5CBHA

Structural and functional characterization of a calcium-activated cation channel from tsukamurella paurometabola
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
102
structure length
102
Chain Sequence
TLMFKRFFGAVRTSWRDPSTRGAVLSLAIIVTAATIFYTLAEKWSVIDSLFYAVSVGLPMGNGPLSPTLTLSKIFTLVYAILVVGLFVTVGGSLASAIVQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of a calcium-activated cation channel from Tsukamurella paurometabola.
pubmed doi rcsb
source organism Tsukamurella paurometabola (strain atcc 8368 / dsm 20162 / jcm 10117 / nbrc 1612
molecule tags Transport protein
molecule keywords Ion transport 2 domain protein
total genus 28
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5cbhA00
2X6CA 3SPJA 3EFFK 1R3JC 1JVMA 1OCOC 4MS2A 4PA4A 2WLKA 3LDCA 4P9PA 3E89A 4OXSA 3ZRSA 3T2MA 2WLHA 3UKMA 3VOUA 5KUKA 3OUFA 2ITCC 1R3KC 4MVRA 2WLLB 2ZXWC 5B1BC 4JTCB 2HVJC 4PA9A 4MVUA 4RAIA 2ZD9A 3GB7C 4GX5A 3STZC 4F4LA 4GX2A 3E8HA 2WLNA 4QE7A 3WG7C 3ASOC 4MVMA 3SPCA 4HZ3A 4PA7A 4P9OA 1R3LC 3K03A 1XL4A 3K08A 4DXWA 1KKDA 4HYOA 5BZBA 3JYCA 4JTDB 2A9HA 2Q6AA 2IH1C 3HPLC 2K1EA 3OUSA 1ORQC 3SPHA 3IFXA 3KG2A 2DYRC 4I9WA 5KUMA 2X6BA 3SPGA 2X6AA 4XDKA 4PA6A 3F7VC 3TETA 1P7BA 2Q68A 3RW0A 3IGAC 5EC2C 4EKWA 4MTGA 2IH3C 3SYPA 2WLJA 4H37A 2A0LA 4MSWC 4X88A 2EIMC 2BOCC 2YEVA 4ZBMA 4QNHB 5J9PC 2A79B 4MW3A 4XDJA 3SPIA 4RUEA 5EK0A 4P30A 4QE9A 1ZWIC 3LDDA 2KB1A 2HJFC 3ABMC 3STLC 4MVQA 4LCUC 4RUFA 3ASNC 2JK5C 3OGCC 4WFEA 5EBWC 2ATKC 5IY5C 2WLMA 3SYAA 3E8FA 4R6ZA 4WFGA 3X2QC 4UUJC 1R3IC 2BOBC 3LUTB 1QLEC 5EC1C 2HVKC 3RVYA 3RBZA 1V55C 4PDLA 4H33A 2AHZA 4R8CA 3AG4C 1LNQA 3ABLC 3E8GA 5CBHA 3BEHA 2AHYA 5E1AC 2EINC 4PDVA 2EIKC 4LBEC 3T4ZA 1M56C 1OCCC 5B3SC 2WLIB 1V54C 4G28B 2R9RB 3R65A 1XL6A 2EIJC 3ABKC 4R50A 1K4CC 4MVOA 3E86A 4BW5A 3TCUA 3OR7C 4TWKA 1J95A 3K06A 2DWEC 2QKSA 2QTOA 3T4DA 1OCZC 4MW8A 4GX0A 4X89A 4MTOA 4X8AA 4PA3A 1K4DC 3FB6C 3AG3C 4WFFA 3F5WC 3E8BA 2NLJC 4JTAB 4LP8A 4MTFA 3SJQC 2Y69C 1M57C 4GX1A 3LDEA 4CBCA 3LNMB 2ITDC 4PDRA 5EBMC 4MVSA 4RO2A 3UM7A 3K0GA 2W0FC 4MVZA 3FB7C 4P2ZA 3SYOA 5CBGA 4WFHA 3T1CA 3AG2C 2DWDC 2Q67A 4R7CA 4KFMA 2WLIA 5B1AC 5CBFA 2H8PC 3E83A 2WLLA 3PJSK 5EBLC 3SYCA 3SYQA 3ZJZA 1BL8A 1OCRC 3K04A 3K0DA 3F7YC 4J9ZB 1G4YB 4XDLA 2EILC 2HFEC 2OCCC 3AG1C 3FB8C 3RVZA 2HG5C 2P7TC 4G27B 3OR6C 3FB5C 2DYSC 4J9YB 1S5HC 4PDMA 2Q69A
chains in the Genus database with same CATH superfamily
3HKBA 1TAEA 1GN6A 3H1HH 2P06A 2GUZB 2E75B 3OUFA 1NKDA 1K5QA 2WLLB 1PM9A 4GX5A 3STZC 1BQZA 4LNUB 5D5QA 1XMOO 1AI4A 3HPLC 4JYCA 3FFQA 1FYJA 4HBNA 4W4KA 1I08A 3AG7A 5IYDO 4IHJB 4JI3B 4FM0A 3CD6V 1YDXA 4BIZA 4H37A 2LFRA 4GYCB 4ZBMA 5E79Z 4LFCO 4ZI7A 1AR4A 1OCOB 4UVAA 1Z2GA 3E8FA 1H2NA 4UUJC 3ZMZA 3ZHVA 2OWOA 2KSDA 4CH3A 2EIJB 3AG4C 3CHXA 3E8GA 1RSOA 2D2CB 3K57A 1KD1W 2EIKB 1YTFB 2B1IA 1SQBH 1H2KA 3E86A 1K5SA 1MMMA 1JJ2U 4X64B 3FKSG 4U3FH 5LMUO 1GTOA 1VQ4V 3FB6C 2WWWA 2IU3A 4JI4O 4PJ0Z 3U10A 5LMNO 3SYOA 1NR1A 2ZT9B 2IJHA 3A0HZ 1AROP 3CCUV 4DR7B 1CEZA 1B06A 2VQEO 4CZZA 3N2KA 4UCRA 4J9ZB 1U96A 4YY3O 1EZJA 3IJ4A 2WLKA 3L72H 1TVKA 1P4RA 3UKMA 1L8DA 5KUKA 4DK0A 3R66A 4UCTA 1YIJV 2AGAA 4LWSB 1HWYA 5HFMA 2QM8A 3D3QA 4LF9O 1E1QG 1ORQC 1CXZB 4LF7O 1K9MW 3RWRD 5KHIA 4J7ZA 3IGAC 3N2GB 4BR6A 4X88A 1IBMB 1GN4A 4D7SA 1E79G 2YI9A 1LUVA 3TJTA 2B1GA 4U7OA 3SR2C 1VP7A 2VRZA 2CDYA 1SQGA 4DV4O 3SJBC 2JGDB 1A32A 4KHPO 1WB7A 4FFBB 1ZL8A 1K34A 1I0HA 3N2GA 5CA0A 3CC4V 1WLEA 1VF6C 1VEWA 5J2UB 1AI6A 1AI7A 4JYAB 2PY5A 1YCIA 1V55B 4Q6GA 5LP6B 3G4SV 4O4JB 4MTFA 1QCEA 4QJFB 2QWNB 1QLEB 3D36C 1ZAUA 5IT9N 4J10A 1Y76A 3K58A 3QG5A 1G1XB 4I9QA 5H2FZ 4WFHA 3T1CA 4JI8O 1JCHA 2WLIA 2XAGA 2P4KA 1JFFB 4X20B 2ZE5A 5B5EZ 4WBNB 1OCRC 2R72A 2EILC 1Z5VA 4UCUA 4HNAA 4G27B 3OR6C 3RT3C 3CEIA 4PDMA 3ZBHA 1YZBA 4QPJA 2QR4A 2IU0A 1XMQO 4LWSA 2HP8A 1BSMA 3KCYA 4RAIA 3OAAG 3FAVA 4K35A 2ZIOA 1IX9A 4OPHA 5JH7B 4DO2A 2OIEA 4HZ3A 3JAWA 5KAFZ 1Q6HA 5KHJA 3OUSA 1Q5OA 4JAUA 2DMXA 5JQGB 5CB4A 4I9WA 4JV5B 4PA6A 4X9QA 5A9GA 1SZTA 5TISZ 2ZCEA 1D5NA 2EBOA 3WB1A 2BOCC 4NXNB 1Q82W 2JGUA 2RDCA 2EINB 1ZWIC 4BIUA 4X1YB 3ZN1A 3W7UA 4LFCB 5J2TA 2KG7A 2B9ZA 4FJCC 4NTWA 3U11A 3ZIAG 5GTIZ 4FFBA 1M5IA 1W0KG 2B5UA 2EINC 2WPDG 2FMLA 3TXSA 3ZX6A 3RYCA 3WB2A 3JASB 3ABKC 3A2FA 5KLVH 1VQ9V 1JOYA 4NTYA 4HNAB 1J95A 4PELA 3DXRB 2NNUA 3ZS8C 3FYEB 2DE0X 5K1PA 1BHBA 4DR4B 4X8AA 2K9PA 3ETGA 4O4HB 4DUYB 5FNVB 1H8EG 2GDSA 1ENVA 3CYOA 4FLXA 4JI1O 2UUAB 3UM7A 2XT9A 4MVZA 4Z1MG 1FD9A 2DYRB 5JJJB 5LHIA 3CJHB 3MDSA 2ZNIA 4X65B 3ZJZA 5FLXN 1PPJH 2HLDG 4O4HA 1OHHG 3OTOO 4X1YA 2F1MA 1F4MA 4XDLA 3F5TA 1KYOF 3K9SA 1NH2B 2JDIG 4K0KB 1PD3A 1OCOC 3CMEV 3ETQA 4DK1A 5KAIZ 2UUBO 2ZQMA 4Z1VA 1IXBA 2EZOA 3JARB 4H13B 2YI8A 2ITCC 1R3KC 2R9IA 2N04A 4F6RA 2JJ2G 2IBZH 2E76B 3WG7C 1XI1A 5IDJA 3ZRXA 2HHHO 4PHZA 1RSOB 3UT5B 2IJIA 1KQSU 4FFKA 5JJEB 3C3TA 3OEHG 2RQ6A 3W7TA 1HNZO 3F7VC 4NXMB 3ZHTA 2XAHA 4UXNA 4F6EA 2A79B 3ZRWA 3L9DA 1E1RG 2UXBO 3VQYA 4FK5C 4P30A 4LCUC 4RUFA 1GM9A 4UFZA 3JD0A 3G71V 4GLXA 1IBLO 3T1HB 3UCSC 4TV8A 5E1AC 4QIWF 4LBEC 1WPBA 1ZUQA 2FKXA 2Q4PA 5LYJA 3R65A 1XL6A 2XAJA 1UPGA 2P6JA 1CPYA 5L3EA 4DV3O 4NTXA 3QVNA 3DTUB 3P30A 3OD4A 2YIAA 4CBCA 5LA6A 3IC9A 2ITDC 4MVSA 1WNSA 3K0GA 4CS4A 5LMNB 1JJOA 4YHHB 3FB7C 1QNMA 2Q67A 5CBFA 2JIZG 5KA5A 5FL7G 1RM1B 4AQYB 5LP6A 1XNRO 1MABG 4U7NA 3O65A 1AI5A 4BW9A 2Q9LA 4DUZO 4X64O 1ZTEA 4J9YB 2IJKA 3SPJA 4MS2A 1XNQB 3K59A 3WG7B 4I50B 1H2GA 1Q3EA 3JATB 2DW4A 2F95B 4XBFA 2ZD9A 1KMIZ 3VQXA 1P49A 2JEXA 2WLNA 2JRIA 3L71H 4QE7A 3DC6A 4B7EA 3JD2A 1Y74A 3HKCA 1VMGA 4EB6A 4FLYA 4JTDB 4ZI7B 3JSNA 1HNZB 1J5EO 1FJGB 4W4LA 3RW0A 1VQ7V 1N33B 2IH3C 4LF8B 2WLJA 4D7TA 3WU2Z 4UV8A 5DECA 1M93A 3ML0A 2E3CA 2W0XA 1N33O 2ZNJA 3B77A 5BMVA 2WLMA 1WJZA 2JS5A 2PI5A 4WFGA 