5CBGA

Calcium activated non-selective cation channel
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
102
structure length
102
Chain Sequence
b'TLMFKRFFGAVRTSWRDPSTRGAVLSLAIIVTAATIFYTLAEKWSVIDSLFYAVSVGLPMGNGPLSPTLTLSKIFTLVYAILVVGLFVTVGGSLASAIVQNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ion transport 2 domain protein
publication title Structural and functional characterization of a calcium-activated cation channel from Tsukamurella paurometabola.
pubmed doi rcsb
source organism Tsukamurella paurometabola (strain atcc 8368 / dsm 20162 / jcm 10117 / nbrc 1612
molecule tags Transport protein
total genus 28
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5cbgA00
2EILC 3HPLC 2ZXWC 2EINC 2WLKA 5CBGA 2WLLB 3OR6C 4F4LA 4J9YB 2W0FC 3SPHA 2BOBC 3OUFA 4WFEA 4XDLA 3STLC 1R3KC 3LNMB 3SPIA 1LNQA 2EIMC 4MTFA 4PA6A 3E8GA 3F7VC 3AG4C 4KFMA 2ATKC 2WLNA 5B3SC 3K0DA 2EIKC 3K06A 3LDDA 4RUEA 4TWKA 1V54C 3E89A 4GX0A 3ASOC 3ASNC 3E8HA 4MS2A 3ZJZA 1OCOC 2A0LA 3K04A 4I9WA 1OCCC 4PDLA 2WLHA 3R65A 3BEHA 3RW0A 4R6ZA 3UM7A 4MTGA 2JK5C 3STZC 5EC1C 2Q69A 4XDJA 3PJSK 3F7YC 2Q67A 4QE7A 5EBLC 3SYCA 4CBCA 5CBHA 3E86A 3ABMC 3K0GA 4QE9A 4HYOA 4P9OA 3E8FA 4LP8A 4P30A 1R3IC 2HG5C 1JVMA 4MVUA 3UKMA 4GX1A 3E8BA 4MVSA 4MTOA 2AHYA 3OR7C 5EBMC 3T1CA 3ZRSA 1ZWIC 4PA9A 2A79B 4LBEC 1ORQC 5B1BC 3E83A 2WLLA 3SPJA 4DXWA 1KKDA 1K4CC 2P7TC 3AG3C 5BZBA 5IY5C 2NLJC 2X6AA 1M56C 2EIJC 5EC2C 2IH3C 4ZBMA 3T4ZA 4MVRA 1M57C 3LDCA 3SYPA 4PA4A 2Q6AA 3EFFK 4X89A 3FB6C 2WLIA 2A9HA 1QLEC 1V55C 5CBFA 2HJFC 4P2ZA 5KUMA 4MVZA 3SYQA 4MSWC 3VOUA 2DWDC 4PDVA 3RVZA 2AHZA 2HVJC 2HFEC 4P9PA 4R7CA 5EBWC 3TETA 2BOCC 3F5WC 3K08A 3OGCC 2WLJA 1OCZC 4PA7A 4UUJC 4X8AA 3RBZA 1XL4A 1R3LC 2IH1C 2YEVA 3ABKC 1XL6A 3FB7C 3K03A 4MVMA 5EK0A 4QNHB 4JTDB 2DYRC 4RUFA 2DYSC 3IFXA 4JTAB 3LDEA 3RVYA 3KG2A 4MW8A 3FB5C 1OCRC 3ABLC 5J9PC 4JTCB 4H33A 4MVQA 4R8CA 4RAIA 1J95A 4GX2A 3X2QC 4EKWA 3AG2C 3OUSA 2X6BA 2QKSA 2ITDC 3SPCA 2Q68A 1K4DC 3SYOA 3T2MA 1G4YB 4PDRA 4J9ZB 4RO2A 3IGAC 4WFFA 3JYCA 3WG7C 3SYAA 1BL8A 5E1AC 4WFHA 3T4DA 2ITCC 2HVKC 2KB1A 4R50A 2X6CA 4MVOA 4XDKA 2Y69C 2WLIB 2WLMA 4G28B 4WFGA 1P7BA 2DWEC 4H37A 3TCUA 4G27B 3SJQC 2R9RB 4LCUC 3SPGA 4PA3A 5KUKA 2ZD9A 3GB7C 3LUTB 1R3JC 4MW3A 4HZ3A 4GX5A 4X88A 5B1AC 4OXSA 4PDMA 3AG1C 2K1EA 1S5HC 3FB8C 2QTOA 4BW5A 2OCCC 2H8PC
chains in the Genus database with same CATH superfamily
1M9NA 2LJ2A 1WB7A 4DV7O 2ZE8A 1FD9A 1EZJA 3LNMB 2RDCA 2GTSA 1YSCA 1OCRB 3LSSA 4B3MO 2EIKC 3LDDA 4TWKA 4DR2O 1RSOA 4MS2A 3HKCB 5BXZA 2HHHB 4R6ZA 3L75H 3PJSK 3WG7B 4LF8B 4K0KB 1J5EB 3K0GA 4IIJB 4JI2B 3W7XA 5EZYB 1SA0A 3T1CA 3OD4A 4NXNO 2Y48A 2ZINA 2CTPA 2JJ2G 4LNUB 3B4SA 2ZIMA 2JEUA 5BZBA 1YITV 3ZMSA 2IH3C 1I5YA 5DECA 3EFFK 4FFBB 3FB6C 1KU9A 3CRAA 1Q6UA 5CBFA 2QGNA 1K5QA 4MSWC 5KHGA 3HKEA 3OTOB 4WBNA 4I4TB 3AG7A 1Z5WA 3J80N 1BE3H 2YIAA 4DRXB 2RMKB 2AZ2A 1WB8A 4DR4O 1MA1A 3OUSA 2F4VO 3CC4V 2ZE6A 1YDXA 1BSMA 2ZR2A 1QHTA 2UXBO 2D2CB 2N05A 2HVKC 2XAQA 3AEIA 1NS1A 3KCXA 3CCJV 2WLIB 4G28B 3OEHG 5L3CA 4DR5O 2ZE5A 1VQOV 4UCVA 1L0NH 5LA6A 3ZRWB 1BQZA 4OX9B 1Q90D 3K58A 1HW7A 5J2UB 3UT5A 4CZZA 3ZRXA 3OR6C 2CK3G 1MSDA 2BOBC 1I08A 2ETNA 2DYRB 4BIOA 1OV9A 4PA6A 2LFRA 3JARA 5JH7B 4CH3A 4FLZA 3ABLB 2LP7A 3SGIA 1V54C 4YJ2A 5LBQA 2QWPB 2BTQB 4GCZA 3OTFA 2VQEB 2A0LA 1R1BA 4I9WA 1OCCC 5LOVB 3VQWA 2YXLA 4YIOA 4CBCA 2HJDA 4FPPA 2A3QA 2RNBA 5JCOA 4DV7B 3G80A 1R3IC 2KG7B 4QIWF 3ZRSA 4FIPC 4B3MB 4I0XB 4E4EA 4UCOA 3QO5A 1K4CC 1XBLA 1SS3A 4J7KA 1V9PA 4F6RB 2JIZG 2A9HA 2PF4E 1VF7A 1BQ0A 2HFEC 4PA7A 1OCZC 4AHCA 3H1LH 1XL4A 1Y76B 4MVMA 4NXNB 2V1DA 5C8YA 3OM3B 1P49A 3EHBB 2ZE7A 1K33A 3FB5C 3K79A 1EZVH 1U97A 1AI6A 3ABMB 4GUNA 4EKWA 2QEXV 3RWRD 2CGOA 2E3CA 4I50B 3BCCH 4LR3A 1YTFD 4UXNA 3W7SA 4XDKA 4MVOA 5IE9A 4DV1O 3E2EA 3M99B 1VQ5V 2R9RB 4O4HB 2BCCH 1IBKO 2FKXA 1JA8A 1F51A 4DR4B 4FM0A 3IAYA 1V55B 2F4VB 4BW5A 3MAQA 1QLNA 2W0FC 5IYZA 1VQ9V 3G4SV 5GW7A 3SPIA 2WA3A 2EIMC 2B1IA 4DR5B 2UUCO 3JCUZ 2PI4A 4O4LB 1TGOA 1W59A 3CCEV 2JDIG 4YJ3B 3WB1A 4UCUA 1VIBA 2F43G 4OPAA 5IYBO 5CBHA 5EYPA 4HYOA 2Q9LA 2JS3A 3ABKB 4JAAA 5JQGB 4B3RO 2UU9O 2BE3A 2R9IA 3ZCCA 1JJOA 2Q7GA 3DSQA 1I7FA 4FM1A 2ZXWB 1NQTA 3SYPA 1AI4A 1M1KW 4PA4A 1Q5OA 1WNSA 4X1YB 3CC7V 1DF5A 1PD3A 3VOUA 2DWDC 4DUYO 1S5LZ 4LC1A 4AQYO 3JAWA 1XI1A 3JATA 1OCRC 4RAIA 1BGYH 1IX9A 3JALA 2DN9A 3SPCA 1RPRA 2E74B 1YEWA 5CN0A 1XUQA 3ETQA 4N23A 3ZHTA 2P67A 3HKCA 3WG7C 1NVPD 1TUEB 1KP3A 4DV4O 1IVSA 3H01A 3A0RA 1XILA 5EIBC 2OTJV 4LF5O 1SZXA 2ZM6O 1SA0B 2Y4TA 4PDMA 4GKJO 2LGQA 4IIJA 4GT1A 2QTOA 5EZYA 3CRMA 2RCVA 5CBGA 2YICA 5DM6V 4FLYA 4LNUA 3QO8A 3DXRA 3ZHUA 4FVMA 1BHBA 2QWQB 1S5JA 4RQEA 3E8GA 4DV1B 2ATKC 3RYIB 3E89A 4TV9A 2R9AA 5B5EZ 1IBKB 3HKEB 3N2KA 4WBNB 2WLHA 4KHPO 4BR6A 4MTGA 4I4TA 3TXSA 2AW9A 2ZDIC 1EFRG 1GN2A 3LSQA 1YJNV 1QU7A 4JI1O 1WJZA 2JGUA 3B8MA 4X1IB 1Q6HA 2OIEA 2ZDIA 1ZX3A 2ADPA 1XNQO 2UUCB 2A79B 2FL4A 4PHZA 4JI8O 1O9HA 1PV0A 4PJ0Z 2CH7B 2WLIA 4O4IB 3ZEDA 5LA6B 4CC6A 4B3RB 2UU9B 3RYHA 4TV8B 4QNHB 3UT5B 4IT5A 2DYRC 2HLDG 5B66Z 5J2UA 4EB6A 3ABLC 3KKYA 2YI9A 1VQ6V 1PPJH 4MTXA 3JARB 2X6BA 1QVFU 2CUGA 1JQ0A 4E2LA 2Y0PA 2ADQB 4RO2A 4I9QA 4U3JA 3JYCA 4PI0A 5GTIZ 1V54B 4AQYB 5FNVA 2WWWA 3OMAB 5KHJA 2CGNA 2GUZA 5H5NA 2MW2B 3G71V 1GN4A 3GB7C 3CEIA 3ETDA 4D7SA 1Q81W 2XHBA 1I5XA 1B3QA 2MK3A 3CRRA 3ZIAG 2GHYA 2ODMA 3OAAG 3OW2U 5LHIA 3BFRA 4X1KA 1YJ9V 3ZMZA 2M7WA 1SQVH 2A06H 4LF5B 3ZJZA 2CDYA 2B9ZA 2ZM6B 2WAMA 3B8NA 3I56V 3BEHA 2YIBD 4GKJB 1URFA 1OZ0A 1NJIW 1Y76A 2QM8A 3ABMC 4UVCA 1U96A 1PM9A 2CAZC 4X20A 4FLUA 1JVMA 4GLXA 1M90W 4UCRA 3P32A 2AHYA 1L8DA 3FYIB 3CX5F 3GVMA 2CTQA 2ZIOA 1QBZA 1XOUA 4LWSB 5IYDO 4KHPB 5DEDA 1YXBA 4ZBMA 3C3SA 1XNRO 1N33O 4LF4O 3ZS8C 2AGAA 2WPDG 3J81N 1AVMA 1V55C 4P2ZA 