5CBLA

Crystal structure of the c-terminal domain of human galectin-4 with lactose
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
130
Chain Sequence
GPPTFNPPVPYFGRLTARRTIIIKGYVPPTGKSFAINFKVSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSVDTLEIQGDVTLSYVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Galectin-4
publication title Recombinant expression, purification and preliminary biophysical and structural studies of C-terminal carbohydrate recognition domain from human galectin-4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 27
structure length 130
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cblA00
3APBA 1N1TA 2UWBA 3FFZA 1W6QB 4YZ4A 1AXKA 4YZ2A 1NXD1 2CNAA 2E7TA 2YY1A 2YZ4A 4FPYA 3WUCA 1UAIA 2CWSA 1C1LA 1WW4A 2WT2A 3U4XA 3W59A 3PVEA 4K1YA 1Z78A 1MS9A 2P3IA 2ZGLA 2YMZA 4Y22A 4BMBA 3USUB 1QOSA 4R9AA 4YM3A 1AF9A 4ATEA 1SLIA 2WQZC 1HDKA 4ZXKA 3ZSLA 3AZZA 2CY6A 2EF6A 4FPOB 5CBLA 3SH3A 5JOXA 3L2YA 1IS6A 1JW6A 3A0NA 3VKOA 1CPNA 2JKBA 5JVVA 1PZ8A 1IS5A 4Q8KA 3ILRA 2ZZJA 4YM1A 1LOCA 3NV1A 3AZVA 3PJQA 2ZGPA 1CJPA 4ISRA 1LGCA 4YW1A 2W39A 1ULFA 1ULCA 2EXJA 4R9CA 4UW6A 2GMPA 5CB7A 5HCFA 4YG6A 3JUUA 1WLWA 2DURA 4UW3A 1W6OB 2EXIA 5DUWA 1CVNA 1MR5A 3RMXA 2AENA 2ZHKA 2GNMA 5T5OA 1QKQA 1KJRA 3VKLA 1FATA 3OPZA 5EYYA 4YW2A 1G86A 2ZGQA 4FOWA 1S0EA 4XE9A 2VW2A 2DU1A 1DGLA 4YG0A 1N1SA 4YZ3A 3WG2A 4GXLA 3ZXFA 2YV8A 4K20A 1BKZA 2NN8A 2DUOA 4AVVA 2A6WA 1LHOA 3O5SA 1EPWA 1NLSA 1GNZA 2JE9A 2PHUA 2WT1A 1LOFA 1URXA 1GICA 3O0WA 1MS8A 2A6YA 4Q26A 3WV6A 4HL0A 1SFYA 1W0PA 1BYHA 1ENRA 4FPKA 5T54A 3BOPA 2ARXA 4P9WA 5E88A 4XBQA 5KXBA 2GMMA 3NV2A 4ASMB 4CZSA 2ZGRA 1BZWA 3MW4A 2ZMNA 4FOYA 1WUVA 2P3KA 3RQ0A 1SCSA 1GNHA 1CPMA 1DHKB 5AVAA 4WVWA 2CWMA 4HANA 1OKQA 4FPJA 2OUHA 2W68A 2OW4A 4P14A 5T52A 4LBKA 3SNMA 2D6OX 1V6KA 1ENSA 1Q8PA 4LBJA 2GALA 2EIGA 3HR9A 3OYWA 4AGGA 4DFSA 3WHTA 1JUIA 1LOFC 1YRZA 2A70A 1SBEA 1GANA 4JCKA 1V00A 1TEIA 4XHXA 2LALA 2PHTA 4JC1A 5JOYA 1LOGA 1UPSA 3AZWA 4TZDA 1QOTA 2D6MA 2RHPA 4YGEA 4YW5A 3AXEA 2AYHA 3ENRA 2VXRA 2D3PA 4PF5A 1SLCA 4FPHA 4XJ9A 1UKGA 5GZFA 3T1LA 4BM8A 3OBTA 1UX6A 4XJUA 1S0FA 1W6PB 1AXYA 1H9WA 2A3WA 3AP6A 3A4UA 3CNAA 1SLAA 3B01A 2LTNA 1SBFA 3BTAA 4Y20B 1RIRA 1YXWA 2GNTA 2EAKA 3ZSMA 2P3JA 1MVEA 2R0HA 4I30A 2FMDA 2D3SA 1LOEA 5JLVA 3POWA 4XJ8A 3IMNA 4P9YA 3M3QA 1DLLA 5EXOA 3WDXA 4WVVA 3WG4A 2DU0A 1C1FA 2PHWA 1GLHA 2D6NA 1LULA 1GZWA 2WSVA 3NV3A 4FPEA 5JOZA 1AX0A 1FNYA 1MS0A 1AJOA 4BQ1A 2WJSA 1OFSA 5DZEA 3WDWA 1R1ZA 2WKKA 1W6NA 4XXPA 4GKXA 4IQPA 2A6ZA 1LHWA 2H0BA 1B09A 3WCSA 4FOQA 1G9BA 1DQ1A 1I3HA 4BMEA 4XMIA 4PCRA 1LOAA 3O0XA 1OQ1A 3POSA 3ZXEA 3ZSKA 1N3QA 1U0AA 5IK7A 1IKPA 3N7JA 1CONA 1MZ5A 4DRRA 2A3YA 1DZQA 3KQRA 3WLUA 3V0AA 4L8QA 3V0BA 3WHUA 2E51A 5H9QA 1LJ7A 2R49A 1FV3A 2HYKA 3M3EA 1LHVA 1S0GA 2G4IA 4Y24A 2NP0A 1DQ5A 3ZVXA 2Z42A 3B3QE 1LHUA 5FRAA 2UWAA 3IM0A 2ZGMA 2ZHNA 5E8AA 2WSUA 2ZGNA 2CYFA 2DTWA 3UK9A 4YG3A 5GJ6A 5L73A 1PZ9A 2JJ6A 4LBQB 2P37A 4Y1ZA 1LGBA 2ZKNA 4Q8LA 1WW6A 1Q8VA 2AR6A 1X50A 3SH4A 4GA9A 5JOWA 2VW0A 2DUPA 3WDTA 4XIOA 1G9FA 4CRQA 4FP3A 2A3XA 2WT0A 3D4KA 1CR7A 2ZHLA 1DQ4A 2E53A 2C9AA 1VIWB 4KBBA 1F9KA 1W6MA 2ZA9A 2BQPA 4K1ZA 2V5YA 4AVSA 1ENQA 4OZXA 3VUOA 1C4RA 1AX2A 2UU8A 1S0DA 3ILNA 4FPLA 4U2AA 5GLWA 1JN2P 1F5FA 3D5OA 1FYUA 2D6LX 1WLDA 3D6EA 4XOGA 2DVFA 2AREA 4XDQA 5GLTA 3AZYA 5F9TA 3ASIA 1UZZA 4XMAA 5GZDA 1O4YA 1KDMA 4Y1YA 2VY0A 1VALA 4Y1UA 5IUQA 2D7FA 2NMOA 3AP4A 1S0JA 3AYCA 3MW3A 1HQWA 3QCWA 1IKQA 4U36A 5DG1A 3UL2A 3WUDA 4GKYA 2Q5TA 5DG2A 5KXEA 3VKFC 4RL7A 3IN9A 4YW3A 2A7AA 2A75A 3SH5A 1N1VA 1ULEA 1IS3A 3WOGA 2ZMLA 2JE7A 3AP7A 2ZMKA 1LTEA 1WBLA 1HQLA 1QU0A 2R0FA 2B7YA 2YROA 2R1BA 1AJKA 1W6OA 1LHNA 2JD4A 5CNAA 3WVJA 1JYIA 1S0IA 1YIFA 2D6KA 2WNEA 1APNA 5JMCA 3OY8B 3AK0A 4LBMA 3IKWA 2ZGKA 3C2UA 1G9DA 5DXDA 1CIWA 1MACA 5FREA 4XIKA 1G9CA 2A71A 1FX5A 2OVUA 4Y1XA 3POYA 4LBNA 5T5JA 2DVAA 3R05A 3ZXLA 3N36A 2P2KA 2ZHMA 1QDOA 4AVTA 2DTYA 1LEMA 4MYEA 3PMEA 1VLNA 4AGVA 2A6XA 2DVBA 1V6LA 2D3RA 2UWCA 4XTMA 1Q8SA 1LCLA 1ULGA 1GZCA 1JOJA 4YGBA 3RRDA 2YXSA 3FLRA 1N3OA 5H9SA 3N35A 3N7LA 4RA0A 3AYDA 3OJBA 1S0BA 1YO8A 4NO4A 1KJLA 4XTPA 1BQPA 3N3HA 5DZGA 4BLIA 3FUOA 2PHRA 1AVBA 4M3CA 1Q8QA 4BOWA 4UW5A 1CESA 1DIWA 1FV2A 3AYEA 3FUQA 4TYSA 1LU1A 3GALA 1DYKA 4YGCA 4Q1PA 3SLIA 3TB0A 4WV8A 3M3CA 2DVDA 1VAMA 5GZEA 4GWMA 3LCPA 5IK8A 3OGGA 1PZ7A 4R9DA 1N1YA 1IS4A 1KQRA 5DUXA 1GV9A 4GWNA 3AJZA 3ILFA 3ZYRA 4BLJA 1SLLA 1QDCA 1JXNA 2GNDA 5EYXA 1S0CA 2DUQA 2NZ9A 1V6JA 4XYXA 1C57A 