5CBKA

Crystal structure of the strigolactone receptor shhtl5 from striga hermonthica
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
271
structure length
271
Chain Sequence
MSTVGSAHNVTVLGSGETTVVLGHGFGTDQSVWKYLVPHLTDDYRVLLYDNMGAGTTDPNLYDFERYSSLEGHSQDLIAILEEFHVTKCIFVGHSLSSMVGAVSSIFRPDLFRKIVMISACPRVANADDYYGGFEEEDVNQLYGAMEENFQTMMTGYAPIVVGGDLESEAMQEFSRTLFNMRPDIALSICRMISGYDLRPYLGLVVIPCHIIQSSKDKLVPVAVAEYLHRNFGGKSVVELIPTEGHLPHLSAPDITIPVLIRHINQDIADD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function analysis identifies highly sensitive strigolactone receptors in Striga.
pubmed doi rcsb
source organism Striga hermonthica
molecule tags Signaling protein
molecule keywords ShHTL5
total genus 95
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cbkA00
2QTBA 1WPXA 2I03A 2ZJFA 1XZEA 4BVJA 2HA7A 5AICA 4XWGA 3G8YA 3D3NA 1DWQA 3C6BA 4Q05A 2BUBA 2XE4A 1MJ5A 1FFEA 1CUHA 2O2HA 4W1RA 1CRLA 1RP1A 2VAVA 4UBLA 2GBIA 5EIAA 4G9GA 1DU4A 2GBGA 4EZIA 1UOPA 3QMVA 1QONA 1AMNA 1XZGA 4GEGA 1TKRA 1XRNA 3VDXA 3ESAA 2WILA 2X8BA 2WIFA 5CT8A 2DQZA 2VJBA 5ALWA 4CCWA 1Z68A 3N2ZB 4B84A 4X7BA 3I1IA 4ARBA 4X94A 1X2EA 4EBBA 1L7QA 3KOOA 2HRQA 4A23A 2VJCA 4BZWA 3I2FA 3U0VA 5I9IA 4KE8A 5EHQA 4P92A 3DKKA 3D7RA 1H2XA 4KE9A 3ZLUA 2C7BA 2QT9A 2ZSHA 4ITVA 4X95A 1VZ3A 5HFNA 4ZV9A 5ALYA 4HTAA 1EI9A 3DJYA 4IH4A 4CIAA 2XMGA 4HVTA 2VJAA 1EB9A 5AK6A 1GKLA 3K6KA 2C5GA 4KE6A 4N8SA 1P0PA 3M82A 2XDWA 1XLVA 3W04A 4KAJA 1MX9A 2O7RA 1GZ7A 3FYUB 1ETHA 2XMBA 3GROA 1R3DA 1CUEA 4YASA 3H1AA 4XX1A 1QTRA 1K6EA 1VZ2A 1KEZA 1UXOA 1WB4A 2BUCA 5AHXA 4EY7A 1U8EA 1YASA 3EIOA 5A6VA 1MPXA 5A2GA 4BDSA 2GYVA 4DNPA 3DL7A 3ANSA 2Y6VA 2J3DA 4Y2RA 3SC2A 4J3JA 1EDEA 2OPHA 4B0PA 3D2AA 1E8MA 4J0HA 1FSSA 5ALKA 3N0TA 4C87A 3WZMA 1BEEA 1XZAA 3BXPA 3IUJA 5AI8A 4B9AA 1ZGBA 1LBSA 4OSEA 4DIUA 4MWSA 5HK9A 3E3AA 5E4TA 3FLEA 1XKLA 3ICWA 3SX4A 4DNQA 1X2BA 1HBJA 5HZGA 1H2ZA 1T2NA 1A88A 1F6WA 4XJVA 3IVMA 1CUGA 3QYJA 3FWHA 4X6XA 5ALJA 1QLWA 1CQWA 4OYLA 5ALDA 2XUHA 4KR0A 3OM8A 1SC9A 3DLTA 5CH5A 4INZA 1XQWA 1LGYA 1C4XA 5KBYA 1WHSA 2QVBA 1FFCA 3PUIA 4IQ4A 1TCCA 4MYSA 2AJ8A 4BC0A 1HQDA 5T4FA 3STVA 4Q1VA 1VXOA 1CPYA 1MU0A 1GT6A 3H18A 4PSCA 3B3QA 3GUUA 1EDBA 2WFLA 2ZYHA 1JU4A 3V1MA 3DYVA 2R8BA 4K6GA 3GELA 2K2QB 4G5XA 4DGQA 2BKLA 3O4IA 1J07A 2V97A 3MVEA 4YPVA 5AKGA 3C5VA 4DLNA 2RHWA 3ZLVA 1UKCA 5JZSA 3SWWA 3DD5A 3IULA 1YAHA 2JGJA 1GGVA 1WB6A 1F0PA 1LPOA 2XI4A 5K3DA 2WIDA 2WIJA 4ZV7A 4B9EA 5BWBA 1HDEA 2HA5A 3BWXA 5JATA 2HU8A 3AIOA 4WDRA 2WFLB 3WKDA 1VLQA 2OQIA 5AKZA 3KXPA 4AZ3A 2DR0A 2WJ4A 1GKKA 2WM2A 4QE3A 1DQYA 1LPMA 1FFBA 3G0GA 4KAFA 5A62A 3VISA 1MNQA 2PX6A 2Y1KA 4W1QA 3O4JA 2BFNA 3AZPA 4OU4A 4OU5A 3BDIA 2C0PA 5EHNA 1QIEA 4FMPA 3WWDA 1AUOA 3ESCA 2WU3A 3G0DA 2QR5A 2WG0A 2WTNA 2O7VA 1YS1X 2H7XA 2W6CX 4G4IA 3D2CA 4AN1A 3A2LA 4C4YA 5K3FA 1FFDA 2AJBA 1C7IA 4B82A 5HKAA 5AK3A 1Q83A 5HQ3A 1CUXA 4AMZA 4OYYA 3F67A 2VATA 5ALGA 3O4GA 3WK9A 4DMFA 2AXEA 3QPDA 3UUEA 5E4JA 3FOBA 2I78A 3ED1A 3ILSA 4QWWA 4Q34A 1W75A 2Z8ZA 4CG1A 1ODSA 4IH9A 4OB7A 4TGLA 3QMMA 2YYSA 3DOHA 1ZICA 2IX9A 4FHZA 1E66A 1HKHA 1AZWA 5K3BA 2VT6A 4B81A 3FLBA 4JEIA 3VVMA 1CIJA 2J4FA 2PVSA 5DYYA 1A8SA 1UOOA 4IHAA 2WQZA 4KRXA 4M0FA 3L1HA 2WG1A 3W9UA 5JANA 1JJBA 3CCBA 3HJUA 4C89A 4UFPA 3EQ7A 3MGAA 4ZGBA 4MWTA 1JT2A 4DTCA 4C6HA 2XMSA 2QXTA 1XRQA 2XUDA 3A2NA 2HA2A 3WWEA 4BC1A 3LLCA 5K5EA 1KU6A 3F9CA 1BROA 3F98A 4UPDA 2X76A 5JD4A 3OPMA 1YB7A 2V98A 4H7DA 3FCYA 1DQZA 4AZ0A 3FYUA 1LLFA 5C8ZA 1SCIA 5KWIA 3C6ZA 5HF9A 5JZBA 4CG2A 4Y2JA 5AKIA 2JGEA 2OCIA 2JGMA 3WJ2A 3AFIA 1W1IA 3G9UA 4MQMA 5AIAA 2PL5A 1WB5A 4UBOA 1CV2A 4DM7A 1H2WA 4BZZA 5LYYA 1G4HA 1UK7A 1LZLA 1RYYA 2PSJA 4UHEA 4AQDA 4CFSA 1FJ2A 1XKTA 2RAUA 4Y2UA 5ALOA 2XUFA 4ZXFA 1QIHA 1SOMA 3X3HA 1F8UA 3W06A 2PUJA 2I3DA 2QXUA 4Y2TA 1BE0A 3IUNA 2PBLA 1XRMA 3H19A 4Y7DA 1TRHA 4J0GA 3EBLA 4PNZA 3E1GA 4PO3X 1Y37A 1E8DA 1QE3A 2GYUA 4LKOA 5IVIA 1C7JA 3QBJA 4JYMA 5JYCA 3M83A 3H2GA 4CCYB 1CUWA 3DDUA 3TEJA 2B61A 2VAXA 1QIIA 3O9VA 3JYHA 4B0OA 3LCRA 1P0IA 4GWLA 4FLEA 4J03A 1N1MA 1CR6A 4W1SA 3DKRA 4B6GA 2QJRA 1R1DA 2WIGA 2FJPA 1ZD3A 1NX9A 2UZ0A 1EHYA 1JMKC 5CT5A 5T4HA 3IIIA 4WFIA 5CW2A 4X00A 3PI6A 2GBCA 1QIJA 2YXPX 5AIBA 4RGYA 1HLGA 4WJLA 4OD0A 5FKJA 4BTLA 5ALPA 4QZVA 3ESDA 2JGIA 1IMJA 3Q8WA 1G5FA 3VJMA 3HYSA 4CG3A 3I2HA 3ANTA 3PFBA 5ALMA 5HF5A 4K2AA 3FYTA 4OUKX 2WG2A 4AX4A 1TIBA 3I2JA 4UHDA 1XZHA 2B20A 4A16A 1XQYA 1CUZA 3LIIA 5A7HA 4BRZA 4AXBA 4M0EA 1NU6A 1UT6A 3WYDA 4KE7A 5ALEA 4NZZA 4MQLA 4G9EA 5EIHA 2QS9A 4I4CA 3I6MA 4GLBA 1LPBB 1QIDA 1D07A 1IZ7A 1K8QA 4S0XA 5JZ9A 4PV7A 1UZAA 4AO6A 2PPLA 1MNAA 5ALRA 1ORVA 5JARA 4C4XA 2O2IA 4OB6A 3A2MA 1UK8A 2Q0XA 2Y6UA 3V1NA 3HRHA 2QRUA 1EVQA 5IH7A 1XFDA 4OB8A 2OCKA 3WK4A 1BN6A 4J0KA 2C4HA 5AI5A 1P0QA 1XZKA 2XUQA 1VA4A 1ZJ5A 1CUSA 3EQ8A 2OGTA 3AJAA 1YB6A 4H18A 2E3JA 3HACA 4BB0A 2O2GA 4KACA 4P93A 1DWOA 2ZVDA 3DQZA 2XMZA 5KWJA 2GZSA 4UFNA 1BRTA 5IVKA 2PU7A 1LBTA 2DCMA 5HCUA 4EY6A 4TVKA 5LZ8A 4DNFA 2WUFA 3IURA 5SYNA 2PSFA 4KYVA 4H7EA 1QTIA 1SCQA 5HFAA 3V48A 2QJWA 1S8OA 4U2DA 5HKBA 1JJFA 4X3CA 3QMWA 2QM0A 2Y2VA 1EA5A 1B6GA 1QIKA 4HXEB 