5KUMA 4JI1B 1H38A 4O4HA 2W6JG 2KQXA 1FJGO 2UXCO 1AR4A 4EEQA 1KUQA 1XL6A 1XNQB 5JJJB 3SJAC 4L8JA 4W4LA 2P4KA 1NTMH 3MD0A 5L3FA 4JI8B 3L9DA 3SR2C 2RN9A 1H8EG 1JR9A 2QKSA 1IDSA 3CCSV 4X64B 4NKGB 4DV2O 2HP8A 2E5LO 3D36C 4O4LA 3OT7A 4JV5O 1M5IA 4WFGA 2P90A 3D36A 5EYPB 4LFBO 2NR5A 1QR8A 1E1RG 1JCHA 2DE0X 1Q3EA 1R3JC 4IGGA 2YIBA 5H2FZ 3K5OA 1QLEB 2W0XA 2AXTZ 4OXSA 2F23A 3GWOA 1VQPV 2R70A 3BHPA 3BPZA 2ZXWC 4O2BB 4ZI7A 3SPHA 4DW1A 1WN7A 1YHQV 3QG5A 1K97A 3ZMVA 2XT9A 3QTCA 4JAUA 3C90A 1X4TA 3K06A 4UB8Z 2QM4A 5FPRA 1YTFB 2QDOA 3HKBA 4KUMA 5K1XA 1PNMA 3IC9A 1VQMV 2Q69A 4A5UB 4LF7O 1KBHA 4FK5C 3JATB 4MVUA 1K5SA 2FYUH 3JALB 2EULA 2XAFA 4MTOA 1GN6A 4CS3A 1ORQC 1EBOA 1P84F 4Z1MG 1VQ4V 2F95B 3MDSA 3VQXA 1SQPH 5IYCO 3SYQA 3CCQV 5EBWC 1GO3F 3F5WC 3K08A 2YS8A 3FB7C 1H2SB 1AR5A 4FJCC 4JYAB 5KAFZ 3WFVA 1ZLZA 3DXRB 3JAKB 4X66B 1XNRB 4LF4B 1RFYA 4TV9B 1F4MA 4RQFA 3RYIA 3S3XA 1X59A 1G6UA 3N2KB 4WFBV 1FJGB 2EJ7A 2Q8VA 4J7ZA 5KUKA 4JI5O 5DN6G 4RWUA 4LF6O 4GX5A 4GKKO 1EM1A 4X1IA 2VWKA 4DR6O 5ITZA 3P3NA 4WCEV 4DV2B 5CA0A 2E5LB 3JAMN 5LMNO 5C93A 4F4LA 2OTLV 1KMIZ 1UFIA 4LFBB 2CH7A 4O4IA 4OGQB 1NVPB 1KB9F 3A0HZ 2X7RB 3RYHB 4J41A 5KMGA 3S3WA 4TV8A 4B3TO 3I55V 4EB6B 1UPGA 3UKMA 4JPRA 4GX1A 1AJPA 2UUAB 2YDEA 2JVDA 1ZWIC 4B3SO 1ROPA 3CMEV 5KA5A 1IBLO 3CWBH 4U3JB 3LNNA 1B04A 2JS5A 5FNVB 4K8ZA 4NVPA 3LDCA 5JCOC 4LF7B 3RYFA 2GUZB 2DQ0A 5JJEB 4FLTA 4MVZA 1YJWV 3FX7A 4DR2B 3RVYA 4J80A 3ZHVA 5B1NA 4DW0A 5IT9N 4X1KB 4JASA 3PN1A 4CH5A 5A2QN 4U3FH 5JVDB 3CS5A 4J9ZB 3JCZA 2RQ6A 1BL8A 2ITCC 2IJJA 1IBMO 2L6LA 3AG3B 1P7BA 3TJTA 1R6KA 5IJ0A 1GAXA 3H1HH 2JGDB 4X20B 2Y4UA 4PV1B 1N32O 2E75B 3FYEB 2IU0A 4FMTA 1NU1H 4LFCO 3ZRVA 3ETEA 2K1EA 2H8PC 1M4UA 3KZIZ 4YHHO 4XDLA 4KXRA 3QF7A 4LWSA 1Y74A 2P4VA 4YXWG 2EJRA 5J2TB 3K59A 1Z2GA 3M7MX 2WLNA 1B06A 2BSKA 4GX0A 2E76B 4LF6B 1FS0G 3WB2A 4DR6B 2QM7A 5LYJA 5LMNB 4QE9A 1HR0O 4P9OA 2Q4PA 4G2KA 2ZNIA 2UXBB 1VF6C 1SETA 3U0ZA 3BABA 1Y66A 5EBMC 3L71H 2JJ1G 4PA9A 4QGPA 2B5UA 2GTAA 1VF6A 1KKDA 1MOFA 5EC2C 2EINB 4JGSA 3K9SA 1FXKA 3B40A 1QLEC 1DF4A 3A2FA 4PI2A 2M6YA 4PDVA 2HVJC 3HKDA 2L35A 4C7UA 1Y67A 3TETA 3CRCA 3ICXA 4X8AA 1OCOB 3CPWU 4B3SB 3QVNA 1SQXH 4TUYA 4JTDB 3LDEA 4ZI7B 1IBLB 2Q7HA 2DW4A 5J9PC 4O2BA 1Z5VA 3HKBB 1BS3A 3T2MA 4H13B 4DR1O 3SYAA 1CP9A 3H1JH 3C3TA 3AK3A 1KECA 1GTOA 2DWEC 4H37A 3SJQC 4L87A 2WA4A 4JYYA 1EN6A 3CB2A 2C2AA 1S72V 1WAZA 4Q20A 1CPYA 2ZNJA 4LH7A 1H2KA 3O9OA 4MTFA 1IBMB 2FB5A 5KAIZ 5L3BA 1Q43A 1PNLA 4EFEA 2PYJA 1N32B 3BY6A 1VQNV 4LFCB 3R65A 4ASUG 2QSAA 3TXQA 4YHHB 2Y69B 2ZKOA 5LHHA 3L70H 1NR1A 3JAKA 1FYJA 1SC5B 1LUVA 3E8BA 2NN4A 2ZQMA 2OIGA 5BMVA 3OGIB 1SKVA 1Q6IA 2WLLA 3SPJA 2XAGA 2NLJC 3CSXA 2CTRA 4ZOLA 1WA8A 1EN4A 2P6JA 3APOA 3UCSC 1HR0B 3AG4B 3JASA 5B3SB 5GTHZ 2AHZA 4NR1A 4KL1A 5ITZB 1TVKB 5CA0B 2UUBO 4MW8A 4R8CA 2KSDA 2UXNA 5LXTB 4B7KA 1JJ2U 2FTKA 4J42A 1HNXO 5KA6A 4WFHA 5KMGB 1TUBB 1QQCA 3TCUA 4K8XA 3E22A 1NBMG 2Q0OC 4X88A 1G8MA 3OFNG 4ZIBA 3T1YO 1KKCA 4HNAA 3CD6V 4J11A 1AI5A 5LP6C 3STLC 4DUYB 4KFMA 3RYFB 3CC2V 1XQ8A 3RT3C 5LP6A 3B77A 3E8HA 3MHHC 3DGEA 3E35A 4JI4O 1XHZA 1K9MW 1WLEA 1ZL8A 4XDJA 3ZX6A 4LH6A 5LMUO 1D2DA 4DK1A 2Z0AA 1MZEA 3CCMV 4D7TA 2XOKG 2QWOB 1MZFA 2K9PA 4JI6O 4PD4F 4JI7O 4DV4B 5D5PA 1XDCA 4YIPA 1AP6A 2RJZA 3ABUA 5JVDA 3AG3C 2EIJC 5IJ0B 1SRYA 2QA4V 3OEEG 4DK0A 3R66A 2HJFC 4CS4A 3O65A 2JGDA 2CTWA 4P9PA 3J7AU 2VWJA 2WLJA 4UVAA 4IL6Z 4FM2A 2IJHA 1R3LC 3BA9A 3RYCA 1D5AA 5EK0A 2PYLA 5CB4A 3N27A 2QE7G 3CYOA 2LQTA 1KC8W 1Y74B 3A0BZ 5TISZ 3H1KH 1Q8IA 4DV5O 5J2TA 1JMKC 2BSKB 1HNZO 3F5TA 1FAFA 3CMAV 4DUZO 2UXDO 1N8RW 3GWKC 2LW7A 1FFXA 1SQBH 5LYJB 4G27B 3CCRV 1SZTA 3SPGA 2UUBB 3LUTB 5KHHA 3D3IA 1GKFA 1YI2V 1AILA 1ZSPA 2DOSA 2ARHA 1S5HC 1LR1A 2B1GA 3FAVB 4UVBA 3JSLA 2EINC 2WLKA 3QNEA 1HNXB 1NH2D 3CJHB 5H9CA 3HR0A 4LFAO 1FXKB 2DQ3A 3K0DA 3BRCA 1W2BU 1OCOC 3HKDB 4NYKA 4UFZA 5BR8O 4TUYB 1LUWA 3JD4A 1K8AW 1H2MA 4ABMA 3NR7A 3P30A 5CA1A 2HG5C 2IM9A 4IHJA 1NTZH 5IJ9B 3VBBA 2YXHA 1NZ6A 5B1AB 1SQFA 4FFKA 4NTXA 5B1BC 3AG1B 4JI4B 4FZ1A 5GONB 2EILB 1MNGA 3CCLV 3K9AA 1ENVA 2O57A 2Q6AA 5LMUB 1DK1A 2YSUB 3ZN0A 2OWOA 3ETGA 2F93B 1BHAA 1L0LH 3VQVA 4LF9O 3RFRA 3A8TA 4JI6B 4JI7B 3CCUV 4AI8A 1N0JA 1VQ7V 5KHKA 4QPKA 1F4NA 2ILMA 2AZ0A 4JF3A 5AG2A 2VQEO 1YIJV 4JAVA 1VF5B 4K3AA 2LO1A 1IURA 3HB3B 1GN3A 3K5NA 5LGUA 2DJVA 2JEXA 4I7ZB 4ZKIA 2F1MA 1E79G 3EVKA 3TK1A 5CMUA 1US6A 2XUMA 2X6CA 2Y69C 1JFFA 5IY5B 5KHIA 4PA3A 3ZHQA 4DV5B 1SQGA 5BMVB 1N33B 4BIUA 3D8CA 5A9GA 3DTUB 1HNZB 1F23A 2WLLB 3AK1A 4DUZB 4WFEA 2UXDB 4BIZA 2DYSB 3K3WA 4ZOLB 2UXCB 3AG4C 5B3SC 1WA8B 5K1PA 3JD3A 2IJKA 4O4JB 1IXMA 3JASB 2GBOA 2F66C 2VRZA 1SERA 1GH6A 1UJWB 3ZMUA 1Q86W 1GM8A 3L73H 5IWAO 1VMGA 2Q67A 5EBLC 1TVKA 4I5SA 1K7DA 5LGTA 1Y6XA 3M8AA 4TSFG 4LFAB 3B09A 4JV5B 1WPBA 2XAHA 4I55A 5LXTA 1XREA 1G1XB 1M56C 3JD2A 3Q4HA 4W4KA 2PY5A 1EN5A 1NI8A 5BR8B 3UQ8A 4X89A 4O2AA 3E22B 3ZMTA 1TUBA 2PZSA 4BWAA 3LSUA 1BZKA 2BOCC 3ASOB 1K92A 1GM7A 2IH1C 1O9GA 4QJFB 2PGGA 3THOA 5F2VO 3UO3A 2GSMB 2QWNB 4HNAB 4JTAB 4RUFA 2XNDG 1J95A 2ZCEA 1FKAO 4GX2A 4KP4A 2IBZH 2ITDC 3WU2Z 4B08A 1Q82W 1PL4A 5LP6B 1VQLV 2QWRB 3SDLA 1XEQA 4WFFA 3FD9A 4DR7O 3T4DA 4LF9B 4R50A 1M93A 1ZL8B 2CE4A 4Q6GA 2XTAA 4JYCA 4BAYA 2YXYA 4LCUC 3KCYA 4DO2A 1NR7A 1OHHG 2V4DA 4DV3O 1AJNA 4U7NA 1AI7A 5L3EA 4NTWA 2BTOA 3ZHRA 3FFQA 3ML0A 2QKAA 3JD0A 2V7QG 1GK9A 2XASA 1YZBA 2H3OA 4NB5A 1VQKV 3X2QB 2EIJB 1ZUQA 4TT3G 1XMOO 4N21A 1AJQA 1N0NA 4PDLA 3RYCB 1R6NA 2YI8A 3STZC 5EC1C 5CB4B 3SYCA 4CH4A 3E86A 3P3PA 4HBNA 1QVGU 4MVSA 4JZGA 1WP7A 5KX5A 1Y4MA 1N34O 4LBEC 1AP5A 4AILC 4JI5B 5LGNA 5B1OA 2FMLA 4JI3O 4DR3O 4GKKB 4MVRA 5IWAB 3H1IH 1H2NA 3VQYA 1FFXB 3T1HO 4D6TH 1S3JA 4UCSA 3MHSC 1W0KG 4CC5A 4EFBA 2QKCA 3ASNB 1PL0A 2HKOA 4X65O 3K03A 2G38A 2P06A 1ZAUA 