WLKA 3RVYA 1M57B 3OGIB 2ZDIC 2WLIA 5IYCO 4FLVA 4DXWA 1GKFA 4FVMA 2CGOA 2FTKA 4LF6O 3HKBA 5LMUO 3SPIA 3IGAC 4O4IA 4DV2O 1N4CA 5LGNA 4DV4B 4JTDB 1XMQB 3QO5A 2IW5A 4X8AA 4FM0A 3ZIAG 1I7FA 4H33A 4JI3B 1VQPV 1Y6XA 2YI8A 4O2AB 4CH4A 3F5TA 4DW0A 1H2NA 1AP6A 4FFKA 4DK1A 2CTPA 5CA3A 1AJNA 3IC7A 2ZKOA 4FZ1A 4IIJB 1F23A 2XAFA 3JCUZ 1KMIZ 4TOIA 5CMUA 2JGDB 1D2DA 1J5EB 4CS2A 2JS3A 5D5QA 3OUFA 2E3CA 4LF8O 1KKCA 1UFIA 4K0KO 5KMGB 3SJAC 1FXVA 4FFBA 1YHQV 4O4LB 3CRMA 4MTXA 4GKJB 4MVZA 4X1IB 2RQ6A 1AI6A 4ASUG 5IY5C 4WF9V 3H01A 4DV7O 3B77A 1GTOA 4O4JA 1MA1A 1FYJA 3E8FA 4PA3A 5JVDB 1TUEB 1THZA 3RVZA 4LWSA 1QNMA 1GN2A 2W6JG 4PJ0Z 2CH7A 3RBZA 1JPXA 4Q20A 4LC1A 4EEQA 1JX9A 1YVWA 3JD4A 2E74B 2UUAB 2P4VA 1VIBA 4ICGA 1WP8A 2Q7EA 2QDOA 5B66Z 1QLEB 5L3CA 1ZTEA 5FLXN 4YY3O 3FX7A 2BSKA 3M8AA 1F7YA 1VQ5V 3N2KA 3TXSA 4X20A 1FFTB 4ZBMA 3OMAB 3CCEV 3MDSA 3WG7C 4NXNB 1MG1A 3E22B 3SR2C 5GW7A 4RQFA 1YIJV 2BOBC 3OE7G 4J10A 4NXMB 3K0GA 2ZD9A 2P6JA 5IYZA 4EB6A 1Q5OA 4TUYB 1Y76B 1F4MA 5FL7G 3TJTA 3T1HO 2X7RB 2BE3A 4DR6B 1SETA 3TGUH 3GWOA 1GO3F 3OT7A 3UO3A 3E2EA 1QVGU 2V4DA 1NR7A 4J80A 4AHCA 2VQEO 3ZHVA 2PYJA 4O4HA 5IWAO 2YS8A 4DW1A 1MZEA 1VQ6V 4DR3O 4DR4O 1LUWA 3ZX6A 1AVMA 4QGPA 3UT5A 2WLLA 3H1HH 4B3MO 3BAAA 1KBHA 4JASA 2R72A 1F51A 5LA6A 4U3FH 3G71V 1VQMV 1J95A 1EBOA 5JH7B 4C7UA 3TETA 1FS0G 2NN4A 3MD0A 2WLIB 1FXKA 2Z3YA 3ZMTA 3MHSC 4MVQA 3K5MA 3OMNB 3K06A 3TK1A 1AR4A 5B1AB 5LGTA 2QA4V 1S76D 2MW2B 3IC9A 2LFRA 4ZI7A 4FK5C 2AXTZ 1XREA 2EIJB 2DYSC 2DJVA 3B4SA 2ARHA 5CA1A 1L0LH 1GN6A 4JYAO 1H8EG 1YCIA 3OMIB 4H13B 4UCUA 4JI0B 2VWKA 2HJDA 4UCSA 1HNZO 4MVOA 1MABG 1M9NA 2YIBA 5KA5A 5CA0A 2CUGA 3CSXA 2JS5A 4FFBB 1VF5B 1GN3A 2FL4A 1W0JG 2IJHA 4JYYA 4DR5B 1AROP 4F6EA 1BE3H 2UXCB 4CH6A 1HNXO 4F6RA 1K7DA 4JPRA 2QJ1A 1VQKV 2NNUA 4GKKB 2Q4PA 1R3LC 3A8TA 4LWSB 3CCUV 3E8HA 4X62B 1N34B 5KUKA 3F5WC 2YEVA 1SF9A 3Q4HB 2F66C 3FB7C 3AG1B 3I5DA 3UM7A 3QG5A 4UCTA 2N74A 5DM6V 5EC2C 4LF7O 4YXWG 1HR0O 4LFCO 3LDEA 3CPWU 1NJIW 1NVPD 2ZE8A 2CAZC 1Q6IA 4DR7B 4FZ0A 1XUQA 2LW7A 5DECA 2BSKB 4K8XA 1FFXA 2GHYA 3B09A 4GYCB 2EZOA 3ASNB 2VQFB 4X20B 4YIOA 1XEQA 4B08A 2Y4UA 5KHHA 1V54B 2D3OW 3AG3C 1B3QA 1K8AW 1R6KA 3G6BA 2ZR2A 1Y74A 1RPOA 1NU1H 2IJKA 5IYZB 3KG2A 3KKYA 2EIKB 2M6YA 2PYLA 1ENVA 4PDLA 3W7UA 1ZUQA 5EK0A 2QWNB 1UJWB 1VF6C 1TA8A 5H5NA 1GMGA 1YJ9V 4G28B 3CMAV 3SGIA 3HKCB 1L8DA 1IXMA 1GN4A 3EXAA 2QSAA 3P3NA 4RQEA 3APQA 3SDLA 4YJ2A 3OTFA 5B1BC 3D3QA 2AZ0A 2LW1A 5KHIA 2WLLB 3BY6A 3CJHA 4MTGA 2Q67A 4GX0A 1G6UA 5C93A 5J2TA 5LA6B 1EN6A 2YXLA 1KQSU 3DSQA 5ITZA 2A7WA 4B3RB 1WA8B 1FXKB 3VOUA 1AR1B 4OX9O 3B8NA 2NR5A 2X6CA 2UXDO 2X6BA 1H8HG 4X89A 5LL6Y 1Q6UA 2WLHA 4H37A 2QTSA 1SS3A 3WB1A 1QR8A 3FAVB 3BA9A 1Z2GA 4GCZA 2X6AA 5CA1B 5LOVA 5JCOC 4UCVA 3F7YC 1V9PA 3CRRA 3GWKC 4PHZA 4QE9A 4CBCA 1XI1A 4X1YB 1MNGA 1SESA 1FXHA 2G38A 2IH3C 4LR3A 1O9GA 5CA0B 3W7XA 4I50A 4YHHB 2XTAA 4JV5O 1MZFA 2N04A 5A2QN 2OCHA 3FB8C 1P7BA 4DV5O 4UB6Z 1BQZA 4NVPA 4PI0A 4DRXA 3E35A 3SYOA 3FFQA 1H2LA 4LFAO 5IJ9A 1G4YB 3RYCA 1JJ2U 2GBOA 2AHYA 1QLEC 3PN1A 1BSMA 4BR6A 1HNWO 2YEVB 3W7TA 5H2FZ 3I55V 2AW9A 4JI4O 1S5HC 1XNRO 5LP6A 4FIPC 2IJJA 2BTQB 4XBFA 3D36A 3BEHA 3L75H 5L3DA 2YUAA 2YSUB 1JMKC 2HHHB 5L3BA 1H2MA 2Q68A 3SPJA 1FFXB 2WLMA 1YTFB 1K33A 5EC1C 1JFFA 1X59A 4XDKA 1OHHG 2FYUH 4IYHA 1DGSA 3ETEA 1EZVH 4JF3A 1N36O 1B6QA 1XILA 2UU9B 4LF9B 1KKDA 3OAAG 3QO8A 4L87A 1N33B 4RO2A 4RWUA 4X65O 1WPBA 3CS5A 3D8CA 5C8YA 4HAMA 3OUSA 2CDYA 1CXZB 2HVKC 5JQGB 1P49A 2HEPA 4JI5B 2P5OA 3CCLV 1H2SB 1YEWA 1SQPH 3J81N 1IBLB 1Y67A 2L35A 4PD4F 5B1AC 4PV1B 3CJHB 4WFEA 2ITCC 3FYEB 1V55C 2XT9A 5J2TB 4MTOA 5KA6A 4DV3B 4HYOA 2H94A 2Q9LA 5ITZB 4X64B 1QCEA 2OT5A 2E5LO 4DUYB 2Z0AA 1FPOA 4U7NA 5JJNB 1GM7A 2ZE6A 4JI6O 2OIGA 4LP8A 1ZAUA 1HDJA 4K35A 2ZXWB 5BMVA 1Q82W 2H3OA 1SKVA 1BCCH 1R3IC 4AQYO 1MMMA 1S0VA 2RN9A 3SYPA 3OTOB 5CN0A 4OPHA 1YDXA 5KAIZ 4U3JA 2F95B 1XNQO 1ZLZA 4DV4O 4UCRA 1XMQO 1Q43A 5LOVB 1QR9A 3JCZA 2K1EA 4LF6B 5LMUB 2A9HA 4FLYA 4ZKIA 3C3SA 3R65A 1N0JA 4DV0O 1KC8W 2DOSA 1NT2B 4I50B 2WA4A 4B3SO 2WSSG 1ZX3A 2XUMA 2ZNIA 3U11A 4PI2A 4O2BA 4D7TA 2C2AA 2GSMB 2ZDIA 2PI4A 1IBMO 3ZN1A 3AG7A 5IT9N 3VQXA 2KKWA 4JAAA 1XBLA 4LF8B 3C3TA 4JI1O 1W0KG 3ZHTA 4K0KB 5IJ9B 1IBKB 5GTHZ 2QKSA 2YC0A 3RYCB 1B06A 1TVKA 1EM1A 1H2KA 1SRYA 1Q86W 1M56B 1O9HA 4LH7A 4CS3A 4UVAA 2Q73A 4CZZA 4A5UB 3CCMV 4X9QA 2CTQA 3ASNC 5LP6B 4FLUA 4P30A 3K5OA 4XDJA 4TSFG 1YZBA 1R6TA 3K9AA 2LGQA 2EJRA 4E2LA 1JCHA 2YIAA 1WP7A 1AJQA 2RJZA 3X2QB 3ABMB 2P22C 2ZNJA 2JJ2G 2EIKC 1JFFB 3OEEG 4MVRA 3ZMVA 4H0LB 2PF4E 2YI9A 4FLZA 1WJZA 3CC4V 1QU7A 3FKSG 5IYBO 4FJCC 1BS3A 1WB7A 5CB4A 5D5PA 4PA7A 2UUCO 1MSWD 4DUZO 2RNBA 3AG2C 4MVSA 4ZOLA 3RFRA 1NI8A 1YJNV 3K04A 5B5EZ 1JA8A 3LSSA 5LGUA 3E89A 5DEDA 1MOFA 3CCVV 1AI4A 3A0RA 2HLDG 4DK0A 1EZJA 4MW8A 3T1HB 1BMFG 4BW5A 1CP9A 2EIMB 2QTOA 5H6RA 3ETQA 4YJ3A 4X66O 3ABKB 2JK5C 4MTFA 3JATA 4TV9B 2VQEB 1NR1A 2VRZA 1ZL8A 1L1FA 4PA4A 4DR3B 4DR4B 1FJGO 3SYAA 3T1CA 4WFFA 3GVMA 2F4VO 3JAMN 4B3MB 2DWEC 2JVDA 5BMVB 1DTOA 3LDCA 4JI8O 3HKBB 4J7KA 4O4IB 4HBNA 1IX9A 1OCZC 4U3JB 5KHKA 4JYCA 2N05A 3RYHA 1SA0A 1H38A 3JSLA 1SQFA 5L3EA 