3R3ZA 1R9MA 2OCLA 5JAPA 5AOCA 3STYA 1JKMA 5D3ZA 3VVLA 3QPCA 2BAGA 1XQVA 2CMFA 1ORWA 1H2YA 1ZD5A 4K5QA 3PUHA 1W52X 3IUQA 5CXUA 2ROQA 3C6XA 4N5HX 2JEYA 3G0CA 3R40A 4E46A 4AO8A 1EX9A 4HZGA 5EFZA 3R3UA 1IVYA 4H7JA 2QOEA 1GPKA 1ODTC 3SK0A 4NMWA 1BEZA 4Q3KA 5ALHA 5DYTA 3OG9A 2WTMA 5ALIA 2WIKA 3BJRA 5DNUA 2HA6A 1U4NA 2H7YA 3FVTA 1QIFA 3QPAA 2B9VA 4GW3A 4C01A 4Q3LA 5CMLA 3L1IA 3WK8A 1BU8A 2I3ZA 4X6UA 5A7GA 5C8XA 2CUTA 3BL8A 4UBKA 1F0NA 2IITA 4PSDA 4KEAA 4G4JA 2WJ3A 5JASA 4LXIA 1QFSA 1UFOA 3FVRA 2QUAA 4J0CA 2CBGA 3WKCA 4U2EA 1EINA 3EQ9A 4N5IX 3DEAA 1J06A 5SYMA 2HU7A 3PF8A 3U1TA 2WFMA 5T4EA 4AN0A 3DYIA 4FOLA 1ZOIA 2ZYIA 1BCRA 3G9TA 4UHCA 4UBJA 1GPLA 5HF6A 2DHDA 4QEKA 5LKAA 1QO7A 3MUOA 1UKBA 3PF9A 5LZ4A 1R9NA 4RE6A 4UHHA 1WM1A 4V2IA 3UUFA 1UK6A 2HDWA 3S8YA 4U2CA 3WWPA 1XRRA 3D59A 1ACLA 2YASA 3WL5A 4EB0A 5CBKA 3WKEA 5FXMA 1XZFA 4G1FA 4MEAA 5AKLA 7YASA 1AQLA 3P2MA 2B4KA 1SFRA 3VKFA 3NOXA 4L0CA 1N8SA 1P0MA 3D2BA 5FUMA 5CH3A 2HA0A 1BN7A 3WKBA 3E0XA 1AC5A 5CT9A 3H2IA 2XT0A 4UUQA 3TRDA 2Z3ZA 4BP8A 4BCDA 1ISPA 1BS9A 1VKHA 2DSNA 4N8DA 3JWEA 3C5WP 2NW6A 1ZIYA 2WFZA 4Q82A 5AKKA 2VJDA 3Q0TA 5DTIA 4F21A 4YX9A 5ALVA 5K3FB 3G9XA 4J7AA 1EK1A 1TK3A 1G66A 3IB3A 2PU5A 3NGMA 2OLEA 1Q84A 2HA4A 5AI0A 1ZI9A 4Y2QA 3FBWA 4TPKA 2JGKA 1TCBA 3HXKA 4MYDA 4LXGA 1XZBA 4MXDA 2PM8A 2D0DA 1A8UA 5F4ZA 2XQJA 3B12A 4ROTA 4UHBA 5D3KA 3KD2A 4QWMA 1UOQA 1ZGCA 5DYWA 3ZI7A 1K4YA 3AIKA 3UMJA 4PW0A 2H1IA 5ALSA 4WY8A 3M3DA 5A7FA 2XUIA 4KRYA 2OAEA 5CRIA 1JU3A 4ZREA 3FYUC 3D4LA 1N5RA 1VXRA 1WOMA 2WU4A 3HI4A 1MT3A 3RK4A 1N5MA 5JADA 4X97A 2BGNA 2RIPA 1J2EA 3IDAA 1R50A 4X85A 4XVCA 5JAOA 3T52A 1LNSA 1LPAB 2H7CA 3QH4A 4CIBA 1CUCA 1R4ZA 3FSGD 4H7FA 1OXMA 4QDUA 3IA2A 3I28A 2RI6A 4G8DA 1W6RA 2WHPB 3WL8A 3L1JA 1WHTA 1XZMA 1PFQA 2OXEA 4W9RA 5HK8A 5AI9A 5A71A 1MX1A 1SCKA 3LP5A 3WL6A 3OC0A 1R88A 4H77A 4QDZA 5AI6A 3WI7A 3G0IA 2C0QA 5CT4A 3I1YA 1G42A 4E14A 1XZCA 1VE7A 5ALFA 1T4MA 2BCEA 1KU0A 5AO9A 1XZDA 2QKYA 3VJLA 3F8SA 3R3VA 4ARAA 5K3CA 2J4CA 1E3QA 4FWBA 5LIPA 2DFPA 3G0BA 3QVMA 4H7KA 3D0KA 3QM1A 1MTZA 3DNMA 1GQRA 1XLWA 1THGA 2VSQA 1YAJA 1LPNA 4LYEA 5BWCA 3RM3A 4BVLA 5DTJA 4UFOA 4N8EA 1U2EA 5JALA 2AJCA 4B7ZA 3HSSA 4X92A 1YSCA 2ZYRA 4K6KA 4ZI5A 2QUBA 4L72A 4Y9SA 2GZRA 1XROA 1AURA 1WPRA 1AKNA 2XMQA 2WHRA 1IUPA 4DYHA 2G5PA 2AJDA 3HZOA 2Z3WA 5FRDA 1ZD2P 2XUKA 2AJLI 3H2HA 3K2IA 1EVEA 3R0VA 3A6ZA 4F60A 3JW8A 4DMHA 2VF2A 3QZUA 2WHPA 4RNCA 2HL6A 4W1PA 1ZI8A 2FX5A 4OCZA 5ALZA 1E89A 3GA7A 4U2GA 3KWJA 2EDAA 1THTA 5H3HA 4G8CA 4H7IA 1MX5A 4GHWA 5JAHA 1JJIA 1E5TA 3ZV7A 1A7UA 1USWA 2HFJA 5DNVA 2XQFA 5FOQA 1XRLA 1CUDA 2HM7A 4RPCA 4QA9A 5KREA 1K63A 5IKXA 5AKXA 2XLCA 3G7NA 5AK4A 4NS4A 3BF8A 3GBSA 1GXSA 5FLKA 3T4UA 1CUFA 2XQKA 2XMCA 5ALTA 4WCVA 3W05A 3ZWQA 3STTA 2ES4A 3DS8A 5BOVA 4L3WA 5BV7A 3IBTA 5ALNA 4JNCA 2ZJ6A 2PUHA 3WIOA 1IUNA 3AZOA 3WKAA 3STXA 5AM1A 1MAAA 3F96A 1LPSA 1Q0RA 4LIPD 5AM3A 3CCCA 5D7BA 2FUKA 4FFVA 1DX4A 3OTQA 1DT5A 4BCCA 1U65A 4UHFA 4E15A 4C88A 2V96A 3LS2A 2RHTA 2WKWA 2OAGA 2OQVA 3H0CA 4FTWA 4HXFB 2P8SA 2BJHA 2VQ6A 1YA8A 5AM5A 1Y7HA 2CEKA 2WLSA 4FBLA 5CTAA 1M33A 2JEZA 3CN9A 5K3AA 2Z5GA 1DINA 3BF7A 1QOZA 5C81A 4B85A 2VA9A 1QJ4A 4LHEA 3WWCA 1GQSA 4H35A 1VOTA 3I2GA 2DHEA 4FNGA 2G63A 5ALUA 4GECA 4WFJA 2J3QA 4I3FA 3RARA 1EK2A 2DHCA 2YH2A 1EXWA 3V1KA 4F0JA 4FKBA 4GBGA 2ACKA 4EA6A 3WZLA 2HHAA 2PSEA 4FDMA 4X71A 3QITA 1PJAA 3WL7A 3AILA 2IIVA 3O0DA 3GFFA 3W2TA 4EHBA 3TJMA 4BAZA 1ACJA 5ESRA 2OGSA 2D5LA 3R3YA 4HRYA 4BTVA 5K3EA 4QLAA 4P9NA 3VXKA 4Q3OA 4EY8A 4UBMA 2WHQA 4BCBA 3AIMA 4LYDA 2OCGA 2XQIA 3I2IA 4UBNA 3C87A 5FPPA 1LZKA 1CUJA 3GZJA 3PE6A 1CVLA 3ICVA 4FLFA 1CQZA 3EF3A 5HF8A 1DT3A 5DWDA 2WSLA 5HQ3B 3V9AA 1A8QA 1ODCA 2HU5A 1EB8A 1MAHA 5JD5A 5LZ2A 2XUJA 1ZD4A 4DSZA 1DWPA 3FAKA 2DQYA 4BYMA 3NUZA 1DTEA 4L9AA 1YS2X 4JUIA 2H9YA 4G4GA 1CUUA 5LZ7A 2BGRA 2JGLA 1WCYA 3FNBA 3OOSA 1JMYA 3BDVA 4DMCA 5JD6A 2PSHA 5JAUA 1W4LA 4ZRDA 1XZIA 3DL4A 5C8VA 1W76A 3WYNA 2QZPA 4WY5A 5ALQA 3WK5A 5FV4A 4AO7A 3BIXA 2OG1A 4Y2XA 2VT7A 5E4YA 5AH0A 2ZJ7A 4QNNA 5CT6A 4GXNA 2G5TA 5LKRA 4BDTA 4D9JA 1QGED 3VJKA 4GI1A 1UWCA 3O9MA 1EDDA 3WJ1A 3AZQA 1YR2A 1CEXA 4HAIA 4QDXA 3R3XA 5AKJA 2JF0A 2C58A 1ZJ4A 1CUIA 5J3JA 1UKAA 3WA6A 4KAAA 2XLBA 1FFAA 4J0JA 3C70A 5AI4A 3WQHA 1DX6A 5AM0A 3STUA 2VEOA 1XLUA 4E11A 4OPMA 5EGNA 5JIBA 2LIPA 2W22A 2WUEA 1AX9A 1XZLA 2FJ0A 4DNOA 4RE5A 4BVKA 1EH5A 3FSGA 5DLPA 1Q0ZA 3KDAA 5I8PA 4FLMA 1IUOA 4X91A 4DSAA 4QDTA 2JBWA 5I7UA 4BP9A 1CUAA 5C7YA 4FNMA 5DNWA 2EEPA 1UK9A 3C45A 4BBZA 3BJMA 5YASA 4AMYA 3LIPA 5LZ9A 4H0CA 3WWOA 2XUAA 5AM2A 2CB9A 1YA4A 4PSUA 1BCSA 3DOIA 3YASA 2JIDA 5E2IA 5AJHA 5LLSA 2HFKA 3WLAA 2JGFA 3IUMA 4HS9A 2G4LA 4HRXA 4M0MA 3WK6A 2X5XA 3HABA 1MO2A 4ZWNA 4FFWA 4YK7A 1VA5A 1MN6A 2GYWA 3HEAA 3ZLTA 4A5SA 4U2FA 3M81A 5FDFA 1YCDA 4EY4A 2BUAA 3R41A 2HRRA 1QO9A 1TQHA 3I2KA 4BAGA 1O6FA 1O6GA 1QIGA 2WUDA 3H17A 3C8HA 5AK5A 4JH0A 3A70A 2ZYSA 3H2JA 3BE8A 3G02A 5AM4A 1RWQA 4QLOA 4P08A 2WUGA 4CCYA 3CXUA 1QZ3A 4MEBA 1PV1A 2CZQA 3PDCA 3KWFA 1ZI6A 3FCXA 5DJ5A 4EY5A 3C8DA 5IVHA 2OGZA 5CH8A 3F97A 5AKHA 2RGUA 6YASA 3TGLA 4Y2PA 2RONA 1E8NA 3O4HA 4IH1A 1CLEA 