3FAVA 2Q73A 4ZHQA 4DV0O 1FXKC 3G6BA 4JTCB 1OJHA 1TA8A 2IJIA 4NTYA 5KLVH 1DGSA 1KP2A 2N74A 3AG2C 3CJHA 1SESA 1D5NA 2WSSG 3W7UA 2P5OA 2KKWA 1H8HG 4B3TB 5E79Z 1THZA 3NXSA 1N4CA 1SQQH 3JSNA 2NNUA 3QO7A 2Q0AA 1NKDA 4X9QA 1VEWA 5BY1A 1M57B 3CP1A 4FZ0A 5CA1B 1Q7YW 4MW3A 1P7GA 2YEVB 5B1AC 1QNMA 5EIBD 3AG1C 4IHJB 2H94A 4DYLA 5L3GA 2D3OW 2EILC 5IJ9A 1R73A 3DC6A 4DR7B 3OUFA 1H2LA 1RPOA 2Z5UA 1R3KC 2ZR3A 5GONA 1L1FA 1TAEA 2Z3YA 2YIDA 5B1BB 1B6QA 4Z1VA 3DC5A 2Y0IA 5H6QA 4DV3B 2JK5C 4U7OA 4X62O 2GV9A 3N2GA 2OYQA 5FL7G 1RM1B 4WFAV 1I94O 3K57A 3OR7C 2YUAA 3SJBC 2A7WA 3OE7G 1NH2B 1QCEA 1XMOB 2P7TC 2OCCB 5IY5C 3CCVV 3BA8A 2R72A 2QR4A 1I0HA 2PUSA 4UV9A 4MT8A 1JFFB 1RSOB 2EZPA 2OCHA 1T5EA 2QJ1A 4UCTA 2EIKB 4R7CA 3RGBA 1FPOA 1HNWO 3APQA 1N34B 3EXAA 2DYSC 4TOIA 4H0LB 4JI3B 5HFMA 5H6RA 4DR3B 1MMMA 2EX3A 1KD1W 4K35A 1COWG 5JWPA 3T1HB 1K4DC 2LW1A 2PTMA 1HWYA 4NXMO 3IGAC 2OT5A 4O4JA 3G6EV 2VS0A 2Q7EA 4UB6Z 4X65B 4FFBA 2P22C 1W0JG 4DV0B 1GRJA 5FPOA 2X0LA 1PP9H 4J10A 1PNKA 4JI0O 3CHXA 3FB8C 4I55B 4CS2A 4FLWA 4J9YB 4DRXA 5LL6Y 2IW5A 4WF9V 3Q4HB 3F7VC 3ZBHA 4O2AB 1MSWD 3WB0A 5LHGA 1SF9A 4JZ2A 4DV6O 1M56B 3ASOC 1K34A 4B7EA 1HP8A 1XHXA 3K04A 1XMQO 1KYOF 3ZN1A 1MG1A 3UM7A 4UV8A 4FLXA 4X64O 3F7YC 1BT8A 3W7WA 1DTOA 3CE2A 1IXBA 2VQFO 3UO2A 1JOYA 4LP8A 3CXCU 2W6IG 4DR1B 4OPHA 3ZRWA 3G67A 1FXHA 3BVOA 5IDJA 4DXWA 1E1QG 1RP3B 2EZOA 3AK2A 4QPJA 4X62B 2PI5A 5JH7A 4YJ2B 1VQ8V 1YVWA 3U10A 2BTQA 2YC0A 5LOVA 1I94B 3TGUH 2HEPA 3OGCC 4UUJC 1BCCH 3RBZA 1GM9A 1N36O 1OCCB 3L72H 2GDSA 3OMNB 1GMGA 2LFSA 1JPXA 2KG7A 4TQFA 3X2QC 1WPXA 3L74H 4I0XA 4YY3O 3SYOA 1G4YB 3IJ4A 4XBFA 1F7YA 3BAAA 5E1AC 1HNWB 2KB1A 1FFTB 4HAMA 4GZRB 1AR1B 4F6RA 2DMXA 3ZHSA 2HHHO 1S77D 1HDJA 1YCIA 1BMFG 1ZTEA 3D3QA 5C8YB 5KX5B 3B2EE 4K0KO 4LF8O 3HPLC 1J5EO 1OCZB 4NXMB 1VP7A 1LNQA 4JI2O 1R6TA 3W7TA 1QR9A 2LGWA 4RUEA 4JYAO 3ABTA 4IYHA 4FLVA 4I50A 3ASNC 1NT2B 3H9VA 4IYIA 4X66O 4JI0B 1A32A 5HFLA 3K5LA 5L3DA 3RW0A 3IC7A 4Z2WA 4QE7A 3CRQA 3JD1A 4ZHQB 1WP8A 3E8FA 4P30A 1S76D 3U11A 3OTOO 2QTSA 2ZT9B 5CA3A 4DV6B 2UXXA 4F6EA 1KQSU 5IYZB 3E83A 3AG2B 1XMQB 2X6AA 1MABG 1JX9A 3T4ZA 1M57C 1K3EA 4PELA 1IZ3A 2N04A 3T1YB 3I5DA 2VQFB 1DLBA 2EBOA 2EIMB 1CEZA 3RVZA 4YJ3A 4J7JA 4TQDA 2HR3A 2XAJA 1VARA 3ABKC 2YEVA 3IFXA 1AROP 3KG2A 5FLXN 3SJCC 4H33A 4MVQA 5JQGA 1CXZB 4ICGA 4GYCB 4OX9O 1S0VA 2Q68A 1NTKH 4BW9A 5JJNB 1H2GA 3CXHF 2IU3A 4PDRA 4CH6A 3K5MA 4H44B 2Q5ZA 2UUAO 1N36B 2WLMA 1FXVA 3RN4A 1RM1C 4X1YA 5D5QA 1K73W 3N2GB 3FKSG 3OMIB 2ZD9A 1YF2A 1P4RA 4HZ3A 3JAWB 1PKXA 2JRIA 4JYBA 1AB3A 2OCCC 4YY3B
chains in the Genus database with same CATH topology
3ZIAG 1M9NA 4U7NA 1AI7A 5L3EA 4Q20A 1CPYA 1EZJA 3ML0A 3LNMB 2GHYA 3OAAG 4MTFA 3OW2U 3JD0A 2V7QG 1YSCA 1GK9A 1OCRB 5LHIA 3LSSA 5L3BA 2EIKC 3LDDA 2XASA 4TWKA 3ZMZA 1YJ9V 2M7WA 1VQKV 1PNLA 3X2QB 2EIJB 4MS2A 3ZJZA 3BY6A 4TT3G 4N21A 1VQNV 1AJQA 4PDLA 2WAMA 3B8NA 3R65A 3I56V 3BEHA 4R6ZA 1R6NA 4ASUG 1OZ0A 3STZC 5EC1C 3PJSK 1NJIW 2QM8A 3WG7B 3SYCA 3E86A 3ABMC 4UVCA 3K0GA 2Y69B 5LHHA 1JVMA 1NR1A 1M90W 3P32A 1QVGU 3E8BA 4MVSA 3W7XA 2AHYA 3T1CA 2Y48A 2ZQMA 1Y4MA 3FYIB 4LBEC 2JJ2G 1QBZA 2WLLA 3SPJA 5LGNA 5IYDO 2JEUA 5BZBA 2XAGA 5B1OA 2NLJC 1YITV 3ZMSA 2IH3C 4ZBMA 4MVRA 1I5YA 3EFFK 3FB6C 2WPDG 2P6JA 1S3JA 1V55C 5CBFA 3MHSC 4P2ZA 5KUMA 3AG4B 1K5QA 1W0KG 4MSWC 5B3SB 1H38A 2W6JG 2AHZA 3ASNB 1PL0A 2HKOA 1XL6A 3K03A 4MW8A 1FXKC 3MD0A 5L3FA 4JTCB 2IJIA 4R8CA 1KP2A 3AG2C 1SESA 3OUSA 2WSSG 1H8EG 2QKSA 3CCSV 3CC4V 2UXNA 3W7UA 1H8HG 2ZR2A 1JJ2U 2FTKA 1THZA 3NXSA 5KA6A 4WFHA 2HVKC 2NNUA 3QO7A 3AEIA 2XAQA 3CCJV 2WLIB 1NKDA 4G28B 3OEHG 4WFGA 3TCUA 2P90A 3D36A 5L3CA 1QR8A 1M57B 3CP1A 1E1RG 1JCHA 1NBMG 1VQOV 1Q7YW 1R3JC 4MW3A 4X88A 2YEVB 1QLEB 5B1AC 1G8MA 4OXSA 3ZRWB 3AG1C 3OFNG 2H94A 3GWOA 5L3GA 1VQPV 2D3OW 2EILC 4CZZA 2ZXWC 1R73A 3ZRXA 3OR6C 3CD6V 2CK3G 3SPHA 1AI5A 2BOBC 3OUFA 3STLC 1YHQV 1RPOA 2Z5UA 2DYRB 1K97A 1R3KC 2ZR3A 1L1FA 3ZMVA 2Z3YA 2LFRA 4PA6A 4KFMA 5B1BB 4JAUA 3ABLB 3K06A 3CC2V 1B6QA 2LP7A 1V54C 1YTFB 3B77A 5LBQA 3E8HA 3MHHC 3DGEA 3E35A 4KUMA 4GCZA 2A0LA 4I9WA 1OCCC 1PNMA 1K9MW 1WLEA 1VQMV 5H6QA 2JK5C 4U7OA 2Q69A 4XDJA 4CBCA 4FPPA 4FK5C 3CCMV 5FL7G 2XOKG 1R3IC 4MVUA 4WFAV 1RM1B 1K5SA 4QIWF 4MTOA 2XAFA 3OR7C 3ZRSA 4FIPC 3OE7G 3QO5A 1NH2B 1QCEA 1ORQC 3ABUA 1K4CC 1EBOA 2P7TC 3AG3C 4Z1MG 2OCCB 5IY5C 3CCVV 2EIJC 1VQ4V 4UV9A 4MT8A 2EZPA 1SRYA 2QA4V 3OEEG 2JIZG 2A9HA 5IYCO 2HJFC 3SYQA 2EIKB 3CCQV 2HFEC 4P9PA 4R7CA 5EBWC 1GO3F 3F5WC 3K08A 4PA7A 2WLJA 1OCZC 4UVAA 1XL4A 1R3LC 2IJHA 3FB7C 4MVMA 5EK0A 2V1DA 2QE7G 4FJCC 3OM3B 3WFVA 2DYSC 3EHBB 3CYOA 1K33A 3FB5C 3K79A 1KC8W 1AI6A 5HFMA 5H6RA 3ABMB 4EKWA 2QEXV 1KD1W 1COWG 1K4DC 1F4MA 4RQFA 3CMAV 1HWYA 3IGAC 2OT5A 1YTFD 3G6EV 1N8RW 4WFBV 4UXNA 3W7SA 4XDKA 4MVOA 3E2EA 4G27B 3CCRV 3M99B 1VQ5V 1SZTA 2R9RB 1W0JG 3SPGA 5KUKA 2X0LA 3LUTB 5DN6G 1F51A 1PNKA 3D3IA 1GKFA 4GX5A 1V55B 1YI2V 1S5HC 2B1GA 3FB8C 4BW5A 4UVBA 4WCEV 2EINC 2WLKA 3QNEA 5C93A 4F4LA 4J9YB 2W0FC 1QLNA 1NH2D 2OTLV 1VQ9V 2IW5A 3G4SV 4WF9V 5GW7A 5H9CA 3SPIA 2EIMC 2B1IA 3F7VC 1FXKB 2DQ3A 1MSWD 3K0DA 5LHGA 1W2BU 2PI4A 1M56B 3ASOC 1OCOC 1K34A 3CCEV 2JDIG 1NVPB 3K04A 2X7RB 3ZN1A 1MG1A 3UM7A 4UV8A 2F43G 3F7YC 3W7WA 5IYBO 1DTOA 5CBHA 3JD4A 3I55V 1K8AW 4HYOA 1JOYA 3ABKB 3P30A 4LP8A 2W6IG 2HG5C 3UKMA 3CXCU 4JPRA 4GX1A 1AJPA 3ZRWA 1ZWIC 1ROPA 3VBBA 3CMEV 5B1AB 1FXHA 5KA5A 5IDJA 5B1BC 2R9IA 3AG1B 3ZCCA 1E1QG 4DXWA 2EILB 3CCLV 2ZXWB 2EZOA 3K9AA 1ENVA 1NQTA 3LDCA 3SYPA 4QPJA 2PI5A 1AI4A 1M1KW 4PA4A 2Q6AA 1VQ8V 3CC7V 1DF5A 2YSUB 3ZN0A 3ETGA 1BHAA 1PD3A 2DQ0A 4MVZA 3VOUA 2DWDC 4LC1A 3OGCC 4UUJC 3RBZA 3CCUV 1YJWV 1GM9A 1OCCB 1VQ7V 4QPKA 1F4NA 3RVYA 4JF3A 3OMNB 1YIJV 1OCRC 4JAVA 1GMGA 2LFSA 1JPXA 4RAIA 5B1NA 3X2QC 3HB3B 1WPXA 3SPCA 5LGUA 1RPRA 