1CQ9A 1LESA 3V0BB 4Y1VA 3NWKA 4YZ5A 1UMZA 1W6PA 3VKNA 5BYNA 1Q8OA 1IOAA 3DGTA 2GNBA 5T5PA 4Y22B 2SBAA 1MS5A 2DWRA 4XILA 4Y20A 1GBGA 3IPVA 3WG1A 3B9CA 1V6IA 3BODA 3NV4A 3O0VA 4R9BA 1LU2A 1ZM1A 4M3CF 5T55A 1WLCA 3PVNA 3LSEA 4H55A 3FLTA 1WD4A 3ATGA 2EALA 5GZGA 2PHFA 4XJWA 1UN1A 4Z8BA 4GALA 1F31A 5GLZA 1WBFA 5HCBA 1W6MB 1LEDA 3TAYA 2ZAAA 4YLZA 3RS6A 3WDYA 3OBRA 2GMEA 2VUAA 4WZFA 5H9PA 4BPZA 3RMYA 1JHNA 5DUVA 4JRAA 4FQZA 4AYUA 1G8WA 4CTEA 3M2MA 4Y26A 1FAYA 1JYCA 2R1DA 2AH2A 1LECA 1W6QA 3QLQA 5GM0A 1SLTA 2I2SA 1G9AA 1AXZA 3MPPG 4YW4A 1A3KA 2ARBA 2KM2A 2A6VA 3HMYA 2ENRA 3H0OA 3JU9A 1W0OA 5IT6A 2ZGTA 4PBPA 3HN1A 2D6PA 3I8TA 3USUA 4Q1RA 3M3OA 3T2TA 1V6MA 5DUUA 2ZACA 4FP2A 5GZCA 3ZXKA 2D44A 4SLIA 1RINA 4XHBA 3W58A 4LBQA 5KXDA 5LK5A 5F5QA 3AXDA 4F83A 2XG3A 5T50A 3B00A 2AUYA 2W52A 3FLPA 3N7KA 4PQ9A 2JDZA 4XXAA 5E89A 2FHRA 5GLVA 5SV8A 4PBOA 1UZYA 2W08A 3AYAA 1GYKA 4D69A 4M00A 1ULDA 1KDKA 1MS1A 1DQ2A 4XBLA 5HCAA 5KXCA 4DPNA 2WLQA 3OYWB 2OUJA 4XBNA 1D2SA 1QMJA 2CL2A 2ZGOA 5IK4A 4AWDA 4LBQD 3ZYPA 2AGSA 2ZBJA 4FQ4A 1YI7A 5CA6A 1WW7A 2XB6C 2C5DA 5DZFA 1MS3A 3R4UA 3T1MA 1G7YA 1WW5A 4YGDA 1QGLA 4AGRA 1D0HA 3SITA 5JDBA 2NMNA 2VU9A 5EWSA 3WCRA 1FNZA 2CTVA 1SLBA 1GZ9A 1QNYA 2GN7A 4YM0A 3WNXA 3Q9OA 3UJOA 1SBDA 3R4SA 1N3PA 2TEPA 3MW2A 2SLIA 3KM5A 1Z0HA 1J1TA 4M3CB 2DYCA 1DQ0A 3INAA 1UL9A 4ISQA 3M1HA 5GLUA 3AZXA 3WZ1A 1GSLA 5GALA 4ATFA 1MZ6A 3PVOA 4M3CE 1XQNA 4LBLA 4LBOA 1GZWB 4P9XA 1RITA 2UURA 3A0KA 2PELA 4Q27A 2ES3A 5CAZA 3OY8A 2VW1A 1DQ6A 3ZXJA 1Q56A 5IK5A 1A78A 3RG0A 1HKDA 1AX1A 1H30A 1V6OA 1W6NB 2V73A 3GNEA 1ZA4A 3WDUA 1LGNA 1S1AA 3B69A 3BIWE 4C1WA 4DQAA 1DFQA 1O4ZA 4YFWA 3FBYA 2JECA 4ZKTB 1LODA 1KRIA 2A5ZA 2NYYA 4Q2FA 4XZPA 3AX4A 1CN1A 1HLCA 2D43A 1LENA 1VAVA 5H9RA 4YZ1A 2R16A 3I4IA 3N7MA 1Y7BA 3AP5A 4FVVA 3ZSJA 4YFZA 2PHXA 5T5LA 2ZABA 4NOTA 3SISA 2DVGA 3IPVB 3V0AB 2ZGSA 2GN3A 3AFKA 1SCRA 4DS0A 4K21A 1MVQA 1JBCA 2E7QA 3MEPA 3DUIA 3O12A 3V65A 1SACA 2NM1A 3WG3A 3ZPYA 4YM2A 2EXHA 2VH9A 4M01A 2P34A 4FPFA 1H9PA 2EXKA 2ZGUA 1AZDA 4XJZA 1QF3A 1MS4A 1N47A 1YYNA 1V6NA 2E6VA 3AJYA 3RSJA 3AP9A 1DBNA 1WD3A 3UJQA 1BJQA 1LOBA 3VV1A 4DRVA 1I1EA 2DV9A 1GKBA 4ITCA 1QOOA 2GDFA 4UW4A 1ONAA 4W65A 3WDVA 3VKMA 1QNWA 1KITA 4FOVA 4FPGA 3LSDA 1A8DA 1BXHA 4FPCA 4C1XA 1WCSA 3V64A 2ERFA 1DYPA 4XJAA
chains in the Genus database with same CATH superfamily
3ACFA 1W0NA 1N1TA 4OUEA 2UWBA 2HWC2 1W6QB 1HRI2 4MXWA 1AXKA 4XFGA 4YZ4A 4YZ2A 3RZHA 3UV9A 2E7TA 2YY1A 2XH6A 1RUJ1 3K48A 3WUCA 1UAIA 2CWSA 3GDBA 4NUBA 4AVAA 3CU7A 4A6OA 4CU8A 4Y3OA 3PVEA 2VZ3A 2VO5A 1MS9A 3BVCA 2UYBA 1ZZCA 3BN6A 3GF6A 3KSCA 1QOSA 4Y22A 4F7ZA 1UKRA 2K2SA 3UNPA 2BNMA 4ZXKA 4FPOB 1UWWA 5CBLA 3LPFA 5C3RA 1BBT2 3A0NA 1CPNA 2HWD1 2ZZQA 2JKBA 2K46A 4JHZA 1PZ8A 3POIA 5LA2A 2CSGA 3PJQA 1PMIA 4ISRA 5EHDA 1LGCA 4QX3A 5D2AA 2XJSA 4YW1A 1ULFA 1UYZA 3T0BA 3POBA 4R9CA 4YVWC 5FMBA 5DAVA 1VMFA 3U10A 2GMPA 1B35B 5CB7A 1NE4A 1K5JA 4RFT0 1WLWA 3RMXA 1SDDB 2EXIA 4PI2A 2AENA 4M4PA 5F1RA 1XNBA 2OXBA 1YQ5A 2VZOA 3BB6A 1KJRA 5FUNA 1RUC1 1FATA 3H3LA 3OPZA 5EYYA 4YW2A 2DU1A 4D7YA 4B1LA 2BOIA 4MV2A 4YG0A 1RHI3 1N1SA 2CAVA 4GXLA 3VDCA 1VRH2 2YV8A 2BYVE 4QDRA 4DUVA 3IB3A 2NN8A 2DUOA 4EJRA 4AVVA 1W90A 2CDOA 4FI9A 1LHOA 2HWE2 3WX5A 1EPWA 1NLSA 1GNZA 1NAEA 4QHZA 5JCTA 1LOFA 1GICA 4XUOA 1QIQA 1W0PA 4LHLA 5T54A 1W99A 2VG9A 5E88A 3MDPA 4EV0A 3ZYHA 4ES8A 4E2GA 5KXBA 2GMMA 1JZ4A 4B7EA 4B8EA 4LO8A 2WZEA 4CU7A 2ZGRA 5FZEA 5FMOL 3HEIA 3WINE 4YVSB 4NWWA 3RQ0A 3FC0A 4DXZA 1HB2A 1CPMA 2FQPA 1NQDA 4WVWA 4NHLA 4Z92B 4QKBA 4JVAA 4PLMA 2LS6A 1KS5A 2W68A 3G6JB 5T52A 4K7JA 2V4AA 2Q8EA 1W3XA 3VZJA 1XOYA 3B7MA 5LBCA 1ENSA 5FXWA 1H4HA 4RR3C 3WHTA 1DCSA 5IYYA 1TEIA 4IXLA 2QQLA 5JOYA 4NIHA 1Y9QA 2Q8OA 3VBHB 3KS7A 5FP7A 1ZRIA 3Q8EA 2EICA 4HMZA 5A7WA 3KV6A 2I45A 2VMFA 2VXRA 4FXGB 4LE4A 2D3PA 3DL3A 3HOBA 1EYBA 1SLCA 2XL7A 1ZRRA 3T1LA 1VBD1 4EWEA 4NWVA 3WNMA 4LHKA 3ME2A 3NJXA 5J37A 4MHUA 5DAPA 4GB33 3B01A 4ORFA 3AB0A 1YQ2A 2J1RA 1V0AA 3BTAA 4LKSA 1YXWA 3ZSMA 2P3JA 1MVEA 4N53A 1YJKA 5JSRA 2JIJA 3POWA 3V56A 4XJ8A 3D8CA 4P9YA 5JI9A 1GFF2 4XAEA 2IXCA 1YHFA 4OI2A 1TMF3 3ETQA 4P9JA 4EN7B 4WM8C 5FR3A 2PHWA 1GLHA 3MUY1 1LULA 5FYSA 2WSVA 3S6PA 1SFNA 4Z2WA 1JZ2A 2CV6A 4LKDA 4XPVA 2WAOA 2QNKA 2BOJA 2C6SA 1K42A 2WKKA 4GKXA 2VUJA 4MXWB 5EIYB 5FY5A 3WCSA 5HBAA 2XWBB 3GXUA 1BHGA 3T09A 1DQ1A 1XE7A 2BPA2 1HRV1 2ID4A 5C5TA 4HKLA 4DUWA 1UY3A 1RUJ3 3O0XA 1OQ1A 4MZUA 4BXFA 1UIJA 2D5HA 3ZXEA 3ZFGB 2PHLA 1IKPA 2WRAA 5CG8A 3KT4A 1YEWA 4DRRA 5DAQA 5EP9A 3WLUA 