2CAZC 1QLEC 1EZVH 3EVKA 3RVYA 5BR8O 2UU9B 1BZKA 2YXYA 1LNQA 5IWAO 2PF4E 1V54C 2Y48A 2R9RB 3HKBB 4CS3A 3MAQA 3TK1A 3H1KH 2JVDA 2L35A 2OT5A 5LOVB 3J7AU 1Y4MA 1JX9A 3A8TA 3ASNB 2G38A 2W0FC 1WP8A 3HKDA 5LA6B 2F93B 5B1AC 2QWQB 4JI7B 2LJ2A 2XUMA 5LXTA 4X66O 3BCCH 4CH4A 3CXCU 4FLTA 2CE4A 2Q73A 2ZIMA 1NZ6A 1S5HC 1VQ8V 5LMUB 2YUAA 2WA3A 2L6LA 2QTSA 1QR9A 4JTCB 5CA3A 3OGIB 3QO8A 4TSFG 3P32A 3SJCC 4A5UB 3CCSV 4HYOA 1PV0A 2K1EA 4B08A 1I5XA 3T1HO 2FTKA 3KG2A 4I55B 1BCCH 2Q68A 3CRAA 2UUCB 2XTAA 5B1BB 1BT8A 1XDCA 1Q90D 5EIBD 3GWKC 1AP5A 1P7GA 3E35A 4DV0O 3KCXA 4DV7O 4DV5O 3T1YB 2UUAO 2HVKC 4YJ3B 1XNRB 1B04A 1BGYH 1OCCB 3S3WA 3BFRA 2YIDA 5CN0A 5H5NA 2V4DA 1DF4A 1N34B 2QSAA 3JAWB 1WP7A 4EFBA 2F23A 2Y69B 3BVOA 1Y67A 4FZ1A 2QA4V 4MW8A 2PYJA 2R9AA 4LF9B 4PA3A 1K4DC 4IL6Z 4K0KO 1FFXB 4N23A 2AW9A 3E22B 2NLJC 4J7KA 1VQNV 1H2MA 1FAFA 4DR2B 3CRQA 1Q43A 3CB2A 2BE3A 5HFLA 4KFMA 4B7KA 3ICXA 1HP8A 5J2TB 3SYCA 3SYQA 1TGOA 4C7UA 1K97A 1N32O 3IC7A 2OCCC 3RVZA 1GK9A 5L3BA 3K3WA 4JV5O 4FMTA 1L1FA 3G6EV 4O4LB 3LDCA 4AILC 1KUQA 3RYCB 1IDSA 3P3NA 4FZ0A 3JD3A 3CCJV 1N0NA 5JJNB 1GRJA 5H9CA 4JF3A 1VF7A 2R70A 3G6BA 4DXWA 4RQFA 2CTPA 3OT7A 2Q6AA 2IW5A 4YIOA 4UB8Z 1ZL8B 3DGEA 1PKXA 3SJAC 3K5MA 1FXKB 1HNWO 5IJ0A 1RM1C 2A0LA 4JASA 1NVPD 3JSLA 3ZRVA 2YEVA 2XNDG 4EB6B 2NR5A 5LP6C 2OYQA 5GW7A 1FXKA 3T1YO 2VWKA 3X2QB 1FXVA 4X20A 3LSQA 5KA6A 4PDLA 4DV2O 2Q0AA 1QVGU 4B3MB 4DUZB 1D5AA 1VF6A 3H1LH 1FJGO 1YF2A 1OCCC 2JGDA 2UUCO 1NR7A 3GVMA 1IBLB 1R6KA 2YIBD 5L3CA 3K06A 5LYJB 1VARA 3ZHUA 1N36B 3D36A 4LC1A 3ZMTA 1HW7A 3P3PA 3CC7V 3F5WC 5KHGA 4I4TB 2M6YA 1FXKC 5ITZA 5IWAB 2BTOA 3RYIB 2E5LB 2F43G 2Y0PA 2FL4A 3OMNB 4P2ZA 4UCOA 1Y76B 3AG2C 1FFTB 2DWDC 1M1KW 3CRMA 5JCOC 4JI6B 2QJ1A 1YITV 2GTSA 1W59A 1S5LZ 4U3JB 4LR3A 1SQQH 4I0XB 2X0LA 3AG1C 2PGGA 1L0LH 4LF5O 4CS2A 4X1IA 2P4VA 1AVMA 3QTCA 4I50A 2LW7A 5DEDA 3CSXA 3K5NA 2F4VO 3T2MA 3AEIA 4FVMA 1AJPA 4FLWA 2DOSA 2D3OW 4OGQB 1KP2A 3GB7C 4FLVA 4MVMA 3KKYA 1R3LC 1BQ0A 1XL4A 3CPWU 1KKDA 4YJ3A 1KU9A 2Y4TA 2X6AA 1VQPV 4JI1B 3SYPA 3JALA 4MSWC 2EIMC 3AK1A 1SRYA 2E74B 1VQ6V 4TOIA 4DR4O 3L74H 2ZM6O 4WFEA 5L3DA 3O9OA 2P22C 3W7SA 3D8CA 2A06H 1FFXA 3VQWA 2EIKC 3T4ZA 1HNWB 4B3SB 2YS8A 4DRXA 1FPOA 1XEQA 1HR0O 1M90W 2EIJC 3U0ZA 2AZ0A 1G8MA 4BW5A 4X1KB 4FIPC 3JASA 2ETNA 4DV0B 5LHGA 1MG1A 4F6RB 4LF6O 1EN5A 4X66B 1U97A 3ASOB 4DR3B 4UCVA 2LFSA 3J80N 4RQEA 4RO2A 2KQXA 1MZFA 4G2KA 2UXBB 4IIJA 4E4EA 3C90A 3S3XA 1B3QA 3F7YC 2IM9A 2PTMA 4B3SO 1QHTA 5EZYB 5L3FA 4NXMO 2RMKB 5IYZB 4DR6O 4Q20A 3JD4A 3ZRSA 1THZA 2WLHA 2HHHB 4IHJA 2Y4UA 2Q7EA 4MVRA 1SS3A 4FLZA 4MVUA 1LR1A 4GX2A 3SDLA 3HKDB 3UO3A 2P5OA 3AG1B 2DN9A 4Z2WA 2XASA 3CJHA 3L75H 2PUSA 3SPHA 3IFXA 4DR6B 2Q5ZA 3ZMUA 2DYRC 2X6BA 3SPGA 5BMVB 1OCRB 4JYBA 5KX5B 4EKWA 2MK3A 4BWAA 2YDEA 5IYBO 1R73A 4CH5A 4EFEA 3ZN0A 2QM7A 3ABLB 4CC6A 4L8JA 3NR7A 5IY5C 4X1IB 4JI2B 4B3TB 4LF4B 1V55C 1JQ0A 1PL4A 3QNEA 5B3SB 1K8AW 1FS0G 5JWPA 5F2VO 1F7YA 2AXTZ 4NKGB 5CA0B 1MOFA 3FAVB 4DR5B 1Q86W 4TUYA 1AILA 1NT2B 4N21A 1Q8IA 1XQ8A 5B66Z 4AQYO 4JTAB 3JAKA 4ASUG 1VQKV 4EEQA 3LDEA 1M56B 2JEUA 2LW1A 2Q0OC 1S77D 3E2EA 1NTMH 3B2EE 4HAMA 1XUQA 4JYAO 5KHHA 5B1OA 3ABUA 5LOVA 4B3RB 4WBNA 3E83A 5EBLC 5C93A 3K04A 3DC5A 3ZMSA 4IYIA 2ZE7A 2BTQA 2ZE8A 1PNKA 1SESA 2CGNA 2X6CA 4BIOA 3RYFA 1JA8A 2HJDA 4FPPA 4O4JA 3CCEV 2DQ3A 1EBOA 3FD9A 1O9GA 1WB8A 1QLNA 4X1KA 4WFBV 4PA9A 2Q7GA 4ZOLB 5LGUA 3D3IA 5IJ9A 5D5PA 2MW2B 1Y6XA 3JYCA 4TV8B 1DGSA 2A9HA 2IH1C 2N05A 3ETEA 3A0BZ 2YXLA 3M8AA 2W6JG 1P7BA 3K5OA 2UXCB 2RNBA 4KHPB 3AK2A 1SZXA 1MA1A 4DR1O 1GAXA 1K73W 1PNLA 4X62B 1N4CA 5EYPA 3LDDA 3STLC 4GT1A 4MVQA 4KL1A 4UB6Z 5J2UA 3WFVA 3CMAV 4CH6A 2E5LO 2UXNA 4BAYA 3UT5A 5CBHA 1B6QA 2C2AA 4ZHQA 2AHYA 4ICGA 3H01A 2ARHA 5H6RA 1N32B 3AG2B 1TA8A 3ABTA 3CCLV 1I7FA 1W2BU 3W7WA 5K1XA 4TQDA 4JI2O 1KP3A 3TCUA 4TWKA 3VBBA 4JPRA 1VF5B 1EFRG 4PI0A 4IIJB 2AZ2A 4JI0B 5IJ0B 1S76D 4JAVA 3AG4B 4O2BB 1R6TA 4X65O 3JCZA 1M57C 3MD0A 4JI5B 4LFAO 1N8RW 3HR0A 5EBMC 2M7WA 3CCQV 2XAFA 3ABKB 3OTFA 5CBGA 2QM4A 4DR5O 1S72V 1VQMV 3H9VA 1HNXO 1SQFA 3M99B 4GUNA 2BTQB 2VQEB 3UQ8A 2RCVA 5BY1A 1Q6IA 2XHBA 1COWG 1YXBA 2ZR2A 2W6IG 4J41A 3HKEA 1YHQV 1H8HG 4OXSA 3L73H 3VOUA 2QDOA 5B1BC 1L0NH 3BAAA 1GN2A 4LH7A 4CC5A 1VQOV 4OPAA 2UXDO 4I55A 4GKKB 3AG3B 4QPKA 1P84F 3MHSC 1DF5A 1WPXA 4MT8A 5B1AB 4H44B 4NB5A 2F66C 3B09A 2EZPA 3ZHSA 1SETA 4L87A 1WN7A 3RGBA 1RFYA 3K5LA 1URFA 2BSKB 5EK0A 1XHZA 4YJ2B 3CS5A 1AB3A 3CE2A 5CB4B 4GKKO 5BXZA 1AP6A 1X59A 4TUYB 2UXXA 1H2SB 4KP4A 3BA8A 4JI4B 2OCHA 1GN3A 5B1NA 1VQ5V 1EN6A 1NTZH 2YC0A 1KBHA 1WAZA 2QWRB 4O4IA 5GONB 3OR7C 3JCUZ 2Z3YA 4PV1B 1KB9F 4I5SA 2ZDIA 3B8MA 4O4LA 3ETDA 4WFFA 3W7XA 4LP8A 3JAMN 1HNXB 2Y69C 4DV6O 2CH7A 2EX3A 5CA1B 1JFFA 3JD1A 2N74A 1EM1A 5JVDA 3RYHA 1XNQO 4R7CA 3OM3B 4UVCA 3IAYA 1QQCA 1RPOA 1YJWV 1SQPH 3PJSK 5EZYA 1IZ3A 2GSMB 3LNNA 4PD4F 2BSKA 2P90A 2P7TC 4E2LA 1GO3F 2A7WA 1SC5B 5DM6V 2UU9O 3CWBH 1Y66A 3QO5A 2WAMA 2WA4A 3PN1A 1UFIA 4F4LA 4LF6B 1Q6UA 3JALB 3I56V 1LUWA 5A2QN 5LL6Y 5BR8B 3SPCA 2HR3A 4P9OA 4DV1B 4GKJB 3BHPA 2DYSB 5EYPB 1K7DA 1J5EB 1YI2V 2YEVB 2QKAA 1KECA 5JQGA 3JAKB 1XHXA 1R6NA 3QF7A 2UXCO 2H3OA 3OEEG 3L70H 2UUBB 4I4TA 1V54B 3THOA 4R6ZA 2VQFB 2QWPB 4D6TH 4NXNO 3Q4HA 3RBZA 4I0XA 2AHZA 4R8CA 2GHYA 3CCRV 3CP1A 3BABA 1OCZB 1W0JG 5DN6G 1QU7A 5H6QA 4KUMA 3B4SA 4R50A 2HEPA 4MVOA 2ADQB 3RN4A 5KHKA 2DWEC 2QKSA 3I55V 5EIBC 2YSUB 4X62O 3E8BA 4WFAV 2EJRA 1XMQB 4ZHQB 5LXTB 1S0VA 4LF5B 3APOA 3EHBB 2KKWA 4O2BA 4YXWG 1H2LA 4JAAA 3OTOB 3ZEDA 2DYSC 1K33A 4QNHB 4TV9A 4DV5B 1OV9A 3TGUH 2DJVA 4IYHA 1D2DA 2CGOA 3RYIA 4DR3O 4DUYO 4FM2A 1EN4A 1YTFD 1QR8A 2QKCA 5KUMA 1T5EA 1ZLZA 4DR2O 5EC2C 1M4UA 4MTGA 3CXHF 3CX5F 5L3GA 4DV4B 3RYFB 2YIBA 4DV1O 1NH2D 4K8XA 3QO7A 5AG2A 3BRCA 1NU1H 2XAQA 2GV9A 4FLUA 