4JASA 3SYOA 5CN0A 2JEXA 4N23A 1G4YB 4J9ZB 4ZKIA 2P67A 4XBFA 3JCZA 1E79G 3TK1A 5CMUA 1BL8A 5E1AC 3WG7C 2ITCC 2KB1A 1NVPD 1TUEB 2X6CA 2IJJA 1FFTB 1KP3A 2Y69C 3H01A 4HAMA 3AG3B 1P7BA 3A0RA 1R6KA 5IY5B 1AR1B 2OTJV 4PA3A 1S77D 3FYEB 2IU0A 4FMTA 3ZRVA 4PDMA 1BMFG 3ETEA 2K1EA 4GT1A 2QTOA 4BIUA 2H8PC 3DTUB 3HPLC 1F23A 1OCZB 5CBGA 2WLLB 5DM6V 3QO8A 4WFEA 4XDLA 4YXWG 1BHBA 4BIZA 2DYSB 2EJRA 1LNQA 3K3WA 4RQEA 3E8GA 3AG4C 5B3SC 2ATKC 1QR9A 2WLNA 3JD3A 3W7TA 2IJKA 4RUEA 3ABTA 3E89A 4GX0A 1IXMA 3ASNC 1SERA 1UJWB 1FS0G 2WLHA 3ZMUA 5HFLA 1Q86W 1GM8A 5L3DA 3RW0A 3IC7A 4MTGA 2Q67A 4QE7A 5EBLC 2QM7A 2ZDIC 3JD1A 4I5SA 4QE9A 1EFRG 3LSQA 4P9OA 1YJNV 1K7DA 4G2KA 3E8FA 4P30A 1S76D 5LGTA 1SETA 3B8MA 4TSFG 1Y66A 5EBMC 2ZDIA 2JJ1G 4PA9A 2B5UA 5CA3A 2XAHA 2A79B 2UXXA 1KQSU 3E83A 3AG2B 1KKDA 2X6AA 1MOFA 1M56C 1MABG 1JX9A 5EC2C 2EINB 3JD2A 3T4ZA 1M57C 4JGSA 1K3EA 1FXKA 4PELA 4X89A 2WLIA 3ZMTA 1DLBA 1QLEC 1DF4A 2EBOA 2EIMB 4PDVA 1CEZA 3RVZA 2HVJC 3TETA 2BOCC 4X8AA 3ASOB 2HR3A 2XAJA 1K92A 1GM7A 1OCOB 3ABKC 2IH1C 2YEVA 3CPWU 4QJFB 4QNHB 4JTDB 2DYRC 2GSMB 4RUFA 4JTAB 2HLDG 3IFXA 3LDEA 1AROP 2XNDG 3KG2A 2DW4A 3ABLC 5J9PC 4H33A 4MVQA 1VQ6V 1J95A 4GX2A 4MTXA 2X6BA 1QVFU 4KP4A 2ITDC 1S0VA 1Q82W 2Q68A 1VQLV 1JQ0A 4E2LA 1H2GA 3T2MA 2IU3A 4PDRA 4RO2A 4WFFA 3JYCA 3SYAA 3T4DA 1CP9A 1V54B 4R50A 2WWWA 3OMAB 1KECA 1FXVA 2WLMA 1GTOA 2DWEC 4H37A 4BAYA 4JYCA 1RM1C 1K73W 3SJQC 3FKSG 4L87A 3OMIB 4LCUC 3G71V 4DO2A 1NR7A 2ZD9A 3GB7C 1P4RA 3ETDA 4HZ3A 1OHHG 1PKXA 1Q81W 1I5XA 4JYBA 2C2AA 2MK3A 1S72V 1AJNA 2OCCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIL C;  3HPL C;  2ZXW C;  2EIN C;  2WLK A;  5CBG A;  2WLL B;  3OR6 C;  4F4L A;  4J9Y B;  2W0F C;  3SPH A;  2BOB C;  3OUF A;  4WFE A;  4XDL A;  3STL C;  1R3K C;  3LNM B;  3SPI A;  1LNQ A;  2EIM C;  4MTF A;  4PA6 A;  3E8G A;  3F7V C;  3AG4 C;  4KFM A;  2ATK C;  2WLN A;  5B3S C;  3K0D A;  2EIK C;  3K06 A;  3LDD A;  4RUE A;  4TWK A;  1V54 C;  3E89 A;  4GX0 A;  3ASO C;  3ASN C;  3E8H A;  4MS2 A;  3ZJZ A;  1OCO C;  2A0L A;  3K04 A;  4I9W A;  1OCC C;  4PDL A;  2WLH A;  3R65 A;  3BEH A;  3RW0 A;  4R6Z A;  3UM7 A;  4MTG A;  2JK5 C;  3STZ C;  5EC1 C;  2Q69 A;  4XDJ A;  3PJS K;  3F7Y C;  2Q67 A;  4QE7 A;  5EBL C;  3SYC A;  4CBC A;  5CBH A;  3E86 A;  3ABM C;  3K0G A;  4QE9 A;  4HYO A;  4P9O A;  3E8F A;  4LP8 A;  4P30 A;  1R3I C;  2HG5 C;  1JVM A;  4MVU A;  3UKM A;  4GX1 A;  3E8B A;  4MVS A;  4MTO A;  2AHY A;  3OR7 C;  5EBM C;  3T1C A;  3ZRS A;  1ZWI C;  4PA9 A;  2A79 B;  4LBE C;  1ORQ C;  5B1B C;  3E83 A;  2WLL A;  3SPJ A;  4DXW A;  1KKD A;  1K4C C;  2P7T C;  3AG3 C;  5BZB A;  5IY5 C;  2NLJ C;  2X6A A;  1M56 C;  2EIJ C;  5EC2 C;  2IH3 C;  4ZBM A;  3T4Z A;  4MVR A;  1M57 C;  3LDC A;  3SYP A;  4PA4 A;  2Q6A A;  3EFF K;  4X89 A;  3FB6 C;  2WLI A;  2A9H A;  1QLE C;  1V55 C;  5CBF A;  2HJF C;  4P2Z A;  5KUM A;  4MVZ A;  3SYQ A;  4MSW C;  3VOU A;  2DWD C;  4PDV A;  3RVZ A;  2AHZ A;  2HVJ C;  2HFE C;  4P9P A;  4R7C A;  5EBW C;  3TET A;  2BOC C;  3F5W C;  3K08 A;  3OGC C;  2WLJ A;  1OCZ C;  4PA7 A;  4UUJ C;  4X8A A;  3RBZ A;  1XL4 A;  1R3L C;  2IH1 C;  2YEV A;  3ABK C;  1XL6 A;  3FB7 C;  3K03 A;  4MVM A;  5EK0 A;  4QNH B;  4JTD B;  2DYR C;  4RUF A;  2DYS C;  3IFX A;  4JTA B;  3LDE A;  3RVY A;  3KG2 A;  4MW8 A;  3FB5 C;  1OCR C;  3ABL C;  5J9P C;  4JTC B;  4H33 A;  4MVQ A;  4R8C A;  4RAI A;  1J95 A;  4GX2 A;  3X2Q C;  4EKW A;  3AG2 C;  3OUS A;  2X6B A;  2QKS A;  2ITD C;  3SPC A;  2Q68 A;  1K4D C;  3SYO A;  3T2M A;  1G4Y B;  4PDR A;  4J9Z B;  4RO2 A;  3IGA C;  4WFF A;  3JYC A;  3WG7 C;  3SYA A;  1BL8 A;  5E1A C;  4WFH A;  3T4D A;  2ITC C;  2HVK C;  2KB1 A;  4R50 A;  2X6C A;  4MVO A;  4XDK A;  2Y69 C;  2WLI B;  2WLM A;  4G28 B;  4WFG A;  1P7B A;  2DWE C;  4H37 A;  3TCU A;  4G27 B;  3SJQ C;  2R9R B;  4LCU C;  3SPG A;  4PA3 A;  5KUK A;  2ZD9 A;  3GB7 C;  3LUT B;  1R3J C;  4MW3 A;  4HZ3 A;  4GX5 A;  4X88 A;  5B1A C;  4OXS A;  4PDM A;  3AG1 C;  2K1E A;  1S5H C;  3FB8 C;  2QTO A;  4BW5 A;  2OCC C;  2H8P C; 
#chains in the Genus database with same CATH topology
 1M9N A;  2LJ2 A;  1WB7 A;  4DV7 O;  2ZE8 A;  1FD9 A;  1EZJ A;  3LNM B;  2RDC A;  2GTS A;  1YSC A;  1OCR B;  3LSS A;  4B3M O;  2EIK C;  3LDD A;  4TWK A;  4DR2 O;  1RSO A;  4MS2 A;  3HKC B;  5BXZ A;  2HHH B;  4R6Z A;  3L75 H;  3PJS K;  3WG7 B;  4LF8 B;  4K0K B;  1J5E B;  3K0G A;  4IIJ B;  4JI2 B;  3W7X A;  5EZY B;  1SA0 A;  3T1C A;  3OD4 A;  4NXN O;  2Y48 A;  2ZIN A;  2CTP A;  2JJ2 G;  4LNU B;  3B4S A;  2ZIM A;  2JEU A;  5BZB A;  1YIT V;  3ZMS A;  2IH3 C;  1I5Y A;  5DEC A;  3EFF K;  4FFB B;  3FB6 C;  1KU9 A;  3CRA A;  1Q6U A;  5CBF A;  2QGN A;  1K5Q A;  4MSW C;  5KHG A;  3HKE A;  3OTO B;  4WBN A;  4I4T B;  3AG7 A;  1Z5W A;  3J80 N;  1BE3 H;  2YIA A;  4DRX B;  2RMK B;  2AZ2 A;  1WB8 A;  4DR4 O;  1MA1 A;  3OUS A;  2F4V O;  3CC4 V;  2ZE6 A;  1YDX A;  1BSM A;  2ZR2 A;  1QHT A;  2UXB O;  2D2C B;  2N05 A;  2HVK C;  2XAQ A;  3AEI A;  1NS1 A;  3KCX A;  3CCJ V;  2WLI B;  4G28 B;  3OEH G;  5L3C A;  4DR5 O;  2ZE5 A;  1VQO V;  4UCV A;  1L0N H;  5LA6 A;  3ZRW B;  1BQZ A;  4OX9 B;  1Q90 D;  3K58 A;  1HW7 A;  5J2U B;  3UT5 A;  4CZZ A;  3ZRX A;  3OR6 C;  2CK3 G;  1MSD A;  2BOB C;  1I08 A;  2ETN A;  2DYR B;  4BIO A;  1OV9 A;  4PA6 A;  2LFR A;  3JAR A;  5JH7 B;  4CH3 A;  4FLZ A;  3ABL B;  2LP7 A;  3SGI A;  1V54 C;  4YJ2 A;  5LBQ A;  2QWP B;  2BTQ B;  4GCZ A;  3OTF A;  2VQE B;  2A0L A;  1R1B A;  4I9W A;  1OCC C;  5LOV B;  3VQW A;  2YXL A;  4YIO A;  4CBC A;  2HJD A;  4FPP A;  2A3Q A;  2RNB A;  5JCO A;  4DV7 B;  3G80 A;  1R3I C;  2KG7 B;  4QIW F;  3ZRS A;  4FIP C;  4B3M B;  4I0X B;  4E4E A;  4UCO A;  3QO5 A;  1K4C C;  1XBL A;  1SS3 