1RUI3 1HB1A 1W2OA 3SXWA 5BNNA 3KMHA 5C8CC 4KGGA 2RJKA 1GP5A 3NNJA 1PIV2 2R49A 2NP0A 2HYKA 3M3EA 2G4IA 2QZ3A 5FWJA 2HWD3 3RZKA 1DQ5A 2Z42A 3B3QE 3VDDC 5F3GA 1UY0A 1H1MA 3IM0A 3JBG2 4XURA 5FPAA 1RUE2 2ZHNA 3TBDA 2ZGNA 3AMPA 2ZX1A 3UK9A 4YG3A 5GJ6A 3ZR6A 4Q0QA 2YU1A 5IFTA 1YWKA 2ZKNA 1JYNA 1JMUB 4R4XA 1OOPC 4B29A 4DEVA 3EBRA 1HB4A 1HXS2 4XUNA 3WF3A 4PHZA 2DUPA 3WDTA 5A32B 2JX9A 4FP3A 5FPLA 3RJ2X 1RUC3 1AHSA 5L36A 3S5QA 4URAA 5KC6A 2YBPA 2V5YA 3GHMA 2R6QA 1ENQA 2ZX3A 2CGOA 1AR72 5KR7A 1GNYA 4ZU7A 4QPGA 1D7PM 4MO3M 3TEZA 1JN2P 1W03A 4XOGA 3WW1A 4W8JA 1WLDA 2Q0AA 4RD7A 2DVFA 1HIXA 2WS92 3PL0A 2VOTA 3AZYA 3ES1A 3OBZA 5DABA 4CXXA 3VD3A 4RR3A 4DB5A 2MEV1 5F6KA 2DBNA 1W39A 1GUIA 4UXAA 3AP4A 4XZUG 2VZQA 1HQWA 2JDNA 1PNGA 2Q5TA 5KXEA 4YW7A 1EPZA 2A7AA 5J98B 1ULEA 1IS3A 2IXKA 5FMOS 1QJU2 3M8LA 1TE1B 3SCHA 4P9IA 2YROA 1VBA2 1CAWA 3I2FA 1AJKA 3LEGA 1LHNA 1OPOA 2PQSA 1YIFA 1UYPA 4Q5OA 3PVBB 4N53C 2XMLA 5A80A 3WSOA 5C9AC 5A70A 5A7WB 5LRSA 2WBKA 1W2TA 2ZGKA 3IAQA 1BK0A 3C2UA 1XRUA 1BBT1 2O8OA 4UFHA 4W6XA 1MACA 2R30A 3QD6A 1G9CA 2A71A 4Y1XA 4I3PA 3PU3A 5FZFA 4K40A 1ZBE2 3MV11 2ZX0A 2QQOA 3GHNA 1AL22 3R05A 1F2NA 4A4AA 3ZXAC 2ZHMA 1QDOA 2WWJA 2DTYA 3PJYA 4MYEA 4WM8A 3PMEA 2W92A 4WBBA 5LATA 2DVBA 3EQEA 4L97A 4CDUB 4CUBA 2UWCA 4FAGA 1E5RA 5FYCA 5KC5A 4MG2A 1Q8SA 5IVEA 2Y33A 1GZCA 1RUF2 2VMIA 3ECQA 1UQXA 4N53B 1KFUL 4YGBA 4E2SA 4FBFA 1CZTA 4COUA 1N3OA 2XXZA 3A21A 4KG0A 3AYDA 5IWFA 1YO8A 3CJIC 4NO4A 3TYJA 3I3QA 1OLMA 1QJX1 3N3HA 4HONA 1Y9MA 3FUOA 2PHRA 1EY2A 2GC3A 2VL4A 3OPTA 4LJHA 4N7IA 4FFFA 1NX9A 3OUIA 3AYEA 1ENXA 4TYSA 1LU1A 4NRMA 4PDWA 1DYKA 2RS31 3BPSA 3FFQA 3SLIA 4LUMA 1RJ8A 4RHV1 4R52A 5C8CA 1YUDA 3GJAA 3VHPA 5FZ0A 4AAXA 5GZEA 5FZOA 1HRV3 4AI1A 1N1YA 1D0GA 1OPMA 2I74A 3D82A 4OHXA 5DUXA 3ILFA 4AI8A 2JD9A 2GNDA 1JXNA 3HNYM 4X6QB 2DUQA 4YVWB 4XYXA 3LB9A 1UMHA 2VMDA 4I0WB 2YGLA 4NPLA 4HSJA 1XU2A 4Y1VA 4BQ3A 4COYA 4YZ5A 5BYNA 1GOHA 4AFDA 3J7NA 4D8MA 1ALYA 1ZZ7A 5FZ8A 4NPRA 4KNCA 2SBAA 3OUHA 4XILA 4L92A 1ZBA1 1VR3A 5T55A 1ZM1A 5A33B 2YHJA 5ACA1 4QX2A 4PLOA 3IDEA 4UF0A 2JG9A 5D21A 3UYJA 1KGYA 3OD4A 2EALA 5GZGA 3B93A 5JAXA 1RHI2 4E9KA 2RV9A 5ANNA 5FYHA 4NIAA 2PHFA 3B02A 2LM3A 4Z8BA 4DY3A 1I5ZA 4GALA 4QQ2A 1GZTA 1HW5A 4NR1A 4Y4YA 5FZ3A 4FTBA 2ZAAA 4YLZA 3QOPA 1E5HA 2A73B 5H9PA 2ET1A 3FMGA 4JRAA 1OC1A 4W50A 3M2MA 2Y26A 1JYCA 1NZCA 5FY4A 5FZ9A 2WZR3 3KLSA 1QJY1 2WINB 1X9PA 1SLTA 1D4M1 2ZEYA 5FLHA 5GM0A 5D8AC 3SEPA 2A6VA 1XYOA 2ENRA 4RR3B 4AFMA 2ARAA 2MEV3 3UGHA 2P4EA 1SPPA 4Q1RA 5A7PA 3USUA 3WQ7A 2ZACA 2WQ8A 4FP2A 4QPWA 5JZGC 1PO11 4SLIA 1JZ8A 4CDXC 5KXDA 4D7SA 4TTGA 4WM7C 1NZIA 3AC0A 1CAWB 2RS13 5T50A 3FLPA 2AC1A 5FPXA 4HFSA 2FHRA 1W8UA 4GH4C 5FPVA 4PBOA 2W08A 4X8PA 5HCAA 3MHZA 1XYPA 1IZ3A 3OYWB 3LWCA 3ZDVA 2PLV1 3ACGA 3FHQA 4IEUA 1QMJA 2CL2A 4XUQA 2RVAA 5I0DA 4A6SA 2W1QA 3DYPA 4GB32 3NRUA 4CP9B 3AKTA 4QQOA 1RUE1 1YI7A 1J58A 3JB4C 4BH9A 3O1RA 2XB6C 3CJIA 4A41A 4DOUA 2CGNA 1VPHA 4WM8B 5G05L 3VZLA 2RM21 2VXJA 3R4UA 3T1MA 1HV0A 3WT3A 1H6XA 2Y0OA 4YGDA 1QGLA 4P00B 4ZZ5A 3K4DA 1TMF2 1D0HA 2VE1A 2XLAA 5EWSA 1CX1A 3E6CC 1X33A 3WCRA 3ZPOA 1FNZA 1SLBA 3VD5A 1QNYA 4B4QA 3R4DB 1SBDA 1V70A 3J8F3 4P08A 2XVKA 2PXJA 4DZGA 1QJX3 2SLIA 1Z0HA 2JDYA 4LA2A 2KXLA 2ZJCA 3C7HA 4C90A 1UL9A 1AYM1 5BNOA 4LOSA 3AZXA 3H3UA 3CZUA 1MZ6A 5FZKA 1RUJ2 3O1PA 4LBLA 2RS33 5C8CB 5CFDC 4P9XA 4RHV3 1RITA 4QQLA 4Q0UA 5FZOB 3MYXA 3U0ZA 3I3DA 4Q27A 3FWEA 3OY8A 1DQ6A 2YGMA 3VDDB 1RUI2 2WO2A 4AF9A 1NYWA 4IERA 3WDUA 4AHXA 2Q1MA 1DFQA 4HN1A 3I3EA 4B1MA 4DMIA 4YFWA 3FBYA 2JECA 2HWD2 1GMMA 4OFGA 1NY71 3U07A 2CGPA 1OOPB 2IFRA 1HLCA 1GP6A 3AX4A 2D43A 4QDQA 5H9RA 4QX7A 4DXRA 1Y7BA 3AP5A 4ES9A 3ROUA 1VBC1 4YFZA 4QXCA 5KHIA 5T5LA 4C91A 2OQ6A 2JG8A 2ZABA 3RI8A 4V1PA 4HVQA 1L7QA 5IVCA 2GN3A 1VBA1 4BK4A 1SCRA 2VAUA 4DS0A 1NCRC 1ZBA3 3DUIA 3O12A 3WG3A 4JGYC 2F4PA 3ALQA 5EFUA 5ACA3 4I09A 1C28A 5J7MA 4DO0A 4TLFA 1RUC2 4FPFA 4BWOA 1H9PA 1AZDA 4XJZA 1MS4A 1N47A 2ARCA 2BFUL 5CIRA 2C24A 4META 2BERA 1JYTA 1I1EA 4DRVA 4QM9A 5C4WC 1ZBE1 5JXHA 1GKBA 4ITCA 1QJFA 5D8AA 2GDFA 5L7OC 3WDVA 2C0ZA 2QDNA 3LPGA 2BWCA 3IWZA 4FPGA 2VTXJ 3VBSC 1W2UA 2YB7A 4C1XA 2A1XA 2UY9A 3V64A 1DYPA 3APBA 3CJXA 2QQKA 4CUAA 4EROA 3D0SA 4EQVA 5LASA 5JZGA 5JXJA 1NXD1 5IJRA 3U14A 1QJY3 3T08A 4CDXA 1D4M3 1O91A 1PO21 3DEMA 3K75B 1W28A 1C1LA 1IG3A 4FO9A 1FPN1 3OCPA 4LTAA 4MGTA 2ZGLA 1OFNA 1US2A 2QQIA 4GH4A 4YM3A 1ND2A 3PDQA 3USUB 1NLRA 5FPZA 1XNKA 2WQZC 5DQ0A 3AZZA 1UCXA 5FO8B 2VR4A 1SFPA 2RJ2A 3BIEA 1PO13 4CDQC 4NVPA 3ZLIA 