4DW0A 1BHAA 2KB1A 1DTOA 3E22A 4DW1A 3VQVA 3SYAA 3RFRA 1YEWA 4JYYA 1I5YA 1S5JA 4DRXB 4H33A 3K79A 1R1BA 3ABLC 3BEHA 5IE9A 2OTLV 2GUZA 1XILA 1SKVA 5FPRA 3JATA 3T4DA 1DK1A 1YSCA 2EIMB 3OW2U 4MTOA 2ZE6A 4YIPA 4JI0O 4GX1A 1GM7A 2Q8VA 4NVPA 1FXHA 1O9HA 3FX7A 2FYUH 2JS3A 1MSDA 2F4VB 3N27A 1MSWD 1WA8B 2Z0AA 2ZINA 4YY3B 4TQFA 2OIGA 3WB0A 1NS1A 1JMKC 1IBKB 4FM1A 4J7JA 1OJHA 2HFEC 2X7RB 1F51A 3GWOA 4LFBB 4OX9O 5CA1A 3C3SA 2Q69A 3CC2V 2KG7B 1NQTA 1H38A 1TUBB 1R3JC 3ABMB 3B40A 2QEXV 2PYLA 2Z5UA 4JI8B 4P9PA 1XOUA 3E89A 4DYLA 2ZXWC 3HKCB 1MNGA 1OZ0A 3E8HA 4U3JA 1SF9A 3ASOC 2EJ7A 3OE7G 3K03A 3K08A 3TXQA 2EILB 1F4NA 2QWOB 1I94O 1MZEA 2CUGA 2ZKOA 1TVKB 2OCCB 1Q81W 1GMGA 3CRCA 1RP3B 4XDKA 3TETA 2PI4A 2WSSG 1NJIW 1Z5WA 5ITZB 1N0JA 5JCOA 3SGIA 4B3TO 2XOKG 4PI2A 4MW3A 4XDJA 4YJ2A 4RUEA 3BY6A 4QE9A 2JK5C 3OGCC 5EBWC 1VQLV 5LGTA 2VWJA 2BOBC 1BS3A 1XBLA 4DV6B 1QVFU 3OFNG 1FKAO 4JI3O 3ZCCA 1IBMO 2WLIB 4B3RO 4G28B 5KX5A 3EXAA 1V9PA 2DQ0A 3KZIZ 1XMOB 1US6A 3JARA 3M7MX 2ZM6B 4GZRB 3H1JH 4GX0A 4H0LB 4O4IB 4K3AA 5GONA 4UCSA 2LO1A 2JJ1G 4JI6O 4AHCA 3UO2A 1YJ9V 4DV3B 3RYHB 4MTXA 5KMGB 1X4TA 2NN4A 2QE7G 5LHHA 1IURA 2CH7B 5JH7A 4OX9B 4JI5O 4LFAB 2H8PC 4ZKIA 1IBKO 1GKFA 1BL8A 1WA8A 3BPZA 2ZR3A 1G4YB 1N36O 2P67A 4WF9V 2HG5C 1SA0B 1GH6A 1HDJA 2ZXWB 2GTAA 4DR7O 4LH6A 5LBQA 3DXRA 1NTKH 1TUBA 3A0RA 1KC8W 2ILMA 3ZHQA 3DSQA 4O2AA 1KKCA 3H1IH 2LGWA 3LSSA 1IXMA 3N2KB 4ABMA 2RJZA 2LQTA 1ZX3A 1RPRA 1N34O 1NBMG 1JPXA 1PL0A 1F23A 1AR5A 4UVBA 3SPIA 4GCZA 1PNMA 4LF7B 3ASNC 1M9NA 4JZGA 2O57A 2ATKC 3CCMV 5CMUA 2ODMA 4I7ZB 1K3EA 1NVPB 3CRRA 1R3IC 1SERA 2FB5A 2Y0IA 4LF8O 2UXDB 5C8YA 4PDVA 4TV9B 1NI8A 2BCCH 2OTJV 4UV9A 3G67A 1SQXH 5FPOA 4J11A 3HKEB 1K4CC 4IT5A 2VQFO 5IJ9B 2IJJA 2VS0A 2HKOA 4K8ZA 3ZHRA 1DLBA 1OCZC 1AJQA 1TUEB 3LSUA 3B8NA 5C8YB 1Y74B 3AG3C 2V1DA 4J42A 3APQA 1YJNV 5IY5B 3ZRWB 4PDRA 4JGSA 2RN9A 3NXSA 2Q7HA 4J80A 2ADPA 1GM8A 3OMAB 4GKJO 4LFBO 2H94A 4DR1B 2A3QA 4ZOLA 2CTRA 4RWUA 3OMIB 2QGNA 3EFFK 1JVMA 1BMFG 4PA4A 4QGPA 1SA0A 3CCVV 4KXRA 2YICA 3K9AA 1AR1B 5LGNA 2LGQA 4O2AB 2HVJC 2EULA 1M57B 4LF4O 4PA7A 2V7QG 4B3MO 5BZBA 3J81N 4DV2B 5KMGA 3BA9A 4WCEV 3Q4HB 5J9PC 1VIBA 1QBZA 3G80A 1AJNA 1UJWB 1ROPA 2HJFC 3ABMC 5JVDB 1IVSA 4NR1A 4YHHO 1CP9A 1S3JA 1ZSPA 2GBOA 3MHHC 3X2QC 3LUTB 5EC1C 1PP9H 1YVWA 5GTHZ 1M56C 3I5DA 5B3SC 4LNUA 5IYCO 1K92A 2ZDIC 3ZMVA 1SQVH 4DV7B 3AK3A 2CTWA 2QTOA 4X89A 5FNVA 1BE3H 4IGGA 1XREA 3SJQC 4JI7O 1G6UA 3FYIB 3LNMB 5IYZA 4NYKA 3HB3B 1Q7YW 4ZIBA 4AI8A 1I94B 2CTQA 2PZSA 4JZ2A 2WLLA 2YXHA 3K0DA 1JR9A 2LP7A 2CK3G 1HR0B 3FB8C 3FB5C 4TT3G
chains in the Genus database with same CATH topology
2IJKA 3SPJA 4MS2A 4Q20A 3JD4A 3WG7B 3ZRSA 1THZA 2WLHA 1H2GA 3OUFA 1NKDA 1K5QA 2WLLB 4MVRA 2DW4A 4XBFA 4MVUA 2ZD9A 4GX5A 3STZC 4GX2A 2JEXA 2WLNA 4QE7A 3JD2A 3AG1B 1YTFD 1QR8A 1AI4A 2XASA 3HPLC 4JTDB 4JYCA 3SPHA 3IFXA 3ZMUA 2DYRC 5KUMA 2X6BA 3SPGA 5IYDO 1OCRB 4JYBA 3CD6V 3RW0A 1VQ7V 5EC2C 4EKWA 4MTGA 2IH3C 2WLJA 4BIZA 4H37A 2MK3A 2LFRA 5L3GA 4UV8A 3ML0A 4ZBMA 5IYBO 1NH2D 3QO7A 1R73A 3ZN0A 2XAQA 2QM7A 1BHAA 3ABLB 1OCOB 2KB1A 1DTOA 5IY5C 3B77A 4UVAA 2WLMA 3SYAA 3E8FA 2PI5A 1I5YA 4WFGA 4UUJC 1QLEC 3RVYA 1V55C 3ZMZA 4H33A 3K79A 2EIJB 3AG4C 1LNQA 3ABLC 3E8GA 1JQ0A 3BEHA 3QNEA 5B3SB 1K8AW 1KD1W 2OTLV 2EIKB 1V54C 2Y48A 1YTFB 1FS0G 2R9RB 2B1IA 3E86A 1K5SA 3TK1A 1JJ2U 3FKSG 2OT5A 3T4DA 1MOFA 1Q86W 1YSCA 2EIMB 1GTOA 3OW2U 4MTOA 1VQ4V 1Y4MA 3FB6C 2WWWA 4N21A 1JX9A 2IU3A 4JTAB 4GX1A 1GM7A 4ASUG 1VQKV 3ASNB 3LDEA 1M56B 1FXHA 2JEUA 1S77D 3E2EA 2W0FC 4HAMA 3SYOA 1NR1A 2IJHA 1MSWD 5B1OA 1AROP 3ABUA 3CCUV 5B1AC 3E83A 1CEZA 5EBLC 4CZZA 5C93A 3K04A 3CXCU 3ZMSA 4J9ZB 2HFEC 2X7RB 1F51A 3GWOA 1EZJA 1PNKA 1S5HC 2Q69A 1SESA 2X6CA 1NQTA 3CC2V 1H38A 1R3JC 3ABMB 1VQ8V 2QEXV 2Z5UA 2WLKA 4P9PA 3E89A 4FPPA 1P4RA 3CCEV 2DQ3A 1EBOA 3UKMA 5KUKA 1QLNA 1QR9A 2ZXWC 4WFBV 4JTCB 4PA9A 1YIJV 5CA3A 1OZ0A 3E8HA 5LGUA 3D3IA 1HWYA 3ASOC 3OE7G 3QO8A 4TSFG 5HFMA 3P32A 3K03A 3K08A 2QM8A 3CCSV 4HYOA 2EILB 1F4NA 3JYCA 1E1QG 2A9HA 2IH1C 2K1EA 1ORQC 1I5XA 3ETEA 2FTKA 2OCCB 3KG2A 1Q81W 1GMGA 1K9MW 4XDKA 2W6JG 3TETA 1P7BA 2PI4A 2Q68A 2WSSG 3IGAC 1NJIW 4X88A 5B1BB 1K73W 1PNLA 2XOKG 4MW3A 4XDJA 4RUEA 1E79G 3BY6A 4QE9A 2B1GA 3LDDA 4U7OA 3E35A 3STLC 4GT1A 4MVQA 2JK5C 3OGCC 5EBWC 1VQLV 3WFVA 3CMAV 5LGTA 2BOBC 2HVKC 2UXNA 4BAYA 1QVFU 5CBHA 3OFNG 1B6QA 2C2AA 2AHYA 1OCCB 3H01A 3ZCCA 5H6RA 1K34A 2WLIB 3AG2B 5CN0A 4G28B 3ABTA 3CCLV 1DF4A 3W7WA 1W2BU 3CC4V 1WLEA 2DQ0A 1KP3A 3TCUA 4TWKA 3VBBA 1AI6A 1AI7A 2Y69B 2QA4V 4MW8A 4GX0A 4JPRA 1EFRG 1V55B 1K4DC 4PA3A 1S76D 4JAVA 3AG4B 3G4SV 4N23A 2JJ1G 2NLJC 1VQNV 4MTFA 1QCEA 4QJFB 3JCZA 1QLEB 1M57C 1YJ9V 3MD0A 1N8RW 4MTXA 5EBMC 2M7WA 2QE7G 3CCQV 2XAFA 3ABKB 5LHHA 5CBGA 4WFHA 3T1CA 5HFLA 1S72V 1VQMV 4KFMA 1JCHA 2WLIA 2H8PC 2XAGA 3M99B 4ZKIA 3SYCA 3SYQA 1GKFA 1BL8A 1OCRC 2ZR3A 1K97A 1G4YB 3IC7A 2EILC 2OCCC 3RVZA 2P67A 4WF9V 2HG5C 4G27B 1GK9A 3OR6C 2ZR2A 1COWG 3K3WA 4PDMA 2W6IG 5L3BA 2ZXWB 4QPJA 4FMTA 1L1FA 2IU0A 3G6EV 3LDCA 1YHQV 1H8HG 4OXSA 3VOUA 5LBQA 3JD3A 3CCJV 5B1BC 3A0RA 4RAIA 3OAAG 5H9CA 1KC8W 4JF3A 4DO2A 4HZ3A 1VQOV 4DXWA 3LSSA 1IXMA 4RQFA 3AG3B 4QPKA 2Q6AA 3OUSA 2IW5A 4JAUA 3DGEA 1PKXA 3MHSC 1DF5A 1WPXA 4I9WA 1FXKB 4MT8A 4PA6A 5B1AB 1RPRA 1NBMG 1JPXA 2EZPA 1PL0A 1SETA 1SZTA 1RM1C 4L87A 1F23A 2A0LA 4JASA 1NVPD 2EBOA 3ZRVA 2BOCC 2YEVA 2XNDG 1Q82W 4UVBA 3SPIA 4GCZA 2EINB 5EK0A 1ZWIC 1PNMA 4BIUA 3ZN1A 3W7UA 3ASNC 1M9NA 5GW7A 3CCMV 2ATKC 1FXKA 5CMUA 1K3EA 4FJCC 3X2QB 1FXVA 1NVPB 3LSQA 5KA6A 1R3IC 1SERA 3ZIAG 4PDLA 2UXXA 1QVGU 4KP4A 1W0KG 2B5UA 2EINC 2WPDG 4PDVA 1OCCC 2OTJV 4UV9A 5B1NA 1VQ5V 1NR7A 3ABKC 1JOYA 1K4CC 1VQ9V 1R6KA 2IJJA 3OR7C 2HKOA 5L3CA 1J95A 3K06A 4PELA 2NNUA 3FYEB 2Z3YA 1BHBA 1DLBA 1OCZC 4I5SA 1AJQA 