A;  4J7K A;  1V9P A;  4F6R B;  2JIZ G;  2A9H A;  2PF4 E;  1VF7 A;  1BQ0 A;  2HFE C;  4PA7 A;  1OCZ C;  4AHC A;  3H1L H;  1XL4 A;  1Y76 B;  4MVM A;  4NXN B;  2V1D A;  5C8Y A;  3OM3 B;  1P49 A;  3EHB B;  2ZE7 A;  1K33 A;  3FB5 C;  3K79 A;  1EZV H;  1U97 A;  1AI6 A;  3ABM B;  4GUN A;  4EKW A;  2QEX V;  3RWR D;  2CGO A;  2E3C A;  4I50 B;  3BCC H;  4LR3 A;  1YTF D;  4UXN A;  3W7S A;  4XDK A;  4MVO A;  5IE9 A;  4DV1 O;  3E2E A;  3M99 B;  1VQ5 V;  2R9R B;  4O4H B;  2BCC H;  1IBK O;  2FKX A;  1JA8 A;  1F51 A;  4DR4 B;  4FM0 A;  3IAY A;  1V55 B;  2F4V B;  4BW5 A;  3MAQ A;  1QLN A;  2W0F C;  5IYZ A;  1VQ9 V;  3G4S V;  5GW7 A;  3SPI A;  2WA3 A;  2EIM C;  2B1I A;  4DR5 B;  2UUC O;  3JCU Z;  2PI4 A;  4O4L B;  1TGO A;  1W59 A;  3CCE V;  2JDI G;  4YJ3 B;  3WB1 A;  4UCU A;  1VIB A;  2F43 G;  4OPA A;  5IYB O;  5CBH A;  5EYP A;  4HYO A;  2Q9L A;  2JS3 A;  3ABK B;  4JAA A;  5JQG B;  4B3R O;  2UU9 O;  2BE3 A;  2R9I A;  3ZCC A;  1JJO A;  2Q7G A;  3DSQ A;  1I7F A;  4FM1 A;  2ZXW B;  1NQT A;  3SYP A;  1AI4 A;  1M1K W;  4PA4 A;  1Q5O A;  1WNS A;  4X1Y B;  3CC7 V;  1DF5 A;  1PD3 A;  3VOU A;  2DWD C;  4DUY O;  1S5L Z;  4LC1 A;  4AQY O;  3JAW A;  1XI1 A;  3JAT A;  1OCR C;  4RAI A;  1BGY H;  1IX9 A;  3JAL A;  2DN9 A;  3SPC A;  1RPR A;  2E74 B;  1YEW A;  5CN0 A;  1XUQ A;  3ETQ A;  4N23 A;  3ZHT A;  2P67 A;  3HKC A;  3WG7 C;  1NVP D;  1TUE B;  1KP3 A;  4DV4 O;  1IVS A;  3H01 A;  3A0R A;  1XIL A;  5EIB C;  2OTJ V;  4LF5 O;  1SZX A;  2ZM6 O;  1SA0 B;  2Y4T A;  4PDM A;  4GKJ O;  2LGQ A;  4IIJ A;  4GT1 A;  2QTO A;  5EZY A;  3CRM A;  2RCV A;  5CBG A;  2YIC A;  5DM6 V;  4FLY A;  4LNU A;  3QO8 A;  3DXR A;  3ZHU A;  4FVM A;  1BHB A;  2QWQ B;  1S5J A;  4RQE A;  3E8G A;  4DV1 B;  2ATK C;  3RYI B;  3E89 A;  4TV9 A;  2R9A A;  5B5E Z;  1IBK B;  3HKE B;  3N2K A;  4WBN B;  2WLH A;  4KHP O;  4BR6 A;  4MTG A;  4I4T A;  3TXS A;  2AW9 A;  2ZDI C;  1EFR G;  1GN2 A;  3LSQ A;  1YJN V;  1QU7 A;  4JI1 O;  1WJZ A;  2JGU A;  3B8M A;  4X1I B;  1Q6H A;  2OIE A;  2ZDI A;  1ZX3 A;  2ADP A;  1XNQ O;  2UUC B;  2A79 B;  2FL4 A;  4PHZ A;  4JI8 O;  1O9H A;  1PV0 A;  4PJ0 Z;  2CH7 B;  2WLI A;  4O4I B;  3ZED A;  5LA6 B;  4CC6 A;  4B3R B;  2UU9 B;  3RYH A;  4TV8 B;  4QNH B;  3UT5 B;  4IT5 A;  2DYR C;  2HLD G;  5B66 Z;  5J2U A;  4EB6 A;  3ABL C;  3KKY A;  2YI9 A;  1VQ6 V;  1PPJ H;  4MTX A;  3JAR B;  2X6B A;  1QVF U;  2CUG A;  1JQ0 A;  4E2L A;  2Y0P A;  2ADQ B;  4RO2 A;  4I9Q A;  4U3J A;  3JYC A;  4PI0 A;  5GTI Z;  1V54 B;  4AQY B;  5FNV A;  2WWW A;  3OMA B;  5KHJ A;  2CGN A;  2GUZ A;  5H5N A;  2MW2 B;  3G71 V;  1GN4 A;  3GB7 C;  3CEI A;  3ETD A;  4D7S A;  1Q81 W;  2XHB A;  1I5X A;  1B3Q A;  2MK3 A;  3CRR A;  3ZIA G;  2GHY A;  2ODM A;  3OAA G;  3OW2 U;  5LHI A;  3BFR A;  4X1K A;  1YJ9 V;  3ZMZ A;  2M7W A;  1SQV H;  2A06 H;  4LF5 B;  3ZJZ A;  2CDY A;  2B9Z A;  2ZM6 B;  2WAM A;  3B8N A;  3I56 V;  3BEH A;  2YIB D;  4GKJ B;  1URF A;  1OZ0 A;  1NJI W;  1Y76 A;  2QM8 A;  3ABM C;  4UVC A;  1U96 A;  1PM9 A;  2CAZ C;  4X20 A;  4FLU A;  1JVM A;  4GLX A;  1M90 W;  4UCR A;  3P32 A;  2AHY A;  1L8D A;  3FYI B;  3CX5 F;  3GVM A;  2CTQ A;  2ZIO A;  1QBZ A;  1XOU A;  4LWS B;  5IYD O;  4KHP B;  5DED A;  1YXB A;  4ZBM A;  3C3S A;  1XNR O;  1N33 O;  4LF4 O;  3ZS8 C;  2AGA A;  2WPD G;  3J81 N;  1AVM A;  1V55 C;  4P2Z A;  5KUM A;  4JI1 B;  1H38 A;  4O4H A;  2W6J G;  2KQX A;  1FJG O;  2UXC O;  1AR4 A;  4EEQ A;  1KUQ A;  1XL6 A;  1XNQ B;  5JJJ B;  3SJA C;  4L8J A;  4W4L A;  2P4K A;  1NTM H;  3MD0 A;  5L3F A;  4JI8 B;  3L9D A;  3SR2 C;  2RN9 A;  1H8E G;  1JR9 A;  2QKS A;  1IDS A;  3CCS V;  4X64 B;  4NKG B;  4DV2 O;  2HP8 A;  2E5L O;  3D36 C;  4O4L A;  3OT7 A;  4JV5 O;  1M5I A;  4WFG A;  2P90 A;  3D36 A;  5EYP B;  4LFB O;  2NR5 A;  1QR8 A;  1E1R G;  1JCH A;  2DE0 X;  1Q3E A;  1R3J C;  4IGG A;  2YIB A;  5H2F Z;  3K5O A;  1QLE B;  2W0X A;  2AXT Z;  4OXS A;  2F23 A;  3GWO A;  1VQP V;  2R70 A;  3BHP A;  3BPZ A;  2ZXW C;  4O2B B;  4ZI7 A;  3SPH A;  4DW1 A;  1WN7 A;  1YHQ V;  3QG5 A;  1K97 A;  3ZMV A;  2XT9 A;  3QTC A;  4JAU A;  3C90 A;  1X4T A;  3K06 A;  4UB8 Z;  2QM4 A;  5FPR A;  1YTF B;  2QDO A;  3HKB A;  4KUM A;  5K1X A;  1PNM A;  3IC9 A;  1VQM V;  2Q69 A;  4A5U B;  4LF7 O;  1KBH A;  4FK5 C;  3JAT B;  4MVU A;  1K5S A;  2FYU H;  3JAL B;  2EUL A;  2XAF A;  4MTO A;  1GN6 A;  4CS3 A;  1ORQ C;  1EBO A;  1P84 F;  4Z1M G;  1VQ4 V;  2F95 B;  3MDS A;  3VQX A;  1SQP H;  5IYC O;  3SYQ A;  3CCQ V;  5EBW C;  1GO3 F;  3F5W C;  3K08 A;  2YS8 A;  3FB7 C;  1H2S B;  1AR5 A;  4FJC C;  4JYA B;  5KAF Z;  3WFV A;  1ZLZ A;  3DXR B;  3JAK B;  4X66 B;  1XNR B;  4LF4 B;  1RFY A;  4TV9 B;  1F4M A;  4RQF A;  3RYI A;  3S3X A;  1X59 A;  1G6U A;  3N2K B;  4WFB V;  1FJG B;  2EJ7 A;  2Q8V A;  4J7Z A;  5KUK A;  4JI5 O;  5DN6 G;  4RWU A;  4LF6 O;  4GX5 A;  4GKK O;  1EM1 A;  4X1I A;  2VWK A;  4DR6 O;  5ITZ A;  3P3N A;  4WCE V;  4DV2 B;  5CA0 A;  2E5L B;  3JAM N;  5LMN O;  5C93 A;  4F4L A;  2OTL V;  1KMI Z;  1UFI A;  4LFB B;  2CH7 A;  4O4I A;  4OGQ B;  1NVP B;  1KB9 F;  3A0H Z;  2X7R B;  3RYH B;  4J41 A;  5KMG A;  3S3W A;  4TV8 A;  4B3T O;  3I55 V;  4EB6 B;  1UPG A;  3UKM A;  4JPR A;  4GX1 A;  1AJP A;  2UUA B;  2YDE A;  2JVD A;  1ZWI C;  4B3S O;  1ROP A;  3CME V;  5KA5 A;  1IBL O;  3CWB H;  4U3J B;  3LNN A;  1B04 A;  2JS5 A;  5FNV B;  4K8Z A;  4NVP A;  3LDC A;  5JCO C;  4LF7 B;  3RYF A;  2GUZ B;  2DQ0 A;  5JJE B;  4FLT A;  4MVZ A;  1YJW V;  3FX7 A;  4DR2 B;  3RVY A;  4J80 A;  3ZHV A;  5B1N A;  4DW0 A;  5IT9 N;  4X1K B;  4JAS A;  3PN1 A;  4CH5 A;  5A2Q N;  4U3F H;  5JVD B;  3CS5 A;  4J9Z B;  3JCZ A;  2RQ6 A;  1BL8 A;  2ITC C;  2IJJ A;  1IBM O;  2L6L A;  3AG3 B;  1P7B A;  3TJT