3HBKA 1IS5A 4Q8KA 4N8MA 3VBUC 5FK8A 3DPRC 1CJPA 4AOCA 4MH0E 2BEOA 3EJKA 4JKKA 3S7EA 3F95A 4E27A 3DXTA 1ULCA 5HPOA 3UKNA 2Z5WA 5LBBA 2DURA 1VBD2 2LW8A 4TLGA 1NXMA 5DUWA 1ULPA 4BHPA 1MR5A 2PLV3 3IDCB 4LR4A 5FO7B 3TEWA 5FQ0A 1NA1C 1M06G 1CWPA 3TEXA 2DCTA 3VKLA 2WYFA 2XGXA 2BP6A 1G86A 2VNGA 2XJVA 1S0EA 3CJIB 3OGJA 4FOWA 4GJYA 4NHXA 4XE9A 2Q8DA 3POFA 3THDA 3ZXFA 2RM23 3A23A 4K20A 1HN1A 2A6WA 2G9FA 1RYYA 1S2BA 2X29A 2JE9A 3LQCA 1OHFA 3O5SA 3BU7A 1URXA 3O0WA 3TNQA 4BQ2A 2A6YA 1RHI1 3POJA 1YJLA 1SFYA 3GM8A 2BGPA 5CFDA 1ENRA 5LEKA 4XQWA 3LF7A 3I2IA 3BOPA 1I9RA 4XBQA 4O65A 1US3A 1Z7S1 3WW3A 4ASMB 5C33A 1BZWA 1NE6A 2EIBA 1AYM3 2P3KA 2J1SA 4NAOA 5HXMA 3I2DA 5FY1A 5AVAA 1GQPA 1HRV2 3MO4A 2WAAA 3WF2A 1W8OA 3KCYA 1ACCA 1V6KA 1OH4A 4JHTA 4C0HA 4N9HA 2BWAA 1JU4A 1JUIA 1LOFC 1NT0A 4E2QA 3RWKX 1QQP1 3ZDSA 3POEA 1OD3A 5FY0A 1COV1 1LOGA 3AZWA 4S2GA 2WA4A 2D6MA 4HLTA 4YW5A 2BNNA 2OQ7A 2OZJA 2WNOA 3RI9A 2NLRA 4BQYA 1VBC3 4FPHA 1RB8G 2XDVA 1OQDA 2BU9A 1UX6A 4OVEA 4XF3A 5FZBA 3DKWA 1TNFA 3DYOA 2OX0A 4AG4A 3AP6A 4LE3A 3CNAA 5L7OA 1NUKA 5A1LA 3U1XA 2YBSA 3HAGA 3K2OA 4W6YA 2HWF1 3VBSA 1H4GA 1QH7A 2EAKA 4E4SA 2VNVA 2FMDA 2VBDA 4Y33A 5IAXA 5A6YA 3LA2A 4IEZA 3PIJA 2VZSA 5JI7A 5D8AB 4OZOA 1BK1A 3O1MA 5FLJA 3MLJA 2BFUS 5JOZA 4OI1A 4MSVA 2WZR2 1J3QA 1RL3A 5K9YA 2HWB1 3KF3A 4AFBA 1I5PA 1SEFA 1OFSA 1IGOA 2PTMA 3ZN5A 5DZEA 4AAPA 4IQPA 5JZGB 1FOD1 1LHWA 1B09A 2H0BA 4UFKA 4MUVA 1DP0A 4ZS3A 5F39A 3C7OA 4CDXB 1I3HA 2MEV2 2BUKA 4WM7B 5M0TA 4H7MA 5F5IA 4M0HA 1PO23 2Z2SB 4V2WA 2OZ6A 4QKNA 1JH5A 3C3VA 4IGQA 3VBUA 5IVJA 1FPN3 2W9XA 1IPKA 3DPRA 3LFMA 4GH4B 1N3QA 3N9PA 5IK7A 1GQGA 2OIIA 2VQ0A 4WVMA 3ITQA 3KQRA 4JDOA 3V0AA 4L8QA 2RS12 2JENA 3ES4A 4KG8A 2JB4A 1PGL1 4YW6A 1S0GA 1H8TA 1NA1A 3RZGA 2UWAA 3MBWA 1RUI1 4UAPA 5FJHA 1XJAA 2LROA 5L73A 4LBQB 3M70A 3LOIA 3HIFA 1ODNA 1LGBA 3PU8A 1POV1 2OKXA 4L9BA 2WNUA 3H1YA 1AR61 2VW0A 2JDUA 3T2PA 4N9IA 3BALA 1H0BA 4CRQA 5BNNC 3K77A 4XFBA 3I2KA 1OVSA 4LA3A 1XC6A 2RE9A 5EQUA 2ZEWA 1CR7A 2Q8CA 2ZHLA 4LIUA 4LULA 4D6RA 1CAUB 1F9KA 4H3WA 2ZA9A 4NHKA 4AVSA 4XFHA 4CYDA 2XUMA 3J8F2 2K9ZA 1S0DA 1JODA 1QJX2 1GP4A 4U2AA 2B39A 3MPBA 4PJYA 3GCWA 5CFDB 3D6EA 1FYUA 4RSUA 4XDQA 3W5MA 2JB8A 1Z7S3 2IUWA 5TSWA 5ABJA 3ASIA 2RS32 4JV4A 2EIDA 1O4YA 1KDMA 2GC0A 1DZTA 3MLLA 5C3QA 4HXCA 4RHV2 3OD0A 3EYPA 4Y1UA 4ASKA 3VKOA 5IK4A 3AYCA 4U36A 3UL2A 2BBAA 3RJRA 1IKQA 5DG1A 3WUDA 1HQNA 4EE2A 5DAWA 1SHWB 2FDKA 1H2MA 5DG2A 3VKFC 2E7AA 2W91A 3IN9A 1PM4A 4FFHA 1UY4A 1UPIA 2K0GA 2Q30A 2W1UA 4YW3A 1N1VA 3U75A 1RUG3 3WOGA 3USSA 2ZMLA 3AP7A 2ZMKA 3CHXA 2VECA 1HQLA 1QU0A 2WABA 4COVA 5CNAA 1W6OA 2XJRA 4QPGC 3WVJA 3IBMA 1JYIA 3AFGA 3PURA 2V72A 2NQYA 1NCRB 1QQP3 4HPKA 1APNA 3TN91 4JGYB 4MADA 2E26A 2WUHA 1ZRDA 1COV3 2J1AA 3OOXA 4UOJA 3T30A 4ZXEA 4LBMA 3IKWA 3EMRA 5FJKA 1NLQA 1ZBA2 4O9EA 1R1A1 2VMGA 5DXDA 1CIWA 2XL9A 2EA7A 4P5HA 3D0JA 5FREA 4AEDA 4BQXA 2RR11 3POYA 2HEVF 1SMVA 2QQMA 2DVAA 4MHRA 3TWIA 5ACA2 5C4WB 2XHKA 3CO2A 2P2KA 3WW4A 4ONUA 5IFPA 1HX6A 2XVLA 5L7OB 4XACA 3RDIA 2VZTA 1OF3A 2D3RA 2P1BA 3VBSB 3EO6A 2FCTA 1LCLA 2E32A 2X05A 2HWF3 2PAEA 2VZ1A 4LK7A 2Y6HA 2D40A 1CGPA 4COWA 5J36A 3FLRA 5HI0A 1XB9A 3WQ1A 5KHKA 5FZ6A 3OJBA 5FP4A 2DFBA 3KB5A 5LK7B 3NNLA 4XTPA 4XEZA 5I0RA 1BQPA 2J1UA 4URTA 3P5BA 4UFMA 1GOFA 4BLIA 1NOVA 2C26A 5FP9A 3ZYGA 3CQOA 2VMCA 3W9AA 3HWJA 1Q8QA 4K8RB 4UW5A 1CESA 2XQXA 3S7IA 1DIWA 4BE3A 5AVPA 1HV1A 1C3HA 4KWKA 1QJY2 2HWB3 4CP2A 1D4M2 5LZ6A 4GJZA 4YGCA 4Q1PA 1FOD3 2VZVA 3TB0A 1X7NA 4P02B 1VBE3 2DVDA 1JHJA 4CDQB 2GH2A 4CCEA 4CXYA 4GWMA 4XF9A 5I8YA 1J59A 4CP0A 1PZ7A 2Z79A 4R9DA 1R083 2O1QA 3VBUB 1IS4A 3GGLA 4YYOA 3DPRB 3ZR5A 3I49A 5FKBA 1EAH3 5FZ4A 3VZNA 3ZYRA 1PO12 4MVTA 5EYXA 4BDVB 1V6JA 1YCIA 5BNQA 1LESA 2VULA 2VUCA 3NWKA 1UMZA 1W6PA 4LNVA 4AQSA 4NHMA 2QQNA 1STMA 1IOAA 3VBOC 4BCUA 2GNBA 3ZYJB 1OUSA 2QJVA 4KBZA 1NA1B 5T5PA 4UFLA 4Y22B 3ZO0B 4BU2A 1JYVA 5A3LA 1KS4A 1NQJA 3ZX7A 1MS5A 2DWRA 4PDWC 4Y20A 3IPVA 3BU0A 1V6IA 5F3CA 3BODA 4CCOA 4AHYA 1EV13 2PLV2 2DDUA 4IEVA 3WR0A 1AR91 4IEXA 4KWLA 1W8TA 4QGLA 1WGPA 1WLCA 4IV1C 4QD2A 3T0DA 1W8NA 3LSEA 1D4VB 1POV3 4INDA 4OMDA 2RMU1 3HN3A 5DPNA 1WD4A 2QQPA 4W4ZA 5LWBA 3X29B 1O4TA 3HJRA 1AR63 3N9LA 4B7KA 2F4LA 2HYXA 4QX0A 1LRHA 2RM22 4XJWA 1UN1A 5FZCA 3HVDA 4Q29A 2ZXQA 5FPUA 1W9FA 2YU2A 1RTVA 1WBFA 5HCBA 1DGWA 4GZ9A 1RGSA 5F5AA 3OBRA 5FZIA 4WZFA 3I2HA 1JHNA 1O5LA 1ODMA 4CTEA 1FAYA 5LA9A 4XETA 3QLQA 1AYM2 2I2SA 1G9AA 1AXZA 1UZVA 4YW4A 4CCKA 1K45A 5KWRA 2JG9C 1KEXA 4LT5A 4HKOA 4LORA 3I3BA 