3D36A 2ZDIA 3B8MA 4LC1A 1TUEB 4X8AA 3ZMTA 3ETDA 3B8NA 3ETGA 3CC7V 3AG3C 4WFFA 3F5WC 2V1DA 3W7XA 4LP8A 1FXKC 2Y69C 1H8EG 1YJNV 5IY5B 1ENVA 3CYOA 3ZRWB 4PDRA 3UM7A 2F43G 4JGSA 3NXSA 3OMNB 3JD1A 4MVZA 4P2ZA 4Z1MG 3AG2C 1FFTB 2DWDC 2DYRB 4R7CA 3OM3B 4UVCA 5LHIA 1M1KW 1RPOA 1YJWV 1YITV 3PJSK 1GM8A 3OMAB 3ZJZA 2HLDG 2GSMB 1OHHG 2H94A 1F4MA 2X0LA 3AG1C 4XDLA 2P90A 2P7TC 4E2LA 1NH2B 2JDIG 1GO3F 3OMIB 1PD3A 3EFFK 1JVMA 1BMFG 1OCOC 4PA4A 5DM6V 3CMEV 3CCVV 1Y66A 3T2MA 3K9AA 2ZQMA 3AEIA 1AJPA 2EZOA 3QO5A 1AR1B 2WAMA 2ITCC 1R3KC 5LGNA 2R9IA 2D3OW 2HVJC 1KP2A 3GB7C 4F4LA 2JJ2G 3I56V 3WG7C 1M57B 4MVMA 3SPCA 4PA7A 2HR3A 4P9OA 1R3LC 2V7QG 1XL4A 3CPWU 1KKDA 5IDJA 3ZRXA 5BZBA 1KQSU 2IJIA 2DYSB 1K7DA 3OEHG 3W7TA 4WCEV 1YI2V 2X6AA 2YEVB 3F7VC 1VQPV 1KECA 3SYPA 2XAHA 4UXNA 4MSWC 1K33A 1R6NA 2EIMC 1SRYA 5J9PC 2A79B 1QBZA 3ZRWA 1AJNA 3OEEG 1E1RG 4FK5C 4P30A 1UJWB 1VQ6V 1ROPA 2HJFC 3ABMC 4WFEA 4LCUC 4RUFA 5L3DA 1V54B 1GM9A 1CP9A 1S3JA 3JD0A 3MHHC 4R6ZA 4TT3G 3G71V 3X2QC 3LUTB 3W7SA 5EC1C 3RBZA 2AHZA 4R8CA 2GHYA 3CCRV 3CP1A 1OCZB 5E1AC 4QIWF 2EIKC 1W0JG 4LBEC 5DN6G 3T4ZA 1M56C 5B3SC 5IYCO 5H6QA 4KUMA 1M90W 3R65A 1XL6A 2EIJC 4R50A 1K92A 2ZDIC 4MVOA 2XAJA 1G8MA 4BW5A 3ZMVA 2P6JA 4FIPC 1CPYA 2DWEC 2QKSA 5L3EA 2QTOA 5LHGA 3I55V 1MG1A 4X89A 2YSUB 3DTUB 3P30A 3E8BA 3SJQC 4WFAV 3ASOB 4CBCA 3FYIB 2LFSA 3LNMB 4RQEA 2EJRA 2ITDC 4MVSA 4RO2A 3K0GA 3HB3B 1Q7YW 3FB7C 1S0VA 4G2KA 3EHBB 2Q67A 5CBFA 2JIZG 5KA5A 5FL7G 1RM1B 2WLLA 4YXWG 1MABG 3K0DA 2LP7A 2CK3G 3F7YC 4U7NA 1AI5A 3FB8C 5L3FA 3FB5C 2DYSC 4J9YB 4QNHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6C A;  3SPJ A;  3EFF K;  1R3J C;  1JVM A;  1OCO C;  4MS2 A;  4PA4 A;  2WLK A;  3LDC A;  4P9P A;  3E89 A;  4OXS A;  3ZRS A;  3T2M A;  2WLH A;  3UKM A;  3VOU A;  5KUK A;  3OUF A;  2ITC C;  1R3K C;  4MVR A;  2WLL B;  2ZXW C;  5B1B C;  4JTC B;  2HVJ C;  4PA9 A;  4MVU A;  4RAI A;  2ZD9 A;  3GB7 C;  4GX5 A;  3STZ C;  4F4L A;  4GX2 A;  3E8H A;  2WLN A;  4QE7 A;  3WG7 C;  3ASO C;  4MVM A;  3SPC A;  4HZ3 A;  4PA7 A;  4P9O A;  1R3L C;  3K03 A;  1XL4 A;  3K08 A;  4DXW A;  1KKD A;  4HYO A;  5BZB A;  3JYC A;  4JTD B;  2A9H A;  2Q6A A;  2IH1 C;  3HPL C;  2K1E A;  3OUS A;  1ORQ C;  3SPH A;  3IFX A;  3KG2 A;  2DYR C;  4I9W A;  5KUM A;  2X6B A;  3SPG A;  2X6A A;  4XDK A;  4PA6 A;  3F7V C;  3TET A;  1P7B A;  2Q68 A;  3RW0 A;  3IGA C;  5EC2 C;  4EKW A;  4MTG A;  2IH3 C;  3SYP A;  2WLJ A;  4H37 A;  2A0L A;  4MSW C;  4X88 A;  2EIM C;  2BOC C;  2YEV A;  4ZBM A;  4QNH B;  5J9P C;  2A79 B;  4MW3 A;  4XDJ A;  3SPI A;  4RUE A;  5EK0 A;  4P30 A;  4QE9 A;  1ZWI C;  3LDD A;  2KB1 A;  2HJF C;  3ABM C;  3STL C;  4MVQ A;  4LCU C;  4RUF A;  3ASN C;  2JK5 C;  3OGC C;  4WFE A;  5EBW C;  2ATK C;  5IY5 C;  2WLM A;  3SYA A;  3E8F A;  4R6Z A;  4WFG A;  3X2Q C;  4UUJ C;  1R3I C;  2BOB C;  3LUT B;  1QLE C;  5EC1 C;  2HVK C;  3RVY A;  3RBZ A;  1V55 C;  4PDL A;  4H33 A;  2AHZ A;  4R8C A;  3AG4 C;  1LNQ A;  3ABL C;  3E8G A;  5CBH A;  3BEH A;  2AHY A;  5E1A C;  2EIN C;  4PDV A;  2EIK C;  4LBE C;  3T4Z A;  1M56 C;  1OCC C;  5B3S C;  2WLI B;  1V54 C;  4G28 B;  2R9R B;  3R65 A;  1XL6 A;  2EIJ C;  3ABK C;  4R50 A;  1K4C C;  4MVO A;  3E86 A;  4BW5 A;  3TCU A;  3OR7 C;  4TWK A;  1J95 A;  3K06 A;  2DWE C;  2QKS A;  2QTO A;  3T4D A;  1OCZ C;  4MW8 A;  4GX0 A;  4X89 A;  4MTO A;  4X8A A;  4PA3 A;  1K4D C;  3FB6 C;  3AG3 C;  4WFF A;  3F5W C;  3E8B A;  2NLJ C;  4JTA B;  4LP8 A;  4MTF A;  3SJQ C;  2Y69 C;  1M57 C;  4GX1 A;  3LDE A;  4CBC A;  3LNM B;  2ITD C;  4PDR A;  5EBM C;  4MVS A;  4RO2 A;  3UM7 A;  3K0G A;  2W0F C;  4MVZ A;  3FB7 C;  4P2Z A;  3SYO A;  5CBG A;  4WFH A;  3T1C A;  3AG2 C;  2DWD C;  2Q67 A;  4R7C A;  4KFM A;  2WLI A;  5B1A C;  5CBF A;  2H8P C;  3E83 A;  2WLL A;  3PJS K;  5EBL C;  3SYC A;  3SYQ A;  3ZJZ A;  1BL8 A;  1OCR C;  3K04 A;  3K0D A;  3F7Y C;  4J9Z B;  1G4Y B;  4XDL A;  2EIL C;  2HFE C;  2OCC C;  3AG1 C;  3FB8 C;  3RVZ A;  2HG5 C;  2P7T C;  4G27 B;  3OR6 C;  3FB5 C;  2DYS C;  4J9Y B;  1S5H C;  4PDM A;  2Q69 A; 
#chains in the Genus database with same CATH topology
 3HKB A;  1TAE A;  1GN6 A;  3H1H H;  2P06 A;  2GUZ B;  2E75 B;  3OUF A;  1NKD A;  1K5Q A;  2WLL B;  1PM9 A;  4GX5 A;  3STZ C;  1BQZ A;  4LNU B;  5D5Q A;  1XMO O;  1AI4 A;  3HPL C;  4JYC A;  3FFQ A;  1FYJ A;  4HBN A;  4W4K A;  1I08 A;  3AG7 A;  5IYD O;  4IHJ B;  4JI3 B;  4FM0 A;  3CD6 V;  1YDX A;  4BIZ A;  4H37 A;  2LFR A;  4GYC B;  4ZBM A;  5E79 Z;  4LFC O;  4ZI7 A;  1AR4 A;  1OCO B;  4UVA A;  1Z2G A;  3E8F A;  1H2N A;  4UUJ C;  3ZMZ A;  3ZHV A;  2OWO A;  2KSD A;  4CH3 A;  2EIJ B;  3AG4 C;  3CHX A;  3E8G A;  1RSO A;  2D2C B;  3K57 A;  1KD1 W;  2EIK B;  1YTF B;  2B1I A;  1SQB H;  1H2K A;  3E86 A;  1K5S A;  1MMM A;  1JJ2 U;  4X64 B;  3FKS G;  4U3F H;  5LMU O;  1GTO A;  1VQ4 V;  3FB6 C;  2WWW A;  2IU3 A;  4JI4 O;  4PJ0 Z;  3U10 A;  5LMN O;  3SYO A;  1NR1 A;  2ZT9 B;  2IJH A;  3A0H Z;  1ARO P;  3CCU V;  4DR7 B;  1CEZ A;  1B06 A;  2VQE O;  4CZZ A;  3N2K A;  4UCR A;  4J9Z B;  1U96 A;  4YY3 O;  1EZJ A;  3IJ4 A;  2WLK A;  3L72 H;  1TVK A;  1P4R A;  3UKM A;  1L8D A;  5KUK A;  4DK0 A;  3R66 A;  4UCT A;  1YIJ V;  2AGA A;  4LWS B;  1HWY A;  5HFM A;  2QM8 A;  3D3Q A;  4LF9 O;  1E1Q G;  1ORQ C;  1CXZ B;  4LF7 O;  1K9M W;  3RWR D;  5KHI A;  4J7Z A;  3IGA C;  3N2G B;  4BR6 A;  4X88 A;  1IBM B;  1GN4 A;  4D7S A;  1E79 G;  2YI9 A;  1LUV A;  3TJT A;  2B1G A;  4U7O A;  3SR2 C;  1VP7 A;  2VRZ A;  2CDY A;  1SQG A;  4DV4 O;  3SJB C;  2JGD B;  1A32 A;  4KHP O;  1WB7 A;  4FFB B;  1ZL8 A;  1K34 A;  1I0H A;  3N2G A;  5CA0 A;  3CC4 V;  1WLE A;  1VF6 C;  1VEW A;  5J2U B;  1AI6 A;  1AI7 A;  4JYA B;  2PY5 A;  1YCI A;  1V55 B;  4Q6G