A;  1R6K A;  5IJ0 A;  1GAX A;  3H1H H;  2JGD B;  4X20 B;  2Y4U A;  4PV1 B;  1N32 O;  2E75 B;  3FYE B;  2IU0 A;  4FMT A;  1NU1 H;  4LFC O;  3ZRV A;  3ETE A;  2K1E A;  2H8P C;  1M4U A;  3KZI Z;  4YHH O;  4XDL A;  4KXR A;  3QF7 A;  4LWS A;  1Y74 A;  2P4V A;  4YXW G;  2EJR A;  5J2T B;  3K59 A;  1Z2G A;  3M7M X;  2WLN A;  1B06 A;  2BSK A;  4GX0 A;  2E76 B;  4LF6 B;  1FS0 G;  3WB2 A;  4DR6 B;  2QM7 A;  5LYJ A;  5LMN B;  4QE9 A;  1HR0 O;  4P9O A;  2Q4P A;  4G2K A;  2ZNI A;  2UXB B;  1VF6 C;  1SET A;  3U0Z A;  3BAB A;  1Y66 A;  5EBM C;  3L71 H;  2JJ1 G;  4PA9 A;  4QGP A;  2B5U A;  2GTA A;  1VF6 A;  1KKD A;  1MOF A;  5EC2 C;  2EIN B;  4JGS A;  3K9S A;  1FXK A;  3B40 A;  1QLE C;  1DF4 A;  3A2F A;  4PI2 A;  2M6Y A;  4PDV A;  2HVJ C;  3HKD A;  2L35 A;  4C7U A;  1Y67 A;  3TET A;  3CRC A;  3ICX A;  4X8A A;  1OCO B;  3CPW U;  4B3S B;  3QVN A;  1SQX H;  4TUY A;  4JTD B;  3LDE A;  4ZI7 B;  1IBL B;  2Q7H A;  2DW4 A;  5J9P C;  4O2B A;  1Z5V A;  3HKB B;  1BS3 A;  3T2M A;  4H13 B;  4DR1 O;  3SYA A;  1CP9 A;  3H1J H;  3C3T A;  3AK3 A;  1KEC A;  1GTO A;  2DWE C;  4H37 A;  3SJQ C;  4L87 A;  2WA4 A;  4JYY A;  1EN6 A;  3CB2 A;  2C2A A;  1S72 V;  1WAZ A;  4Q20 A;  1CPY A;  2ZNJ A;  4LH7 A;  1H2K A;  3O9O A;  4MTF A;  1IBM B;  2FB5 A;  5KAI Z;  5L3B A;  1Q43 A;  1PNL A;  4EFE A;  2PYJ A;  1N32 B;  3BY6 A;  1VQN V;  4LFC B;  3R65 A;  4ASU G;  2QSA A;  3TXQ A;  4YHH B;  2Y69 B;  2ZKO A;  5LHH A;  3L70 H;  1NR1 A;  3JAK A;  1FYJ A;  1SC5 B;  1LUV A;  3E8B A;  2NN4 A;  2ZQM A;  2OIG A;  5BMV A;  3OGI B;  1SKV A;  1Q6I A;  2WLL A;  3SPJ A;  2XAG A;  2NLJ C;  3CSX A;  2CTR A;  4ZOL A;  1WA8 A;  1EN4 A;  2P6J A;  3APO A;  3UCS C;  1HR0 B;  3AG4 B;  3JAS A;  5B3S B;  5GTH Z;  2AHZ A;  4NR1 A;  4KL1 A;  5ITZ B;  1TVK B;  5CA0 B;  2UUB O;  4MW8 A;  4R8C A;  2KSD A;  2UXN A;  5LXT B;  4B7K A;  1JJ2 U;  2FTK A;  4J42 A;  1HNX O;  5KA6 A;  4WFH A;  5KMG B;  1TUB B;  1QQC A;  3TCU A;  4K8X A;  3E22 A;  1NBM G;  2Q0O C;  4X88 A;  1G8M A;  3OFN G;  4ZIB A;  3T1Y O;  1KKC A;  4HNA A;  3CD6 V;  4J11 A;  1AI5 A;  5LP6 C;  3STL C;  4DUY B;  4KFM A;  3RYF B;  3CC2 V;  1XQ8 A;  3RT3 C;  5LP6 A;  3B77 A;  3E8H A;  3MHH C;  3DGE A;  3E35 A;  4JI4 O;  1XHZ A;  1K9M W;  1WLE A;  1ZL8 A;  4XDJ A;  3ZX6 A;  4LH6 A;  5LMU O;  1D2D A;  4DK1 A;  2Z0A A;  1MZE A;  3CCM V;  4D7T A;  2XOK G;  2QWO B;  1MZF A;  2K9P A;  4JI6 O;  4PD4 F;  4JI7 O;  4DV4 B;  5D5P A;  1XDC A;  4YIP A;  1AP6 A;  2RJZ A;  3ABU A;  5JVD A;  3AG3 C;  2EIJ C;  5IJ0 B;  1SRY A;  2QA4 V;  3OEE G;  4DK0 A;  3R66 A;  2HJF C;  4CS4 A;  3O65 A;  2JGD A;  2CTW A;  4P9P A;  3J7A U;  2VWJ A;  2WLJ A;  4UVA A;  4IL6 Z;  4FM2 A;  2IJH A;  1R3L C;  3BA9 A;  3RYC A;  1D5A A;  5EK0 A;  2PYL A;  5CB4 A;  3N27 A;  2QE7 G;  3CYO A;  2LQT A;  1KC8 W;  1Y74 B;  3A0B Z;  5TIS Z;  3H1K H;  1Q8I A;  4DV5 O;  5J2T A;  1JMK C;  2BSK B;  1HNZ O;  3F5T A;  1FAF A;  3CMA V;  4DUZ O;  2UXD O;  1N8R W;  3GWK C;  2LW7 A;  1FFX A;  1SQB H;  5LYJ B;  4G27 B;  3CCR V;  1SZT A;  3SPG A;  2UUB B;  3LUT B;  5KHH A;  3D3I A;  1GKF A;  1YI2 V;  1AIL A;  1ZSP A;  2DOS A;  2ARH A;  1S5H C;  1LR1 A;  2B1G A;  3FAV B;  4UVB A;  3JSL A;  2EIN C;  2WLK A;  3QNE A;  1HNX B;  1NH2 D;  3CJH B;  5H9C A;  3HR0 A;  4LFA O;  1FXK B;  2DQ3 A;  3K0D A;  3BRC A;  1W2B U;  1OCO C;  3HKD B;  4NYK A;  4UFZ A;  5BR8 O;  4TUY B;  1LUW A;  3JD4 A;  1K8A W;  1H2M A;  4ABM A;  3NR7 A;  3P30 A;  5CA1 A;  2HG5 C;  2IM9 A;  4IHJ A;  1NTZ H;  5IJ9 B;  3VBB A;  2YXH A;  1NZ6 A;  5B1A B;  1SQF A;  4FFK A;  4NTX A;  5B1B C;  3AG1 B;  4JI4 B;  4FZ1 A;  5GON B;  2EIL B;  1MNG A;  3CCL V;  3K9A A;  1ENV A;  2O57 A;  2Q6A A;  5LMU B;  1DK1 A;  2YSU B;  3ZN0 A;  2OWO A;  3ETG A;  2F93 B;  1BHA A;  1L0L H;  3VQV A;  4LF9 O;  3RFR A;  3A8T A;  4JI6 B;  4JI7 B;  3CCU V;  4AI8 A;  1N0J A;  1VQ7 V;  5KHK A;  4QPK A;  1F4N A;  2ILM A;  2AZ0 A;  4JF3 A;  5AG2 A;  2VQE O;  1YIJ V;  4JAV A;  1VF5 B;  4K3A A;  2LO1 A;  1IUR A;  3HB3 B;  1GN3 A;  3K5N A;  5LGU A;  2DJV A;  2JEX A;  4I7Z B;  4ZKI A;  2F1M A;  1E79 G;  3EVK A;  3TK1 A;  5CMU A;  1US6 A;  2XUM A;  2X6C A;  2Y69 C;  1JFF A;  5IY5 B;  5KHI A;  4PA3 A;  3ZHQ A;  4DV5 B;  1SQG A;  5BMV B;  1N33 B;  4BIU A;  3D8C A;  5A9G A;  3DTU B;  1HNZ B;  1F23 A;  2WLL B;  3AK1 A;  4DUZ B;  4WFE A;  2UXD B;  4BIZ A;  2DYS B;  3K3W A;  4ZOL B;  2UXC B;  3AG4 C;  5B3S C;  1WA8 B;  5K1P A;  3JD3 A;  2IJK A;  4O4J B;  1IXM A;  3JAS B;  2GBO A;  2F66 C;  2VRZ A;  1SER A;  1GH6 A;  1UJW B;  3ZMU A;  1Q86 W;  1GM8 A;  3L73 H;  5IWA O;  1VMG A;  2Q67 A;  5EBL C;  1TVK A;  4I5S A;  1K7D A;  5LGT A;  1Y6X A;  3M8A A;  4TSF G;  4LFA B;  3B09 A;  4JV5 B;  1WPB A;  2XAH A;  4I55 A;  5LXT A;  1XRE A;  1G1X B;  1M56 C;  3JD2 A;  3Q4H A;  4W4K A;  2PY5 A;  1EN5 A;  1NI8 A;  5BR8 B;  3UQ8 A;  4X89 A;  4O2A A;  3E22 B;  3ZMT A;  1TUB A;  2PZS A;  4BWA A;  3LSU A;  1BZK A;  2BOC C;  3ASO B;  1K92 A;  1GM7 A;  2IH1 C;  1O9G A;  4QJF B;  2PGG A;  3THO A;  5F2V O;  3UO3 A;  2GSM B;  2QWN B;  4HNA B;  4JTA B;  4RUF A;  2XND G;  1J95 A;  2ZCE A;  1FKA O;  4GX2 A;  4KP4 A;  2IBZ H;  2ITD C;  3WU2 Z;  4B08 A;  1Q82 W;  1PL4 A;  5LP6 B;  1VQL V;  2QWR B;  3SDL A;  1XEQ A;  4WFF A;  3FD9 A;  4DR7 O;  3T4D A;  4LF9 B;  4R50 A;  1M93 A;  1ZL8 B;  2CE4 A;  4Q6G A;  2XTA A;  4JYC A;  4BAY A;  2YXY A;  4LCU C;  3KCY A;  4DO2 A;  1NR7 A;  1OHH G;  2V4D A;  4DV3 O;  1AJN A;  4U7N A;  1AI7 A;  5L3E A;  4NTW A;  2BTO A;  3ZHR A;  3FFQ A;  3ML0 A;  2QKA A;  3JD0 A;  2V7Q G;  1GK9 A;  2XAS A;  1YZB A;  2H3O A;  4NB5 A;  1VQK V;  3X2Q B;  2EIJ B;  1ZUQ A;  4TT3 G;  1XMO O;  4N21 A;  1AJQ A;  1N0N A;  