2XMDA 3I6ZA 1X70A 3E4DA 3B5EA 2ONCA 1CFJA 3OURA 4J0IA 1XRPA 1VJ5A 3C6YA 5LZ5A 2C5FA 1LPPA 2QMQA 3G9ZA 4IO0A 1NU8A 1HL7A 4ETWA 1GPNA 2XUOA 4H7HA 3MUNA 4GDMA 1CUYA 1H22A 4LXHA 4BE9A 4B83A 5EHXA 4J0DA 5CXXA 3H2KA 3H1BA 4PQEA 2CJPA 1CUVA 2ACEA 3WA7A 3O95A 3C43A 4Y2SA 3WK7A 1IZ8A 3WMRA 4NVRA 2GBFA 4Z49A 5ALLA 4KJXA 1TCAA 4U2BA 3D5EA 4UBIA 2ZSIA 4X93A 2XMRA 1JFRA 4PF1A 2PSDA 2ECFA 4HXGA 2VTVA 3BIWA 3ESBA 3R3WA 2XB6A 4BRSA 3HLKA 2V9ZA 1L7AA 3AINA 5AP9A 3W9BA 2Z8XA 5D6OA 1I6WA 4BE4A 3KSRA 4O08A 4G8BA 4X6YA 3FLAA 4K6HA 5IVDA 1K5PA 1JI3A 1TAHA 4CI9A 4QDOA 1HPLA 2R11A 4W63A 1AGYA 4FBMA 4DMKA 3NWOA 2HIHA 4MJ3A 2CKMA 3S2ZA 3HC7A 5AKEA 4JYPA 4XIIA 1Y7IA 2XQGA 3PFCA 4EUSA 4WDQA 1ZIXA 2HADA 3K9BA 3PICA 1XQXA 5LP1A 1VE6A 4Y2YA 2HA3A 3V1LA 2XUGA 4Y2VA 5ALXA 3AUKA 5EIEA 3DCNA 5AOBA 1XZJA 1QIMA 4B80A 1OILA 1J1IA 2Y2UA 5ISMA 1CUBA 1QFMA 4C4ZA 4AB1A 3RLIA 1OCEA 5T4BA 3I6YA 5FP0A 5AKYA 3RKSA 4BAUA 3ZPXA 5CURA 3WIBA 3CN7A 2EDCA 2ORYA 3STWA 4I19A 4WFKA 5EI5A 2WJ6A 1B41A 3H04A 5EHZA 4F5ZA 1L7RA 5FPQA 2PKYX 4BATA 1H23A 4X90A 2XUPA 5AOAA
chains in the Genus database with same CATH superfamily
3WS7A 4FM9A 3FCSB 1WPXA 3WLPA 1X7DA 3WNDA 2GM5A 1KI6B 1S2MA 3OQIA 3EH2A 4CLRB 1LJLA 1T2EA 1L4BA 2QD4A 1PT6A 4FFBB 4FU0A 4RPGA 2JLVA 1MJNA 2MU1A 3LQ2A 2OFWA 3I9V6 4FIDA 4BVJA 3RLFA 3HZZA 4EGQA 1OVMA 4YQFA 1IXYA 3JQ8A 3QWHA 1DWQA 2QTZA 3DDZX 4GX2A 2FGJA 4OJTA 4JL6A 1NNI1 4Q05A 5DHTA 3I5XA 4JT8A 1ZUNA 3AUXA 2Z8YM 3LDUA 3PIDA 1P5ZB 4HX5A 4UM7A 2PKQO 4EL0A 2ZRPA 4ND1A 4WV3A 1HTBA 2IXTA 1PJCA 3RYFB 1FFEA 1UADA 2O2HA 1SD1A 4HUQB 2PL9A 3CEHA 4DUPA 2WDPA 1T5DX 3HP7A 3C8UA 1E59A 4QARA 2V7WA 1CZLA 1G8HA 3W5IA 2GBIA 4NOMA 5EIAA 4G9GA 1DU4A 1FDRA 2HXYA 1R0ZA 1UZUA 3BMOB 4PO8A 4MA4A 3S28A 1XVUA 2FHSA 2LZ0A 4GLFA 5JY1A 3H97A 1ZCJA 1HSOA 1RYHA 1W34A 1O97D 2R3SA 1QAMA 1RCUA 3DMGA 4KSBA 1U3UA 1C1XB 2NO1A 1NMZA 4X20A 2ST1A 4CDGA 4XSGA 4G37A 5KX5A 1AMNA 1Z28A 2P9HA 5ELLA 3DFIA 1I2DA 1C1HA 3I9NA 3ESAA 2WILA 1CCWA 2J5RA 3C85A 2WIFA 1GZ4A 2QTAA 3OZIA 4K9SA 4NULA 5HA5A 1GZHB 4R1PA 2QM3A 1SC1A 5FD8A 5B58T 5TPWA 4IO1A 3G2PA 3N2ZB 3W5VA 2OK8A 1R8JA 3E53A 3D1VA 1S2GA 4ZI2A 2GO7A 3PEWA 1MT0A 1V25A 3O94A 1EGMB 1WP4A 3KOOA 1XTRA 2C2XA 2HRQA 1AK2A 4R4JA 3A6PC 3CZ4A 5DNYB 4KQ2A 2I4RA 2EZ4A 5LD2C 1Q2UA 3NHFA 4FGLA 5EUBA 2QRGA 1BVRA 3I2FA 3JQFA 4MS3B 3RIHA 1XG5A 5LP6C 3T3GA 2FZLA 3U0VA 3WTBA 3PDHA 2BEWA 2X0IA 2YVUA 2ZI7A 4TYQA 4BLPA 5F2OA 2UVPB 3KKEA 4BEJA 4D6XA 5LLDA 1RBYA 3VC1A 4KNWA 3V8QA 5IUJC 1Z29A 3PNKA 4Q24A 5HQTA 4XDGA 2P6MA 2FPPA 3PPXA 3G9QA 4B17A 1NM5C 3HUEA 4X95A 2QT9A 1YFZA 1C1YA 3DV2A 1U80A 2CVZA 1IJBA 1Z4IA 3MPUA 4WE3A 5ALYA 4E03A 4LOLA 2OV8A 4HTAA 3CLSC 3L7JA 5CCXA 1SCBA 5IXJA 4ZVVA 2IU4A 3DJYA 3P0RA 5DM70 3WGVA 3AR5A 2VF7A 1JRLA 2IYUA 3CUKA 3PIIA 3CVJA 4TMTA 2DYKA 4HQLA 4PFSA 3FD8A 3CSDA 5DBGA 2VDOB 5AK6A 2VK4A 4HNVA 3OU7A 4W7HA 3K6KA 5A9SA 1Z4NA 2F3QA 4HEA6 5ITZB 2P75A 2FNAA 3MTEA 3B3AA 1OLUA 3B82A 4UQLA 1QQ5A 3HI6A 4CKYA 5AFSA 4DR1B 5E7JA 1P0PA 3M82A 1YRHA 2W6JD 2XYQA 4O2AF 3E7FA 3Q41A 3FW1A 1JEAA 1SZPA 2JFUA 3RSQA 1H5UA 3GGJA 1MX9A 5JSKA 2RBEA 2HQ1A 2O7RA 4X41A 3FYUB 1GTG1 1CE8B 2V3VA 3GROA 1M2FA 3HZRA 4OG2A 2AFVA 4K9QA 5ERGB 1GAXA 1QTRA 1PGQA 3R74A 2Q1WA 4OGFA 1KEZA 2DULA 2MSCB 4IXTA 1WMBA 2EW8A 4DARA 2EFJA 1Y48E 3IRUA 2MIIA 4CMJA 1FE8A 1Z82A 1QF9A 4I46A 2UXDB 4BNFA 3W3ZB 5A04A 5A2GA 5JSQA 1G38A 4BDSA 1J56A 5JJCA 1N2CE 4C05A 1KAOA 3VJRA 3HR7A 2AOTB 3SFZA 2Y6VA 4WH0A 2R8RA 4NZNA 3LW8A 3P9IA 4OIFA 5U1PA 1R5BA 3SC2A 1T4CB 2YJNA 5K8VA 1DKNA 2J3MA 2FP4B 1EP1B 2RGEA 5FPTA 5JZVA 2E89A 4J3JA 1I24A 2HIAA 2HIGA 2FEWB 3DAOA 3PXXA 4M53A 5ARDA 1JFVA 5TT1A 3JD3A 4UCFA 4OKNA 1ORIA 3QEJA 2A9JA 1MOSA 1NJSA 4HB0A 3VV3A 2NZVG 3MEQA 1NUPA 2DP4E 5CNIA 3D2AA 4BO0A 4EHKA 1E8MA 2G0NA 3C0KA 3HPRA 2AD1A 1YBAA 2ZETA 3OEHD 4XPIB 1QE5A 4UNRA 1FPQA 4R3NA 5ALKA 1N6PA 2HHLA 2VDNB 4WA7A 2ZE6A 1FS6A 2JASA 1RNLA 2OORA 2J7PD 2Q3BA 4QU5A 1DXYA 4UUMA 4OFZA 4QPZA 5IJ0A 4P0TA 1BEEA 3TTWA 2Q3DA 2EWVA 5KQSA 5LDGA 1XZAA 1PUJA 1WJGA 4KU4A 3LM8A 4F4HA 5CAEB 3KHSA 4YUWA 1ZGBA 4O33A 5HIMA 2Q3HA 2H0RA 1YQEA 4PHGA 5A05A 2JJQA 1NVBA 5IKEA 1RRKA 5B57C 3HO1A 1OGJA 5EMNA 4BN0A 3BRWD 4UVDA 5IK2D 1CHNA 3E3AA 2HBYA 2VYFA 3ZY5A 1OZAA 1ZINA 2OG2A 3CNLA 1DQPA 4FDUA 4FUQA 2Q49A 3ONDA 4DSUA 4HFMA 3UMYA 3P2KA 2I1QA 4XR4A 2R8EA 4D3ZA 2C07A 2EERA 3W2IA 3SXUB 2BGIA 1I7QB 2Y77A 2D59A 3RUEA 3UY4A 1FFHA 3QYFA 4CR6A 2JFOA 2Y1FA 3V6MA 3HJTA 1OZGA 1A88A 3WGOA 1W44A 2DJIA 3T0GA 1BDBA 4NQZA 1AU9A 2XAAA 4EGAA 3U6BA 1RRMA 1ZSVA 1QLWA 1D6SA 4OYHA 2MWMA 1BH2A 3PPYA 5HW0A 5K03A 1UPXA 3KELA 3WSWA 2B92A 4IGFA 4HRVA 2AVDA 2QN9A 4ZTUB 4B6OA 1YONA 1C81A 2O0MA 2UYGA 2PDAA 3A4VA 5EAIA 1NMXA 3BMCB 3LWNA 4BV3A 4D3YA 4J7XA 1CYDA 2HJVA 5JJKA 4AICA 2DU8A 3W6ZA 2G80A 3OEWA 2FSPA 1T5HX 1UBGA 2GK4A 5EGSA 1Y5MA 2PTGA 2J9GA 3O74A 2H29A 1E2JA 3FOWA 4I1SA 4MYTA 2XF2A 2OVBA 1T1EA 1A97A 3WIEA 1N3BA 1BX3A 2QN3A 5IABA 3SVLA 1AZLA 4MYSA 4MUMA 1FX0A 2HYDA 4R0NA 3LY9A 1V43A 3EIEA 3ET5A 3C3AA 4UTNA 4X8OA 2H3HA 4BC0A 3JYQA 4AUKA 1AXEA 3C3WA 4G36A 2PBRA 4DLXA 2VS1A 3AEZA 3MRXA 4ZD6A 1GT6A 2XRYA 3E23A 3RHFA 1Y4SA 3AJEA 