4Q4Y1 2ZGTA 3H50A 2WZR1 2QUOA 2WC2A 3M3OA 3ZSEA 5DUUA 5FZDA 2PAKA 3ZXKA 3CBNA 4XHBA 3VZKA 3JD71 5LK5A 1DGRN 1A8MA 5F7UA 2YPDA 4RQPA 2FCVA 2XG3A 2WNVA 2W52A 4XXAA 4PQ9A 1NY72 1Y4WA 1YFXA 2WQ4A 3O7OA 1UZYA 4OULA 3WW2A 1NCQC 4M00A 1VBC2 3TN93 2P5BA 2AEYA 4CP1A 3ZYFA 3AKRA 4E8CA 2WLQA 2RS11 2VNRA 1PVXA 3J26N 5CZKA 2VOKA 3AKSA 4D0QA 3WP3A 4AI3A 1R1A3 1RXFA 4IEYA 1KD7A 4LBQD 2AZ5A 2Y6KA 2RR13 2ZBJA 4FQ4A 4MXVA 4Y4RA 3T2OA 1XNAA 5EZWA 1WW7A 2C5DA 1NG0A 4I0BA 5DZFA 4CA9A 4EN0A 4QPYA 1S55A 1TNRA 5F3EA 3ZM8A 4LHSA 4D3WA 1CZSA 1F4HA 4Q0PA 2CU5A 2Y0IA 5FY7A 3SITA 4LO4B 5LEJA 2J1TA 2CTVA 3WNKA 4YM0A 2GN7A 3WQ0A 1VE0A 3GBWA 5JR7B 3MF9A 4OQ9A 1N3PA 2VVEA 2TEPA 3MW2A 1K5MA 1UOFA 3KM5A 4LO6B 4AVBA 1Y3TA 1UY2A 1DQ0A 2WN3A 3SKJE 1LB2A 1L7LA 2ZX2A 3DN7A 2HKXA 3M1HA 3WZ1A 2X10A 2V09A 3NNGA 5IHRA 5JUVA 1UYXA 3J8F1 4XC9A 3O1SA 1PO22 3N9QA 5KHGA 3PUSA 1XQNA 4LBOA 2XVGA 2IFWA 4XCAA 1W06A 1FPN2 4GMP1 2UURA 3A0KA 4TSVA 3VBOA 3ZN6A 2ES3A 4IE6A 2VW1A 3SHRA 1Q56A 1A78A 1VP6A 1HKDA 2F17A 2V73A 3GNEA 4C1WA 1LGNA 4CU6A 2IXJA 3I97A 1W9TA 4ZKTB 2YDEA 4IV1A 3THPA 3ZKUA 3AKQA 3HPNA 4CCNA 4CPBA 4RS5C 1CN1A 3GYDA 1LENA 4OUSA 4Y5TA 3N7MA 2GAUA 1DG6A 2X8KA 3WNPA 5A3MA 5BNOC 2PHXA 4XFFA 2FMYA 4IGOA 1ZREA 2R041 3OUJA 1TG7A 5AFEA 2XOMA 1T2XA 3IPVB 2B45X 5LY2A 5BNNB 3AFKA 3SKVA 3VHNA 3LGRA 2QVSB 3FBMA 4IEQA 4K21A 4ZS2A 3MEPA 5K0UA 1OT5A 4BZ4A 2ZTNA 2NM1A 4CCLA 2WIIB 3ABZA 3ZPYA 1AR93 3U11A 2RG4A 1VBB3 2IXIA 1WCQA 2VBPA 4M01A 1ND3C 4AK3A 2RMU3 3KCCA 1QF3A 1W9YA 4XF1A 3H8XA 3E5UA 3EXUA 5A7QA 3PMSA 4PIXA 4AW7A 2C4XA 4IV3C 1REFA 3WF4A 2ZS6B 1LAJA 1RC6A 3OPWA 3BCWA 2VM9A 1A34A 4A7ZA 4EWDA 3KVAA 3WQBA 1FI2A 2JG8C 3NNMA 3OEBA 5JPMB 1OXCA 4FOVA 2VVFA 3HQXA 1PX4A 1WCSA 1BEV1 4LXLA 5KHHA 2ERFA 2R063 4LPLA 3T4HB 1XSQA 1Z7S2 3B9IA 4IDZA 3C8XA 4YWAA 3FFZA 1UO9A 2W95A 2XR4A 4AI2A 4UFIA 2YZ4A 4FPYA 5CKQA 3NJVA 3GZAA 5E16A 1OKOA 2F6BA 1RUOA 4K6BA 5FYYA 1WW4A 2WT2A 3VB9A 1PK6A 3J7LA 4QPGB 2DCKA 2TBVA 2VBBA 3J4UH 4FT8A 4Q4Y3 4YNIA 5EPAA 4YARA 2VOWA 2YMZA 3LEIA 4R9AA 1RUG2 1NCQA 4UYBA 2VPVA 1NKGA 1SLIA 2VTXA 3MIGA 3PHMA 2ILMA 3ZSLA 4LLFA 3SH3A 2QKDA 1AR81 3L2YA 4Q4W1 3VD7A 1JW6A 2DCZA 3S30A 1GU3A 4JDMA 1QQP2 3JD73 5JVVA 2QQWA 3JQXA 1W04A 2ZZJA 3ILRA 1COV2 2B5HA 3NV1A 1YLLA 3AZVA 1ZVFA 3GBFA 4V2VA 3PIGA 4E8DA 1OURA 5FYUA 1OBNA 4J1XA 1IQAA 1F5JA 3LKJA 4EYUA 4UW6A 4YG6A 3JUUA 4DEQA 1E57A 4JQTA 4NJ4A 4UW3A 5JIAA 4CEWC 1CAXA 1CVNA 3BOWA 2ZHKA 2GNMA 1OUXA 5T5OA 4M4RA 5C7GA 5JIUA 3ZOIA 1ND2C 5EJZB 3W5NA 1L7RA 2ZGQA 3CDZB 4FFGA 4MLOA 3SMHA 5K4LA 4QX1A 3VZMA 2HWF2 4AI0A 1DGLA 3WG2A 4YZ3A 3ZIWA 2FDJA 1BKZA 4AXOA 2YUEA 3NL1A 2B8MA 1R091 4QU2A 1YI9A 2PHUA 2WT1A 5FP8A 3BPZA 4JTOA 4Q26A 3WV6A 3WXPA 1E5IA 4JQRA 1GWLA 4FPKA 4QHOA 4XUPA 3U4SA 4P9WA 2HWB2 4CZSA 3LA3A 4QMAA 4R4ZA 4BK5A 4JAAA 4CSWA 1W2NA 2X09A 4HN0A 3MW4A 1DZRA 4FOYA 1FOD2 1WUVA 5C3SA 4OHZA 1GNHA 4XDOA 1DHKB 1V9U1 5JSPA 2IXHA 4I3GA 3M3IA 4CDWC 4HANA 1OKQA 1R082 2OW4A 4RS5A 2OYZA 4IE4A 3VBOB 1EAH2 3JCIA 1Q5OA 4GMP3 4LBKA 3SNMA 1PNFA 2O14A 4LMFA 3VHOA 4LBJA 3HR9A 2EIGA 3CF6E 4DFSA 2W87A 2A70A 4PDWB 4Z1VA 4CUCA 3ORJA 3GZEA 4Z07A 4XHXA 4JC1A 1JI6A 4IV1B 1PGL2 1UPSA 3OF1A 1W3VA 2RHPA 3P1IA 1UX7A 3AXEA 1ND3A 2AYHA 2VQUA 3ENRA 1PHMA 4I02A 4PF5A 4DINB 5BXXA 1UKGA 1GWKA 2R043 2D5FA 4BM8A 2TUNA 4XABA 2EAAA 1QXPA 4IV3A 4XJUA 1AXYA 4QDSA 4QXBA 4ZHNA 1AR62 3ZIXA 4PQQA 1SBFA 2PN5A 4OYUA 1RUH3 5IW0A 3TEYA 2R0HA 5EJ1B 2D3SA 1ST8A 3IMNA 3I54A 3KGLA 5FP3A 3ACHA 5ANQA 3P3NA 5FZ7A 3ZFEC 3WDXA 3NAPC 2TNFA 4UF0B 3WG4A 2BZDA 1C1FA 2JG9B 1GZWA 5IVBA 5IVFA 5FBJA 3H42B 3VBRA 1AX0A 1FNYA 1MQTC 3HT2A 1W8WA 2ZKLA 4BQ1A 2JEMA 2WJSA 1BEV3 1H6YA 4GULA 4HT1T 1R1ZA 3WDWA 5FTTC 1W6NA 3VDAA 1CJDA 2A6ZA 1W9SA 4CEYA 4N90A 4BMEA 4NAMA 3GJBA 3TNPB 4PCRA 2BGOA 2VCCA 5BUVA 3POSA 2XBO3 2YBKA 4PF1A 2ADDA 3ZSKA 1M4WA 1ZX5A 2J42A 1NCQB 3LAGA 1MZ5A 1DZQA 3FL7A 2FDGA 3RYKA 4ARYA 1F15A 3WHUA 1W8HA 1GWMA 2E51A 4LO7A 1LJ7A 4O9GA 4CEWA 1AR83 4Q4W3 3DYMA 1FV3A 5IAVA 1LHVA 1UU6A 3HQRA 4DXTA 1OH3A 1LHUA 3TN92 1SPPB 3TRSB 3WNNA 1UIKA 3KV5A 5E8AA 5FY9A 2CYFA 2DTWA 4DXSA 1REEA 4JTNA 2RDNA 1C8NA 1DYOA 2YC0A 2P37A 4Y1ZA 1R1A2 2HH9A 2PAMA 5A7SA 1Q8VA 3OGSA 4CCDA 2RR12 3KWVA 2J1EA 4GA9A 5JOWA 4L2NA 2LUWA 1QJEA 3MIHA 4XIOA 1VJ2A 2GH8A 1VRBA 3PTRB 3LEKA 2A3XA 1G6NA 2WT0A 2B42B 3OB8A 5A7NA 2WYSA 3IIIA 4LOTA 2Y64A 1BVVA 1VIWB 2IZWA 1H8TC 1RUD1 4KBBA 1W6MA 4OUMA 2J1VA 4MGYE 4LIVA 4SBVA 4P5YA 4NRPA 1R093 2GU9A 2JE8A 3DCQA 2UU8A 3K3NA 4FCAA 1GR3A 3ILNA 4K9SA 5F2SA 4CDWA 2W1WA 4FPLA 