A;  5LP6 B;  3G4S V;  4O4J B;  4MTF A;  1QCE A;  4QJF B;  2QWN B;  1QLE B;  3D36 C;  1ZAU A;  5IT9 N;  4J10 A;  1Y76 A;  3K58 A;  3QG5 A;  1G1X B;  4I9Q A;  5H2F Z;  4WFH A;  3T1C A;  4JI8 O;  1JCH A;  2WLI A;  2XAG A;  2P4K A;  1JFF B;  4X20 B;  2ZE5 A;  5B5E Z;  4WBN B;  1OCR C;  2R72 A;  2EIL C;  1Z5V A;  4UCU A;  4HNA A;  4G27 B;  3OR6 C;  3RT3 C;  3CEI A;  4PDM A;  3ZBH A;  1YZB A;  4QPJ A;  2QR4 A;  2IU0 A;  1XMQ O;  4LWS A;  2HP8 A;  1BSM A;  3KCY A;  4RAI A;  3OAA G;  3FAV A;  4K35 A;  2ZIO A;  1IX9 A;  4OPH A;  5JH7 B;  4DO2 A;  2OIE A;  4HZ3 A;  3JAW A;  5KAF Z;  1Q6H A;  5KHJ A;  3OUS A;  1Q5O A;  4JAU A;  2DMX A;  5JQG B;  5CB4 A;  4I9W A;  4JV5 B;  4PA6 A;  4X9Q A;  5A9G A;  1SZT A;  5TIS Z;  2ZCE A;  1D5N A;  2EBO A;  3WB1 A;  2BOC C;  4NXN B;  1Q82 W;  2JGU A;  2RDC A;  2EIN B;  1ZWI C;  4BIU A;  4X1Y B;  3ZN1 A;  3W7U A;  4LFC B;  5J2T A;  2KG7 A;  2B9Z A;  4FJC C;  4NTW A;  3U11 A;  3ZIA G;  5GTI Z;  4FFB A;  1M5I A;  1W0K G;  2B5U A;  2EIN C;  2WPD G;  2FML A;  3TXS A;  3ZX6 A;  3RYC A;  3WB2 A;  3JAS B;  3ABK C;  3A2F A;  5KLV H;  1VQ9 V;  1JOY A;  4NTY A;  4HNA B;  1J95 A;  4PEL A;  3DXR B;  2NNU A;  3ZS8 C;  3FYE B;  2DE0 X;  5K1P A;  1BHB A;  4DR4 B;  4X8A A;  2K9P A;  3ETG A;  4O4H B;  4DUY B;  5FNV B;  1H8E G;  2GDS A;  1ENV A;  3CYO A;  4FLX A;  4JI1 O;  2UUA B;  3UM7 A;  2XT9 A;  4MVZ A;  4Z1M G;  1FD9 A;  2DYR B;  5JJJ B;  5LHI A;  3CJH B;  3MDS A;  2ZNI A;  4X65 B;  3ZJZ A;  5FLX N;  1PPJ H;  2HLD G;  4O4H A;  1OHH G;  3OTO O;  4X1Y A;  2F1M A;  1F4M A;  4XDL A;  3F5T A;  1KYO F;  3K9S A;  1NH2 B;  2JDI G;  4K0K B;  1PD3 A;  1OCO C;  3CME V;  3ETQ A;  4DK1 A;  5KAI Z;  2UUB O;  2ZQM A;  4Z1V A;  1IXB A;  2EZO A;  3JAR B;  4H13 B;  2YI8 A;  2ITC C;  1R3K C;  2R9I A;  2N04 A;  4F6R A;  2JJ2 G;  2IBZ H;  2E76 B;  3WG7 C;  1XI1 A;  5IDJ A;  3ZRX A;  2HHH O;  4PHZ A;  1RSO B;  3UT5 B;  2IJI A;  1KQS U;  4FFK A;  5JJE B;  3C3T A;  3OEH G;  2RQ6 A;  3W7T A;  1HNZ O;  3F7V C;  4NXM B;  3ZHT A;  2XAH A;  4UXN A;  4F6E A;  2A79 B;  3ZRW A;  3L9D A;  1E1R G;  2UXB O;  3VQY A;  4FK5 C;  4P30 A;  4LCU C;  4RUF A;  1GM9 A;  4UFZ A;  3JD0 A;  3G71 V;  4GLX A;  1IBL O;  3T1H B;  3UCS C;  4TV8 A;  5E1A C;  4QIW F;  4LBE C;  1WPB A;  1ZUQ A;  2FKX A;  2Q4P A;  5LYJ A;  3R65 A;  1XL6 A;  2XAJ A;  1UPG A;  2P6J A;  1CPY A;  5L3E A;  4DV3 O;  4NTX A;  3QVN A;  3DTU B;  3P30 A;  3OD4 A;  2YIA A;  4CBC A;  5LA6 A;  3IC9 A;  2ITD C;  4MVS A;  1WNS A;  3K0G A;  4CS4 A;  5LMN B;  1JJO A;  4YHH B;  3FB7 C;  1QNM A;  2Q67 A;  5CBF A;  2JIZ G;  5KA5 A;  5FL7 G;  1RM1 B;  4AQY B;  5LP6 A;  1XNR O;  1MAB G;  4U7N A;  3O65 A;  1AI5 A;  4BW9 A;  2Q9L A;  4DUZ O;  4X64 O;  1ZTE A;  4J9Y B;  2IJK A;  3SPJ A;  4MS2 A;  1XNQ B;  3K59 A;  3WG7 B;  4I50 B;  1H2G A;  1Q3E A;  3JAT B;  2DW4 A;  2F95 B;  4XBF A;  2ZD9 A;  1KMI Z;  3VQX A;  1P49 A;  2JEX A;  2WLN A;  2JRI A;  3L71 H;  4QE7 A;  3DC6 A;  4B7E A;  3JD2 A;  1Y74 A;  3HKC A;  1VMG A;  4EB6 A;  4FLY A;  4JTD B;  4ZI7 B;  3JSN A;  1HNZ B;  1J5E O;  1FJG B;  4W4L A;  3RW0 A;  1VQ7 V;  1N33 B;  2IH3 C;  4LF8 B;  2WLJ A;  4D7T A;  3WU2 Z;  4UV8 A;  5DEC A;  1M93 A;  3ML0 A;  2E3C A;  2W0X A;  1N33 O;  2ZNJ A;  3B77 A;  5BMV A;  2WLM A;  1WJZ A;  2JS5 A;  2PI5 A;  4WFG A;  2CAZ C;  1QLE C;  1EZV H;  3EVK A;  3RVY A;  5BR8 O;  2UU9 B;  1BZK A;  2YXY A;  1LNQ A;  5IWA O;  2PF4 E;  1V54 C;  2Y48 A;  2R9R B;  3HKB B;  4CS3 A;  3MAQ A;  3TK1 A;  3H1K H;  2JVD A;  2L35 A;  2OT5 A;  5LOV B;  3J7A U;  1Y4M A;  1JX9 A;  3A8T A;  3ASN B;  2G38 A;  2W0F C;  1WP8 A;  3HKD A;  5LA6 B;  2F93 B;  5B1A C;  2QWQ B;  4JI7 B;  2LJ2 A;  2XUM A;  5LXT A;  4X66 O;  3BCC H;  4CH4 A;  3CXC U;  4FLT A;  2CE4 A;  2Q73 A;  2ZIM A;  1NZ6 A;  1S5H C;  1VQ8 V;  5LMU B;  2YUA A;  2WA3 A;  2L6L A;  2QTS A;  1QR9 A;  4JTC B;  5CA3 A;  3OGI B;  3QO8 A;  4TSF G;  3P32 A;  3SJC C;  4A5U B;  3CCS V;  4HYO A;  1PV0 A;  2K1E A;  4B08 A;  1I5X A;  3T1H O;  2FTK A;  3KG2 A;  4I55 B;  1BCC H;  2Q68 A;  3CRA A;  2UUC B;  2XTA A;  5B1B B;  1BT8 A;  1XDC A;  1Q90 D;  5EIB D;  3GWK C;  1AP5 A;  1P7G A;  3E35 A;  4DV0 O;  3KCX A;  4DV7 O;  4DV5 O;  3T1Y B;  2UUA O;  2HVK C;  4YJ3 B;  1XNR B;  1B04 A;  1BGY H;  1OCC B;  3S3W A;  3BFR A;  2YID A;  5CN0 A;  5H5N A;  2V4D A;  1DF4 A;  1N34 B;  2QSA A;  3JAW B;  1WP7 A;  4EFB A;  2F23 A;  2Y69 B;  3BVO A;  1Y67 A;  4FZ1 A;  2QA4 V;  4MW8 A;  2PYJ A;  2R9A A;  4LF9 B;  4PA3 A;  1K4D C;  4IL6 Z;  4K0K O;  1FFX B;  4N23 A;  2AW9 A;  3E22 B;  2NLJ C;  4J7K A;  1VQN V;  1H2M A;  1FAF A;  4DR2 B;  3CRQ A;  1Q43 A;  3CB2 A;  2BE3 A;  5HFL A;  4KFM A;  4B7K A;  3ICX A;  1HP8 A;  5J2T B;  3SYC A;  3SYQ A;  1TGO A;  4C7U A;  1K97 A;  1N32 O;  3IC7 A;  2OCC C;  3RVZ A;  1GK9 A;  5L3B A;  3K3W A;  4JV5 O;  4FMT A;  1L1F A;  3G6E V;  4O4L B;  3LDC A;  4AIL C;  1KUQ A;  3RYC B;  1IDS A;  3P3N A;  4FZ0 A;  3JD3 A;  3CCJ V;  1N0N A;  5JJN B;  1GRJ A;  5H9C A;  4JF3 A;  1VF7 A;  2R70 A;  3G6B A;  4DXW A;  4RQF A;  2CTP A;  3OT7 A;  2Q6A A;  2IW5 A;  4YIO A;  4UB8 Z;  1ZL8 B;  3DGE A;  1PKX A;  3SJA C;  3K5M A;  1FXK B;  1HNW O;  5IJ0 A;  1RM1 C;  2A0L A;  4JAS A;  1NVP D;  3JSL A;  3ZRV A;  2YEV A;  2XND G;  4EB6 B;  2NR5 A;  5LP6 C;  2OYQ A;  5GW7 A;  1FXK A;  3T1Y O;  2VWK A;  3X2Q B;  1FXV A;  4X20 A;  3LSQ A;  5KA6 A;  4PDL A;  4DV2 O;  2Q0A A;  1QVG U;  4B3M B;  4DUZ B;  1D5A A;  1VF6 A;  3H1L H;  1FJG O;  1YF2 A;  1OCC C;  2JGD A;  2UUC O;  1NR7 A;  3GVM A;  1IBL B;  1R6K A;  2YIB D;  5L3C A;  3K06 A;  5LYJ B;  1VAR A;  3ZHU A;  1N36 B;  3D36 A;  4LC1 A;  3ZMT A;  1HW7 A;  3P3P A;  3CC7 V;  3F5W C;  5KHG A;  4I4T