3E83A 3EHBB 4IT5A 5EYPA 1I5YA 1QBZA 1OCCC 5LYJA 5A9GA 3H1LH 1GK9A 1WB8A 3EFFK 5FNVA 1OCOB 3G4SV 3ABTA 5LXTA 3IJ4A 2UUBO 4BW9A 3CEIA 4J11A 2B9ZA 1QHTA 1GM8A 1Q6HA 5J2UA 4PDMA 2EILB 4Q6GA 3OEHG 4J41A 4XDLA 4WFBV 2ZINA 1N8RW 3CWBH 2UXBO 2ZE5A 4ZHQA 1HNZB 4TV8A 1TUBA 2LO1A 3T4ZA 4Z2WA 3M7MX 1D5NA 1Q7YW 2UXCO 4O4JB 3TCUA 2XHBA 2RCVA 1T5EA 1G1XB 4FLWA 3P30A 4NTYA 3K0DA 2HFEC 4K8ZA 2CH7B 4I4TA 1P84F 3CYOA 4NYKA 2KSDA 4GUNA 3ETGA 4IHJA 3AK3A 2E75B 4KL1A 2WA3A 5B1NA 1EFRG 5FPRA 3D3IA 3VQWA 4DV6O 4B3TO 2QWOB 2ZE7A 2R9IA 1RPRA 5IY5B 4LF7B 2RMKB 4PELA 3N2KB 3H1KH 4B7KA 3K57A 1HR0B 2DQ0A 1VEWA 2ITDC 4LFCB 4GT1A 4UCOA 4LFBO 3QTCA 3A2FA 2Q7HA 2YXYA 4RAIA 5J9PC 1K9MW 1KYOF 1L0NH 4JI2O 4I55A 1PKXA 2QR4A 4EB6B 4ZOLB 1LR1A 4UV8A 1KP2A 4DV1O 4FM2A 3JSNA 3EVKA 1K5QA 2FB5A 4IGGA 3CCJV 2OCCC 4DR2O 4BIUA 1BT8A 3S3WA 1PPJH 2A79B 3OR7C 5HFMA 1M90W 1QQCA 2DN9A 3JASA 2ILMA 1P4RA 3WU2Z 1FAFA 2VS0A 1NQTA 1M57C 4O4HB 4KHPB 3K5LA 2W0XA 2OTJV 3HKDA 1I5XA 3AK2A 1PNKA 2PUSA 3CXCU 3UT5B 1E1QG 3SPCA 3WG7B 3B40A 3CMEV 1ZL8B 1GH6A 2QE7G 1TGOA 3ZMZA 3OFNG 3RYFA 4LNUA 4Z1MG 3ETDA 3H9VA 4TT3G 2JRIA 4I0XA 1CPYA 1K5SA 1VF6A 4G27B 3BFRA 4E4EA 1D5AA 2A06H 3OW2U 4ZI7B 4FLTA 3ZRWA 5B3SB 2WAMA 1SA0B 4JYBA 2QWQB 2DMXA 1K73W 2JEXA 1R6NA 4N23A 3SJQC 5LBQA 3LSQA 2UXDB 5EYPB 1W2BU 2IU3A 5K1XA 3KCXA 1ZWIC 1IVSA 1HWYA 5LXTB 1PP9H 1XHZA 2CTWA 5J2UB 2HJFC 4LH6A 1XMOO 2LJ2A 4GZRB 3ML0A 3VQVA 2BTOA 3ASOB 1M56C 1R73A 4ZHQB 3L71H 4TV8B 1TUBB 3UO2A 1KD1W 3UKMA 2A3QA 4X88A 3L73H 4F6RB 2ZR3A 4DR1O 3HR0A 1KB9F 3NXSA 5AG2A 2ZIMA 3S3XA 1Y66A 4DV5B 1AR5A 1NH2B 5KMGA 3ABMC 4JAVA 4I4TB 3T1YO 5BY1A 3U10A 2ZM6O 1N32O 5LMNO 1R3JC 4BWAA 2DYRB 5BR8O 1SC5B 1SQGA 1KUQA 5JCOA 2CTRA 4JI7B 4LFAB 3ZRSA 2A0LA 3ZS8C 4R50A 1VQ9V 3K58A 4LF5O 1KP3A 3DTUB 2QEXV 1M5IA 2LP7A 4H44B 2WLJA 1HNWB 2Q5ZA 4KP4A 5JVDA 2YDEA 3RGBA 2EX3A 4JI4B 2MK3A 1AI7A 2IJIA 2M7WA 1XNRB 3VQYA 4UB8Z 1OCRB 3ZRXA 2YIBD 3H1JH 4RUFA 4P9PA 3RWRD 1YITV 3E8GA 2O57A 3HB3B 4OGQB 5IYDO 1Y74B 2W0FC 2Q6AA 4I55B 4J42A 2QWRB 5KHGA 3SYCA 1ROPA 4MT8A 2EIMC 1FD9A 2ZIOA 1WN7A 1AI5A 3OR6C 1N36B 1Z5WA 3DGEA 4FPPA 2OYQA 3G80A 3E22A 3KZIZ 5IDJA 3B2EE 2KQXA 3ZEDA 4X65B 1S77D 3N2GA 1K4CC 4N21A 4YIPA 4MVMA 4YJ2B 3CX5F 4CC5A 1I0HA 1Y76A 5GTIZ 1EN4A 2WWWA 2IU0A 1SQBH 1E79G 4BAYA 4WBNA 3CCRV 2EIJC 4UVBA 1YXBA 3M99B 4DV3O 1BGYH 4ABMA 2EULA 1I94O 3RN4A 1YTFD 1PD3A 4LF4O 3L70H 1RP3B 2BCCH 4KFMA 4MS2A 4NTXA 1KU9A 1OCOC 1DK1A 3JAKA 3ZRWB 4PA9A 2EILC 3A0BZ 4P9OA 4JI6B 3PJSK 4UUJC 2Y48A 1NTKH 5B1BB 1DF5A 1WPXA 4QIWF 4AQYB 4JI3O 4DV2B 3IAYA 1SQQH 3IFXA 3A0HZ 1AJPA 3DXRA 1Q81W 3SYQA 1XNQB 4BIOA 2R9RB 4J7JA 2P7TC 2K9PA 4JTAB 5BXZA 3K5NA 3MAQA 1BHBA 1J5EO 4I9QA 2QM7A 1VQNV 1YF2A 5L3GA 1JR9A 4DV0B 3RYIA 3QF7A 4DRXB 2F93B 3AG1C 3AG4B 2IM9A 4B3SB 4GKJO 1NZ6A 1P7GA 5JJJB 2XASA 1HP8A 2XOKG 5E1AC 1RM1B 5LHHA 3ICXA 4TWKA 1IBKO 1IBMB 1YSCA 2GUZA 1G8MA 1I08A 2LQTA 3W7SA 4JI1B 4DV7B 1NTMH 2WPDG 3L72H 1IDSA 4PDVA 1M4UA 2DWDC 1V54C 4JZ2A 1HW7A 5B1OA 4JTCB 4CS4A 4IL6Z 5KHJA 2UUAO 2OIEA 2EINB 1GM9A 4EFEA 2ZCEA 1U96A 2CK3G 1LUVA 3LNMB 1ORQC 4P2ZA 2XAHA 3Q4HA 2JJ1G 2JGUA 3BRCA 4B7EA 3GB7C 3ZHRA 5L3FA 3JAWA 1BL8A 3O65A 2AHZA 1BZKA 4CC6A 3ZBHA 4YY3B 1DLBA 1CEZA 1R1BA 4NXNO 1H2GA 3ZRVA 3ZHQA 5EZYA 5HFLA 2VWJA 1SERA 1Z5VA 4NXMO 3WB0A 3OM3B 2PZSA 1NS1A 4EFBA 5C8YB 2E76B 2ZT9B 1BHAA 2P4KA 2OTLV 3JARA 1QLNA 2HR3A 3ABLB 2UUCB 2V1DA 4DUZB 3G6EV 2Z5UA 2Y69B 3T2MA 1A32A 5DN6G 4DR6O 2HG5C 2ODMA 3N2GB 2F43G 1FXKC 1IZ3A 2B5UA 3SJCC 4FLXA 1GRJA 2OWOA 4MW3A 3SPHA 3QO7A 4NTWA 4HZ3A 3FYIB 3T4DA 4WBNB 3HKCA 4AILC 5B3SC 1OV9A 3E86A 5IWAB 4W4KA 4WCEV 4WFAV 3RW0A 2ETNA 2XAGA 1W59A 2PI5A 4X66B 5KLVH 2FKXA 5GONA 2XAQA 4CH3A 3JAKB 3K3WA 5CBGA 3NR7A 1VP7A 1PL4A 2FMLA 1FJGB 4R6ZA 1S5LZ 2F4VB 1WLEA 2Q7GA 3P3PA 4QPKA 4FMTA 1JQ0A 3ASOC 1WA8A 3ZN0A 4JI8B 3U0ZA 1OJHA 2GTAA 1UPGA 5EBLC 1DF4A 1BQ0A 3DXRB 1QVFU 1V55B 3P32A 4KUMA
chains in the Genus database with same CATH topology
3LDDA 3E8FA 3CMEV 4PA3A 1KECA 1TUEB 1THZA 3RVZA 1Y4MA 2QE7G 4JF3A 4WFGA 1B6QA 3ZMZA 2W6JG 3OFNG 3HPLC 4Z1MG 1KKDA 3OAAG 3QO8A 2DYRC 1JPXA 3ETDA 3RBZA 3ZJZA 4Q20A 4L87A 3STZC 4LC1A 4BIZA 1NVPB 1LNQA 4TT3G 4UXNA 4RO2A 1JX9A 3JD4A 1CPYA 1K5SA 4G27B 4J9YB 1K4DC 4HAMA 3OW2U 1COWG 3OUSA 2HVKC 3ZRWA 5B3SB 2WAMA 1OZ0A 1JOYA 4JYBA 5BZBA 1M1KW 1QLEB 1K73W 3WG7B 5L3CA 2JEXA 3CCLV 2HKOA 1R6NA 4N23A 3SJQC 5LBQA 2KB1A 3LSQA 4MSWC 3MHHC 1W2BU 2IU3A 1OCRC 1VQ5V 5B1AC 1ZWIC 4I5SA 1HWYA 4WFEA 2ITCC 1FFTB 3FYEB 1V55C 4ZBMA 3OMAB 4MTOA 3CCEV 5KA6A 3JD1A 4R8CA 3WG7C 3ZMUA 1MG1A 4HYOA 2H94A 2HJFC 5GW7A 4RQFA 1YIJV 1VQ4V 2BOBC 3ML0A 1K97A 3OE7G 1QCEA 2OT5A 3K0GA 5H6QA 1VQ7V 2ZD9A 3ASOB 1M56C 2P6JA 1VQ8V 2JIZG 4UV9A 1R73A 3SPGA 4U7NA 1GM7A 1PNMA 1KD1W 3UKMA 4LP8A 2ZXWB 1Q82W 4X88A 1F4MA 5FL7G 1R3IC 2HVJC 4LBEC 1VQOV 2ZR3A 1S0VA 2X7RB 2LFSA 1PL0A 1SETA 5CN0A 3SYPA 3GWOA 3NXSA 1GO3F 4QNHB 4PDRA 1Y66A 2P90A 3E2EA 1NH2B 2H8PC 1QVGU 3ABMC 4JAVA 1NR7A 1QR9A 3JCZA 1R3JC 2K1EA 2DYRB 2A9HA 1VQ6V 4ZKIA 3R65A 3ZRSA 2A0LA 4R50A 1VQ9V 1KP3A 3DTUB 2QEXV 1KC8W 2LP7A 2WLLA 2BOCC 2WLJA 4JASA 1F51A 2WSSG 4KP4A 3G71V 3K08A 