4IEPA 3RNSA 3T3YA 5CU1A 4IGPA 1F5FA 1O3SA 1RXGA 4N43C 1WMDA 2AREA 5GLTA 2WNUC 5I8TA 5F9TA 2P3YA 3MIDA 4IEOA 3BTYA 3K3OA 3PUIA 1WLTA 1DGRA 4UT5A 4XMAA 5GZDA 3ZYIB 4CVUA 2VY0A 1JZ7A 1VALA 1HN0A 2OS2A 5IUQA 1QH6A 2NMOA 1C8M1 1S0JA 1V9U3 1YQCA 3MW3A 3AVSA 3NVCA 1ZYBA 4MGZE 5FYTA 5A3PA 5FZAA 4GKYA 1UD1A 4EZHA 4LO5B 4RS5B 5F2WA 5J48A 4RL7A 3POGA 4C8DA 5CVRA 4X8NA 3AMQA 5BNOB 2B9UA 1UNBA 2JE7A 5FMDA 1LTEA 1AL0G 4LQRA 2R0FA 1J3PA 2B7YA 3A22A 3FE5A 5AFBA 2H6BA 2D6KA 2WNEA 5JMCA 5JSOA 5FYVA 1U5YA 1EP0A 1RUG1 3NO8A 3OY8B 4LKEA 2XJPA 5ABJC 1ND3B 3SQOA 4AI9A 2JDAA 4AZZA 3ZYBA 4BISA 1PVC1 3AL6A 5I91A 3O1OA 2RS53 2VTFA 1AR92 1O59A 4IV3B 1VBB2 5T5JA 3ZXLA 4LKFA 3ZFEA 3BGAA 3NAPA 2RMU2 4PIZA 2JWPA 1ASJ1 4YPJA 2GC2A 2A6XA 2JG8B 1V6LA 4KH9A 2QTWB 3DECA 5CFCC 1MQTA 2W47A 1JU3A 2HJIA 1ULGA 3CL1A 1JOJA 1BMV1 4DUXA 1WWYA 5H9SA 3N35A 2Y38A 3N7LA 3CZJA 5CEHA 2FBEA 1S0BA 4BXSV 4JRLA 1O8SA 2R7EB 4Y5Z0 2JDPA 4KGQA 5DZGA 2R062 3S5AA 2ZPXA 1ZZBA 4HZFA 4QPIC 3VBRB 4M3CA 2JKXA 4AEDC 3GBGA 1ZNPA 5T3NA 1FV2A 5K8SA 2J7MA 3FUQA 3I2JA 4L0PA 1QEXA 2YFUA 1ZA7A 3AL5A 4FTEA 3JZVA 3ETPA 3LDRA 1WCKA 3M3CA 2WO1A 1W9WA 4Q4Y2 1R64A 2V5DA 5I0UA 3OGGA 5FUIA 4PI0A 1VB2A 1WCUA 1JYWA 5AC91 1OA3A 2E9QA 4XCBA 2WZPP 1GV9A 4BLJA 1U5IA 1JZ6A 3N9MA 3E6BA 2DCJA 1VBE1 5C70A 1XPWA 2NZ9A 2VUDA 3JD72 3L2HA 1Y9GA 1R081 4A7YA 1PX3A 4CEWB 1UMIA 2QDRA 4XVHA 1FXZA 4HVOA 3KCXA 4JDNA 1EAH1 3THCA 3VD9A 3BUCA 2BV4A 1ND2B 4BQWA 5FO9B 1AL23 3WY6A 3ZN4A 4BQ4A 4EWAA 5F37A 1GBGA 4QHBA 3B9CA 1W8ZA 2E33A 3NV4A 3S57A 5KHJA 4M3CF 1AYN1 3UETA 1YIPA 4A3ZA 2OPKA 5FYIA 3PVNA 2Q1FA 1RUNA 1OMIA 2DBIA 3QH6A 4AQTA 1X8EA 4QAWA 4AL9A 1TQ5A 1WMEA 3ATGA 1EV11 5C8WA 4CUGA 4N43A 1POV0 5GLZA 4G3YC 3EB7A 5FQ0B 1W6MB 1YFUA 1LEDA 5BNPC 1RUD3 2Y60A 3RS6A 3WDYA 3LE0A 4PIYA 4EN6B 2BGCA 2VUAA 5BY5A 3IDBB 3RMYA 5DUVA 4CDWB 5J3UA 4QB2A 4NROA 4L99A 4Y26A 3ZFGA 1YC61 2D93A 2R1DA 3UGFA 4ZZ8A 3L9JT 1LECA 1X8MA 3FZ3A 4TWTA 1K12A 1J3RA 1O5UA 2QE3A 2Z69A 3MPPG 3UKTA 5ISLA 2ARBA 2JDMA 2BNOA 3HMYA 1PM7A 2G9ZA 1W0OA 2HEYF 3VLBB 1HJFA 1U5ZA 2W3JA 4IETA 4ZU5A 2D6PA 3I8TA 1U5XA 3RYPA 1C8M3 1JYXA 3NKTA 3W20A 1FT9A 3P6BA 4KQ7A 2QZ2A 3BTZA 5GZCA 1OVPA 1RINA 3KQ4B 4Q4X1 4WZCA 2VVDA 4HKWA 1MZFA 3W58A 5DMYA 1BVP1 3PUQA 2XKOA 3DKQA 1JTZX 4F83A 2W94A 4PLNA 3B00A 2AUYA 3N7KA 3MICA 5E89A 1WZXA 2B9VA 2KA3A 1XNTA 2Z4FA 3Q8CA 3AYAA 4GWIA 5A32A 5CG9A 3RWNA 1ULDA 4UFJA 2ZX4A 4XBLA 2RDSA 2R042 4DPNA 2OUJA 3F2ZA 3ZMNA 5CFCA 4XBNA 3IT8A 4AFCA 2FDIA 4EZ4A 3WNLA 1PVC3 2FZ1A 2NPIA 3NMBA 3ZYPA 2AGSA 3ZFEB 3H8RA 3BTXA 3NAPB 5CA6A 1RUH2 4QQHA 1IPSA 2YFZA 3RGBA 5IVVA 1ULOA 1MS3A 2I07B 1UXXX 2IVJA 4KU7A 4COZA 1ASJ3 4QPIA 4LK6A 4RQPC 1WW5A 1MQTB 3B94A 3LFIA 2WNVC 1JZ3A 3KVBA 2Q1ZB 2VCAA 1RMU1 5JDBA 3CKHA 3IIAA 5FV3A 5FZGA 3H7YA 1H2LA 4I2OA 2JXAA 1GZ9A 2HBUA 3NKGA 3Q9OA 1CAVA 2YC4A 3E5QA 2WWUA 5C6CA 1BEV2 1BLZA 3J7MA 3M7AA 4A45A 4RGKA 1J1TA 1QY4A 4M3CB 5HXVA 4F8AA 3INAA 3RZMA 5A6XA 1O3QA 4UBGA 1EUUA 2VOVA 2JDHA 1WKYA 4ATFA 2MPFA 2B46X 3FJSA 3MV01 3PVOA 4QGNA 3RYRA 2YC2A 2XBO2 4G9SB 1IPJA 1JUHA 2QQUA 1O7FA 5FXXA 3THTA 2JDKA 4AQ6A 4NIIA 2W46A 4R8HA 5A3WA 3ZXJA 5IK5A 3RG0A 4AEJA 3BKZA 5AC93 1V6OA 4QKFA 3E97A 1XNDA 3MGUA 1S1AA 3B69A 3BIWE 3KF5A 4P9LA 4XF0A 4A44A 5I93A 1AR82 3M4FA 4Q4W2 3WD5A 4D6QA 1O3TA 3LOBA 1KRIA 2A5ZA 2NYYA 4G4FA 4B3NA 4NHYA 4XZPA 1FMD3 1K5MC 2BBVA 1VAVA 2XUEA 3AMNA 2R16A 3I4IA 3PLQA 4QB6A 5IATA 4CCMA 4CDUA 5F5CA 4EN9B 2ET7A 4WVMB 2DVGA 2VZRA 3V0AB 2IVIB 1TME1 1MVQA 1JBCA 4ZPIA 3H3ZA 1XE0A 3V65A 5C3OA 4YM2A 2EXHA 1AYN3 1H8TB 1EUTA 2RJLA 2GP3A 5BNPA 5HV0A 1C5IA 1J1LA 1CX4A 1F4AA 1Q43A 2VH9A 2P34A 1OA2A 2XJUA 4W6WA 2EXKA 5DDJ1 4A42A 2KD7A 1V6NA 3RSJA 3AJYA 4I0AA 3VGIA 5FZ1A 2AEZA 3AP9A 3UJQA 1BJQA 4N43B 3VV1A 1VBB1 1YFWA 2DV9A 3HT1A 4JKLA 1R092 2WNUB 1QOOA 3I2OA 4W65A 4UBHA 3VKMA 2R071 2PHDA 3RZJA 1WA6X 1KFXL 1QNWA 3LSDA 1REDA 5CYYA 2XJQA 3VL9A 5HV4A 1YNAA 2J22A 2Y34A 5H9QA 4XJAA 2DFCA 5K0UC 2DF7A 3LEMA 2X5IC 5LBEA 3VZOA 2C1FA 3H8UA 2CNAA 4YVWA 4QWNA 4C0BA 1V9U2 3K51A 4JKMA 1XBFA 2R061 3U4XA 3W59A 5A6ZA 4K1YA 1Z78A 2P3IA 1IHMA 3E5XA 2VZPA 5FAXA 4BMBA 5LY1A 2H0VA 1AF9A 3LIHA 3MIFA 4ATEA 4YSFA 2OT7A 1HDKA 4E4DX 2VMEA 5FUPA 2CY6A 2EF6A 2PMWB 5ABJB 3PUAA 5JOXA 3WF0A 1IS6A 5A33A 4Q4X3 3OBAA 2FCUA 5APAA 5JXIA 1RVF1 4Q4V1 4YM1A 3N4MA 1LOCA 2WA3A 3H1MA 4KWUA 3Q8AA 2ZGPA 1SDWA 2VC9A 2W39A 4UI9L 1X9TA 2WFF1 5LCWL 2X53S 2EXJA 3HBZA 5JR2A 2RS52 5FYMA 5FZMA 4FSJA 5HCFA 4QQPA 5CFCB 1PGW1 2IWGB 1F8VA 3H1WA 1W6OB 1PK6C 5DAXA 2WZ8A 3BI3A 1WMFA 