5KYXB 3H18A 1HRKA 3ZDXB 3QKRA 4BQFA 1JIQA 2WFLA 3SHWA 1IAQA 4A8JA 4QBHA 2D5IA 4OQEA 3EZNA 2PO5A 2JAWA 3H5TA 4R7ZA 3TQOA 3AL2A 4I4NA 3RVQA 5AYVA 2CJWA 4N6NA 4XB6B 1XXHA 5LJIA 4TZTA 3AVUA 1OZ0A 4M8SA 1G9TA 3HO6A 4MVJP 1VECA 4Y6GB 5UKDA 1OYYA 2VDWA 4FC6A 1XR3A 2A2ZA 2D5AA 3BCUA 4M0UA 1ODKA 2VHWA 5IAJA 2K2WA 4ZMSA 2D6FA 1A2BA 3AX6A 5GGXA 1RDFA 1S0UA 1KDZA 5AMXA 3ZUGA 4G07A 3U3MA 2XCTB 5L7YA 3IAS6 2F9MA 1MC1A 2I7CA 1II8A 1GYQA 4LDAA 2TRSB 4RSHA 1PR4A 1XB2A 2WHXA 1MV8A 2B6HA 4ER3A 3S2YA 3HN7A 4B31A 3DD5A 2WHYA 1B0PA 1US8A 3A4MA 4RV5A 3T06B 3WLOA 2CUZA 1XN1A 1UIRA 2JGJA 1GGVA 4ME6A 5EMLA 5K0LA 5LDHA 4QDJA 2ZRGA 4K81B 2I6QA 4L8VA 2XI4A 5K3DA 2WIDA 4INOA 2FG6C 3BJZA 1DJQA 3IQXA 4ZV7A 3SYTA 1PHRA 1W36C 3I5YA 3DUFB 2X86A 1RFLA 1E2PA 2NSJA 2ZT7A 3NKFA 4DDKA 4AKHA 2FOLA 2X6RA 3S2EA 2NSYA 1F48A 2IPMA 4L9WA 3C4VA 4I1RA 4LDRA 1U0LA 3V4PB 3R8FA 3EXHB 5JMOA 1MPTA 1C3EA 4TLMB 2B1JA 1VLQA 2C31A 2YW2A 4JV5B 4BIMA 2ZB8A 1HG0A 5JBQA 1B23P 3PGMA 5IAAA 4X1KB 1BW9B 2DR0A 3VZRA 1WPGA 2QQ0A 1SA0B 1UEXC 1WW8A 4RD6A 2GBLA 3NRBA 2RCYA 1XGKA 4R51A 2UUPA 3G5MA 3E15A 4YJHB 4OHMA 1PKEA 4CKEA 1FFBA 1R9GA 2Z5VA 3CNNA 2GVDC 4ZQEA 4UNIA 1RYNA 2EZTA 2Y1KA 4FIZA 4MW4A 3ZBQA 2X5JO 4B2IA 1JHZA 1ID1A 3I72A 4M0LA 4YCJA 5EPEA 3IQDB 4EJ6A 2C0PA 1JDTA 4K6MA 5HRUA 4ARIA 1SK9A 3QHAA 2OHXA 2CHEA 1QIEA 1F2UB 1R0XA 1Y80A 2WAAA 1SNYA 3HCCA 4Y6SA 5BYKA 1OPXA 1TKAA 3D3QA 2GEVA 1OXTA 4PINA 4B1FA 3JWIA 2CFOA 2DETA 1AUOA 1DEXA 2WU3A 2UZ4A 2WUVA 3FJOA 3G0DA 5DO9A 1KO8A 5IS2A 3I8XA 5E2AA 2WG0A 2NQTA 3EPLA 4FFLA 3CRNA 2CLIB 4YV2A 3B9PA 1O5TA 4P3PA 1B2LA 2LNDA 3IMFA 3L7NA 4BMOB 1O58A 2D1SA 1SQ0A 1KEEA 1P7ZA 3ZHTA 1RWPA 1WUKS 5EKDA 5K2OA 4W99A 1UC9A 1WHSB 3FYSA 3G2HA 3OF3A 2ORVA 1KVTA 2EF0A 2A0FA 2QHXA 4D4LA 4TKVA 4DPLA 3AM1A 4B5KA 3FZQA 3RGGA 5G53C 5HQ3A 3L0SA 3AHEA 3ETGA 3BFPA 3KZCA 4RS4A 1QOQB 4OXKA 4DCJA 3ZVKA 3DOCA 4LJ4A 2JGDA 4Q37A 4OYYA 4G0YA 2PQ2A 2TS1A 8ATCA 3SE7A 4B3IA 4DL9A 2ANBA 4I2VA 5ALGA 1SBTA 3E58A 2H63A 4AJHA 3WNVA 1QDEA 3UUEA 1ETUA 4MUEA 4B7XA 1V7QA 3FOBA 4ENPA 5KWJA 1HDCA 2GJ8A 2JD2A 3ILSA 4CHTA 3M34A 5A5VA 3T3MB 2H1LA 3QKTA 5B53A 2F00A 3NDBB 4DYDA 2GO1A 1EX1A 2F2TA 1R5NA 1I7SB 2C84A 2SCUB 3DFZA 3V9PA 3PI7A 1WO8A 1VKRA 2AUNA 2RC6A 3LHDA 2JB9A 2C57A 3FWPA 4TN5A 3Q1KA 1WD5A 4M37A 2L19A 1V6CA 4I8XA 2FPXA 3PL5A 3DOHA 2XA2A 3QF4B 4E2FA 4QO8A 5J2UB 4PFQA 2IX9A 5KDLA 3CJTA 3RTAA 5FTLA 1EG2A 5EE0A 1PJZA 3C15C 1ONNA 4XLTA 2XSZA 2Y0EA 3C3EA 1YCGA 2KLBA 2EKPA 3NNDA 4IDNA 5F7JA 3TDKA 1YU6A 4EB6A 2MMGA 5KVCA 4BWGA 5KYTA 4NHOA 1MJFA 4TLLB 3ZD9A 4FMCF 2PZJA 1E9VA 1G3RA 4AYWA 4S1NA 5LA6B 2CBZA 4JEIA 3M9XA 1UZLA 5LMUB 4DUGD 2J4FA 2M9MA 2PVSA 1A96A 4CM9D 2O7QA 1D2MA 1UOOA 3PFKA 2EJVA 4OOFA 4NCBA 2B7CA 2G88A 1H1LA 3ZZMA 4CT5A 4JT2A 1BQEA 4Z3OA 4KRXA 4K6OA 5FR2A 4F6RA 4G5SA 4I4TB 3E9EA 3GVCA 4M0FA 4CPDA 1XTZA 4RVFA 3KZMA 3ZBPA 1RTKA 2P1ZA 5CLLA 3FTQA 3B1YA 4MV4A 1PYGA 2WG1A 3TZHA 3W9UA 2F64A 3CCBA 1GCUA 3KAPA 5KTSA 4C89A 1RQNA 4RTOA 3R9XB 3EQ7A 1ZK3A 4ALKA 1P2BA 4O5AA 4CN8A 2EWWA 4MWTA 5CLQA 4DW8A 3PEVA 1GUFA 2Q9UA 2Q6LA 4JSYA 5TARA 2PRIA 1HX7A 3SGLA 4YJFB 2WU8A 4IAOA 3UB2A 3L4SO 1TNDA 2HA2A 4ADSG 1O5IA 2PT7A 1RPNA 1MH9A 2EKZA 2GN4A 1WDKA 3ONVA 1BROA 4DHWA 2DWQA 3KPVA 1ZN8A 5D5HA 2XGJA 4JGGA 2M6RA 1NUAA 1E9DA 1MFPA 3L3BA 1UZMA 4GO1A 4BNHA 3PS9A 4KNYA 1YB7A 4Z2AA 3Q9SA 4WOKA 1XNQB 4MVJG 2RGDA 4WLUA 1OU4A 3SP1A 1VSQA 3BHMA 3RIGA 1CJBA 5AOVA 3TIGA 3FOEC 1K7SN 3EY9A 3Q7QA 4DRXB 1PYDA 3FUUA 4LOAA 4JP5A 1AXGA 1ZMXA 4ZN6A 1LLFA 5JXGA 5IT5A 2XCOA 3RBZA 3O8QA 2A7QA 3EIFA 4O4LA 1U8UA 3RWOA 3U4CA 5HYVA 2ATEA 2WSSD 4Y2JA 5AKIA 5JZBA 3WMEA 2JGMA 2QTHA 4LCJA 3EZ9A 3M6WA 3QE0A 1DKLA 2WD7B 4JVSB 5LBTA 4D9MA 3PEEA 4NONA 1D1SA 1FBNA 2R65A 1VIMA 2C1XA 1G41A 1LRKA 2DTXA 2OCDA 3L7MA 4NBKA 2G7MC 6NULA 3TEFA 5JVDF 5JXWA 1L4MA 5FNVB 4KXVA 3DJFA 5JLAA 4DM7A 1HETA 3C16C 3MS7A 1GLVA 3QLTA 4LRXA 4XEUA 1O0SA 1WXGA 1G4HA 5LYYA 2ZUFA 2WYWA 3ODPA 3Q85A 2CDBA 2PSJA 1EPUA 5DHQA 5DM60 4X65B 4XGNA 2P1DA 2H5LA 4L76A 4P82A 4LWOA 2FN4A 3BKWA 1LBHA 3DT9A 3QA9A 1XKTA 2RAUA 3PUVA 1I3MA 5DISB 3ZCPA 1ZHOA 4KQIA 4IIJF 1IH8A 5EZQA 3HGQA 1U0JA 2J6IA 3DWFA 5ED0A 3PHGA 4BMSA 1EZZA 5DEIA 2QIOA 3DXZA 3EVGA 3RO7A 1M3SA 3VDQA 3ZLJA 1YZQA 2QL5A 4HH3C 4QUDA 5KNBA 2FN9A 2H4FA 2V4UA 1OAOA 3KXKA 1CVRA 4M9SA 4P80A 4ZJUA 4L27A 3P9QA 1DC5A 1T15A 2HWUA 4HDMB 1F8UA 3L7BA 3IIEA 4WZZA 5HMLA 4FOOA 1YKSA 1L7PA 2QORA 3OQMA 4J4HA 4LTMA 8GPBA 4HAOA 3NO4A 4LXTA 5A3RA 3TW4A 1CQIA 2CMHA 1NBWB 3BD6A 3O8RA 1MG5A 3OAAD 2ACVA 2Q5FA 2ON6A 3NV9A 4G97A 3H1TA 4MVJD 4PS1A 1HMYA 1FCJA 4TOIA 4WN9A 3T3EA 3NIWA 1Z5VA 4R84A 2ORIA 1NPTO 2CEAA 3FN4A 3O8LA 4FSXA 2AOTA 1Z4OA 5D1HA 1YR8A 2E5LB 1DJMA 1TC1A 2PMDA 4RELA 1VLLA 4C4RA 3QI7A 2Y1LA 1P77A 1ZU4A 2ZUSA 4V1CB 1LSOA 1GKYA 2ZIXB 3FNEA 3HYNA 4RFSB 1CY2A 2LKDA 2I6SA 4LKOA 2D62A 2BTEA 4R0VA 3AP1A 1D04A 1VJ1A 4TTVA 4GOJA 1G3IA 1TVMA 2JS7A 3ICOA 4AP6A 1Z4QA 2JCBA 3M6UA 5TJHA 3M83A 4QTYA 2DMRA 3TKLA 1EVZA 1QB7A 2E6KA 3UT0A 3AU9A 1YR6A 2P7HA 5EWLB 2DBQA 4DB2A 2XPCA 1D6MA 1AUQA 1K06A 1W4AA 2YVQA 1PFKA 3DBHA 3NCHA 4ZEOA 5IN5A 5JNVA 4LS3A 1DUIA 4MO2A 4OAOA 5IH3A 4H0FA 