1VQMV 1J95A 1EBOA 2MK3A 3TETA 1FS0G 1AI7A 2IJIA 2JEUA 2M7WA 3MD0A 2IH1C 2WLIB 2C2AA 4R7CA 1FXKA 2GSMB 2ZDIA 2Z3YA 3ZMTA 3I56V 1YI2V 2PI4A 3MHSC 4DO2A 3CCQV 4MVQA 3ZN1A 1OCRB 4EKWA 4QJFB 3ZRXA 3OMNB 3K06A 3TK1A 4RUFA 5B1AB 4LCUC 2ZXWC 5LGTA 4P9PA 2QA4V 1YITV 1W0KG 3E8GA 1F4NA 3OGCC 1S76D 3HB3B 2LFRA 4FK5C 2QKSA 5EBWC 5IYDO 2EIJB 2DYSC 3JYCA 2B1GA 1VQLV 4GX5A 2W0FC 2Q6AA 1SRYA 3STLC 1Q86W 3W7WA 1M56B 2JDIG 3AG2B 4UVAA 5H9CA 5LHIA 1H8EG 4CZZA 2QM8A 3OMIB 1PNLA 4JAUA 3CCMV 3SYCA 3ASNC 1ROPA 2W6IG 4MT8A 4P30A 2EIMC 4XDJA 4TSFG 1AI5A 3OR6C 4MVOA 1MABG 1M9NA 4GX1A 5KA5A 4J9ZB 3DGEA 4FPPA 3K9AA 4UVCA 2EJRA 4E2LA 1JCHA 5IDJA 1AJQA 3X2QB 3ABMB 1S77D 2JJ2G 1W0JG 1K4CC 2EIKC 2IJHA 4MVMA 4N21A 1NKDA 3CC2V 1AROP 3OEEG 4MVRA 3ZMVA 3AG4C 1R3KC 4QE7A 3WFVA 3CC4V 3QNEA 3FB5C 2B1IA 1K7DA 2WWWA 2XNDG 4JPRA 2IU0A 4JGSA 1VQKV 2NNUA 3FB6C 3FKSG 5IYBO 1RM1C 1E79G 4FJCC 4BAYA 3CCRV 1R3LC 3CCUV 3E8HA 2EIJC 4UVBA 4F4LA 3M99B 5KUKA 4PA7A 3CD6V 3F5WC 1YTFD 3JD0A 1MSWD 1PD3A 2YEVA 1K34A 3AG2C 4MVSA 3K79A 3FB7C 2XAJA 3AG1B 3UM7A 4KFMA 4MS2A 5DM6V 5CBHA 3JD3A 1YJNV 1OCOC 3K04A 5EC2C 3P32A 1OCZB 1K3EA 2UXXA 3LSSA 3ZRWB 5LGUA 3ZMSA 4G2KA 4YXWG 4PA9A 1JVMA 3E89A 1SZTA 1MOFA 3LDEA 3CCVV 3CPWU 2EINC 2DYSB 2EILC 2EZPA 1NJIW 1AI4A 4P9OA 1NVPD 3X2QC 3PJSK 3A0RA 4UUJC 1K92A 2Y48A 2HLDG 5B1BB 1EZJA 1DF5A 1WPXA 4MW8A 4QIWF 1OCCB 2GHYA 1BMFG 2EZOA 3IFXA 3ASNB 4BW5A 1CP9A 2WLNA 2EIMB 2QTOA 5H6RA 4MVUA 1AJPA 1V54B 1Q81W 3SYQA 2D3OW 3ABKB 3AG3C 2R9RB 2JK5C 4MTFA 4GX2A 2P7TC 1K8AW 1R6KA 4JTAB 1NR1A 1S72V 1L1FA 2X0LA 2ZR2A 1S3JA 1BHBA 1RPOA 4PA4A 2IJKA 2QM7A 3KG2A 3SYAA 1VQNV 5L3GA 3T1CA 2EIKB 4WFFA 5KUMA 1ENVA 4PDLA 2DWEC 4PA6A 3W7UA 5EK0A 1DTOA 1UJWB 3CCSV 3AG1C 3AG4B 3LDCA 2XASA 1GMGA 2XOKG 2ZQMA 4G28B 1YJ9V 1OCZC 4QPJA 4JYCA 5E1AC 3JD2A 3CMAV 3ABLC 1RM1B 5CBFA 5LHHA 2Y69C 1IXMA 3E8BA 4TWKA 2UXNA 1YSCA 1H38A 1G8MA 3W7SA 4RQEA 5L3EA 3E83A 5B1BC 3EHBB 1I5YA 1QBZA 5LHGA 1OCCC 1XL6A 2WPDG 2DW4A 4PDVA 1GK9A 2ATKC 3EFFK 2WLLB 3BY6A 4MTGA 1OCOB 2Q67A 4GX0A 5EBMC 2DWDC 1V54C 5C93A 3G4SV 3ABTA 5B1OA 3ABKC 4JTCB 1XL4A 1NH2D 1YJWV 1GM8A 4I9WA 4PDMA 2EINB 1GM9A 2EILB 1KQSU 3F7VC 3OEHG 1E1RG 4XDLA 4WFBV 2P67A 2NLJC 2CK3G 1N8RW 1FXKB 3B8MA 3LNMB 3VOUA 1AR1B 1ORQC 4P2ZA 2XAHA 2JJ1G 3T4ZA 2DQ3A 2EBOA 3GB7C 4OXSA 3B8NA 2X6CA 3VBBA 5L3FA 2X6BA 1H8HG 1NBMG 4X89A 1Q7YW 2Q69A 1BL8A 3AG3B 4U7OA 2AHZA 3TCUA 2WLHA 4H37A 3CC7V 1DLBA 1QR8A 1CEZA 3P30A 1H2GA 2HFEC 2X6AA 3K0DA 4GCZA 3ZRVA 5HFLA 1SERA 3K03A 2V7QG 3F7YC 3OM3B 3CP1A 3AEIA 4QE9A 2OCCB 3CYOA 4CBCA 1BHAA 3ETGA 2OTLV 1SESA 1FXHA 4RUEA 2IH3C 3W7XA 3ABUA 1QLNA 2HR3A 3ABLB 2V1DA 4WFHA 3ZCCA 3G6EV 2Z5UA 5B1NA 2Y69B 3LUTB 3T2MA 1EFRG 5DN6G 2HG5C 2F43G 3FB8C 2WLKA 3RVYA 3D3IA 1M57B 1P7BA 1FXKC 2B5UA 2ZDIC 2WLIA 5IYCO 2R9IA 1RPRA 1GKFA 4DXWA 5IY5B 4MW3A 4PELA 3E35A 3SPHA 2FTKA 3SYOA 2DQ0A 2ITDC 3IGAC 3QO7A 3SPIA 4GT1A 5LGNA 4HZ3A 3FYIB 4JTDB 3QO5A 3T4DA 1G4YB 2IW5A 5B3SC 4X8AA 3ZIAG 3E86A 4RAIA 5J9PC 1K9MW 1JJ2U 2AHYA 4H33A 1QLEC 1VQPV 4WCEV 4WFAV 2YEVB 3RW0A 2XAGA 1PKXA 3W7TA 3I55V 2PI5A 5CA3A 1AJNA 3IC7A 4UV8A 1KP2A 1S5HC 1K5QA 2XAQA 1F23A 2IJJA 2XAFA 4FIPC 5CMUA 3CCJV 2OCCC 4XBFA 3K3WA 3D36A 3BEHA 4BIUA 5CBGA 5L3DA 2YSUB 5HFMA 2A79B 3OR7C 3OUFA 4R6ZA 5L3BA 1M90W 1WLEA 1YHQV 1FXVA 4QPKA 4FMTA 4MTXA 1JQ0A 3ASOC 3ZN0A 1P4RA 2Q68A 1NQTA 1M57C 3SPJA 4MVZA 2WLMA 1YTFB 2OTJV 1K33A 5EC1C 1AI6A 4ASUG 1I5XA 5EBLC 4XDKA 5IY5C 1DF4A 1OHHG 4WF9V 1PNKA 3H01A 1QVFU 3CXCU 1V55B 1E1QG 3SPCA 1GTOA 3ETEA 3B77A 4KUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLJ A;  3LDD A;  3E8F A;  2AHZ A;  3TCU A;  2WLH A;  4PA9 A;  4H37 A;  4PA3 A;  1JVM A;  3E89 A;  3RVZ A;  3LDE A;  2EIN C;  3K08 A;  2EIL C;  1J95 A;  4WFG A;  4P9O A;  3K0D A;  2HFE C;  2X6A A;  3X2Q C;  3PJS K;  3TET A;  3HPL C;  4UUJ C;  3K03 A;  4R7C A;  1KKD A;  2IH1 C;  2WLI B;  2DYR C;  3RBZ A;  3ZJZ A;  4MW8 A;  3STZ C;  1LNQ A;  4MVQ A;  4EKW A;  3F7Y C;  4RO2 A;  3K06 A;  3IFX A;  4G27 B;  2WLN A;  4J9Y B;  4LCU C;  2QTO A;  4RUF A;  4BW5 A;  4QE9 A;  1K4D C;  2ZXW C;  4MVU A;  4P9P A;  4CBC A;  3E8G A;  3SYQ A;  3OGC C;  4RUE A;  3AG3 C;  2R9R B;  2IH3 C;  3OUS A;  2JK5 C;  4MTF A;  2HVK C;  4GX2 A;  5EBW C;  2QKS A;  4WFH A;  2P7T C;  4JTA B;  3T2M A;  3LUT B;  5BZB A;  2DYS C;  3JYC A;  4GX5 A;  2HG5 C;  2W0F C;  4PA4 A;  2Q6A A;  3STL C;  3FB8 C;  2WLK A;  3KG2 A;  3RVY A;  3SJQ C;  3SYA A;  2KB1 A;  3T1C A;  1P7B A;  4MSW C;  4WFF A;  2WLI A;  5KUM A;  1OCR C;  4PDL A;  3SYC A;  2DWE C;  4PA6 A;  4DXW A;  4MW3 A;  5EK0 A;  3ASN C;  3AG1 C;  5B1A C;  1ZWI C;  2EIM C;  3LDC A;  4P30 A;  3SPH A;  3SYO A;  4WFE A;  2ITD C;  2ITC C;  3IGA C;  3SPI A;  4XDJ A;  4G28 B;  1V55 C;  4ZBM A;  3OR6 C;  4MVO A;  4GX1 A;  4MTO A;  1OCZ C;  4HZ3 A;  4J9Z B;  4JTD B;  4R8C A;  5E1A C;  1G4Y B;  3ABL C;  3T4D A;  4HYO A;  3WG7 C;  5B3S C;  5CBF A;  2HJF C;  4X8A A;  2Y69 C;  3E86 A;  3E8B A;  4RAI A;  4TWK A;  5J9P C;  2AHY A;  2BOB C;  4H33 A;  1QLE C;  3K0G A;  2ZD9 A;  1M56 C;  3RW0 A;  1K4C C;  2EIK C;  4MVM A;  3SPG A;  3E83 