4PDL A;  3RYC B;  1R6N A;  2YI8 A;  3STZ C;  5EC1 C;  5CB4 B;  3SYC A;  4CH4 A;  3E86 A;  3P3P A;  4HBN A;  1QVG U;  4MVS A;  4JZG A;  1WP7 A;  5KX5 A;  1Y4M A;  1N34 O;  4LBE C;  1AP5 A;  4AIL C;  4JI5 B;  5LGN A;  5B1O A;  2FML A;  4JI3 O;  4DR3 O;  4GKK B;  4MVR A;  5IWA B;  3H1I H;  1H2N A;  3VQY A;  1FFX B;  3T1H O;  4D6T H;  1S3J A;  4UCS A;  3MHS C;  1W0K G;  4CC5 A;  4EFB A;  2QKC A;  3ASN B;  1PL0 A;  2HKO A;  4X65 O;  3K03 A;  2G38 A;  2P06 A;  1ZAU A;  3FAV A;  2Q73 A;  4ZHQ A;  4DV0 O;  1FXK C;  3G6B A;  4JTC B;  1OJH A;  1TA8 A;  2IJI A;  4NTY A;  5KLV H;  1DGS A;  1KP2 A;  2N74 A;  3AG2 C;  3CJH A;  1SES A;  1D5N A;  2WSS G;  3W7U A;  2P5O A;  2KKW A;  1H8H G;  4B3T B;  5E79 Z;  1THZ A;  3NXS A;  1N4C A;  1SQQ H;  3JSN A;  2NNU A;  3QO7 A;  2Q0A A;  1NKD A;  4X9Q A;  1VEW A;  5BY1 A;  1M57 B;  3CP1 A;  4FZ0 A;  5CA1 B;  1Q7Y W;  4MW3 A;  1P7G A;  2YEV B;  5B1A C;  1QNM A;  5EIB D;  3AG1 C;  4IHJ B;  2H94 A;  4DYL A;  5L3G A;  2D3O W;  2EIL C;  5IJ9 A;  1R73 A;  3DC6 A;  4DR7 B;  3OUF A;  1H2L A;  1RPO A;  2Z5U A;  1R3K C;  2ZR3 A;  5GON A;  1L1F A;  1TAE A;  2Z3Y A;  2YID A;  5B1B B;  1B6Q A;  4Z1V A;  3DC5 A;  2Y0I A;  5H6Q A;  4DV3 B;  2JK5 C;  4U7O A;  4X62 O;  2GV9 A;  3N2G A;  2OYQ A;  5FL7 G;  1RM1 B;  4WFA V;  1I94 O;  3K57 A;  3OR7 C;  2YUA A;  3SJB C;  2A7W A;  3OE7 G;  1NH2 B;  1QCE A;  1XMO B;  2P7T C;  2OCC B;  5IY5 C;  3CCV V;  3BA8 A;  2R72 A;  2QR4 A;  1I0H A;  2PUS A;  4UV9 A;  4MT8 A;  1JFF B;  1RSO B;  2EZP A;  2OCH A;  1T5E A;  2QJ1 A;  4UCT A;  2EIK B;  4R7C A;  3RGB A;  1FPO A;  1HNW O;  3APQ A;  1N34 B;  3EXA A;  2DYS C;  4TOI A;  4H0L B;  4JI3 B;  5HFM A;  5H6R A;  4DR3 B;  1MMM A;  2EX3 A;  1KD1 W;  4K35 A;  1COW G;  5JWP A;  3T1H B;  1K4D C;  2LW1 A;  2PTM A;  1HWY A;  4NXM O;  3IGA C;  2OT5 A;  4O4J A;  3G6E V;  2VS0 A;  2Q7E A;  4UB6 Z;  4X65 B;  4FFB A;  2P22 C;  1W0J G;  4DV0 B;  1GRJ A;  5FPO A;  2X0L A;  1PP9 H;  4J10 A;  1PNK A;  4JI0 O;  3CHX A;  3FB8 C;  4I55 B;  4CS2 A;  4FLW A;  4J9Y B;  4DRX A;  5LL6 Y;  2IW5 A;  4WF9 V;  3Q4H B;  3F7V C;  3ZBH A;  4O2A B;  1MSW D;  3WB0 A;  5LHG A;  1SF9 A;  4JZ2 A;  4DV6 O;  1M56 B;  3ASO C;  1K34 A;  4B7E A;  1HP8 A;  1XHX A;  3K04 A;  1XMQ O;  1KYO F;  3ZN1 A;  1MG1 A;  3UM7 A;  4UV8 A;  4FLX A;  4X64 O;  3F7Y C;  1BT8 A;  3W7W A;  1DTO A;  3CE2 A;  1IXB A;  2VQF O;  3UO2 A;  1JOY A;  4LP8 A;  3CXC U;  2W6I G;  4DR1 B;  4OPH A;  3ZRW A;  3G67 A;  1FXH A;  3BVO A;  5IDJ A;  4DXW A;  1E1Q G;  1RP3 B;  2EZO A;  3AK2 A;  4QPJ A;  4X62 B;  2PI5 A;  5JH7 A;  4YJ2 B;  1VQ8 V;  1YVW A;  3U10 A;  2BTQ A;  2YC0 A;  5LOV A;  1I94 B;  3TGU H;  2HEP A;  3OGC C;  4UUJ C;  1BCC H;  3RBZ A;  1GM9 A;  1N36 O;  1OCC B;  3L72 H;  2GDS A;  3OMN B;  1GMG A;  2LFS A;  1JPX A;  2KG7 A;  4TQF A;  3X2Q C;  1WPX A;  3L74 H;  4I0X A;  4YY3 O;  3SYO A;  1G4Y B;  3IJ4 A;  4XBF A;  1F7Y A;  3BAA A;  5E1A C;  1HNW B;  2KB1 A;  1FFT B;  4HAM A;  4GZR B;  1AR1 B;  4F6R A;  2DMX A;  3ZHS A;  2HHH O;  1S77 D;  1HDJ A;  1YCI A;  1BMF G;  1ZTE A;  3D3Q A;  5C8Y B;  5KX5 B;  3B2E E;  4K0K O;  4LF8 O;  3HPL C;  1J5E O;  1OCZ B;  4NXM B;  1VP7 A;  1LNQ A;  4JI2 O;  1R6T A;  3W7T A;  1QR9 A;  2LGW A;  4RUE A;  4JYA O;  3ABT A;  4IYH A;  4FLV A;  4I50 A;  3ASN C;  1NT2 B;  3H9V A;  4IYI A;  4X66 O;  4JI0 B;  1A32 A;  5HFL A;  3K5L A;  5L3D A;  3RW0 A;  3IC7 A;  4Z2W A;  4QE7 A;  3CRQ A;  3JD1 A;  4ZHQ B;  1WP8 A;  3E8F A;  4P30 A;  1S76 D;  3U11 A;  3OTO O;  2QTS A;  2ZT9 B;  5CA3 A;  4DV6 B;  2UXX A;  4F6E A;  1KQS U;  5IYZ B;  3E83 A;  3AG2 B;  1XMQ B;  2X6A A;  1MAB G;  1JX9 A;  3T4Z A;  1M57 C;  1K3E A;  4PEL A;  1IZ3 A;  2N04 A;  3T1Y B;  3I5D A;  2VQF B;  1DLB A;  2EBO A;  2EIM B;  1CEZ A;  3RVZ A;  4YJ3 A;  4J7J A;  4TQD A;  2HR3 A;  2XAJ A;  1VAR A;  3ABK C;  2YEV A;  3IFX A;  1ARO P;  3KG2 A;  5FLX N;  3SJC C;  4H33 A;  4MVQ A;  5JQG A;  1CXZ B;  4ICG A;  4GYC B;  4OX9 O;  1S0V A;  2Q68 A;  1NTK H;  4BW9 A;  5JJN B;  1H2G A;  3CXH F;  2IU3 A;  4PDR A;  4CH6 A;  3K5M A;  4H44 B;  2Q5Z A;  2UUA O;  1N36 B;  2WLM A;  1FXV A;  3RN4 A;  1RM1 C;  4X1Y A;  5D5Q A;  1K73 W;  3N2G B;  3FKS G;  3OMI B;  2ZD9 A;  1YF2 A;  1P4R A;  4HZ3 A;  3JAW B;  1PKX A;  2JRI A;  4JYB A;  1AB3 A;  2OCC C;  4YY3 B; 
#chains in the Genus database with same CATH homology
 3ZIA G;  1M9N A;  4U7N A;  1AI7 A;  5L3E A;  4Q20 A;  1CPY A;  1EZJ A;  3ML0 A;  3LNM B;  2GHY A;  3OAA G;  4MTF A;  3OW2 U;  3JD0 A;  2V7Q G;  1YSC A;  1GK9 A;  1OCR B;  5LHI A;  3LSS A;  5L3B A;  2EIK C;  3LDD A;  2XAS A;  4TWK A;  3ZMZ A;  1YJ9 V;  2M7W A;  1VQK V;  1PNL A;  3X2Q B;  2EIJ B;  4MS2 A;  3ZJZ A;  3BY6 A;  4TT3 G;  4N21 A;  1VQN V;  1AJQ A;  4PDL A;  2WAM A;  3B8N A;  3R65 A;  3I56 V;  3BEH A;  4R6Z A;  1R6N A;  4ASU G;  1OZ0 A;  3STZ C;  5EC1 C;  3PJS K;  1NJI W;  2QM8 A;  3WG7 B;  3SYC A;  3E86 A;  3ABM C;  4UVC A;  3K0G A;  2Y69 B;  5LHH A;  1JVM A;  1NR1 A;  1M90 W;  3P32 A;  1QVG U;  3E8B A;  4MVS A;  3W7X A;  2AHY A;  3T1C A;  2Y48 A;  2ZQM A;  1Y4M A;  3FYI B;  4LBE C;  2JJ2 G;  1QBZ A;  2WLL A;  3SPJ A;  5LGN A;  5IYD O;  2JEU A;  5BZB A;  2XAG A;  5B1O A;  2NLJ C;  1YIT V;  3ZMS A;  2IH3 C;  4ZBM A;  4MVR A;  1I5Y A;  3EFF K;  3FB6 C;  2WPD G;  2P6J A;  1S3J A;  1V55 C;  5CBF A;  3MHS C;  4P2Z A;  5KUM A;  3AG4 B;  1K5Q A;  1W0K G;  4MSW C;  5B3S B;  1H38 A;  2W6J G;  2AHZ A;  3ASN B;  1PL0 A;  2HKO A;  1XL6 A;  3K03 A;  4MW8 A;  1FXK C;  3MD0 A;  5L3F A;  4JTC B;  2IJI A;  4R8C A;  1KP2 A;  3AG2 C;  1SES A;  3OUS A;  2WSS G;  1H8E G;  2QKS A;  3CCS V;  3CC4 V;  2UXN A;  3W7U A;  1H8H G;  2ZR2 A;  1JJ2 U;  2FTK A;  1THZ A;  