1OI2A 2JDID 1QIIA 3WLJA 2HI0A 5IF3A 1ZEMA 3S6JA 4Q9KA 1VJDA 5CA1A 1N1EA 4MVJH 4I1IA 2J4DA 4LOKA 4D8YA 3ORSA 4D43A 1R7RA 2PX8A 3KJNA 1QHGA 2H1WA 2PV7A 4DWJA 5JAMA 3QXGA 4FYXA 2YXNA 3PZBA 3LBFA 2EFEB 1YZGA 3PR1A 2FWIA 1GNLA 2G4VA 1XF9A 2H11A 1PJLA 4FLEA 4J03A 4MEJA 1CJMA 3AUAA 2P2CA 5THXA 1B4DA 2VEDA 3BIJA 1PVOA 1NMQA 1R4MB 5KTNA 1GR0A 4W1SA 3JRWA 1ZKDA 2QJRA 1NN5A 4EG0A 3HBJA 2GVZC 1N2OA 4PVDA 4RZQA 5KQLA 1YZFA 3FFWA 1HTTA 3DEJA 4YWJA 1NX9A 3FUTA 2FWMX 4ZU3A 4AF7A 1EHYA 1JMKC 5T4HA 1DKUA 2FLVA 2P91A 3HCPA 3K0FB 3PD0A 4WFIA 1JIUA 2DKNA 2HK6A 4IZIA 2IZ5A 4X00A 1Z6XA 1JJAA 1NI5A 1Z4PX 2C94A 2CSUA 3PE3A 3IXMA 1Y8QA 1V41E 3QU4A 1DPFA 4A2QA 1R0SA 1BMQA 4JVOA 3IIJA 2Z09A 5EEHA 1C80A 1UT5A 3MJVA 1W19A 1O95A 1SMKA 4WJLA 3FWKA 3RH0A 1ZJZA 4I5DA 1P1FA 2ZROA 4O4JF 2GCPA 2W2TA 2ZR9A 3N53A 4JZYA 5CHYA 5DV9A 5TPWB 4FPXA 1P3DA 4BTLA 3H83A 2RG1A 5AW2A 1QRSA 2JGIA 2X1HA 4E08A 5BRAA 4UNPA 3DZDA 2CHVA 2WW8A 1G5FA 4V0KA 3G8AA 1ES9A 2W58A 3VJMA 5DGIA 3V4VB 1O89A 2RAVA 3T1HB 3JAMA 1DAHA 1AHNA 4CV3A 3ANTA 3A0UA 4FKZA 4Y9TA 4AJIA 3M4XA 5ALMA 2W2VA 3LVFO 4M8KA 4OH1A 4K2AA 4WEQA 3FYTA 4HT3B 2J1LA 1MJHA 1GTRA 5HUHA 1NQVA 1V0JA 3IILA 4JU8A 1V4VA 3OM0A 1RE0A 5DBFA 3WWZA 4HWTA 1JR6A 2B20A 1OSNA 1WLSA 1VL5A 4NBWA 1TZBA 2QP3A 3LIIA 3DZHA 2ONYA 3DL2A 1LDNA 3AUJB 2HLDD 4MWZA 3QUQA 1UT6A 5EJ8A 3L93A 4HUQA 3IAS1 4PLHA 4KE7A 2IXGA 2OAP1 1ADYA 3F49S 3PNQA 4G25A 3IV7A 4MVXA 4X63A 4WERA 1DXQA 2BCGY 4FP9A 5ALEA 4MQLA 3TOXA 2B0CA 4FD2A 3Q0IA 5EVCA 3LGAA 1I0LA 1KHHA 2NXNA 4HEA1 3I6MA 4IIDA 4GLBA 3T3DA 2YWEA 4QXAA 3ZWPA 3FMIA 1FNBA 3UQZA 3KJQA 4ZEVA 1D07A 1WU7A 3SPXA 1PYOA 1IZ7A 5J4KA 5EIBC 4Z2YA 4NPCA 4OQFA 2C5EA 1UZAA 1I4TD 3RAPR 1E7RA 3G85A 2W6ID 1GA4A 3GA5A 1L4KA 4NK5A 1ZESA 2WPDD 3D8NA 5TS2A 3L8FA 4EJSB 4F6CA 5BQ3A 1U28C 5H8WA 3QRWA 3A1NA 3JQDA 2P77A 2A86A 2AYZA 1A04A 1GXSB 2VPIA 4B3HA 4PCUA 1P4SA 4B7UA 2OPBA 1TVKA 1H6BA 1UK8A 2Q0XA 3K4PA 1P1BA 3FCCA 3HRHA 1FSPA 1FUIA 2HWWA 2B5VA 4PYMA 4CF4A 4ERNA 3X1JA 2H52A 3DKPA 4IZHA 1FXUA 4O4HF 4WBNF 3AY3A 4YONB 2FFQA 5BNTA 5K0GA 3G1TA 4LK3A 4AJ9A 1GWNA 4GD3Q 4CKXA 4WK0B 1YOVA 4IDGA 1HNWB 3DHEA 1XTTA 2VAWA 2QM7A 3NTQA 5FIUA 1BN6A 2BGLA 3L4JA 2B4TO 4JBWA 2ZJYA 1P0QA 3SYMA 1ZJ5A 3O7MA 4CKBA 5LN1A 2WEKA 3SSOA 1FUKA 4LWQA 1XJCA 4P83A 1QG2A 5EOVA 3T7EA 1CZKA 1EQ2A 1P9NA 3AJAA 3VI3B 5AXDA 3E3OA 5JQWA 1GKUB 1U8FO 2CVPA 3ZS9A 2I71A 2O2GA 4FHDA 2FG7C 3GV0A 1LXCA 2P3QA 1V4NA 1WPQA 2CLLB 1CK4A 1DWOA 1JB1A 1JIJA 1OIVA 3HWRA 1CJUC 3IQFA 4ISCA 2XMZA 4ZOEA 3E82A 5I9SA 3TR5A 2GZSA 1NN0A 4K6CA 3EFOB 2HJRA 3X1XA 3WB2A 5AJZA 4RF3A 3L18A 2D5BA 5IVKA 3AVOA 4P3XA 3VR5D 4ESHA 2C3PA 5EJ6A 1NM5A 3GJ8A 5FULA 5H80A 3G13A 4EY6A 3J80A 5LZ8A 1ZH0A 4U0JA 2WUFA 3RYHB 4MV8A 3AG6A 5DASA 1HE8B 4NJOA 4LYHA 3WX0A 3KZ1E 4H15A 2HLDA 4DJDC 3NOVA 4BECA 1NWHA 2BSXA 1DKQA 1UC4B 1QTIA 2FR8C 2FN8A 4GWKA 4J2TA 5FTKA 3K1JA 2GM4A 4W8OA 2ZXEA 1SVOA 4LXUA 5L3QA 2M1XA 4N18A 4Z4HA 2E1PA 1GSAA 2QM0A 4DXHA 3UGQA 4AWAA 3UJ7A 1PG0A 4NMHA 4YYEA 2AE2A 3CX4A 3PYLA 4LJYA 4MINA 1EM8A 2NNLD 1QB8A 1TF7A 3F3SA 3KXLA 3U4AA 1LNQA 2CXQA 1DC8A 1T5SA 3Q7RA 2EATA 3UAWA 4DNXA 5A5EA 5JAPA 4BMXA 4ZZ1A 1RHJA 3A27A 4ZIRB 2GA8A 4YMTA 1JKMA 1Z5GA 1X9HA 4A92A 5A6SB 4POAA 1GCAA 4MGZR 3GY0A 4PLPA 1L4NA 3W6UA 3UFXA 1QE0A 1C0IA 5DVZA 1HT2E 5K3OA 1NRWA 3A1WA 3MBOA 1ORWA 1H2YA 1UBOS 2RCNA 2Z9BA 1ZD5A 4BP1A 2O7NA 4F1JA 3LAWA 3DLIA 3TBFA 2E4ZA 1MXHA 4GMHA 3RK1A 4I81A 3E7PA 3IT2A 3HV2A 2HO5A 3UUWA 4QUHA 2YWBA 1QRDA 4AZVA 2AMJA 3IUQA 4OLJA 2QN2A 4MRSA 2ROQA 3C6XA 3OLXA 3T9CA 4DUZB 1N9GB 5FOSA 4P84A 1XHEA 2PGJA 2JEYA 4LFAB 2G8LA 4DLPA 1G21A 3ZE1B 3FDFA 1U2DA 2C1ZA 2FZGA 1NUQA 1PZMA 4AKTA 4QPPA 4H7JA 2QOEA 5K6TA 5KNCH 4BO8A 1GPKA 1KA9H 3IUPA 5GPBA 5JSZA 1ODTC 4NMWA 4RW0A 3WYAA 4DCUA 2BE7A 2IA5A 3Q5DA 1OFUA 1OU0A 1RPJA 3L0DA 2DHRA 4TT3D 4OLFA 3S5JA 4JN6B 3RUAA 3GAFA 2H2WA 3GRAA 3QTLA 4JB3A 4R2KA 5EKSA 2JA1A 5FWDA 5TPZD 3P32A 2BR4A 1X1RA 3V4SA 2CLKB 4HRAA 3KB1A 3L4BA 4Q1EA 5DNUA 4FK8A 1DFGA 1U0FA 3JARB 2XTJA 2PT6A 3EPRA 5G0TA 1BQ4A 1U4NA 3M4NA 4FGSA 2WZDA 4S05A 3O2SB 3IEMA 3GNTA 5JR3A 3H5WA 4WGGA 4YMSA 5G1PA 1Q77A 2C4MA 4M9RA 5CM8B 4WVFA 2VTBB 4C01A 2VF8A 2PZ8A 3I6QA 1ISIA 3KIPA 4Q39A 3Q4GA 4NU6A 1Z06A 1J5PA 3G89A 2X9GA 3D8SA 1BU8A 4X54A 4B6QA 1OBHA 1E9EA 4OFBA 2I3ZA 3FPGA 3KLPX 4U7TB 5CGQB 5B2EA 3P97A 1YBHA 2YN2A 5C8XA 3OCXA 2W37A 4DXDA 2TYSB 4ZCQA 4PSDA 1GGFA 1HORA 1XWWA 4RH0A 4G4JA 3W9YA 4OMDA 2GZ2A 2YIDA 3UOGA 1JSRA 4TMXA 2WJ3A 4YCSA 5CDYA 4CEJA 3T3OA 2IYVA 3MJCA 4QO7A 1D03A 4DVGA 4CGZA 4HFNA 3M8KA 4NENA 3FKQA 2QG6A 2JFHA 4Q1CA 5J2UA 3GEEA 4DR7B 1Y3AA 1KPGA 3PD7A 1UFOA 4J9UE 2YNMD 4ZOQI 1QR6A 1CQJB 3WGMA 3N2YA 3OBBA 4J0CA 2W6MA 4YRJA 3OMXA 4Q7QA 4M76B 4KIJA 3ENKA 3COSA 3GGDA 4HAWA 3A9WA 2CBGA 2JAUA 1P3Y1 1I1QB 4U2EA 1EINA 2R6ZA 4IHKA 3OQVA 4NATA 4BNIA 2XCQA 4KQ1A 4J1NA 4OGLA 3OOYA 2PT9A 1T0IA 4N5IX 1L2TA 1N6OA 1P72A 3B36A 4HUJA 1HT3A 1VFNA 2KWIA 4C0JA 3IXQA 3AETA 1W96A 5SYMA 5LUAA 2ZT5A 2FSUA 4YV1A 4F8JA 8ABPA 1R6VA 4XCVA 3KJEA 2PUGA 4CM3A 1YRAA 3HA3A 2WFMA 5SZIA 2BISA 2QJTA 4R3WA 2ZAOA 2P3SA 2EGHA 3OJ0A 3MM4A 2ZTLA 1ZGGA 3QE2A 3UK6A 2GEFA 3NMUF 