B;  2M6Y A;  1FXK C;  5ITZ A;  5IWA B;  2BTO A;  3RYI B;  2E5L B;  2F43 G;  2Y0P A;  2FL4 A;  3OMN B;  4P2Z A;  4UCO A;  1Y76 B;  3AG2 C;  1FFT B;  2DWD C;  1M1K W;  3CRM A;  5JCO C;  4JI6 B;  2QJ1 A;  1YIT V;  2GTS A;  1W59 A;  1S5L Z;  4U3J B;  4LR3 A;  1SQQ H;  4I0X B;  2X0L A;  3AG1 C;  2PGG A;  1L0L H;  4LF5 O;  4CS2 A;  4X1I A;  2P4V A;  1AVM A;  3QTC A;  4I50 A;  2LW7 A;  5DED A;  3CSX A;  3K5N A;  2F4V O;  3T2M A;  3AEI A;  4FVM A;  1AJP A;  4FLW A;  2DOS A;  2D3O W;  4OGQ B;  1KP2 A;  3GB7 C;  4FLV A;  4MVM A;  3KKY A;  1R3L C;  1BQ0 A;  1XL4 A;  3CPW U;  1KKD A;  4YJ3 A;  1KU9 A;  2Y4T A;  2X6A A;  1VQP V;  4JI1 B;  3SYP A;  3JAL A;  4MSW C;  2EIM C;  3AK1 A;  1SRY A;  2E74 B;  1VQ6 V;  4TOI A;  4DR4 O;  3L74 H;  2ZM6 O;  4WFE A;  5L3D A;  3O9O A;  2P22 C;  3W7S A;  3D8C A;  2A06 H;  1FFX A;  3VQW A;  2EIK C;  3T4Z A;  1HNW B;  4B3S B;  2YS8 A;  4DRX A;  1FPO A;  1XEQ A;  1HR0 O;  1M90 W;  2EIJ C;  3U0Z A;  2AZ0 A;  1G8M A;  4BW5 A;  4X1K B;  4FIP C;  3JAS A;  2ETN A;  4DV0 B;  5LHG A;  1MG1 A;  4F6R B;  4LF6 O;  1EN5 A;  4X66 B;  1U97 A;  3ASO B;  4DR3 B;  4UCV A;  2LFS A;  3J80 N;  4RQE A;  4RO2 A;  2KQX A;  1MZF A;  4G2K A;  2UXB B;  4IIJ A;  4E4E A;  3C90 A;  3S3X A;  1B3Q A;  3F7Y C;  2IM9 A;  2PTM A;  4B3S O;  1QHT A;  5EZY B;  5L3F A;  4NXM O;  2RMK B;  5IYZ B;  4DR6 O;  4Q20 A;  3JD4 A;  3ZRS A;  1THZ A;  2WLH A;  2HHH B;  4IHJ A;  2Y4U A;  2Q7E A;  4MVR A;  1SS3 A;  4FLZ A;  4MVU A;  1LR1 A;  4GX2 A;  3SDL A;  3HKD B;  3UO3 A;  2P5O A;  3AG1 B;  2DN9 A;  4Z2W A;  2XAS A;  3CJH A;  3L75 H;  2PUS A;  3SPH A;  3IFX A;  4DR6 B;  2Q5Z A;  3ZMU A;  2DYR C;  2X6B A;  3SPG A;  5BMV B;  1OCR B;  4JYB A;  5KX5 B;  4EKW A;  2MK3 A;  4BWA A;  2YDE A;  5IYB O;  1R73 A;  4CH5 A;  4EFE A;  3ZN0 A;  2QM7 A;  3ABL B;  4CC6 A;  4L8J A;  3NR7 A;  5IY5 C;  4X1I B;  4JI2 B;  4B3T B;  4LF4 B;  1V55 C;  1JQ0 A;  1PL4 A;  3QNE A;  5B3S B;  1K8A W;  1FS0 G;  5JWP A;  5F2V O;  1F7Y A;  2AXT Z;  4NKG B;  5CA0 B;  1MOF A;  3FAV B;  4DR5 B;  1Q86 W;  4TUY A;  1AIL A;  1NT2 B;  4N21 A;  1Q8I A;  1XQ8 A;  5B66 Z;  4AQY O;  4JTA B;  3JAK A;  4ASU G;  1VQK V;  4EEQ A;  3LDE A;  1M56 B;  2JEU A;  2LW1 A;  2Q0O C;  1S77 D;  3E2E A;  1NTM H;  3B2E E;  4HAM A;  1XUQ A;  4JYA O;  5KHH A;  5B1O A;  3ABU A;  5LOV A;  4B3R B;  4WBN A;  3E83 A;  5EBL C;  5C93 A;  3K04 A;  3DC5 A;  3ZMS A;  4IYI A;  2ZE7 A;  2BTQ A;  2ZE8 A;  1PNK A;  1SES A;  2CGN A;  2X6C A;  4BIO A;  3RYF A;  1JA8 A;  2HJD A;  4FPP A;  4O4J A;  3CCE V;  2DQ3 A;  1EBO A;  3FD9 A;  1O9G A;  1WB8 A;  1QLN A;  4X1K A;  4WFB V;  4PA9 A;  2Q7G A;  4ZOL B;  5LGU A;  3D3I A;  5IJ9 A;  5D5P A;  2MW2 B;  1Y6X A;  3JYC A;  4TV8 B;  1DGS A;  2A9H A;  2IH1 C;  2N05 A;  3ETE A;  3A0B Z;  2YXL A;  3M8A A;  2W6J G;  1P7B A;  3K5O A;  2UXC B;  2RNB A;  4KHP B;  3AK2 A;  1SZX A;  1MA1 A;  4DR1 O;  1GAX A;  1K73 W;  1PNL A;  4X62 B;  1N4C A;  5EYP A;  3LDD A;  3STL C;  4GT1 A;  4MVQ A;  4KL1 A;  4UB6 Z;  5J2U A;  3WFV A;  3CMA V;  4CH6 A;  2E5L O;  2UXN A;  4BAY A;  3UT5 A;  5CBH A;  1B6Q A;  2C2A A;  4ZHQ A;  2AHY A;  4ICG A;  3H01 A;  2ARH A;  5H6R A;  1N32 B;  3AG2 B;  1TA8 A;  3ABT A;  3CCL V;  1I7F A;  1W2B U;  3W7W A;  5K1X A;  4TQD A;  4JI2 O;  1KP3 A;  3TCU A;  4TWK A;  3VBB A;  4JPR A;  1VF5 B;  1EFR G;  4PI0 A;  4IIJ B;  2AZ2 A;  4JI0 B;  5IJ0 B;  1S76 D;  4JAV A;  3AG4 B;  4O2B B;  1R6T A;  4X65 O;  3JCZ A;  1M57 C;  3MD0 A;  4JI5 B;  4LFA O;  1N8R W;  3HR0 A;  5EBM C;  2M7W A;  3CCQ V;  2XAF A;  3ABK B;  3OTF A;  5CBG A;  2QM4 A;  4DR5 O;  1S72 V;  1VQM V;  3H9V A;  1HNX O;  1SQF A;  3M99 B;  4GUN A;  2BTQ B;  2VQE B;  3UQ8 A;  2RCV A;  5BY1 A;  1Q6I A;  2XHB A;  1COW G;  1YXB A;  2ZR2 A;  2W6I G;  4J41 A;  3HKE A;  1YHQ V;  1H8H G;  4OXS A;  3L73 H;  3VOU A;  2QDO A;  5B1B C;  1L0N H;  3BAA A;  1GN2 A;  4LH7 A;  4CC5 A;  1VQO V;  4OPA A;  2UXD O;  4I55 A;  4GKK B;  3AG3 B;  4QPK A;  1P84 F;  3MHS C;  1DF5 A;  1WPX A;  4MT8 A;  5B1A B;  4H44 B;  4NB5 A;  2F66 C;  3B09 A;  2EZP A;  3ZHS A;  1SET A;  4L87 A;  1WN7 A;  3RGB A;  1RFY A;  3K5L A;  1URF A;  2BSK B;  5EK0 A;  1XHZ A;  4YJ2 B;  3CS5 A;  1AB3 A;  3CE2 A;  5CB4 B;  4GKK O;  5BXZ A;  1AP6 A;  1X59 A;  4TUY B;  2UXX A;  1H2S B;  4KP4 A;  3BA8 A;  4JI4 B;  2OCH A;  1GN3 A;  5B1N A;  1VQ5 V;  1EN6 A;  1NTZ H;  2YC0 A;  1KBH A;  1WAZ A;  2QWR B;  4O4I A;  5GON B;  3OR7 C;  3JCU Z;  2Z3Y A;  4PV1 B;  1KB9 F;  4I5S A;  2ZDI A;  3B8M A;  4O4L A;  3ETD A;  4WFF A;  3W7X A;  4LP8 A;  3JAM N;  1HNX B;  2Y69 C;  4DV6 O;  2CH7 A;  2EX3 A;  5CA1 B;  1JFF A;  3JD1 A;  2N74 A;  1EM1 A;  5JVD A;  3RYH A;  1XNQ O;  4R7C A;  3OM3 B;  4UVC A;  3IAY A;  1QQC A;  1RPO A;  1YJW V;  1SQP H;  3PJS K;  5EZY A;  1IZ3 A;  2GSM B;  3LNN A;  4PD4 F;  2BSK A;  2P90 A;  2P7T C;  4E2L A;  1GO3 F;  2A7W A;  1SC5 B;  5DM6 V;  2UU9 O;  3CWB H;  1Y66 A;  3QO5 A;  2WAM A;  2WA4 A;  3PN1 A;  1UFI A;  4F4L A;  4LF6 B;  1Q6U A;  3JAL B;  3I56 V;  1LUW A;  5A2Q N;  5LL6 Y;  5BR8 B;  3SPC A;  2HR3 A;  4P9O A;  4DV1 B;  4GKJ B;  3BHP A;  2DYS B;  5EYP B;  1K7D A;  1J5E B;  1YI2 V;  2YEV B;  2QKA A;  1KEC A;  5JQG A;  3JAK B;  1XHX A;  1R6N A;  3QF7 A;  2UXC O;  2H3O A;  3OEE G;  3L70 H;  2UUB B;  4I4T A;  1V54 B;  3THO A;  4R6Z A;  2VQF B;  2QWP B;  4D6T H;  4NXN O;  3Q4H A;  3RBZ A;  4I0X A;  2AHZ A;  4R8C A;  2GHY A;  3CCR V;  3CP1 A;  3BAB A;  1OCZ B;  1W0J G;  5DN6 G;  1QU7 A;  5H6Q A;  4KUM A;  3B4S A;  4R50 A;  2HEP A;  4MVO A;  2ADQ B;  3RN4 A;  5KHK A;  2DWE C;  2QKS A;  3I55 V;  5EIB C;  2YSU B;  4X62 O;  3E8B A;  4WFA V;  2EJR A;  1XMQ B;  4ZHQ B;  5LXT B;  1S0V A;  4LF5 B;  3APO