A;  5B1B C;  1OCC C;  1XL6 A;  3UKM A;  4MVR A;  4PDV A;  1S5H C;  4LP8 A;  3AG4 C;  1R3K C;  4X88 A;  4QE7 A;  2ATK C;  3EFF K;  2WLL B;  1R3I C;  2HVJ C;  4LBE C;  2OCC C;  4MTG A;  2Q67 A;  4GX0 A;  3FB5 C;  5EBM C;  2DWD C;  1V54 C;  3BEH A;  5CBG A;  3SYP A;  3ABK C;  4JTC B;  3FB6 C;  1XL4 A;  4QNH B;  2A79 B;  3OR7 C;  3OUF A;  1R3L C;  4R6Z A;  4I9W A;  4PDM A;  3E8H A;  4PDR A;  2EIJ C;  4F4L A;  5KUK A;  2H8P C;  3F7V C;  4PA7 A;  3ABM C;  3F5W C;  4XDL A;  2NLJ C;  3ASO C;  2Q68 A;  3VOU A;  3LNM B;  1R3J C;  2K1E A;  1M57 C;  2YEV A;  3SPJ A;  2A9H A;  2WLM A;  3AG2 C;  4MVZ A;  1ORQ C;  4MVS A;  4P2Z A;  5EC1 C;  3T4Z A;  3FB7 C;  3R65 A;  3ZRS A;  3UM7 A;  5EBL C;  3GB7 C;  4KFM A;  2A0L A;  4XDK A;  4OXS A;  4MS2 A;  4R50 A;  5IY5 C;  2X6C A;  5CBH A;  2X6B A;  4X89 A;  1OCO C;  2WLL A;  2Q69 A;  3K04 A;  5EC2 C;  3SPC A;  1BL8 A;  2BOC C; 
#chains in the Genus database with same CATH topology
 4JI0 O;  3LDD A;  2P06 A;  1KEC A;  2Y0P A;  2LGW A;  3RT3 C;  1Y4M A;  4J7Z A;  4JYA B;  3FAV A;  3WB2 A;  4WFG A;  2EJ7 A;  3RYI B;  3HPL C;  4O2B B;  3UQ8 A;  2DYR C;  3ZJZ A;  3STZ C;  1NVP B;  4BIZ A;  1Q90 D;  1LNQ A;  4UXN A;  2UUB B;  2KG7 A;  4D6T H;  1XOU A;  4J9Y B;  1K4D C;  4DR5 O;  1RFY A;  4X1Y A;  5IE9 A;  1COW G;  3THO A;  1OZ0 A;  1JOY A;  3H1I H;  1TVK B;  2UXB B;  5BZB A;  1M1K W;  1ZSP A;  2GUZ B;  4GKK O;  5EIB C;  4DYL A;  2HKO A;  2KB1 A;  4X62 O;  4MSW C;  3MHH C;  2D2C B;  1XDC A;  1HNX B;  1N34 O;  1OCR C;  2YIC A;  1IUR A;  2F1M A;  4I5S A;  4X1K A;  1WNS A;  2ADP A;  3JD1 A;  4R8C A;  3ZMU A;  1VF7 A;  1VQ4 V;  1K97 A;  3CHX A;  4CH5 A;  1S5J A;  5H6Q A;  1VQ7 V;  5KAF Z;  2QM4 A;  1VQ8 V;  1XQ8 A;  2JIZ G;  4UV9 A;  3SPG A;  2QKC A;  2AGA A;  1PNM A;  2CGN A;  1TAE A;  3OD4 A;  4DR7 O;  3JAW B;  2F23 A;  2HVJ C;  2BTQ A;  4LBE C;  3L9D A;  1VQO V;  5K1P A;  2LFS A;  3APO A;  3DC5 A;  5KX5 A;  1PL0 A;  4QNH B;  2VQF O;  4DV6 B;  4B3T B;  4PDR A;  1GAX A;  1URF A;  3KCY A;  5CB4 B;  2P90 A;  2H8P C;  5EZY B;  2Q8V A;  4FM1 A;  4LFB B;  1VMG A;  4I7Z B;  3ZHU A;  2BOC C;  3JAR B;  4L8J A;  2QGN A;  2GDS A;  4JI2 B;  3K08 A;  1RSO A;  4HNA A;  2CE4 A;  4DV1 B;  2JEU A;  4R7C A;  2IH1 C;  3I56 V;  1YI2 V;  3R66 A;  5IJ0 A;  4DO2 A;  3CCQ V;  4DR2 B;  1US6 A;  4EKW A;  4QJF B;  2PTM A;  1PM9 A;  3K59 A;  4LCU C;  4KHP O;  4IYI A;  2ZXW C;  1XHX A;  1VAR A;  4YJ3 B;  4K3A A;  1F4N A;  3OGC C;  3O9O A;  3JAT B;  3JAL A;  5EBW C;  3CRC A;  3JYC A;  5F2V O;  5JQG A;  2Y4T A;  2B1G A;  1VQL V;  2GV9 A;  4GX5 A;  2DE0 X;  3STL C;  3W7W A;  2JDI G;  3AG2 B;  5H9C A;  2L6L A;  2Y0I A;  5LHI A;  1NTZ H;  2QM8 A;  3G67 A;  4B3R O;  4JAU A;  1PNL A;  1B04 A;  2Q0A A;  2W6I G;  5GON B;  3BHP A;  4NKG B;  4TQF A;  4NB5 A;  1EN5 A;  4GX1 A;  4J9Z B;  3CB2 A;  3BPZ A;  4UVC A;  4NR1 A;  3DC6 A;  3HKE A;  3RYH B;  2QWP B;  5E79 Z;  1WAZ A;  4OX9 B;  1X4T A;  1NKD A;  3CC2 V;  5JJE B;  5LYJ B;  1AIL A;  4JZG A;  4AI8 A;  3AG4 C;  1R3K C;  4QE7 A;  3BCC H;  3UCS C;  5FNV B;  3CRQ A;  3WFV A;  3QNE A;  3FB5 C;  1SQX H;  2B1I A;  2XND G;  4JGS A;  3FB6 C;  1RM1 C;  4F4L A;  4YHH O;  3CD6 V;  3K9S A;  3JD0 A;  4O2A A;  2ADQ B;  1K34 A;  3K79 A;  2KG7 B;  2XAJ A;  3CRA A;  4JV5 B;  5LP6 C;  5CBH A;  3CXH F;  4KXR A;  4IIJ A;  3JD3 A;  3N27 A;  1XMO B;  3D36 C;  2JGD A;  1OCZ B;  3CE2 A;  1K3E A;  2UXX A;  3ZMS A;  4G2K A;  2PY5 A;  1JVM A;  1SZT A;  1SQV H;  2EIN C;  3BVO A;  2DYS B;  2EZP A;  3BA8 A;  3X2Q C;  4O4L A;  2Q0O C;  1K92 A;  3J80 N;  1OCC B;  4DR1 B;  2PGG A;  4X1I A;  3LSU A;  3J7A U;  2WLN A;  2R9A A;  1FKA O;  4X1K B;  4MVU A;  4JI7 O;  2AZ2 A;  4ZIB A;  4IHJ B;  4GX2 A;  1M93 A;  3T1Y B;  2ZM6 B;  1N32 B;  5LMN B;  1S72 V;  5BR8 B;  2X0L A;  1S3J A;  2GTS A;  2QKA A;  4LF5 B;  2HHH O;  3LNN A;  1IXB A;  5KUM A;  4GLX A;  1JJO A;  3QVN A;  4PA6 A;  3CCS V;  2R70 A;  2ZQM A;  5KX5 B;  2YID A;  4QPJ A;  3JD2 A;  3ABL C;  5CBF A;  1U97 A;  2Y69 C;  3E8B A;  2UXN A;  2HP8 A;  2IBZ H;  3L74 H;  5LHG A;  1XL6 A;  2DW4 A;  4TQD A;  2UU9 O;  4LF9 O;  3BAB A;  2ATK C;  5EBM C;  1N33 O;  3TXQ A;  2RDC A;  3AK1 A;  3ABK C;  1XL4 A;  1NH2 D;  1YJW V;  1PV0 A;  4I9W A;  1RSO B;  3JAS B;  2YXH A;  4HNA B;  3C90 A;  3F7V C;  1E1R G;  5FPO A;  2P67 A;  2NLJ C;  1MSD A;  3B8M A;  5IJ0 B;  4Z1V A;  4W4L A;  3HKD B;  1Q8I A;  4JI5 O;  2DQ3 A;  2EBO A;  4TUY A;  4OXS A;  3VBB A;  1IBL O;  1NBM G;  2Q69 A;  3AG3 B;  1AB3 A;  4U7O A;  3JAL B;  5EIB D;  3CC7 V;  3SJB C;  4D7S A;  4UFZ A;  1Q3E A;  4OPA A;  3RYF B;  4LNU B;  3K03 A;  1N0N A;  2V7Q G;  4X64 O;  1SZX A;  4I0X B;  3CP1 A;  3FD9 A;  3AEI A;  5JWP A;  4DUY O;  2OCC B;  4RUE A;  1I94 B;  3ABU A;  3HKE B;  5TIS Z;  4TV9 A;  4WFH A;  3ZCC A;  4LF4 B;  2E5L B;  3LUT B;  3OTO O;  1AP5 A;  3ZHS A;  5JH7 A;  2WLK A;  3RVY A;  1M57 B;  3OGI B;  2ZDI C;  2WLI A;  5IYC O;  4FLV A;  4DXW A;  1GKF A;  4FVM A;  2CGO A;  2FTK A;  4LF6 O;  3HKB A;  5LMU O;  3SPI A;  3IGA C;  4O4I A;  4DV2 O;  1N4C A;  5LGN A;  