5IDXA 2DBYA 5I7SA 3NJ8A 3MBIA 2TSYB 2AUMA 4RWZA 1PJ3A 4UHCA 4Z7NB 3PCXA 3GRVA 4UBJA 4XZ3A 3IHKA 3VNBA 3HS3A 4MAFA 2GARA 3SLRA 4BKPA 4D9HA 1KY5A 3IEIA 4GLOA 1U8TA 5LP6B 2OC4A 1CT9A 2NX2A 5HIJA 1YRLA 5LKAA 1MA0A 4MV1A 1UKBA 2IHJA 4YJGA 5B4VA 3HU5A 2XKBA 4NMLA 4A4DA 2IXFA 3KPJA 4H6XA 1X6VA 3ZY2A 4JVNA 4WN3A 1M8KA 2Y27A 2W2PA 3IEXA 5FUYA 4P7FA 1GTMA 3ILYA 3P9PA 2FLWA 3TFQA 1QQBA 4RTMA 3GN2A 5FPYA 4LZNA 4RAQA 4Q1FA 3J7TA 3HLTA 3TW0A 3UXHA 3WDLA 1NLYA 5A1TA 5FBLB 3KQHA 3IAXA 3LWZA 4RDIA 3E7XA 2J5BA 4YN3A 3RUFA 4Z9YA 1WQ4A 5FXMA 3PR3A 3K92A 1Y5NA 1XZFA 5I9BA 1N6HA 2C3OA 3QQPA 4G1FA 3VH1A 1SY7A 1WTCA 2A0KA 1AQLA 4Q3CA 5F7XA 3DV0B 3PDUA 2B4KA 3DOJA 4IXDA 1SFRA 1ZOPA 3IE2A 4KZKA 5CGZA 3VKFA 5CBPB 5IWAB 3ETDA 2WWXA 4YRTA 4ZI3A 5L7TA 1XRSB 1BW9A 2CGEA 4GOLD 1QOPB 1NXTA 1N8SA 4L3VA 3VUEA 1FUUA 2A9FA 3OIDA 4G09A 5JD3A 1U0RA 1VCIA 4NBRA 1ZIDA 2EC5A 3D6AA 3O03A 4GL4A 4WOPA 2JPDA 5CH3A 1JIKA 3VR4A 3WR5A 1DIGA 4N7RA 4XYMA 1E96A 3NBXX 1AC5A 2V4ZA 4V0NA 4R8RA 1DBWA 2FW9A 1RI1A 3AEYA 3FUXA 4I2NA 4N7JA 5CT9A 4ZARA 4F2PA 2MT9A 3MB5A 3F71A 1BXGA 3C3MA 2A9RA 2J5KA 1Z8NA 2V6IA 2Z3ZA 3GLHE 3GRCA 3P0FA 2D7CA 3QUSA 4MIOA 4NE7A 5E6RB 4LV5B 5KOYA 1ISPA 1X7WA 4LEIA 3U09A 1L4YA 4QYIB 4MIYA 2IS6A 4CM4A 3H2SA 3B1WA 3IQHX 2PLWA 1EWVA 3VZDA 3FPKA 3JWEA 4KK3A 5HCNA 2VUSA 3OZ7A 1JG6A 3PFHA 1CYEA 1QKIA 1ZITA 3HB7A 4PZ9A 5D86A 1W47A 1HR0B 3A32A 4CMEC 1DQRA 5BW8A 1CE8A 4R16A 1N3YA 1ZD8A 3REFA 3Q0TA 3U26A 3ON5A 4RH3A 2WJAA 4J7AA 2QPTA 4NL4H 2JLZA 4NFSA 2HB6A 3PC2A 1PR5A 3AHCA 4RVNA 1T1IA 2HOQA 4JYZA 2XY4A 2C20A 4D8UA 3HO8A 3SX2A 1KK3A 1T2AA 3FMVA 5AI0A 1IQUA 4P4NA 1Z6AA 3TS1A 3SLKA 3WL4A 3ICEA 1EFRA 2IC5A 3ESYA 3UJ9A 4JP2A 1V16B 4Q48A 3EA0A 3RVDA 4P53A 1N1GA 1XJQA 3ME5A 2WSYB 2WA2A 4LGCA 2OAQ1 1N2CB 2JGKA 2EQAA 1TCBA 1UMCA 3GJ7A 3V32A 2E7ZA 4ZVLA 3TLJA 4D0SA 4IPTA 2X8JB 2JJ1A 5CNKA 1J2UA 4KRGA 2D0DA 3RHTA 4BX3A 1G1AA 1MG0A 3DMYA 2Q2NA 2NWQA 2QLNA 2XE8A 3U7JA 3B12A 4FD3A 4II2A 4UE2A 4A03A 4B3TB 2W2QA 1CJKC 3TSOA 5D3KA 1Z75A 2QL7A 3IEVA 2X9NA 5GWXA 1ANKA 2FE1A 4QWMA 4XJSA 3D7KA 3AOEC 5EE1A 3ZI7A 1D6JA 1K4YA 4IIJB 1J8DA 4M7WA 4WTOA 1QVWA 3EA5A 4GOND 2Z1NA 2Z3VA 3E9ZA 1QG6A 2V7BA 3CUVA 2XUIA 1DRJA 3EBPA 3CNHA 1PWZA 5ERYA 3LDHA 4EUKA 3KT6A 3NYWA 1RM3A 1WV1A 2IZ0A 1JDZA 1S2OA 2A0UA 1IPEA 3FYUC 3OJLA 5J2TF 3D4LA 4NC9A 2AUTA 4MV3A 4TV9A 4GX0A 4LJ6A 1QCDA 3GLHB 3KDSE 1N5MA 2JK1A 1PL0A 1P45A 1BJTA 1X94A 4GM0A 4EAAA 1V47A 4EFLA 4Z4CA 3O2NA 1KI9A 4ZDWA 2RIPA 2KI5A 2DLCX 1FU7A 3KUCA 4G1CA 3TEMA 4A0RA 5A2QA 2IH2A 1IYZA 3ND8A 4LRWA 5BPHA 1NP6A 1Q1NA 1DBSA 2IQIA 3EHDA 1D09A 3IDAA 2QTNA 3T9DA 1EQUA 4URXR 1U31A 5I3ZA 1L7XA 2JANA 2RB4A 3A9VA 2JFNA 1YS7A 5LQAA 7ADHA 2JI9A 4PLGA 3BJIC 3EEQA 2X0NA 3H0EA 3DT6A 2OUIA 3N0WA 3Q8XB 1DAEA 5ILQA 1G3UA 1G8FA 1Y1LA 2WYHA 1LPAB 1C9YA 4GQIA 4UARA 1K98A 2BFBB 4N3BA 3QJYA 1Q14A 1FK8A 3CX8A 4CIBA 1MABB 1PJ8A 4EG6A 4B3CA 1P39A 4H7FA 4ZHQB 3GPLA 4WXEA 3IA2A 3I28A 4EG4A 2H1RA 1W6RA 4ZO7A 2Y05A 5G4KA 4QOHA 1J22A 3L1JA 3LPLA 1C3VA 4NAHA 3QVSA 4GYWA 5ER6A 1WHTA 4OJQA 5H68A 1KAHA 2PX4A 1DRUA 4JT4A 1A9ZA 3E2IA 4NJMA 2CLOB 2GHRA 4IRUB 3ZV5A 1QPZA 3DZBA 2CZCA 5HK8A 1KJ8A 2PD4A 5JI3E 5JY6A 1TYDE 1SC6A 5A71A 4LHWA 4XWTA 4PNEA 3AFGA 1OH7A 2VT2A 3KWLA 1G5HA 4HQ6A 3VR2A 1GILA 3ROEA 3LPAA 4JLNA 4LC9A 1FLVA 2ODBA 1PIWA 3UH0A 2O8BB 1QGYA 1UMBB 4M89A 3Q7EA 3AV0B 3Q3VA 3NZEA 4C04A 5E7QA 1UBTS 3RQIA 5B7GA 2NO7A 4NICA 1HNXB 4A6EA 3CWCA 1UP6A 2FFAA 4RANA 4EHLA 4QDZA 4M88A 2A0XA 4WZBB 4A91A 1YJAA 4MYUA 4D8WA 3I4CA 4KWTA 3QI2A 1FRQA 1Y7PA 1Y3FE 2P79A 2ZSUA 1CD5A 5HILA 3RASA 3QXSA 4DFDA 5CFQA 2PJUA 4AVYA 1RRPA 2AQ8A 2RGCA 1J39A 2AA3A 2X2FA 1VE7A 5ALFA 4OQLA 3FOFC 5FX2A 5JSYA 3FH0A 3WQRA 4CR7A 1U6IA 2GNPA 3ASYA 1NBMA 3B53X 1X7GA 2F3TA 2L2QA 1A9PA 1KU0A 4IHJB 5ANRB 4JJKA 3OPNA 2AKEA 1P2GA 2P7IA 2QKYA 2FQ1A 1DCTA 3KQPA 1YVUA 3OWHA 4NECA 3EEFA 1L7EA 5T57A 4ARAA 5K3CA 5B3LA 1DHRA 1YF3A 4D9GA 4FWBA 3LHFA 4MRAA 4OYRA 1PBTA 5DGHA 1X19A 1ZO8A 2QE6A 3ACCA 4L4XA 1TQ8A 2WSIA 2IGBA 4QQRA 2Q29A 2QM8A 1KWKA 5J2TA 3DXYA 3BULA 4L2IA 5D84A 1MTZA 3LLMA 3RUDA 4EQZA 3TNJA 5EINA 1YB1A 1XLWA 1THGA 3FZYA 1IY1A 1E7QA 1YAJA 1LPNA 1A8IA 3TSZA 4BVLA 421PA 3OUTA 4R6WA 4ASUA 4ONEA 4PG4A 2PUBA 3I3OA 1Q7RA 1NASA 3WLNA 2H85A 1VC2A 2PLRA 1TD1A 2QTVB 3RVOA 4BFVA 1OV6A 4BV9A 1Z2OX 4YMLA 3TOVA 4L02A 3ZDEA 5LQMA 4HDKA 5CBPA 2D54A 3IYLW 1IPFA 2GAJA 1EE1A 1KPIA 2ODWA 4AYXA 5HX7A 2ZVPX 2ZYRA 3IP9A 3NHUA 1W0KD 1G291 2PZAA 5FHRA 4BEVA 3L2OB 3OE4A 4YT8A 1LUAA 2DSTA 2YQZA 3CMMA 3V7WA 5H9WA 1E7YA 4FQ5A 2P8JA 3CH6A 1SH7A 3CMCO 4EG3A 4FB5A 2XMQA 5IT9A 1Z4KA 2WHRA 1F2UA 121PA 1NLMA 2NACA 1I6KA 2HJ9A 3K1TA 3WRVA 3F5MA 2CFIA 4H16A 3KV3O 4WESA 1WBDA 2YXDA 4QGGA 2BZ1A 2Z2JA 4INAA 3A9SA 2WOJA 4MUNA 3FBGA 4URVR 3QA3E 1M2OB 2V7UA 2LP4Y 2AJLI 2V7EA 2WT8A 1PKXA 2C42A 3T1QA 3LL7A 4Z0PA 3LQ1A 2VF2A 3QZUA 2QI9F 1GGMA 1ODIA 2WHPA 3BRWA 2OLKA 1R0YA 2VBFA 3CX7A 4KVGA 2AGVA 4URUR 4DG8A 4JP3A 4PPYA 4K7JA 4MA0A 2IOFK 1Z7GA 2ZB3A 4OLBA 4EVIA 3SJCA 1NHGA 3T1NA 3V3TA 1NP7A 4R9SA 3KLOA 1KO5A 4U2GA 1HE4A 4E5KA 5BN4B 2FQWA 4KN6A 3TRHA 3GQBA 1IEQA 3P0JA 3ELWA 3C6KA 1V26A 1ZAKA 1ULTA 