5EJ3A 3MF6A 4GAZA 1QKQA 2QQVA 2QBXA 4HPKB 3RVHA 5BV6A 2BVVA 1VB4A 2IXLA 4QXHA 5LA1A 3LA7A 2YG0A 4QGMA 2BJSA 4QPIB 4AFAA 2D97A 1CZVA 4AEDB 5CKNA 4BJ0A 4AR2A 1H1AA 4L11A 1RMU3 5LB6A 3MFAA 3C7GA 1MS8A 3RFRA 2VJXA 4HL0A 1MEC1 1BYHA 2CAUA 1CAVB 1O8PA 1WCDJ 5HCHA 2ARXA 3FHAA 1J83A 4XW3A 3NV2A 1PGSA 2HWC1 1XXNA 1CIYA 1HRI1 3I7DA 2ZMNA 3ELNA 1SCSA 2AACA 4BQ5A 2CWMA 3DXUA 2OPWA 5JWPA 4FPJA 2OUHA 2BVBA 1UU5A 4P14A 3DF0A 3NJZA 4CU9A 2D6OX 3ZXDA 1Q8PA 2GALA 4F3JA 1OLME 3OYWA 1SG3A 4AGGA 4CXWA 1YRZA 3Q8FA 1SBEA 1GANA 4JCKA 1V00A 2VCBA 5FYBA 2W2IA 2LALA 2PHTA 1KXGA 4KU8A 1VBD3 3IDAA 4GMP0 4IE5A 4TZDA 2FDHA 3OG2A 1QOTA 1TZOA 4YGEA 1OQEA 4OQ8A 3VL8A 4O7XA 1MZEA 2V4VA 1Q3EA 4XJ9A 3K4AA 5GZFA 5G04L 4D7TA 1PMHX 3OBTA 4XFCA 5J09A 4AE2A 1CD3G 4JX0A 4ARXA 1S0FA 1TME3 1W6PB 4A7KA 4AEMA 1H9WA 4FTSA 2A3WA 4CP9A 3A4UA 3MLKA 5BNPB 4LLOA 1SLAA 1L3JA 3AKPA 4QX8A 2LTNA 2ZAHA 4XAAA 4XQ4A 4CCCA 4Y20B 1RIRA 1DDLA 2GNTA 5DDJ3 2IC1A 4I30A 4IE7A 1VRH1 5JLVA 1LOEA 3OGVA 5A1AA 5FZLA 2HWE1 3M3QA 1RUD2 1DLLA 2W0XA 1DGWX 2X5IA 3GZTB 4WVVA 5EXOA 5L9BA 3U78A 1RUH1 2DU0A 3E6DA 4DIQA 2QFEA 3T0AA 1JZ5A 2D6NA 5A3TA 3NV3A 4FPEA 3E1F1 2R073 3GZUC 3KT7A 3LDKA 1MS0A 2L9LA 1AJOA 2Y6FA 5CADA 4XF4A 3VDDA 3CEWA 1I6XA 3Q8BA 3KHBA 5J1XA 2YPJA 4XFIA 5L9VA 5LRRA 4MOAA 4XXPA 5K7PA 4LHNA 5FFOC 4BA6A 4YRDA 5A3NA 4FOQA 3VN4A 1G9BA 4J1WA 3NW4A 4XMIA 1LOAA 4UWDA 3WEZA 1OOPA 1C8M2 1WMXA 4OLLA 3PUHA 4QU1A 3ACLA 4X6RB 4TN7A 5FCCA 1U12A 1U0AA 3N7JA 4MGKE 5FK7A 4QXKA 1CONA 4OMCA 1H2NA 2A3YA 1H1IA 2WDBA 5LA0A 4NIDA 3VBFC 1X82A 1W8FA 2EVXA 5FMCA 3LIGA 3V0BA 1RJ7A 5FOBB 2XBO1 2H6CA 4CCJA 3VBRC 2BW8A 2YYOA 1GQHA 3NSTA 4Y24A 3ZVXA 2W1SA 5FRAA 1SQ4A 3AVRA 1RVF3 4Q4V3 4HBNA 5B4XA 1DU3D 2ZGMA 4OHWA 2WSUA 4CEYC 5F32A 1PZ9A 3IAPA 2JJ6A 3JQWA 4D6SA 1O3RA 2ATFA 2WFF3 4QKDA 1PVC2 3UESA 4Q8LA 4DNYA 5FBZA 4RQPB 1WW6A 2AR6A 4KL1A 2O8QA 5JMOA 1X50A 2WNVB 3MUZ1 2XKPA 1MPXA 3SH4A 3UKVA 3KHCA 2B4KA 1SZBA 2OA2A 2Y6LA 2RDQA 1XU1A 3ACIA 5FXZA 1G9FA 1ASJ2 4IESA 1DF0A 3D4KA 5A1FA 1DQ4A 1VMHA 1OD5A 1T6BX 2C9AA 2E53A 3RZLA 2ORXA 4NIGA 1BMV2 3URFA 3KV9A 2BQPA 3OGRA 4K1ZA 4Y5SA 1YQ6A 1F35A 3ZFFC 5A3UA 2UYAA 4OZXA 3VUOA 1C4RA 3IMMA 1AX2A 3VDBA 2WR9A 3CMGA 4H14A 5B2GB 2ZOEB 2Q4SA 4JGZC 5GLWA 1YQ8A 3D5OA 2D6LX 1MEC3 3I59A 5C9AA 4XQDA 1POQA 5FOJB 2GP5A 2RDRA 3ZKYA 2VQAA 1UZWA 4KMQA 4PT6A 3ON7A 1XYNA 2HWC3 1UZZA 1HRI3 2XLFA 4AHWA 4Y1YA 1W2AX 2D7FA 3QCWA 2XQRA 1UOGA 2ZEZA 2JIGA 2PA7A 2E31A 1K5MB 1XSRA 2DCYA 3HNBM 5AC92 3DV8A 3O1TA 1PMJX 5B4NA 2A75A 3SH5A 1S2KA 4HK9A 1W05A 2ORZA 3MIEA 5CKMA 3ZXGA 1VBE2 5L19A 1WBLA 3AM2A 2R1BA 1FMD2 1QJZA 2JD4A 2WO7A 1PIV1 4AQ2A 1S0IA 5FWEA 1BBT3 3MI8A 1H8VA 3HQUA 2JICA 1J84A 3ZN6B 3JBG1 3BYWA 2BDRA 1ZZ9A 3AK0A 1Y43B 5FKCA 1OA4A 2ETEA 4TXWA 2G9GA 3WP5A 4S2HA 3PNAA 4MGSA 1G9DA 4XIKA 1AYN2 1UF2C 2OVUA 1FX5A 1HXS1 2VZUA 3I3MA 4LBNA 1YFYA 1UZ0A 2P17A 3N36A 1LNSA 3J7HA 4AVTA 4BIOA 5F8PA 1LEMA 3WNOA 1VLNA 4RGAA 1T6GC 1EV12 4AGVA 3CLPA 2RS51 3WP4A 1B35C 1S2EA 4XTMA 1S4CA 4IL7A 5LW9A 2WO3A 5GKAC 3RRDA 5K0UB 4N7UA 1QWRA 1VRH3 2YXSA 3HNMA 3QH7A 5FDBA 1HB3A 2C9KA 2X5IB 4RA0A 1IG0A 2HWE3 1AR71 2XLGA 3N9NA 4LUKA 1KJLA 1VMJA 1AVBA 5ERLA 5E6HA 4BOWA 5KBFA 2WS91 4RGGA 2W5FA 4IEWA 3VHRA 3GALA 1UYYA 5C5UA 3MFCA 4IUGA 4QB1A 3VBFA 4ET7A 2ZEXA 4WV8A 1VAMA 3QACA 5IK8A 3LCPA 1JOBA 2FDFA 4A3XA 1UU4A 1KQRA 4GWNA 3AJZA 4YVSC 1SLLA 1QDCA 1QJU1 4Q4X2 1S0CA 1IQDC 1K3IA 2G19A 1C57A 1CQ9A 4FXKB 2CDPA 3V0BB 5FYZA 3O1VA 2G1MA 3VKNA 2MNGA 1AUYA 1Q8OA 1PK6B 3DGTA 2FZ2A 1C5HA 1UY1A 1OSGA 2XJTA 3H7JA 5I8SA 3KZ4C 1UW8A 3WG1A 4BB3A 2XPJA 4QM8A 3J9SA 4ZY9A 3O0VA 4R9BA 1LU2A 1QXRA 3D3AA 2PYTA 1HJGA 4XUTA 3UT0A 4D94A 3VBHC 1O6UA 2QCSB 2GSYA 4H55A 4OCTA 1AL21 3FLTA 2XHNA 3ZFFA 1ZRCA 3AMHA 4J6GA 1X36A 2Y6JA 4JGZA 3O1UA 2VMHA 4XDPA 3ST7A 3U37A 1RUF1 4I01A 1F31A 4NE9A 4DY5A 4Z82A 5A7OA 1CAXB 2EIEA 2HBTA 2WFPA 5F3IA 1RMU2 3TAYA 4HVRA 2VNOA 3IZOA 1OF4A 3G7DA 3TOJA 4NRQA 4WM7A 2GMEA 2GZWA 3FX3A 4AEKA 4ZONA 4BPZA 3FHIB 4HETA 4FQZA 4AYUA 1G8WA 2VQTA 4HSLA 4E4HA 2N7GA 4NMIA 3I59B 2AH2A 3MZHA 2WWSA 3R6SA 1W6QA 5C9AB 2VD7A 5IVYA 2Y6GA 1XE8A 1LKNA 1A3KA 2KM2A 2D98A 2XWJB 4K3UA 4MGIE 3SEEA 3H0OA 3JU9A 4FFIA 4Z2AA 5C71A 1JOPA 5IT6A 3JB8A 3LDBA 4PBPA 3HN1A 4OHVA 4AVCA 4GQ7A 2O0OA 3JXSA 3WF1A 3T2TA 1ZRFA 5E1RA 1V6MA 4OHYA 1XNCA 3OTFA 3KD4A 3KGZA 2D44A 4LEJA 4NPMA 1OLRA 4LBQA 2P6CA 2BRTA 1DLCA 4XFAA 4QX5A 5F5QA 3AXDA 3FN9A 1JS9A 3NQHA 3P3PA 2WN2A 1UOBA 5BPXA 4GD4A 3EHKA 2JDZA 5SV8A 3ZFGC 4O61A 4IW3A 4OI4A 5GLVA 1PIV3 1GYKA 