A;  3EHB B;  2KKW A;  4O2B A;  4YXW G;  1H2L A;  4JAA A;  3OTO B;  3ZED A;  2DYS C;  1K33 A;  4QNH B;  4TV9 A;  4DV5 B;  1OV9 A;  3TGU H;  2DJV A;  4IYH A;  1D2D A;  2CGO A;  3RYI A;  4DR3 O;  4DUY O;  4FM2 A;  1EN4 A;  1YTF D;  1QR8 A;  2QKC A;  5KUM A;  1T5E A;  1ZLZ A;  4DR2 O;  5EC2 C;  1M4U A;  4MTG A;  3CXH F;  3CX5 F;  5L3G A;  4DV4 B;  3RYF B;  2YIB A;  4DV1 O;  1NH2 D;  4K8X A;  3QO7 A;  5AG2 A;  3BRC A;  1NU1 H;  2XAQ A;  2GV9 A;  4FLU A;  4DW0 A;  1BHA A;  2KB1 A;  1DTO A;  3E22 A;  4DW1 A;  3VQV A;  3SYA A;  3RFR A;  1YEW A;  4JYY A;  1I5Y A;  1S5J A;  4DRX B;  4H33 A;  3K79 A;  1R1B A;  3ABL C;  3BEH A;  5IE9 A;  2OTL V;  2GUZ A;  1XIL A;  1SKV A;  5FPR A;  3JAT A;  3T4D A;  1DK1 A;  1YSC A;  2EIM B;  3OW2 U;  4MTO A;  2ZE6 A;  4YIP A;  4JI0 O;  4GX1 A;  1GM7 A;  2Q8V A;  4NVP A;  1FXH A;  1O9H A;  3FX7 A;  2FYU H;  2JS3 A;  1MSD A;  2F4V B;  3N27 A;  1MSW D;  1WA8 B;  2Z0A A;  2ZIN A;  4YY3 B;  4TQF A;  2OIG A;  3WB0 A;  1NS1 A;  1JMK C;  1IBK B;  4FM1 A;  4J7J A;  1OJH A;  2HFE C;  2X7R B;  1F51 A;  3GWO A;  4LFB B;  4OX9 O;  5CA1 A;  3C3S A;  2Q69 A;  3CC2 V;  2KG7 B;  1NQT A;  1H38 A;  1TUB B;  1R3J C;  3ABM B;  3B40 A;  2QEX V;  2PYL A;  2Z5U A;  4JI8 B;  4P9P A;  1XOU A;  3E89 A;  4DYL A;  2ZXW C;  3HKC B;  1MNG A;  1OZ0 A;  3E8H A;  4U3J A;  1SF9 A;  3ASO C;  2EJ7 A;  3OE7 G;  3K03 A;  3K08 A;  3TXQ A;  2EIL B;  1F4N A;  2QWO B;  1I94 O;  1MZE A;  2CUG A;  2ZKO A;  1TVK B;  2OCC B;  1Q81 W;  1GMG A;  3CRC A;  1RP3 B;  4XDK A;  3TET A;  2PI4 A;  2WSS G;  1NJI W;  1Z5W A;  5ITZ B;  1N0J A;  5JCO A;  3SGI A;  4B3T O;  2XOK G;  4PI2 A;  4MW3 A;  4XDJ A;  4YJ2 A;  4RUE A;  3BY6 A;  4QE9 A;  2JK5 C;  3OGC C;  5EBW C;  1VQL V;  5LGT A;  2VWJ A;  2BOB C;  1BS3 A;  1XBL A;  4DV6 B;  1QVF U;  3OFN G;  1FKA O;  4JI3 O;  3ZCC A;  1IBM O;  2WLI B;  4B3R O;  4G28 B;  5KX5 A;  3EXA A;  1V9P A;  2DQ0 A;  3KZI Z;  1XMO B;  1US6 A;  3JAR A;  3M7M X;  2ZM6 B;  4GZR B;  3H1J H;  4GX0 A;  4H0L B;  4O4I B;  4K3A A;  5GON A;  4UCS A;  2LO1 A;  2JJ1 G;  4JI6 O;  4AHC A;  3UO2 A;  1YJ9 V;  4DV3 B;  3RYH B;  4MTX A;  5KMG B;  1X4T A;  2NN4 A;  2QE7 G;  5LHH A;  1IUR A;  2CH7 B;  5JH7 A;  4OX9 B;  4JI5 O;  4LFA B;  2H8P C;  4ZKI A;  1IBK O;  1GKF A;  1BL8 A;  1WA8 A;  3BPZ A;  2ZR3 A;  1G4Y B;  1N36 O;  2P67 A;  4WF9 V;  2HG5 C;  1SA0 B;  1GH6 A;  1HDJ A;  2ZXW B;  2GTA A;  4DR7 O;  4LH6 A;  5LBQ A;  3DXR A;  1NTK H;  1TUB A;  3A0R A;  1KC8 W;  2ILM A;  3ZHQ A;  3DSQ A;  4O2A A;  1KKC A;  3H1I H;  2LGW A;  3LSS A;  1IXM A;  3N2K B;  4ABM A;  2RJZ A;  2LQT A;  1ZX3 A;  1RPR A;  1N34 O;  1NBM G;  1JPX A;  1PL0 A;  1F23 A;  1AR5 A;  4UVB A;  3SPI A;  4GCZ A;  1PNM A;  4LF7 B;  3ASN C;  1M9N A;  4JZG A;  2O57 A;  2ATK C;  3CCM V;  5CMU A;  2ODM A;  4I7Z B;  1K3E A;  1NVP B;  3CRR A;  1R3I C;  1SER A;  2FB5 A;  2Y0I A;  4LF8 O;  2UXD B;  5C8Y A;  4PDV A;  4TV9 B;  1NI8 A;  2BCC H;  2OTJ V;  4UV9 A;  3G67 A;  1SQX H;  5FPO A;  4J11 A;  3HKE B;  1K4C C;  4IT5 A;  2VQF O;  5IJ9 B;  2IJJ A;  2VS0 A;  2HKO A;  4K8Z A;  3ZHR A;  1DLB A;  1OCZ C;  1AJQ A;  1TUE B;  3LSU A;  3B8N A;  5C8Y B;  1Y74 B;  3AG3 C;  2V1D A;  4J42 A;  3APQ A;  1YJN V;  5IY5 B;  3ZRW B;  4PDR A;  4JGS A;  2RN9 A;  3NXS A;  2Q7H A;  4J80 A;  2ADP A;  1GM8 A;  3OMA B;  4GKJ O;  4LFB O;  2H94 A;  4DR1 B;  2A3Q A;  4ZOL A;  2CTR A;  4RWU A;  3OMI B;  2QGN A;  3EFF K;  1JVM A;  1BMF G;  4PA4 A;  4QGP A;  1SA0 A;  3CCV V;  4KXR A;  2YIC A;  3K9A A;  1AR1 B;  5LGN A;  2LGQ A;  4O2A B;  2HVJ C;  2EUL A;  1M57 B;  4LF4 O;  4PA7 A;  2V7Q G;  4B3M O;  5BZB A;  3J81 N;  4DV2 B;  5KMG A;  3BA9 A;  4WCE V;  3Q4H B;  5J9P C;  1VIB A;  1QBZ A;  3G80 A;  1AJN A;  1UJW B;  1ROP A;  2HJF C;  3ABM C;  5JVD B;  1IVS A;  4NR1 A;  4YHH O;  1CP9 A;  1S3J A;  1ZSP A;  2GBO A;  3MHH C;  3X2Q C;  3LUT B;  5EC1 C;  1PP9 H;  1YVW A;  5GTH Z;  1M56 C;  3I5D A;  5B3S C;  4LNU A;  5IYC O;  1K92 A;  2ZDI C;  3ZMV A;  1SQV H;  4DV7 B;  3AK3 A;  2CTW A;  2QTO A;  4X89 A;  5FNV A;  1BE3 H;  4IGG A;  1XRE A;  3SJQ C;  4JI7 O;  1G6U A;  3FYI B;  3LNM B;  5IYZ A;  4NYK A;  3HB3 B;  1Q7Y W;  4ZIB A;  4AI8 A;  1I94 B;  2CTQ A;  2PZS A;  4JZ2 A;  2WLL A;  2YXH A;  3K0D A;  1JR9 A;  2LP7 A;  2CK3 G;  1HR0 B;  3FB8 C;  3FB5 C;  4TT3 G; 
#chains in the Genus database with same CATH homology
 2IJK A;  3SPJ A;  4MS2 A;  4Q20 A;  3JD4 A;  3WG7 B;  3ZRS A;  1THZ A;  2WLH A;  1H2G A;  3OUF A;  1NKD A;  1K5Q A;  2WLL B;  4MVR A;  2DW4 A;  4XBF A;  4MVU A;  2ZD9 A;  4GX5 A;  3STZ C;  4GX2 A;  2JEX A;  2WLN A;  4QE7 A;  3JD2 A;  3AG1 B;  1YTF D;  1QR8 A;  1AI4 A;  2XAS A;  3HPL C;  4JTD B;  4JYC A;  3SPH A;  3IFX A;  3ZMU A;  2DYR C;  5KUM A;  2X6B A;  3SPG A;  5IYD O;  1OCR B;  4JYB A;  3CD6 V;  3RW0 A;  1VQ7 V;  5EC2 C;  4EKW A;  4MTG A;  2IH3 C;  2WLJ A;  4BIZ A;  4H37 A;  2MK3 A;  2LFR A;  5L3G A;  4UV8 A;  3ML0 A;  4ZBM A;  5IYB O;  1NH2 D;  3QO7 A;  1R73 A;  3ZN0 A;  2XAQ A;  2QM7 A;  1BHA A;  3ABL B;  1OCO B;  2KB1 A;  1DTO A;  5IY5 C;  3B77 A;  4UVA A;  2WLM A;  3SYA A;  3E8F A;  2PI5 A;  1I5Y A;  4WFG A;  4UUJ C;  1QLE C;  3RVY A;  1V55 C;  3ZMZ A;  4H33 A;  3K79 A;  2EIJ B;  3AG4 C;  1LNQ A;  3ABL C;  3E8G A;  1JQ0 A;  3BEH A;  3QNE A;  5B3S B;  1K8A W;  1KD1 W;  2OTL V;  2EIK B;  1V54 C;  2Y48 A;  1YTF B;  1FS0 G;  2R9R B;  2B1I A;  3E86 A;  1K5S A;  3TK1 A;  1JJ2 U;  3FKS G;  2OT5 A;  3T4D A;  1MOF A;  1Q86 W;  1YSC A;  2EIM B;  1GTO A;  3OW2 U;  4MTO A;  1VQ4 V;  1Y4M A;  3FB6 C;  2WWW A;  4N21 A;  1JX9 A;  2IU3 A;  4JTA B;  4GX1 A;  1GM7 A;  4ASU G;  1VQK V;  3ASN B;  3LDE A;  1M56 B;  1FXH A;  2JEU A;  1S77 D;  3E2E A;  2W0F