4DV4 B;  4JTD B;  1XMQ B;  3QO5 A;  2IW5 A;  4X8A A;  4FM0 A;  3ZIA G;  1I7F A;  4H33 A;  4JI3 B;  1VQP V;  1Y6X A;  2YI8 A;  4O2A B;  4CH4 A;  3F5T A;  4DW0 A;  1H2N A;  1AP6 A;  4FFK A;  4DK1 A;  2CTP A;  5CA3 A;  1AJN A;  3IC7 A;  2ZKO A;  4FZ1 A;  4IIJ B;  1F23 A;  2XAF A;  3JCU Z;  1KMI Z;  4TOI A;  5CMU A;  2JGD B;  1D2D A;  1J5E B;  4CS2 A;  2JS3 A;  5D5Q A;  3OUF A;  2E3C A;  4LF8 O;  1KKC A;  1UFI A;  4K0K O;  5KMG B;  3SJA C;  1FXV A;  4FFB A;  1YHQ V;  4O4L B;  3CRM A;  4MTX A;  4GKJ B;  4MVZ A;  4X1I B;  2RQ6 A;  1AI6 A;  4ASU G;  5IY5 C;  4WF9 V;  3H01 A;  4DV7 O;  3B77 A;  1GTO A;  4O4J A;  1MA1 A;  1FYJ A;  3E8F A;  4PA3 A;  5JVD B;  1TUE B;  1THZ A;  3RVZ A;  4LWS A;  1QNM A;  1GN2 A;  2W6J G;  4PJ0 Z;  2CH7 A;  3RBZ A;  1JPX A;  4Q20 A;  4LC1 A;  4EEQ A;  1JX9 A;  1YVW A;  3JD4 A;  2E74 B;  2UUA B;  2P4V A;  1VIB A;  4ICG A;  1WP8 A;  2Q7E A;  2QDO A;  5B66 Z;  1QLE B;  5L3C A;  1ZTE A;  5FLX N;  4YY3 O;  3FX7 A;  2BSK A;  3M8A A;  1F7Y A;  1VQ5 V;  3N2K A;  3TXS A;  4X20 A;  1FFT B;  4ZBM A;  3OMA B;  3CCE V;  3MDS A;  3WG7 C;  4NXN B;  1MG1 A;  3E22 B;  3SR2 C;  5GW7 A;  4RQF A;  1YIJ V;  2BOB C;  3OE7 G;  4J10 A;  4NXM B;  3K0G A;  2ZD9 A;  2P6J A;  5IYZ A;  4EB6 A;  1Q5O A;  4TUY B;  1Y76 B;  1F4M A;  5FL7 G;  3TJT A;  3T1H O;  2X7R B;  2BE3 A;  4DR6 B;  1SET A;  3TGU H;  3GWO A;  1GO3 F;  3OT7 A;  3UO3 A;  3E2E A;  1QVG U;  2V4D A;  1NR7 A;  4J80 A;  4AHC A;  2VQE O;  3ZHV A;  2PYJ A;  4O4H A;  5IWA O;  2YS8 A;  4DW1 A;  1MZE A;  1VQ6 V;  4DR3 O;  4DR4 O;  1LUW A;  3ZX6 A;  1AVM A;  4QGP A;  3UT5 A;  2WLL A;  3H1H H;  4B3M O;  3BAA A;  1KBH A;  4JAS A;  2R72 A;  1F51 A;  5LA6 A;  4U3F H;  3G71 V;  1VQM V;  1J95 A;  1EBO A;  5JH7 B;  4C7U A;  3TET A;  1FS0 G;  2NN4 A;  3MD0 A;  2WLI B;  1FXK A;  2Z3Y A;  3ZMT A;  3MHS C;  4MVQ A;  3K5M A;  3OMN B;  3K06 A;  3TK1 A;  1AR4 A;  5B1A B;  5LGT A;  2QA4 V;  1S76 D;  2MW2 B;  3IC9 A;  2LFR A;  4ZI7 A;  4FK5 C;  2AXT Z;  1XRE A;  2EIJ B;  2DYS C;  2DJV A;  3B4S A;  2ARH A;  5CA1 A;  1L0L H;  1GN6 A;  4JYA O;  1H8E G;  1YCI A;  3OMI B;  4H13 B;  4UCU A;  4JI0 B;  2VWK A;  2HJD A;  4UCS A;  1HNZ O;  4MVO A;  1MAB G;  1M9N A;  2YIB A;  5KA5 A;  5CA0 A;  2CUG A;  3CSX A;  2JS5 A;  4FFB B;  1VF5 B;  1GN3 A;  2FL4 A;  1W0J G;  2IJH A;  4JYY A;  4DR5 B;  1ARO P;  4F6E A;  1BE3 H;  2UXC B;  4CH6 A;  1HNX O;  4F6R A;  1K7D A;  4JPR A;  2QJ1 A;  1VQK V;  2NNU A;  4GKK B;  2Q4P A;  1R3L C;  3A8T A;  4LWS B;  3CCU V;  3E8H A;  4X62 B;  1N34 B;  5KUK A;  3F5W C;  2YEV A;  1SF9 A;  3Q4H B;  2F66 C;  3FB7 C;  3AG1 B;  3I5D A;  3UM7 A;  3QG5 A;  4UCT A;  2N74 A;  5DM6 V;  5EC2 C;  4LF7 O;  4YXW G;  1HR0 O;  4LFC O;  3LDE A;  3CPW U;  1NJI W;  1NVP D;  2ZE8 A;  2CAZ C;  1Q6I A;  4DR7 B;  4FZ0 A;  1XUQ A;  2LW7 A;  5DEC A;  2BSK B;  4K8X A;  1FFX A;  2GHY A;  3B09 A;  4GYC B;  2EZO A;  3ASN B;  2VQF B;  4X20 B;  4YIO A;  1XEQ A;  4B08 A;  2Y4U A;  5KHH A;  1V54 B;  2D3O W;  3AG3 C;  1B3Q A;  1K8A W;  1R6K A;  3G6B A;  2ZR2 A;  1Y74 A;  1RPO A;  1NU1 H;  2IJK A;  5IYZ B;  3KG2 A;  3KKY A;  2EIK B;  2M6Y A;  2PYL A;  1ENV A;  4PDL A;  3W7U A;  1ZUQ A;  5EK0 A;  2QWN B;  1UJW B;  1VF6 C;  1TA8 A;  5H5N A;  1GMG A;  1YJ9 V;  4G28 B;  3CMA V;  3SGI A;  3HKC B;  1L8D A;  1IXM A;  1GN4 A;  3EXA A;  2QSA A;  3P3N A;  4RQE A;  3APQ A;  3SDL A;  4YJ2 A;  3OTF A;  5B1B C;  3D3Q A;  2AZ0 A;  2LW1 A;  5KHI A;  2WLL B;  3BY6 A;  3CJH A;  4MTG A;  2Q67 A;  4GX0 A;  1G6U A;  5C93 A;  5J2T A;  5LA6 B;  1EN6 A;  2YXL A;  1KQS U;  3DSQ A;  5ITZ A;  2A7W A;  4B3R B;  1WA8 B;  1FXK B;  3VOU A;  1AR1 B;  4OX9 O;  3B8N A;  2NR5 A;  2X6C A;  2UXD O;  2X6B A;  1H8H G;  4X89 A;  5LL6 Y;  1Q6U A;  2WLH A;  4H37 A;  2QTS A;  1SS3 A;  3WB1 A;  1QR8 A;  3FAV B;  3BA9 A;  1Z2G A;  4GCZ A;  2X6A A;  5CA1 B;  5LOV A;  5JCO C;  4UCV A;  3F7Y C;  1V9P A;  3CRR A;  3GWK C;  4PHZ A;  4QE9 A;  4CBC A;  1XI1 A;  4X1Y B;  1MNG A;  1SES A;  1FXH A;  2G38 A;  2IH3 C;  4LR3 A;  1O9G A;  5CA0 B;  3W7X A;  4I50 A;  4YHH B;  2XTA A;  4JV5 O;  1MZF A;  2N04 A;  5A2Q N;  2OCH A;  3FB8 C;  1P7B A;  4DV5 O;  4UB6 Z;  1BQZ A;  4NVP A;  4PI0 A;  4DRX A;  3E35 A;  3SYO A;  3FFQ A;  1H2L A;  4LFA O;  5IJ9 A;  1G4Y B;  3RYC A;  1JJ2 U;  2GBO A;  2AHY A;  1QLE C;  3PN1 A;  1BSM A;  4BR6 A;  1HNW O;  2YEV B;  3W7T A;  5H2F Z;  3I55 V;  2AW9 A;  4JI4 O;  1S5H C;  1XNR O;  5LP6 A;  4FIP C;  2IJJ A;  2BTQ B;  4XBF A;  3D36 A;  3BEH A;  3L75 H;  5L3D A;  2YUA A;  2YSU B;  1JMK C;  2HHH B;  5L3B A;  1H2M A;  2Q68 A;  3SPJ A;  1FFX B;  2WLM A;  1YTF B;  1K33 A;  5EC1 C;  1JFF A;  1X59 A;  4XDK A;  1OHH G;  2FYU H;  4IYH A;  1DGS A;  3ETE A;  1EZV H;  4JF3 A;  1N36 O;  1B6Q A;  1XIL A;  2UU9 B;  4LF9 B;  1KKD A;  3OAA G;  3QO8 A;  4L87 A;  1N33 B;  4RO2 A;  4RWU A;  4X65 O;  1WPB A;  3CS5 A;  3D8C A;  5C8Y A;  4HAM A;  3OUS A;  2CDY A;  1CXZ B;  2HVK C;  5JQG B;  1P49 A;  2HEP A;  4JI5 B;  2P5O A;  3CCL V;  1H2S B;  1YEW A;  1SQP H;  3J81 N;  1IBL B;  1Y67 A;  2L35 A;  4PD4 