3AR4A 4DCPA 2AG8A 3QFSA 5H3HA 2H9AA 3IOCA 2WIBA 4H7IA 4KREA 1AXRA 3B7WA 3D31A 5JCOA 2ZR7A 1JJIA 1XCMA 1N6RA 3ZV7A 3JZIA 5CX4A 4YJ2B 2CF6A 2GILA 2HFJA 3VZSA 5JOQA 1W88A 3AYXB 3NH9A 1XRLA 4KV9A 3IIMA 2YBDA 4HLUC 3IBFA 3UPUA 5KREA 1QQTA 4F6LA 3WGHA 4YT5A 5AKXA 3FJ1A 3QBVA 2XLCA 5G1OA 1PBNA 1Y8CA 2NVBA 3HP4A 3TVYA 4B6EA 4DPKA 1JVSA 3BF8A 4ZT6A 3DNPA 3GBSA 4TVSA 3QSYA 1GXSA 1NSFA 1K08A 4X1YB 4EHHA 4I8IA 5FLKA 1MORA 4DRXA 1JP7A 1RIIA 1RXCA 3RC3A 2XQKA 3GBVA 2XMCA 1QC5A 2EFCB 4MPDA 4WCVA 5FOTA 1E7MA 2PEYA 4RTRA 4BTEA 1YMVA 1AQNA 2FMUA 2I7DA 2VDUE 3ZWQA 1RBQA 5FLXA 3R6TA 5DWVA 2HHJA 1ODLA 3R24A 4TV8A 1YD7A 1CZUA 2A14A 3QY0A 2YHSA 4GRDA 4LYFA 4BNXA 1T2VA 5B2FA 1IVSA 1RFGE 4G2TA 5IFKA 1IEWA 1INLA 1ONSA 1DJLA 1FP4B 3D0OA 3TZBA 3WIOA 4J90A 2FDCA 2XYPA 1IUNA 1JKJB 4CDRA 1KMCA 5U4XA 1KKMA 4FGWA 4B87A 1MAAA 2A1UB 2ISCA 2JCSA 3ESRA 4TTPA 2J0EA 2WJHA 4NFLA 1U99A 2FSVA 4PLVA 5DK6A 3GMSA 1NVKA 3ZHZA 5I9NA 1TL7C 2HTEA 2WINI 5EJMA 4MQFB 2GI4A 5AVVA 1L3IA 4RDHA 5TEVA 3GMTA 4NFHA 3W5HA 1PQYA 1WULS 2ZWVA 2E55A 3VNSA 1P18A 4FFVA 1I30A 3O7WA 3K9WA 1TI7A 1SOAA 2FKNA 1C3XA 1UBRS 2E4WA 2VZEA 3FPCA 3O82A 2Z8YA 3W8EA 5LP6A 4E5NA 3HCWA 3QU2A 4BCCA 1CY6A 3CUTA 2F62A 3KTAB 3P20A 3TLGB 4YUVA 1DG1G 4X84A 2ONZA 1YKFA 3HNPA 4YQYA 5AVZA 4EI9A 1K3FA 3ZWWA 4PHTA 4AG6A 2I6FA 4CODB 1YK1A 4H3SA 1QDLB 2JLQA 2RH5A 3E05A 1R64A 3TUJC 5DHRA 2XGMA 1E2KA 3H7IA 3OX4A 1C2YA 1ZRMA 5KINB 2TECE 3QK7A 3H0CA 5G3ZA 4DMGA 1T0JB 1I1OA 4Q21A 5IJZA 3HY4A 1CP2A 1PD1A 4EHAA 3TAUA 2BH9A 1HYEA 2NLOA 4YHBA 4PGHA 2X5NA 5HS6A 5TQJA 3UJPA 1U5CA 3L82B 1G8JA 3NAMA 2BDTA 4RZHA 2V5VA 1A82A 2FMFA 3ROKA 2XB2A 1XJWA 4RCZA 1XWFA 1DOHA 3ROZA 1ESNA 1YR9A 3EIQA 3SHQA 1C0EA 5CTAA 5AXCA 5M04A 3VA7A 3K70B 3EAQA 1RI2A 3B13B 2JGAA 1IBSA 3BTOA 3EVBA 4I55F 4BBPA 5B4TA 5CYFA 2WM3A 3TOZA 3SQOA 1QHIA 1E9BA 3TB6A 1J09A 4ETMA 2WF6A 2YCBA 3B7GA 3ZI4A 1XTQA 1B73A 2Z5GA 3LX5A 4U5QA 4NZOA 3E03A 3GK3A 4YROA 3ZHXA 3OLCX 1W36B 1U94A 4UTOA 1E5LA 3Q5GA 5HE9A 4ZHQF 4LHEA 2VZ9A 1Z74A 1VRVA 2O2XA 4ZODA 3T1TA 1EBUA 1PS8A 5TF0A 4IMRA 5D7NA 3JX9A 5EJ2A 2L17A 3HYTA 1W1WA 3ET4A 1VOTA 4LECA 4XD7D 1TD9A 5B7PA 3I52A 3O1IC 2R84A 2OFFA 5CA1B 4GI2A 2IEYA 1ILWA 5CM2Z 2EBFX 2AN1A 2OV3A 4WFJA 1K75A 3VFDA 3M6VA 3DR3A 2NAPA 1PNRA 2GJ4A 2C1EA 4LBZA 5FQOA 1UCFA 4BV8A 3QV1A 3T6KA 3Q6NA 1CRQA 1QK3A 4BB9A 4BNYA 4ZO4A 4IHQA 3NNNA 4UVHA 1L5HA 2JCVA 1DDIA 2YY5A 2LKCA 3R7NA 3V1KA 2HN9A 4DAEA 2YDXA 4E33A 2CLFB 4BKMA 4TWAA 5DSTA 1NXOA 5J2TB 3N76A 4KFSA 2GEJA 4EA6A 1LA2A 1SWVA 1Y1SA 3WZLA 2IHNA 2HHAA 1V7PC 3WBJA 3ZD6A 3K0HA 4YDSA 4PIMA 2CXTA 3W2FA 4EA7A 5K6AA 5EZSA 1YHZA 3OX1A 1TADA 4FSDA 3WL7A 2PVCA 1ZMBA 2IIVA 4L5CA 1F6DA 2Q5QA 2Z83A 3O0DA 4HN2A 2H65A 2QNIA 1ZOOA 3TJMA 3ZDRA 1ZC4A 4BAZA 4F3YA 5IEJA 3GLGA 1LX7A 1P8JA 5GTDA 4GE3A 1CNFA 2H16A 4BGIA 2E4UA 4BTVA 4P81A 2ZCUA 1CY1A 1XMPA 4X1IA 2PUAA 1CRWG 4LVUA 4P9NA 5FL7A 1LDBA 4FI3F 4Q3OA 5AVYA 1H6DA 2JIQA 5FPKA 4JHXA 4BXOB 1E4VA 4YRFA 3SBOA 1JAZA 3OY7A 2Z58A 8MHTA 4V0QA 1GN8A 1JEOA 2OCGA 3K35A 4E7OA 4U4AA 1XMXA 5FPPA 1Z07A 3MQFA 1LZKA 3KBBA 4QPJC 4EHFA 1H1TA 4E2WA 1K9VF 1JQBA 1XDSA 1C41A 1KYTA 3A10A 2VQEB 1P1RA 1Z0IA 2OGUA 1PFYA 5CFNA 1CQZA 5K0EA 1XEXB 1LS1A 3H4IA 5L4SA 1JYSA 1T9ZA 4V1CA 3QU7A 5D2CA 2MSLA 3CG0A 2WY2D 3IMKA 4Q9HA 4RY9A 2LDXA 3WDSA 1DAPA 1EE9A 3E7WA 3LP8A 2H2HA 4K46A 3G2OA 1JDBB 2FTKE 2GK6A 1EB8A 3BSFA 1UBLS 1ND6A 2QY9A 3GCDA 3LPMA 2OYCA 2O59A 1IZZA 1YDMA 5LFAA 3D6HA 3FX2A 2FPUA 3MJ4A 1DWPA 3FAKA 2DQYA 1FTWA 3QHQA 3NUZA 4RSRA 1YS2X 4Q9DA 5DFAA 3W5UA 1EP2B 3HA5A 3ZU5A 2X41A 1DO8A 3L8MA 3N2KA 2W2MA 5DWQA 5J40A 5H4GA 5L95A 2NXCA 2F9LA 2QY6A 3E9DA 4ENUA 3ITKA 2DEUA 2OFXA 4PTLA 5L3ZA 3JSAA 9ATCA 1LBIA 1O4WA 2WD8A 1N57A 4G4GA 4QXPA 4P4UA 1OB5A 1HFEL 3QFRA 3B20A 5JE8A 3GUVA 4GXTA 4BO7A 1SUFA 2NO9A 3UWDA 4YAIA 3AVVA 4ZZ0A 2NP6A 3WFZA 3FSRA 4M8NE 1QNFA 4TM7A 1NT4A 4MQUA 1LRLA 3H8SA 3UZUA 1FXWA 4ID9A 1JMYA 4C7MA 3RBVA 4DBZA 4DMCA 2OHHA 3EOAI 3G3EA 3D6MA 2ASVA 4MULA 4UPEA 4TUYB 2TMGA 3OX2A 2QD1A 3LPNA 3NWBA 2ZVJA 1EK5A 2EFDB 1FW6A 3ABIA 1ESEA 4WMLA 1FLDA 2K7FA 2Q9CA 1ML3A 3ZJ4A 1HL3A 3J7AC 1MVLA 2V7TA 5JS7A 4GZMA 2QZPA 4WY5A 3VTFA 5FV4A 5KSYA 1VM6A 2YYYA 1U1GA 2IU3A 1BRMA 4DQVA 5C5EA 2D06A 1ZVVA 3RYFA 1PNOA 1GY8A 5E4YA 2YJ3A 1PLLA 3OE5A 4AUMA 1VIAA 3I34X 5CLJA 2DXIA 4QT0A 4GXNA 3LHIA 1D4ZA 1XTKA 2E87A 2P9JA 1X1BA 3FPAA 4GOXA 5J9FA 5LXTF 3T3PB 2QTTA 1Z0UA 4R3UC 1KMIY 4BDTA 5LKRA 3W7VA 2SBTA 4G0NA 5C8DA 4KKVA 1HE5A 1P73A 2VNKA 3IAM6 1SKQA 1GZ6A 1AGXA 5AHRA 3T5PA 2WWFA 5LOVB 2OCBA 1APBA 5DSZA 5EJIA 1R0KA 1I5EA 1ILEA 1CZNA 2QE7D 3D4PA 3X43A 5IASA 1VKJA 1LV8A 1CP3A 4KMOA 2REQA 1LJ8A 3AZQA 3LV8A 2Q9BA 5T3UA 1V9LA 3SU8A 3R8CA 1YR2A 4RMGA 4E7PA 5D5PA 3T0FA 4RJTA 1OH6A 1P74A 1W2HA 2X8WA 2EXXA 2AZTA 2ZCVA 5E6UA 4ZK2A 2E4VA 2ZK7A 3AVTA 3GD5A 4TZ6A 1PDOA 3C98A 3OQJA 4ZCLA 5C31A 4ER5A 3ZCVA 2XNCA 2O8VA 1ZYUA 2I4NA 1IB6A 3H3JA 5AXAA 4L4ZA 4FDVA 2F1JA 5HGJA 3WB1A 4E30A 2ODTX 4LFBB 4EABA 4J16C 2VJQA 2VT3A 2KE5A 3PITA 3IPLA 3HB9A 1PL6A 3THSA 4C06A 4L1KA 2XZDA 3HSYA 4YRRA 1J0AA 2JIPA 4KUHA 4AF6A 1QAQA 4OMCA 2RI0A 4RK0A 3THXB 1JSLA 4YRCA 2V9CA 2VEOA 3N87A 