3NXS A;  5KA6 A;  4WFH A;  2HVK C;  2NNU A;  3QO7 A;  3AEI A;  2XAQ A;  3CCJ V;  2WLI B;  1NKD A;  4G28 B;  3OEH G;  4WFG A;  3TCU A;  2P90 A;  3D36 A;  5L3C A;  1QR8 A;  1M57 B;  3CP1 A;  1E1R G;  1JCH A;  1NBM G;  1VQO V;  1Q7Y W;  1R3J C;  4MW3 A;  4X88 A;  2YEV B;  1QLE B;  5B1A C;  1G8M A;  4OXS A;  3ZRW B;  3AG1 C;  3OFN G;  2H94 A;  3GWO A;  5L3G A;  1VQP V;  2D3O W;  2EIL C;  4CZZ A;  2ZXW C;  1R73 A;  3ZRX A;  3OR6 C;  3CD6 V;  2CK3 G;  3SPH A;  1AI5 A;  2BOB C;  3OUF A;  3STL C;  1YHQ V;  1RPO A;  2Z5U A;  2DYR B;  1K97 A;  1R3K C;  2ZR3 A;  1L1F A;  3ZMV A;  2Z3Y A;  2LFR A;  4PA6 A;  4KFM A;  5B1B B;  4JAU A;  3ABL B;  3K06 A;  3CC2 V;  1B6Q A;  2LP7 A;  1V54 C;  1YTF B;  3B77 A;  5LBQ A;  3E8H A;  3MHH C;  3DGE A;  3E35 A;  4KUM A;  4GCZ A;  2A0L A;  4I9W A;  1OCC C;  1PNM A;  1K9M W;  1WLE A;  1VQM V;  5H6Q A;  2JK5 C;  4U7O A;  2Q69 A;  4XDJ A;  4CBC A;  4FPP A;  4FK5 C;  3CCM V;  5FL7 G;  2XOK G;  1R3I C;  4MVU A;  4WFA V;  1RM1 B;  1K5S A;  4QIW F;  4MTO A;  2XAF A;  3OR7 C;  3ZRS A;  4FIP C;  3OE7 G;  3QO5 A;  1NH2 B;  1QCE A;  1ORQ C;  3ABU A;  1K4C C;  1EBO A;  2P7T C;  3AG3 C;  4Z1M G;  2OCC B;  5IY5 C;  3CCV V;  2EIJ C;  1VQ4 V;  4UV9 A;  4MT8 A;  2EZP A;  1SRY A;  2QA4 V;  3OEE G;  2JIZ G;  2A9H A;  5IYC O;  2HJF C;  3SYQ A;  2EIK B;  3CCQ V;  2HFE C;  4P9P A;  4R7C A;  5EBW C;  1GO3 F;  3F5W C;  3K08 A;  4PA7 A;  2WLJ A;  1OCZ C;  4UVA A;  1XL4 A;  1R3L C;  2IJH A;  3FB7 C;  4MVM A;  5EK0 A;  2V1D A;  2QE7 G;  4FJC C;  3OM3 B;  3WFV A;  2DYS C;  3EHB B;  3CYO A;  1K33 A;  3FB5 C;  3K79 A;  1KC8 W;  1AI6 A;  5HFM A;  5H6R A;  3ABM B;  4EKW A;  2QEX V;  1KD1 W;  1COW G;  1K4D C;  1F4M A;  4RQF A;  3CMA V;  1HWY A;  3IGA C;  2OT5 A;  1YTF D;  3G6E V;  1N8R W;  4WFB V;  4UXN A;  3W7S A;  4XDK A;  4MVO A;  3E2E A;  4G27 B;  3CCR V;  3M99 B;  1VQ5 V;  1SZT A;  2R9R B;  1W0J G;  3SPG A;  5KUK A;  2X0L A;  3LUT B;  5DN6 G;  1F51 A;  1PNK A;  3D3I A;  1GKF A;  4GX5 A;  1V55 B;  1YI2 V;  1S5H C;  2B1G A;  3FB8 C;  4BW5 A;  4UVB A;  4WCE V;  2EIN C;  2WLK A;  3QNE A;  5C93 A;  4F4L A;  4J9Y B;  2W0F C;  1QLN A;  1NH2 D;  2OTL V;  1VQ9 V;  2IW5 A;  3G4S V;  4WF9 V;  5GW7 A;  5H9C A;  3SPI A;  2EIM C;  2B1I A;  3F7V C;  1FXK B;  2DQ3 A;  1MSW D;  3K0D A;  5LHG A;  1W2B U;  2PI4 A;  1M56 B;  3ASO C;  1OCO C;  1K34 A;  3CCE V;  2JDI G;  1NVP B;  3K04 A;  2X7R B;  3ZN1 A;  1MG1 A;  3UM7 A;  4UV8 A;  2F43 G;  3F7Y C;  3W7W A;  5IYB O;  1DTO A;  5CBH A;  3JD4 A;  3I55 V;  1K8A W;  4HYO A;  1JOY A;  3ABK B;  3P30 A;  4LP8 A;  2W6I G;  2HG5 C;  3UKM A;  3CXC U;  4JPR A;  4GX1 A;  1AJP A;  3ZRW A;  1ZWI C;  1ROP A;  3VBB A;  3CME V;  5B1A B;  1FXH A;  5KA5 A;  5IDJ A;  5B1B C;  2R9I A;  3AG1 B;  3ZCC A;  1E1Q G;  4DXW A;  2EIL B;  3CCL V;  2ZXW B;  2EZO A;  3K9A A;  1ENV A;  1NQT A;  3LDC A;  3SYP A;  4QPJ A;  2PI5 A;  1AI4 A;  1M1K W;  4PA4 A;  2Q6A A;  1VQ8 V;  3CC7 V;  1DF5 A;  2YSU B;  3ZN0 A;  3ETG A;  1BHA A;  1PD3 A;  2DQ0 A;  4MVZ A;  3VOU A;  2DWD C;  4LC1 A;  3OGC C;  4UUJ C;  3RBZ A;  3CCU V;  1YJW V;  1GM9 A;  1OCC B;  1VQ7 V;  4QPK A;  1F4N A;  3RVY A;  4JF3 A;  3OMN B;  1YIJ V;  1OCR C;  4JAV A;  1GMG A;  2LFS A;  1JPX A;  4RAI A;  5B1N A;  3X2Q C;  3HB3 B;  1WPX A;  3SPC A;  5LGU A;  1RPR A;  4JAS A;  3SYO A;  5CN0 A;  2JEX A;  4N23 A;  1G4Y B;  4J9Z B;  4ZKI A;  2P67 A;  4XBF A;  3JCZ A;  1E79 G;  3TK1 A;  5CMU A;  1BL8 A;  5E1A C;  3WG7 C;  2ITC C;  2KB1 A;  1NVP D;  1TUE B;  2X6C A;  2IJJ A;  1FFT B;  1KP3 A;  2Y69 C;  3H01 A;  4HAM A;  3AG3 B;  1P7B A;  3A0R A;  1R6K A;  5IY5 B;  1AR1 B;  2OTJ V;  4PA3 A;  1S77 D;  3FYE B;  2IU0 A;  4FMT A;  3ZRV A;  4PDM A;  1BMF G;  3ETE A;  2K1E A;  4GT1 A;  2QTO A;  4BIU A;  2H8P C;  3DTU B;  3HPL C;  1F23 A;  1OCZ B;  5CBG A;  2WLL B;  5DM6 V;  3QO8 A;  4WFE A;  4XDL A;  4YXW G;  1BHB A;  4BIZ A;  2DYS B;  2EJR A;  1LNQ A;  3K3W A;  4RQE A;  3E8G A;  3AG4 C;  5B3S C;  2ATK C;  1QR9 A;  2WLN A;  3JD3 A;  3W7T A;  2IJK A;  4RUE A;  3ABT A;  3E89 A;  4GX0 A;  1IXM A;  3ASN C;  1SER A;  1UJW B;  1FS0 G;  2WLH A;  3ZMU A;  5HFL A;  1Q86 W;  1GM8 A;  5L3D A;  3RW0 A;  3IC7 A;  4MTG A;  2Q67 A;  4QE7 A;  5EBL C;  2QM7 A;  2ZDI C;  3JD1 A;  4I5S A;  4QE9 A;  1EFR G;  3LSQ A;  4P9O A;  1YJN V;  1K7D A;  4G2K A;  3E8F A;  4P30 A;  1S76 D;  5LGT A;  1SET A;  3B8M A;  4TSF G;  1Y66 A;  5EBM C;  2ZDI A;  2JJ1 G;  4PA9 A;  2B5U A;  5CA3 A;  2XAH A;  2A79 B;  2UXX A;  1KQS U;  3E83 A;  3AG2 B;  1KKD A;  2X6A A;  1MOF A;  1M56 C;  1MAB G;  1JX9 A;  5EC2 C;  2EIN B;  3JD2 A;  3T4Z A;  1M57 C;  4JGS A;  1K3E A;  1FXK A;  4PEL A;  4X89 A;  2WLI A;  3ZMT A;  1DLB A;  1QLE C;  1DF4 A;  2EBO A;  2EIM B;  4PDV A;  1CEZ A;  3RVZ A;  2HVJ C;  3TET A;  2BOC C;  4X8A A;  3ASO B;  2HR3 A;  2XAJ A;  1K92 A;  1GM7 A;  1OCO B;  3ABK C;  2IH1 C;  2YEV A;  3CPW U;  4QJF B;  4QNH B;  4JTD B;  2DYR C;  2GSM B;  4RUF A;  4JTA B;  2HLD G;  3IFX A;  3LDE A;  1ARO P;  2XND G;  3KG2 A;  2DW4 A;  3ABL C;  5J9P C;  4H33 A;  4MVQ A;  1VQ6 V;  1J95 A;  4GX2 A;  4MTX A;  2X6B A;  1QVF U;  4KP4 A;  2ITD C;  1S0V A;  1Q82 W;  2Q68 A;  1VQL V;  1JQ0 A;  4E2L A;  1H2G A;  3T2M A;  2IU3 A;  4PDR A;  4RO2 A;  4WFF A;  3JYC A;  3SYA A;  3T4D A;  1CP9 A;  1V54 B;  4R50 A;  2WWW A;  3OMA B;  1KEC A;  1FXV A;  2WLM A;  1GTO A;  2DWE C;  4H37 A;  4BAY A;  4JYC A;  1RM1 C;  1K73 W;  3SJQ C;  3FKS G;  4L87 A;  3OMI B;  4LCU C;  3G71 V;  4DO2 A;  1NR7 A;  2ZD9 A;  3GB7 C;  1P4R A;  3ETD A;  4HZ3 A;  1OHH G;  1PKX A;  1Q81 W;  1I5X A;  4JYB A;  2C2A A;  2MK3 A;  1S72 V;  1AJN A;  2OCC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...