F;  5B1A C;  4PV1 B;  3CJH B;  4WFE A;  2ITC C;  3FYE B;  1V55 C;  2XT9 A;  5J2T B;  4MTO A;  5KA6 A;  4DV3 B;  4HYO A;  2H94 A;  2Q9L A;  5ITZ B;  4X64 B;  1QCE A;  2OT5 A;  2E5L O;  4DUY B;  2Z0A A;  1FPO A;  4U7N A;  5JJN B;  1GM7 A;  2ZE6 A;  4JI6 O;  2OIG A;  4LP8 A;  1ZAU A;  1HDJ A;  4K35 A;  2ZXW B;  5BMV A;  1Q82 W;  2H3O A;  1SKV A;  1BCC H;  1R3I C;  4AQY O;  1MMM A;  1S0V A;  2RN9 A;  3SYP A;  3OTO B;  5CN0 A;  4OPH A;  1YDX A;  5KAI Z;  4U3J A;  2F95 B;  1XNQ O;  1ZLZ A;  4DV4 O;  4UCR A;  1XMQ O;  1Q43 A;  5LOV B;  1QR9 A;  3JCZ A;  2K1E A;  4LF6 B;  5LMU B;  2A9H A;  4FLY A;  4ZKI A;  3C3S A;  3R65 A;  1N0J A;  4DV0 O;  1KC8 W;  2DOS A;  1NT2 B;  4I50 B;  2WA4 A;  4B3S O;  2WSS G;  1ZX3 A;  2XUM A;  2ZNI A;  3U11 A;  4PI2 A;  4O2B A;  4D7T A;  2C2A A;  2GSM B;  2ZDI A;  2PI4 A;  1IBM O;  3ZN1 A;  3AG7 A;  5IT9 N;  3VQX A;  2KKW A;  4JAA A;  1XBL A;  4LF8 B;  3C3T A;  4JI1 O;  1W0K G;  3ZHT A;  4K0K B;  5IJ9 B;  1IBK B;  5GTH Z;  2QKS A;  2YC0 A;  3RYC B;  1B06 A;  1TVK A;  1EM1 A;  1H2K A;  1SRY A;  1Q86 W;  1M56 B;  1O9H A;  4LH7 A;  4CS3 A;  4UVA A;  2Q73 A;  4CZZ A;  4A5U B;  3CCM V;  4X9Q A;  2CTQ A;  3ASN C;  5LP6 B;  4FLU A;  4P30 A;  3K5O A;  4XDJ A;  4TSF G;  1YZB A;  1R6T A;  3K9A A;  2LGQ A;  2EJR A;  4E2L A;  1JCH A;  2YIA A;  1WP7 A;  1AJQ A;  2RJZ A;  3X2Q B;  3ABM B;  2P22 C;  2ZNJ A;  2JJ2 G;  2EIK C;  1JFF B;  3OEE G;  4MVR A;  3ZMV A;  4H0L B;  2PF4 E;  2YI9 A;  4FLZ A;  1WJZ A;  3CC4 V;  1QU7 A;  3FKS G;  5IYB O;  4FJC C;  1BS3 A;  1WB7 A;  5CB4 A;  5D5P A;  4PA7 A;  2UUC O;  1MSW D;  4DUZ O;  2RNB A;  3AG2 C;  4MVS A;  4ZOL A;  3RFR A;  1NI8 A;  1YJN V;  3K04 A;  5B5E Z;  1JA8 A;  3LSS A;  5LGU A;  3E89 A;  5DED A;  1MOF A;  3CCV V;  1AI4 A;  3A0R A;  2HLD G;  4DK0 A;  1EZJ A;  4MW8 A;  3T1H B;  1BMF G;  4BW5 A;  1CP9 A;  2EIM B;  2QTO A;  5H6R A;  3ETQ A;  4YJ3 A;  4X66 O;  3ABK B;  2JK5 C;  4MTF A;  3JAT A;  4TV9 B;  2VQE B;  1NR1 A;  2VRZ A;  1ZL8 A;  1L1F A;  4PA4 A;  4DR3 B;  4DR4 B;  1FJG O;  3SYA A;  3T1C A;  4WFF A;  3GVM A;  2F4V O;  3JAM N;  4B3M B;  2DWE C;  2JVD A;  5BMV B;  1DTO A;  3LDC A;  4JI8 O;  3HKB B;  4J7K A;  4O4I B;  4HBN A;  1IX9 A;  1OCZ C;  4U3J B;  5KHK A;  4JYC A;  2N05 A;  3RYH A;  1SA0 A;  1H38 A;  3JSL A;  1SQF A;  5L3E A;  3E83 A;  3EHB B;  4IT5 A;  5EYP A;  1I5Y A;  1QBZ A;  1OCC C;  5LYJ A;  5A9G A;  3H1L H;  1GK9 A;  1WB8 A;  3EFF K;  5FNV A;  1OCO B;  3G4S V;  3ABT A;  5LXT A;  3IJ4 A;  2UUB O;  4BW9 A;  3CEI A;  4J11 A;  2B9Z A;  1QHT A;  1GM8 A;  1Q6H A;  5J2U A;  4PDM A;  2EIL B;  4Q6G A;  3OEH G;  4J41 A;  4XDL A;  4WFB V;  2ZIN A;  1N8R W;  3CWB H;  2UXB O;  2ZE5 A;  4ZHQ A;  1HNZ B;  4TV8 A;  1TUB A;  2LO1 A;  3T4Z A;  4Z2W A;  3M7M X;  1D5N A;  1Q7Y W;  2UXC O;  4O4J B;  3TCU A;  2XHB A;  2RCV A;  1T5E A;  1G1X B;  4FLW A;  3P30 A;  4NTY A;  3K0D A;  2HFE C;  4K8Z A;  2CH7 B;  4I4T A;  1P84 F;  3CYO A;  4NYK A;  2KSD A;  4GUN A;  3ETG A;  4IHJ A;  3AK3 A;  2E75 B;  4KL1 A;  2WA3 A;  5B1N A;  1EFR G;  5FPR A;  3D3I A;  3VQW A;  4DV6 O;  4B3T O;  2QWO B;  2ZE7 A;  2R9I A;  1RPR A;  5IY5 B;  4LF7 B;  2RMK B;  4PEL A;  3N2K B;  3H1K H;  4B7K A;  3K57 A;  1HR0 B;  2DQ0 A;  1VEW A;  2ITD C;  4LFC B;  4GT1 A;  4UCO A;  4LFB O;  3QTC A;  3A2F A;  2Q7H A;  2YXY A;  4RAI A;  5J9P C;  1K9M W;  1KYO F;  1L0N H;  4JI2 O;  4I55 A;  1PKX A;  2QR4 A;  4EB6 B;  4ZOL B;  1LR1 A;  4UV8 A;  1KP2 A;  4DV1 O;  4FM2 A;  3JSN A;  3EVK A;  1K5Q A;  2FB5 A;  4IGG A;  3CCJ V;  2OCC C;  4DR2 O;  4BIU A;  1BT8 A;  3S3W A;  1PPJ H;  2A79 B;  3OR7 C;  5HFM A;  1M90 W;  1QQC A;  2DN9 A;  3JAS A;  2ILM A;  1P4R A;  3WU2 Z;  1FAF A;  2VS0 A;  1NQT A;  1M57 C;  4O4H B;  4KHP B;  3K5L A;  2W0X A;  2OTJ V;  3HKD A;  1I5X A;  3AK2 A;  1PNK A;  2PUS A;  3CXC U;  3UT5 B;  1E1Q G;  3SPC A;  3WG7 B;  3B40 A;  3CME V;  1ZL8 B;  1GH6 A;  2QE7 G;  1TGO A;  3ZMZ A;  3OFN G;  3RYF A;  4LNU A;  4Z1M G;  3ETD A;  3H9V A;  4TT3 G;  2JRI A;  4I0X A;  1CPY A;  1K5S A;  1VF6 A;  4G27 B;  3BFR A;  4E4E A;  1D5A A;  2A06 H;  3OW2 U;  4ZI7 B;  4FLT A;  3ZRW A;  5B3S B;  2WAM A;  1SA0 B;  4JYB A;  2QWQ B;  2DMX A;  1K73 W;  2JEX A;  1R6N A;  4N23 A;  3SJQ C;  5LBQ A;  3LSQ A;  2UXD B;  5EYP B;  1W2B U;  2IU3 A;  5K1X A;  3KCX A;  1ZWI C;  1IVS A;  1HWY A;  5LXT B;  1PP9 H;  1XHZ A;  2CTW A;  5J2U B;  2HJF C;  4LH6 A;  1XMO O;  2LJ2 A;  4GZR B;  3ML0 A;  3VQV A;  2BTO A;  3ASO B;  1M56 C;  1R73 A;  4ZHQ B;  3L71 H;  4TV8 B;  1TUB B;  3UO2 A;  1KD1 W;  3UKM A;  2A3Q A;  4X88 A;  3L73 H;  4F6R B;  2ZR3 A;  4DR1 O;  3HR0 A;  1KB9 F;  3NXS A;  5AG2 A;  2ZIM A;  3S3X A;  1Y66 A;  4DV5 B;  1AR5 A;  1NH2 B;  5KMG A;  3ABM C;  4JAV A;  4I4T B;  3T1Y O;  5BY1 A;  3U10 A;  2ZM6 O;  1N32 O;  5LMN O;  1R3J C;  4BWA A;  2DYR B;  5BR8 O;  1SC5 B;  1SQG A;  1KUQ A;  5JCO A;  2CTR A;  4JI7 B;  4LFA B;  3ZRS A;  2A0L A;  3ZS8 C;  4R50 A;  1VQ9 V;  3K58 A;  4LF5 O;  1KP3 A;  3DTU B;  2QEX V;  1M5I A;  2LP7 A;  4H44 B;  2WLJ A;  1HNW B;  2Q5Z A;  4KP4 