5JCJD 1NZFA 4NH4A 4QJIA 3SYRA 3V7FA 3GJRA 1RKXA 3UJ8A 2PLNA 4IV0A 3SD7A 4OFXA 4L73A 2F8LA 1GU1A 3MWDA 1P4RA 1XZLA 3PNPA 4YJ3B 2YFYA 2PGAA 4R9NA 4J3NA 1OX6A 2D1QA 4A9AA 2WKQA 1EH5A 3PQDA 4QXQA 1KVQA 3FSGA 1M2GA 1Z12A 3RRXA 3RS3A 3EODA 1JPVA 5KTRA 3LX6A 3BFVA 1RWOA 3CURA 2PZBA 1IXSB 1OV4A 4X91A 1YJQA 1VLMA 3ETJA 1BA2A 1R2QA 2Q9AA 3QFFA 4HDRA 2BFFA 4UE6A 4B44A 3QMPA 2JBWA 1P9WA 3TIFA 2AOUA 3IPXA 2X0EA 1N0HA 5C7YA 8ADHA 5ECGC 2HK8A 5DNWA 5IT4A 4W5QA 5GOZA 4HN9A 2Q6IA 4PC2A 1A9XA 1Q3HA 3BJMA 2FN3A 5EZ6B 1Z7BA 2HW8A 3Q1LA 2VJMA 5YASA 4DT1B 3DLAA 2QVXX 1WEKA 1JILA 1E64A 3T4XA 1IG3A 3Q3GE 4RMIA 3GDGA 2I5PO 3LIPA 5LZ9A 1L4EA 3PV0A 4H0CA 2QZZA 1KJQA 2JJ2D 2MINB 4CL8A 5AM2A 1C14A 1OLXA 3HWWA 3KEFA 3PWSA 3Q6IA 4ND2A 1GJRA 2NTYC 1RLOA 3DOIA 3YASA 3GLFE 1VE1A 1FDSA 1YR7A 2JIDA 2VJOA 3NBAA 4MR7B 2H7VA 1FQOA 2QRJA 4R01A 5ENVA 3EQ2A 5LLSA 3TH5A 1NW4A 2OCAA 3LD9A 3PSHA 1C9DB 1MB2A 4I1YA 3GC6A 3WLAA 2JGFA 1JDBC 2G4LA 3K9GA 2GHIA 4HRXA 4KPUA 3WK6A 2X5XA 4HCJA 3LCUA 4TSKA 4F4UA 1TMYA 2DWPA 4QGFA 3SR0A 4PLFA 5LB4A 1X7XB 4JLVA 3U9SA 6GPBA 5KJ6A 3SICE 3ZLTA 4WASA 2RK4A 3KBOA 4URZR 3RE1A 3A6EA 4PZZA 1J20A 3T9BA 5ADUS 3A7DA 2ZTSA 3OTGA 3FRJA 3KR1A 3I0MA 5AJXA 4EY4A 1RM0A 3R20A 1S4QA 1OC4A 4B3MB 2ZBPA 3HCBA 3RVNA 1G16A 3ELDA 4D7AA 1NOJA 4LF9B 2V5AA 5JG7A 2RKOA 2HRRA 2DKFA 2SKEA 2ADMA 2VVTA 2IOHA 2YXBA 3Q9UA 4LY9A 3I2KA 1HF3A 2J85A 3ELYA 4LSGA 3VMFA 3WFJA 3B9QA 4ZZ3A 4JI4B 1HC7A 4CJXA 3W8NA 2WUDA 4DJEC 2P5SA 4TYWA 2FH5B 3C8HA 5COBA 3UK2A 1LSJA 2CXHA 4C7VA 1U5BA 4EENA 3ACBA 3ADKA 2L42A 3M9LA 4HGPA 2C96A 4I36A 3IP6A 2ZYAA 3OQIB 4CLRA 1KYYA 4YQEA 1AUVA 2OILA 5AW6A 1L5SA 3BE8A 3PA8A 2QTFA 1J0EA 1VIDA 2WLTA 2Q4TA 2V3CC 2ZS7A 3N07A 4KCGA 4W9NC 4F46A 2ZSFA 1WXXA 4YRBA 4J6EA 4P08A 4NZMA 5F35A 1NWCA 1G64A 1JXOA 2OBMA 2C0CA 5BQPA 4NBLA 1HZZA 4KQJA 5KHOC 2V7PA 4MEBA 2W98A 1N2IA 3NHPA 4U7DA 4UVGA 1U0HC 2KMLA 5H81A 4BJ3A 3I9KA 3FCXA 4KLRA 4PYLA 4QM6A 4M6WB 2GCEA 3ZVRA 4EY5A 4ZEMA 3C8DA 1QZZA 1RQLA 2OGZA 1SCUB 5H9VA 1XKXA 3FFAA 4RGBA 1Z34A 4N0PA 3VX3A 1FMTA 4NOKA 4ODIA 3S2FA 4RIIA 4D96A 2A59A 4Y2PA 2Y8EA 4TSFA 4X3PA 5KVSA 3W5DA 4MHTA 5EQTA 1R00A 1XRJA 1MA3A 4A73A 4B43A 4YUYA 1EUCA 2HMUA 2XMDA 1TJNA 1JN0A 4QODA 4KPFC 4RY8A 2X0DA 1ZR4A 3NKLA 1EXNA 3IH5A 3FWNA 3KOXA 3DFFA 4M87A 4OQYA 1HLPA 1KP2A 3P1JA 2YHBA 2ONCA 2C9MA 2QGZA 3AM5A 3BSWA 1S3FA 4P54A 1AK1A 3QKSB 1FSGA 4V3BA 2G9ZA 2O50A 4LN1A 4MVYA 5E7IA 1XIVA 1EVLA 1E7SA 3I37X 4YMHA 2PKQP 4M0DA 3GJQA 1Q1GA 2O0KA 3G9ZA 3WP1B 1BXRA 2HEGA 5FNZA 2I2XB 1BWQA 2H1FA 5CVTA 3S2GA 2HMAA 2ZOSA 3K4HA 2AX4A 4Y0NA 1H22A 4LXHA 1H2FA 1IBMB 1F7UA 4XIJA 3FVVA 4RLQA 2PUEA 4M1QA 5BSGA 2POQX 1AM4D 3RFCA 3SQMA 3C6QA 1OY1A 4YY3B 3H1BA 4PQEA 3O3MB 1CXZA 5IHXA 3A4TA 3LDFA 3EUAA 1CUVA 1UJ4A 1SWWA 3L79A 4CV2A 1GSOA 3AB8A 4R41A 1BMFA 3LUDA 3T7SA 4H1WA 3A6DA 3PPWA 3GLIE 1KE2A 4F1WA 1TUEA 3ILHA 1YNOA 4D45A 4O3MA 2WU1A 3WK7A 1LQ2A 3TMKA 3GEPA 3ZQ6A 4BQEA 5KJEA 2CC2A 1U8CB 2P9GA 3PVSA 5KOHA 4WZBA 3BIOA 1SBIA 1R0BA 2C2GA 1M0EA 13PKA 4PRYA 3EGDA 4U2BA 7ABPA 3GDOA 1XLTC 3BICA 4K0RA 4Q7LA 4TKMA 1KJIA 1S9HA 3KJZA 1PJRA 4GNKA 2OXIA 4FFOA 1YRQA 2GPWA 3UJ3X 4PN7A 1KQ3A 4X93A 2ATXA 4GT1A 1ZX1A 1JFRA 1Q0TA 2ZQZA 4LZWA 3NM4A 1WTAA 3QYPA 1KJWA 1BAPA 1IXRC 2C9CA 2PSDA 2QSZA 2WNIA 3NTXA 3NEJA 4UM8B 3W34A 1M0SA 3VVCA 1E4EB 5ADHA 2XB6A 4LNUB 4M0PA 4BRSA 4OHRA 2COKA 2GRUA 4BX2A 1Q5PA 1MEEA 2V9ZA 4PPFA 4EKGA 2YWDA 2AVNA 1L7AA 3AINA 3VM6A 1SKYB 1D8TA 1PEAA 2ZDGA 4WK4B 4C0LA 5GJCA 4KPGA 2V9PA 4G24A 1KYXA 1EEHA 2FRXA 5K8CA 3DBVO 4FYKA 4G8BA 4X6YA 1GEGA 1YC2A 4W5WA 5CR9A 1Y9ZA 4AS3A 3GT4A 1IN5A 4W63A 1FUYB 3HKBA 4OHCA 4HLQB 4U3JB 2CNNA 3HXTA 1JR4A 2BM8A 4D46A 4OSOA 2P62A 2Z04A 3JQ9A 2J3LA 4AURA 4CMKA 4RTLA 5HM6A 2CKMA 1GAEO 1GPDG 2GWHA 1Y1RA 3AK4A 4GOOD 3VDMA 3HC7A 4NAVA 2UXBB 2Y4NA 3UJHA 3A3KA 3GAAA 1J6UA 2A0YA 3KCNA 1I4EB 4N9WA 4QHYA 3T5TA 1RVDA 4L07A 1STOA 1MAVA 3UK7A 5KKNB 3OOJA 1RBZA 2HADA 1NPDA 2IHKA 2X4IA 3W3AA 3SHVA 1MB4A 4GI5A 3O90A 3ZK8A 2AIRA 1QTNA 3MT7A 1XQXA 3TF5A 1YQQA 1ZDMA 3EULA 3O26A 3DE6X 1RXWA 5JWHA 4MLZA 1G5IA 3V1LA 1JQ3A 4IKEA 1ZGAA 2JEOA 2XUGA 2H06A 4TTIA 4XWKA 1O8BA 3A6FA 1GU7A 1KAQA 3OOEA 4QOIA 4P35A 3VKGA 2QTLA 1GAQA 1JBKA 1O77A 3FTNA 1V35A 5IXSA 1TM5E 1M2JA 1U8XX 1O03A 1G4AE 1QP7A 4KO1S 1UJ2A 3EDRA 4Q19A 3EGOA 1ZM2A 4CMEA 4HH0A 1HTWA 4GVLA 4BWVA 4Q4AB 2IPAB 4YO8A 3LQFA 4G5OA 4YP0A 4B8YA 5I3CA 3OLVA 4RF5A 2JIOA 4UDNA 3BILA 4C5CA 3H65A 1OFHA 3QE4A 1GGEA 1VG8A 3KQNA 1CUBA 1YZHA 2H3EA 2HJWA 2X19A 3GGGA 4ILKA 4Z6KA 1PF7E 3W2GA 3N2KB 2VXOA 1KZHA 2HHCA 4XIYA 1TMOA 3C74A 3VVBA 2PCJA 1KZ1A 1VCNA 2QW8A 2WT9A 3ELUA 3M1YA 2D5CA 2OO5C 5BSHA 3BWYA 3TX2A 3OM1A 3ASUA 5B3JA 2NU7A 4IILA 5DI9A 5I7RA 3ZVLA 3JVVA 2G82A 1V48A 4UDOA 4IYJA 2IW1A 3STWA 5CFRA 1OBOA 4OV6B 3DH0A 2GLUA 3UKJA 4OHFA 5CB8A 2I9KA 4HDNB 4LW8A 5EXEA 3WMWA 4TWBA 4F5ZA 2IS1A 2B8WA 3M1IA 4IBOA 2PKYX 3JAKA 4BATA 4BMYA 4EW3A 2VDRB 1BCSB 4GPD1 2ECQA 4RM3A 1EXMA 2LDBA 2ZAGA 3KG2A 1OWLA 3LSYA 5JMTA 1LRJA 2R96A 1UBCA 2NXEA 3NNSA 2QTBA 5AOAA 1NQTA 4X6LA 2HYIC 3DWEX 2V4MA 2XDAA 3LUFA 3H0KA 4QJ4A 3LWBA 5EKTA 2YL2A 4EMSA 2UVDA 1PU2A 1QU2A 4WFQA