C;  4HAM A;  3SYO A;  1NR1 A;  2IJH A;  1MSW D;  5B1O A;  1ARO P;  3ABU A;  3CCU V;  5B1A C;  3E83 A;  1CEZ A;  5EBL C;  4CZZ A;  5C93 A;  3K04 A;  3CXC U;  3ZMS A;  4J9Z B;  2HFE C;  2X7R B;  1F51 A;  3GWO A;  1EZJ A;  1PNK A;  1S5H C;  2Q69 A;  1SES A;  2X6C A;  1NQT A;  3CC2 V;  1H38 A;  1R3J C;  3ABM B;  1VQ8 V;  2QEX V;  2Z5U A;  2WLK A;  4P9P A;  3E89 A;  4FPP A;  1P4R A;  3CCE V;  2DQ3 A;  1EBO A;  3UKM A;  5KUK A;  1QLN A;  1QR9 A;  2ZXW C;  4WFB V;  4JTC B;  4PA9 A;  1YIJ V;  5CA3 A;  1OZ0 A;  3E8H A;  5LGU A;  3D3I A;  1HWY A;  3ASO C;  3OE7 G;  3QO8 A;  4TSF G;  5HFM A;  3P32 A;  3K03 A;  3K08 A;  2QM8 A;  3CCS V;  4HYO A;  2EIL B;  1F4N A;  3JYC A;  1E1Q G;  2A9H A;  2IH1 C;  2K1E A;  1ORQ C;  1I5X A;  3ETE A;  2FTK A;  2OCC B;  3KG2 A;  1Q81 W;  1GMG A;  1K9M W;  4XDK A;  2W6J G;  3TET A;  1P7B A;  2PI4 A;  2Q68 A;  2WSS G;  3IGA C;  1NJI W;  4X88 A;  5B1B B;  1K73 W;  1PNL A;  2XOK G;  4MW3 A;  4XDJ A;  4RUE A;  1E79 G;  3BY6 A;  4QE9 A;  2B1G A;  3LDD A;  4U7O A;  3E35 A;  3STL C;  4GT1 A;  4MVQ A;  2JK5 C;  3OGC C;  5EBW C;  1VQL V;  3WFV A;  3CMA V;  5LGT A;  2BOB C;  2HVK C;  2UXN A;  4BAY A;  1QVF U;  5CBH A;  3OFN G;  1B6Q A;  2C2A A;  2AHY A;  1OCC B;  3H01 A;  3ZCC A;  5H6R A;  1K34 A;  2WLI B;  3AG2 B;  5CN0 A;  4G28 B;  3ABT A;  3CCL V;  1DF4 A;  3W7W A;  1W2B U;  3CC4 V;  1WLE A;  2DQ0 A;  1KP3 A;  3TCU A;  4TWK A;  3VBB A;  1AI6 A;  1AI7 A;  2Y69 B;  2QA4 V;  4MW8 A;  4GX0 A;  4JPR A;  1EFR G;  1V55 B;  1K4D C;  4PA3 A;  1S76 D;  4JAV A;  3AG4 B;  3G4S V;  4N23 A;  2JJ1 G;  2NLJ C;  1VQN V;  4MTF A;  1QCE A;  4QJF B;  3JCZ A;  1QLE B;  1M57 C;  1YJ9 V;  3MD0 A;  1N8R W;  4MTX A;  5EBM C;  2M7W A;  2QE7 G;  3CCQ V;  2XAF A;  3ABK B;  5LHH A;  5CBG A;  4WFH A;  3T1C A;  5HFL A;  1S72 V;  1VQM V;  4KFM A;  1JCH A;  2WLI A;  2H8P C;  2XAG A;  3M99 B;  4ZKI A;  3SYC A;  3SYQ A;  1GKF A;  1BL8 A;  1OCR C;  2ZR3 A;  1K97 A;  1G4Y B;  3IC7 A;  2EIL C;  2OCC C;  3RVZ A;  2P67 A;  4WF9 V;  2HG5 C;  4G27 B;  1GK9 A;  3OR6 C;  2ZR2 A;  1COW G;  3K3W A;  4PDM A;  2W6I G;  5L3B A;  2ZXW B;  4QPJ A;  4FMT A;  1L1F A;  2IU0 A;  3G6E V;  3LDC A;  1YHQ V;  1H8H G;  4OXS A;  3VOU A;  5LBQ A;  3JD3 A;  3CCJ V;  5B1B C;  3A0R A;  4RAI A;  3OAA G;  5H9C A;  1KC8 W;  4JF3 A;  4DO2 A;  4HZ3 A;  1VQO V;  4DXW A;  3LSS A;  1IXM A;  4RQF A;  3AG3 B;  4QPK A;  2Q6A A;  3OUS A;  2IW5 A;  4JAU A;  3DGE A;  1PKX A;  3MHS C;  1DF5 A;  1WPX A;  4I9W A;  1FXK B;  4MT8 A;  4PA6 A;  5B1A B;  1RPR A;  1NBM G;  1JPX A;  2EZP A;  1PL0 A;  1SET A;  1SZT A;  1RM1 C;  4L87 A;  1F23 A;  2A0L A;  4JAS A;  1NVP D;  2EBO A;  3ZRV A;  2BOC C;  2YEV A;  2XND G;  1Q82 W;  4UVB A;  3SPI A;  4GCZ A;  2EIN B;  5EK0 A;  1ZWI C;  1PNM A;  4BIU A;  3ZN1 A;  3W7U A;  3ASN C;  1M9N A;  5GW7 A;  3CCM V;  2ATK C;  1FXK A;  5CMU A;  1K3E A;  4FJC C;  3X2Q B;  1FXV A;  1NVP B;  3LSQ A;  5KA6 A;  1R3I C;  1SER A;  3ZIA G;  4PDL A;  2UXX A;  1QVG U;  4KP4 A;  1W0K G;  2B5U A;  2EIN C;  2WPD G;  4PDV A;  1OCC C;  2OTJ V;  4UV9 A;  5B1N A;  1VQ5 V;  1NR7 A;  3ABK C;  1JOY A;  1K4C C;  1VQ9 V;  1R6K A;  2IJJ A;  3OR7 C;  2HKO A;  5L3C A;  1J95 A;  3K06 A;  4PEL A;  2NNU A;  3FYE B;  2Z3Y A;  1BHB A;  1DLB A;  1OCZ C;  4I5S A;  1AJQ A;  3D36 A;  2ZDI A;  3B8M A;  4LC1 A;  1TUE B;  4X8A A;  3ZMT A;  3ETD A;  3B8N A;  3ETG A;  3CC7 V;  3AG3 C;  4WFF A;  3F5W C;  2V1D A;  3W7X A;  4LP8 A;  1FXK C;  2Y69 C;  1H8E G;  1YJN V;  5IY5 B;  1ENV A;  3CYO A;  3ZRW B;  4PDR A;  3UM7 A;  2F43 G;  4JGS A;  3NXS A;  3OMN B;  3JD1 A;  4MVZ A;  4P2Z A;  4Z1M G;  3AG2 C;  1FFT B;  2DWD C;  2DYR B;  4R7C A;  3OM3 B;  4UVC A;  5LHI A;  1M1K W;  1RPO A;  1YJW V;  1YIT V;  3PJS K;  1GM8 A;  3OMA B;  3ZJZ A;  2HLD G;  2GSM B;  1OHH G;  2H94 A;  1F4M A;  2X0L A;  3AG1 C;  4XDL A;  2P90 A;  2P7T C;  4E2L A;  1NH2 B;  2JDI G;  1GO3 F;  3OMI B;  1PD3 A;  3EFF K;  1JVM A;  1BMF G;  1OCO C;  4PA4 A;  5DM6 V;  3CME V;  3CCV V;  1Y66 A;  3T2M A;  3K9A A;  2ZQM A;  3AEI A;  1AJP A;  2EZO A;  3QO5 A;  1AR1 B;  2WAM A;  2ITC C;  1R3K C;  5LGN A;  2R9I A;  2D3O W;  2HVJ C;  1KP2 A;  3GB7 C;  4F4L A;  2JJ2 G;  3I56 V;  3WG7 C;  1M57 B;  4MVM A;  3SPC A;  4PA7 A;  2HR3 A;  4P9O A;  1R3L C;  2V7Q G;  1XL4 A;  3CPW U;  1KKD A;  5IDJ A;  3ZRX A;  5BZB A;  1KQS U;  2IJI A;  2DYS B;  1K7D A;  3OEH G;  3W7T A;  4WCE V;  1YI2 V;  2X6A A;  2YEV B;  3F7V C;  1VQP V;  1KEC A;  3SYP A;  2XAH A;  4UXN A;  4MSW C;  1K33 A;  1R6N A;  2EIM C;  1SRY A;  5J9P C;  2A79 B;  1QBZ A;  3ZRW A;  1AJN A;  3OEE G;  1E1R G;  4FK5 C;  4P30 A;  1UJW B;  1VQ6 V;  1ROP A;  2HJF C;  3ABM C;  4WFE A;  4LCU C;  4RUF A;  5L3D A;  1V54 B;  1GM9 A;  1CP9 A;  1S3J A;  3JD0 A;  3MHH C;  4R6Z A;  4TT3 G;  3G71 V;  3X2Q C;  3LUT B;  3W7S A;  5EC1 C;  3RBZ A;  2AHZ A;  4R8C A;  2GHY A;  3CCR V;  3CP1 A;  1OCZ B;  5E1A C;  4QIW F;  2EIK C;  1W0J G;  4LBE C;  5DN6 G;  3T4Z A;  1M56 C;  5B3S C;  5IYC O;  5H6Q A;  4KUM A;  1M90 W;  3R65 A;  1XL6 A;  2EIJ C;  4R50 A;  1K92 A;  2ZDI C;  4MVO A;  2XAJ A;  1G8M A;  4BW5 A;  3ZMV A;  2P6J A;  4FIP C;  1CPY A;  2DWE C;  2QKS A;  5L3E A;  2QTO A;  5LHG A;  3I55 V;  1MG1 A;  4X89 A;  2YSU B;  3DTU B;  3P30 A;  3E8B A;  3SJQ C;  4WFA V;  3ASO B;  4CBC A;  3FYI B;  2LFS A;  3LNM B;  4RQE A;  2EJR A;  2ITD C;  4MVS A;  4RO2 A;  3K0G A;  3HB3 B;  1Q7Y W;  3FB7 C;  1S0V A;  4G2K A;  3EHB B;  2Q67 A;  5CBF A;  2JIZ G;  5KA5 A;  5FL7 G;  1RM1 B;  2WLL A;  4YXW G;  1MAB G;  3K0D A;  2LP7 A;  2CK3 G;  3F7Y C;  4U7N A;  1AI5 A;  3FB8 C;  5L3F A;  3FB5 C;  2DYS C;  4J9Y B;  4QNH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...