A;  5JVD A;  2YDE A;  3RGB A;  2EX3 A;  4JI4 B;  2MK3 A;  1AI7 A;  2IJI A;  2M7W A;  1XNR B;  3VQY A;  4UB8 Z;  1OCR B;  3ZRX A;  2YIB D;  3H1J H;  4RUF A;  4P9P A;  3RWR D;  1YIT V;  3E8G A;  2O57 A;  3HB3 B;  4OGQ B;  5IYD O;  1Y74 B;  2W0F C;  2Q6A A;  4I55 B;  4J42 A;  2QWR B;  5KHG A;  3SYC A;  1ROP A;  4MT8 A;  2EIM C;  1FD9 A;  2ZIO A;  1WN7 A;  1AI5 A;  3OR6 C;  1N36 B;  1Z5W A;  3DGE A;  4FPP A;  2OYQ A;  3G80 A;  3E22 A;  3KZI Z;  5IDJ A;  3B2E E;  2KQX A;  3ZED A;  4X65 B;  1S77 D;  3N2G A;  1K4C C;  4N21 A;  4YIP A;  4MVM A;  4YJ2 B;  3CX5 F;  4CC5 A;  1I0H A;  1Y76 A;  5GTI Z;  1EN4 A;  2WWW A;  2IU0 A;  1SQB H;  1E79 G;  4BAY A;  4WBN A;  3CCR V;  2EIJ C;  4UVB A;  1YXB A;  3M99 B;  4DV3 O;  1BGY H;  4ABM A;  2EUL A;  1I94 O;  3RN4 A;  1YTF D;  1PD3 A;  4LF4 O;  3L70 H;  1RP3 B;  2BCC H;  4KFM A;  4MS2 A;  4NTX A;  1KU9 A;  1OCO C;  1DK1 A;  3JAK A;  3ZRW B;  4PA9 A;  2EIL C;  3A0B Z;  4P9O A;  4JI6 B;  3PJS K;  4UUJ C;  2Y48 A;  1NTK H;  5B1B B;  1DF5 A;  1WPX A;  4QIW F;  4AQY B;  4JI3 O;  4DV2 B;  3IAY A;  1SQQ H;  3IFX A;  3A0H Z;  1AJP A;  3DXR A;  1Q81 W;  3SYQ A;  1XNQ B;  4BIO A;  2R9R B;  4J7J A;  2P7T C;  2K9P A;  4JTA B;  5BXZ A;  3K5N A;  3MAQ A;  1BHB A;  1J5E O;  4I9Q A;  2QM7 A;  1VQN V;  1YF2 A;  5L3G A;  1JR9 A;  4DV0 B;  3RYI A;  3QF7 A;  4DRX B;  2F93 B;  3AG1 C;  3AG4 B;  2IM9 A;  4B3S B;  4GKJ O;  1NZ6 A;  1P7G A;  5JJJ B;  2XAS A;  1HP8 A;  2XOK G;  5E1A C;  1RM1 B;  5LHH A;  3ICX A;  4TWK A;  1IBK O;  1IBM B;  1YSC A;  2GUZ A;  1G8M A;  1I08 A;  2LQT A;  3W7S A;  4JI1 B;  4DV7 B;  1NTM H;  2WPD G;  3L72 H;  1IDS A;  4PDV A;  1M4U A;  2DWD C;  1V54 C;  4JZ2 A;  1HW7 A;  5B1O A;  4JTC B;  4CS4 A;  4IL6 Z;  5KHJ A;  2UUA O;  2OIE A;  2EIN B;  1GM9 A;  4EFE A;  2ZCE A;  1U96 A;  2CK3 G;  1LUV A;  3LNM B;  1ORQ C;  4P2Z A;  2XAH A;  3Q4H A;  2JJ1 G;  2JGU A;  3BRC A;  4B7E A;  3GB7 C;  3ZHR A;  5L3F A;  3JAW A;  1BL8 A;  3O65 A;  2AHZ A;  1BZK A;  4CC6 A;  3ZBH A;  4YY3 B;  1DLB A;  1CEZ A;  1R1B A;  4NXN O;  1H2G A;  3ZRV A;  3ZHQ A;  5EZY A;  5HFL A;  2VWJ A;  1SER A;  1Z5V A;  4NXM O;  3WB0 A;  3OM3 B;  2PZS A;  1NS1 A;  4EFB A;  5C8Y B;  2E76 B;  2ZT9 B;  1BHA A;  2P4K A;  2OTL V;  3JAR A;  1QLN A;  2HR3 A;  3ABL B;  2UUC B;  2V1D A;  4DUZ B;  3G6E V;  2Z5U A;  2Y69 B;  3T2M A;  1A32 A;  5DN6 G;  4DR6 O;  2HG5 C;  2ODM A;  3N2G B;  2F43 G;  1FXK C;  1IZ3 A;  2B5U A;  3SJC C;  4FLX A;  1GRJ A;  2OWO A;  4MW3 A;  3SPH A;  3QO7 A;  4NTW A;  4HZ3 A;  3FYI B;  3T4D A;  4WBN B;  3HKC A;  4AIL C;  5B3S C;  1OV9 A;  3E86 A;  5IWA B;  4W4K A;  4WCE V;  4WFA V;  3RW0 A;  2ETN A;  2XAG A;  1W59 A;  2PI5 A;  4X66 B;  5KLV H;  2FKX A;  5GON A;  2XAQ A;  4CH3 A;  3JAK B;  3K3W A;  5CBG A;  3NR7 A;  1VP7 A;  1PL4 A;  2FML A;  1FJG B;  4R6Z A;  1S5L Z;  2F4V B;  1WLE A;  2Q7G A;  3P3P A;  4QPK A;  4FMT A;  1JQ0 A;  3ASO C;  1WA8 A;  3ZN0 A;  4JI8 B;  3U0Z A;  1OJH A;  2GTA A;  1UPG A;  5EBL C;  1DF4 A;  1BQ0 A;  3DXR B;  1QVF U;  1V55 B;  3P32 A;  4KUM A; 
#chains in the Genus database with same CATH homology
 3LDD A;  3E8F A;  3CME V;  4PA3 A;  1KEC A;  1TUE B;  1THZ A;  3RVZ A;  1Y4M A;  2QE7 G;  4JF3 A;  4WFG A;  1B6Q A;  3ZMZ A;  2W6J G;  3OFN G;  3HPL C;  4Z1M G;  1KKD A;  3OAA G;  3QO8 A;  2DYR C;  1JPX A;  3ETD A;  3RBZ A;  3ZJZ A;  4Q20 A;  4L87 A;  3STZ C;  4LC1 A;  4BIZ A;  1NVP B;  1LNQ A;  4TT3 G;  4UXN A;  4RO2 A;  1JX9 A;  3JD4 A;  1CPY A;  1K5S A;  4G27 B;  4J9Y B;  1K4D C;  4HAM A;  3OW2 U;  1COW G;  3OUS A;  2HVK C;  3ZRW A;  5B3S B;  2WAM A;  1OZ0 A;  1JOY A;  4JYB A;  5BZB A;  1M1K W;  1QLE B;  1K73 W;  3WG7 B;  5L3C A;  2JEX A;  3CCL V;  2HKO A;  1R6N A;  4N23 A;  3SJQ C;  5LBQ A;  2KB1 A;  3LSQ A;  4MSW C;  3MHH C;  1W2B U;  2IU3 A;  1OCR C;  1VQ5 V;  5B1A C;  1ZWI C;  4I5S A;  1HWY A;  4WFE A;  2ITC C;  1FFT B;  3FYE B;  1V55 C;  4ZBM A;  3OMA B;  4MTO A;  3CCE V;  5KA6 A;  3JD1 A;  4R8C A;  3WG7 C;  3ZMU A;  1MG1 A;  4HYO A;  2H94 A;  2HJF C;  5GW7 A;  4RQF A;  1YIJ V;  1VQ4 V;  2BOB C;  3ML0 A;  1K97 A;  3OE7 G;  1QCE A;  2OT5 A;  3K0G A;  5H6Q A;  1VQ7 V;  2ZD9 A;  3ASO B;  1M56 C;  2P6J A;  1VQ8 V;  2JIZ G;  4UV9 A;  1R73 A;  3SPG A;  4U7N A;  1GM7 A;  1PNM A;  1KD1 W;  3UKM A;  4LP8 A;  2ZXW B;  1Q82 W;  4X88 A;  1F4M A;  5FL7 G;  1R3I C;  2HVJ C;  4LBE C;  1VQO V;  2ZR3 A;  1S0V A;  2X7R B;  2LFS A;  1PL0 A;  1SET A;  5CN0 A;  3SYP A;  3GWO A;  3NXS A;  1GO3 F;  4QNH B;  4PDR A;  1Y66 A;  2P90 A;  3E2E A;  1NH2 B;  2H8P C;  1QVG U;  3ABM C;  4JAV A;  1NR7 A;  1QR9 A;  3JCZ A;  1R3J C;  2K1E A;  2DYR B;  2A9H A;  1VQ6 V;  4ZKI A;  3R65 A;  3ZRS A;  2A0L A;  4R50 A;  1VQ9 V;  1KP3 A;  3DTU B;  2QEX V;  1KC8 W;  2LP7 A;  2WLL A;  2BOC C;  2WLJ A;  4JAS A;  1F51 A;  2WSS G;  4KP4 A;  3G71 V;  3K08 A;  1VQM V;  1J95 A;  1EBO A;  2MK3 A;  3TET A;  1FS0 G;  1AI7 A;  2IJI A;  2JEU A;  2M7W A;  3MD0 A;  2IH1 C;  2WLI B;  2C2A A;  4R7C A;  1FXK A;  2GSM B;  2ZDI A;  2Z3Y A;  3ZMT A;  3I56 V;  1YI2 V;  2PI4 A;  3MHS C;  4DO2 A;  3CCQ V;  4MVQ A;  3ZN1 A;  1OCR B;  4EKW A;  4QJF B;  3ZRX A;  3OMN B;  3K06 A;  3TK1 A;  4RUF A;  5B1A B;  4LCU C;  2ZXW C;  5LGT A;  4P9P A;  2QA4 V;  1YIT V;  1W0K G;  3E8G A;  1F4N A;  3OGC C;  1S76 D;  3HB3 B;  2LFR A;  4FK5 C;  2QKS A;  5EBW C;  5IYD O;  2EIJ B;  2DYS C;  3JYC A;  2B1G A;  1VQL V;  4GX5 A;  2W0F C;  2Q6A A;  1SRY A;  3STL C;  1Q86 W;  3W7W A;  1M56 B;  2JDI G;  3AG2 B;  4UVA A;  5H9C A;  5LHI A;  1H8E G;  4CZZ A;  2QM8 A;  3OMI B;  1PNL A;  4JAU A;  3CCM V;  3SYC A;  3ASN C;  1ROP A;  2W6I G;  4MT8 A;  4P30 A;  2EIM C;  4XDJ A;  4TSF G;  1AI5 A;  3OR6 C;  4MVO A;  1MAB G;  1M9N A;  4GX1 A;  5KA5 A;  4J9Z B;  3DGE A;  4FPP A;  3K9A A;  4UVC A;  2EJR A;  4E2L A;  1JCH A;  5IDJ A;  1AJQ A;  3X2Q B;  3ABM B;  1S77 D;  2JJ2 G;  1W0J G;  1K4C C;  2EIK C;  2IJH A;  4MVM A;  4N21 A;  1NKD A;  3CC2 V;  1ARO P;  3OEE G;  4MVR A;  3ZMV A;  3AG4 C;  1R3K C;  4QE7 A;  3WFV A;  3CC4 V;  3QNE A;  3FB5 C;  2B1I A;  1K7D A;  2WWW A;  2XND G;  4JPR A;  2IU0 A;  4JGS A;  1VQK V;  2NNU A;  3FB6 C;  3FKS G;  5IYB O;  1RM1 C;  1E79 G;  4FJC C;  4BAY A;  3CCR V;  1R3L C;  3CCU V;  3E8H A;  2EIJ C;  4UVB A;  4F4L A;  3M99 B;  5KUK A;  4PA7 A;  3CD6 V;  3F5W C;  1YTF D;  3JD0 A;  1MSW D;  1PD3 A;  2YEV A;  1K34 A;  3AG2 C;  4MVS A;  3K79 A;  3FB7 C;  2XAJ A;  3AG1 B;  3UM7 A;  4KFM A;  4MS2 A;  5DM6 V;  5CBH A;  3JD3 A;  1YJN V;  1OCO C;  3K04 A;  5EC2 C;  3P32 A;  1OCZ B;  1K3E A;  2UXX A;  3LSS A;  3ZRW B;  5LGU A;  3ZMS A;  4G2K A;  4YXW G;  4PA9 A;  1JVM A;  3E89 A;  1SZT A;  1MOF A;  3LDE A;  3CCV V;  3CPW U;  2EIN C;  2DYS B;  2EIL C;  2EZP A;  1NJI W;  1AI4 A;  4P9O A;  1NVP D;  3X2Q C;  3PJS K;  3A0R A;  4UUJ C;  1K92 A;  2Y48 A;  2HLD G;  5B1B B;  1EZJ A;  1DF5 A;  1WPX A;  4MW8 A;  4QIW F;  1OCC B;  2GHY A;  1BMF G;  2EZO A;  3IFX A;  3ASN B;  4BW5 A;  1CP9 A;  2WLN A;  2EIM B;  2QTO A;  5H6R A;  4MVU A;  1AJP A;  1V54 B;  1Q81 W;  3SYQ A;  2D3O W;  3ABK B;  3AG3 C;  2R9R B;  2JK5 C;  4MTF A;  4GX2 A;  2P7T C;  1K8A W;  1R6K A;  4JTA B;  1NR1 A;  1S72 V;  1L1F A;  2X0L A;  2ZR2 A;  1S3J A;  1BHB A;  1RPO A;  4PA4 A;  2IJK A;  2QM7 A;  3KG2 A;  3SYA A;  1VQN V;  5L3G A;  3T1C A;  2EIK B;  4WFF A;  5KUM A;  1ENV A;  4PDL A;  2DWE C;  4PA6 A;  3W7U A;  5EK0 A;  1DTO A;  1UJW B;  3CCS V;  3AG1 C;  3AG4 B;  3LDC A;  2XAS A;  1GMG A;  2XOK G;  2ZQM A;  4G28 B;  1YJ9 V;  1OCZ C;  4QPJ A;  4JYC A;  5E1A C;  3JD2 A;  3CMA V;  3ABL C;  1RM1 B;  5CBF A;  5LHH A;  2Y69 C;  1IXM A;  3E8B A;  4TWK A;  2UXN A;  1YSC A;  1H38 A;  1G8M A;  3W7S A;  4RQE A;  5L3E A;  3E83 A;  5B1B C;  3EHB B;  1I5Y A;  1QBZ A;  5LHG A;  1OCC C;  1XL6 A;  2WPD G;  2DW4 A;  4PDV A;  1GK9 A;  2ATK C;  3EFF K;  2WLL B;  3BY6 A;  4MTG A;  1OCO B;  2Q67 A;  4GX0 A;  5EBM C;  2DWD C;  1V54 C;  5C93 A;  3G4S V;  3ABT A;  5B1O A;  3ABK C;  4JTC B;  1XL4 A;  1NH2 D;  1YJW V;  1GM8 A;  4I9W A;  4PDM A;  2EIN B;  1GM9 A;  2EIL B;  1KQS U;  3F7V C;  3OEH G;  1E1R G;  4XDL A;  4WFB V;  2P67 A;  2NLJ C;  2CK3 G;  1N8R W;  1FXK B;  3B8M A;  3LNM B;  3VOU A;  1AR1 B;  1ORQ C;  4P2Z A;  2XAH A;  2JJ1 G;  3T4Z A;  2DQ3 A;  2EBO A;  3GB7 C;  4OXS A;  3B8N A;  2X6C A;  3VBB A;  5L3F A;  2X6B A;  1H8H G;  1NBM G;  4X89 A;  1Q7Y W;  2Q69 A;  1BL8 A;  3AG3 B;  4U7O A;  2AHZ A;  3TCU A;  2WLH A;  4H37 A;  3CC7 V;  1DLB A;  1QR8 A;  1CEZ A;  3P30 A;  1H2G A;  2HFE C;  2X6A A;  3K0D A;  4GCZ A;  3ZRV A;  5HFL A;  1SER A;  3K03 A;  2V7Q G;  3F7Y C;  3OM3 B;  3CP1 A;  3AEI A;  4QE9 A;  2OCC B;  3CYO A;  4CBC A;  1BHA A;  3ETG A;  2OTL V;  1SES A;  1FXH A;  4RUE A;  2IH3 C;  3W7X A;  3ABU A;  1QLN A;  2HR3 A;  3ABL B;  2V1D A;  4WFH A;  3ZCC A;  3G6E V;  2Z5U A;  5B1N A;  2Y69 B;  3LUT B;  3T2M A;  1EFR G;  5DN6 G;  2HG5 C;  2F43 G;  3FB8 C;  2WLK A;  3RVY A;  3D3I A;  1M57 B;  1P7B A;  1FXK C;  2B5U A;  2ZDI C;  2WLI A;  5IYC O;  2R9I A;  1RPR A;  1GKF A;  4DXW A;  5IY5 B;  4MW3 A;  4PEL A;  3E35 A;  3SPH A;  2FTK A;  3SYO A;  2DQ0 A;  2ITD C;  3IGA C;  3QO7 A;  3SPI A;  4GT1 A;  5LGN A;  4HZ3 A;  3FYI B;  4JTD B;  3QO5 A;  3T4D A;  1G4Y B;  2IW5 A;  5B3S C;  4X8A A;  3ZIA G;  3E86 A;  4RAI A;  5J9P C;  1K9M W;  1JJ2 U;  2AHY A;  4H33 A;  1QLE C;  1VQP V;  4WCE V;  4WFA V;  2YEV B;  3RW0 A;  2XAG A;  1PKX A;  3W7T A;  3I55 V;  2PI5 A;  5CA3 A;  1AJN A;  3IC7 A;  4UV8 A;  1KP2 A;  1S5H C;  1K5Q A;  2XAQ A;  1F23 A;  2IJJ A;  2XAF A;  4FIP C;  5CMU A;  3CCJ V;  2OCC C;  4XBF A;  3K3W A;  3D36 A;  3BEH A;  4BIU A;  5CBG A;  5L3D A;  2YSU B;  5HFM A;  2A79 B;  3OR7 C;  3OUF A;  4R6Z A;  5L3B A;  1M90 W;  1WLE A;  1YHQ V;  1FXV A;  4QPK A;  4FMT A;  4MTX A;  1JQ0 A;  3ASO C;  3ZN0 A;  1P4R A;  2Q68 A;  1NQT A;  1M57 C;  3SPJ A;  4MVZ A;  2WLM A;  1YTF B;  2OTJ V;  1K33 A;  5EC1 C;  1AI6 A;  4ASU G;  1I5X A;  5EBL C;  4XDK A;  5IY5 C;  1DF4 A;  1OHH G;  4WF9 V;  1PNK A;  3H01 A;  1QVF U;  3CXC U;  1V55 B;  1E1Q G;  3SPC A;  1GTO A;  3ETE A;  3B77 A;  4KUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...