1H2KA 3RZZA 4D69A 1KDKA 1MS1A 1DQ2A 5KXCA 4OI0A 3JBG3 2PFWA 1RUE3 1B35A 2ADEA 3T4VA 4BIFA 1D2SA 1TME2 1TVGA 2ZGOA 4S2FA 5FIXA 5EV7A 1CAUA 4Q0SA 4ASLA 4AWDA 2CHHA 2P6HA 4IE0A 5JPNB 4A2UA 1HXS3 3W21A 4LITA 3K46A 5DDJ2 5SV5A 3LZZA 2ZCWA 2FD8A 2XONA 1G7YA 5D1IA 3H8OA 1LR5A 3SCFA 1D2QA 4WVZA 3ZMOA 4GIQA 4AGRA 2NMNA 2VU9A 4JZRA 1BCXA 3C7EA 2KR2A 2QQJA 2R072 1P8JA 2R32A 3UGGA 3WNXA 1QHDA 2VGDA 3UJOA 3VD4A 3N9OA 4RFRB 3SCGA 1AR73 1VAKA 4Q0VA 3R4SA 5FXVA 5DN2A 2GC1A 2DYCA 4J25A 4RN5A 4ISQA 4YVSA 2WS93 5GLUA 5J96B 1GSLA 3CIHA 3NJYA 5FY8A 5GALA 4K8FA 4M3CE 4HG6B 3VBFB 1GZWB 3PTYA 1NCRA 2E63A 1UXZA 2VCMA 3LD8A 2PELA 4JGYA 4MX3A 3OEAA 5A3OA 3SC7X 2MHFA 1GOGA 4ZU4A 2HEWF 5CAZA 4MGQA 5L9RA 4CE8A 4P9GA 4NN0A 4FAHA 4EN8B 3WP6A 1AX1A 1H30A 1W6NB 5FPBA 1ZA4A 4DQAA 2WLPA 4CEYB 4KI5M 3HD8B 1QJU3 1O4ZA 1LODA 3KV4A 3GCXA 3VBHA 1VBA3 1ZZ6A 1RVF2 4Q2FA 4Q4V2 5C4WA 4M0NA 4YZ1A 2UY8A 3K4ZA 4FVVA 3ZSJA 5A6QA 3T2QA 1OI6A 4H2AA 5C3PA 2WFF2 5JXGA 4RYDA 5LBFA 1ZZ8A 4NOTA 3SISA 2ZGSA 2PQQA 5I0SA 1FMD1 3B5LB 2E7QA 1PGW2 5I0TA 3H9AA 5CISA 1SACA 3I2GA 3O14A 3MIBA 2WL1A 4GB31 4B4PA 4GWJA 4KWJA 4B4RA 2BTVC 2VOXA 1ZBE3 3QBQA 3ZFFB 1A6CA 2ZGUA 4BYYA 2HLEA 3KT1A 4CPBD 4E4ZA 2Y8KA 1YYNA 1UOJA 2E6VA 3A7QA 3OSDA 4JGZB 2LRPA 4S2DA 1DBNA 1WD3A 1LOBA 1TMF1 5FLIA 1RUF3 5FZHA 1E5SA 4HK8A 4UW4A 1QXJA 1ONAA 4H7LA 4CDUC 3S0MA 3R0RA 1OLQA 1KITA 1WA4A 4AHZA 4CDQA 1A8DA 1BXHA 1MEC2 3C7FA 5F6LB 4QT6A 4FPCA 2VW2A 3AMMA 3RPQA 3NNFA 4HOOA
chains in the Genus database with same CATH topology
1N1TA 2UWBA 2HWC2 1W6QB 1HRI2 4MXWA 1AXKA 4XFGA 4YZ4A 4YZ2A 3UV9A 2E7TA 2YY1A 2XH6A 1RUJ1 3K48A 3WUCA 1UAIA 2CWSA 4AVAA 3CU7A 3PVEA 1MS9A 4Y22A 2UYBA 1ZZCA 3GF6A 3KSCA 4F7ZA 1QOSA 1UKRA 2K2SA 2BNMA 4ZXKA 4FPOB 5CBLA 1BBT2 3A0NA 1CPNA 2HWD1 2ZZQA 2JKBA 1PZ8A 3PJQA 1PMIA 4ISRA 1LGCA 4YW1A 2XJSA 1ULFA 4R9CA 4YVWC 3U10A 2GMPA 1B35B 5CB7A 1NE4A 4RFT0 1WLWA 3RMXA 2EXIA 2AENA 5F1RA 1XNBA 3BB6A 1KJRA 1RUC1 1FATA 3OPZA 5EYYA 4YW2A 2DU1A 4D7YA 4MV2A 4YG0A 1RHI3 1N1SA 2CAVA 4GXLA 1VRH2 2YV8A 2BYVE 2NN8A 2DUOA 4EJRA 4AVVA 1LHOA 2HWE2 3WX5A 1EPWA 1NLSA 1GNZA 5JCTA 1LOFA 1GICA 1W0PA 4LHLA 5T54A 2VG9A 5E88A 3MDPA 4EV0A 4ES8A 4E2GA 5KXBA 2GMMA 4B7EA 4B8EA 4LO8A 2ZGRA 5FMOL 3WINE 4YVSB 4NWWA 3RQ0A 3FC0A 4DXZA 1CPMA 2FQPA 1NQDA 4WVWA 4NHLA 4Z92B 4JVAA 4PLMA 1KS5A 2W68A 3G6JB 5T52A 4K7JA 3VZJA 3B7MA 1ENSA 1H4HA 4RR3C 3WHTA 1TEIA 4IXLA 5JOYA 1Y9QA 2Q8OA 3VBHB 3KS7A 4HMZA 2I45A 2VXRA 4FXGB 4LE4A 2D3PA 3DL3A 1EYBA 1SLCA 2XL7A 1ZRRA 3T1LA 1VBD1 4EWEA 4NWVA 4LHKA 3ME2A 5J37A 4GB33 3B01A 4ORFA 3AB0A 3BTAA 1YXWA 3ZSMA 2P3JA 1MVEA 4N53A 1YJKA 5JSRA 3POWA 3V56A 4XJ8A 3D8CA 4P9YA 5JI9A 1GFF2 2IXCA 1YHFA 4OI2A 1TMF3 3ETQA 4P9JA 4EN7B 4WM8C 2PHWA 1GLHA 3S6PA 1LULA 2WSVA 1SFNA 4Z2WA 2CV6A 4XPVA 2QNKA 2WKKA 4GKXA 2VUJA 4MXWB 5HBAA 3WCSA 2XWBB 1DQ1A 1XE7A 2BPA2 1HRV1 4HKLA 1RUJ3 3O0XA 1OQ1A 4MZUA 1UIJA 2D5HA 3ZXEA 3ZFGB 2PHLA 1IKPA 5CG8A 3KT4A 4DRRA 3WLUA 5BNNA 1RUI3 3SXWA 3KMHA 5C8CC 4KGGA 2RJKA 1PIV2 2R49A 2NP0A 2HYKA 3M3EA 2G4IA 2QZ3A 2HWD3 1DQ5A 2Z42A 3B3QE 3VDDC 1H1MA 3IM0A 3JBG2 3TBDA 1RUE2 2ZHNA 2ZGNA 3AMPA 2ZX1A 3UK9A 4YG3A 5GJ6A 4Q0QA 1YWKA 2ZKNA 4R4XA 1OOPC 4B29A 3EBRA 1HXS2 2DUPA 3WDTA 5A32B 2JX9A 4FP3A 3RJ2X 1RUC3 1AHSA 5L36A 5KC6A 2V5YA 3GHMA 2R6QA 1ENQA 2ZX3A 2CGOA 1AR72 4ZU7A 4QPGA 1JN2P 4XOGA 3WW1A 1WLDA 2Q0AA 4RD7A 2DVFA 1HIXA 2WS92 3AZYA 3ES1A 4RR3A 4DB5A 2MEV1 5F6KA 1W39A 4UXAA 3AP4A 1HQWA 1PNGA 2Q5TA 5KXEA 1EPZA 2A7AA 5J98B 1ULEA 1IS3A 2IXKA 5FMOS 1QJU2 3M8LA 1TE1B 3SCHA 4P9IA 2YROA 1VBA2 1CAWA 1AJKA 1LHNA 1OPOA 1YIFA 3PVBB 5C9AC 5LRSA 2ZGKA 3C2UA 1XRUA 1BBT1 2O8OA 4W6XA 1MACA 2R30A 3QD6A 1G9CA 2A71A 4Y1XA 4I3PA 4K40A 1ZBE2 3R05A 2ZX0A 3GHNA 1AL22 1F2NA 3ZXAC 2ZHMA 1QDOA 3PJYA 2DTYA 4MYEA 4WM8A 3PMEA 4WBBA 4CDUB 2DVBA 3EQEA 4L97A 5KC5A 2UWCA 4FAGA 1Q8SA 1GZCA 1RUF2 2VMIA 3ECQA 4N53B 4E2SA 1KFUL 4YGBA 4FBFA 4COUA 1N3OA 4KG0A 3AYDA 1YO8A 3CJIC 4NO4A 3TYJA 1QJX1 3N3HA 3FUOA 2PHRA 1EY2A 2GC3A 4N7IA 3AYEA 1ENXA 4TYSA 1LU1A 4PDWA 1DYKA 2RS31 3FFQA 3SLIA 4LUMA 1RJ8A 4RHV1 4R52A 5C8CA 1YUDA 3VHPA 5GZEA 1HRV3 4AI1A 1N1YA 1D0GA 1OPMA 2I74A 3D82A 4OHXA 5DUXA 3ILFA 4AI8A 1JXNA 2GNDA 4X6QB 2DUQA 4YVWB 4XYXA 3LB9A 4I0WB 4COYA 2YGLA 4HSJA 1XU2A 4Y1VA 4YZ5A 5BYNA 4AFDA 1ALYA 1ZZ7A 4NPRA 4KNCA 2SBAA 4XILA 4L92A 1ZBA1 1VR3A 5T55A 1ZM1A 5A33B 2YHJA 5ACA1 4PLOA 3IDEA 2JG9A 3OD4A 2EALA 5GZGA 3B93A 5JAXA 1RHI2 4E9KA 2PHFA 3B02A 2LM3A 4Z8BA 4DY3A 1I5ZA 4GALA 4QQ2A 1HW5A 4NR1A 4Y4YA 4FTBA 2ZAAA 4YLZA 3QOPA 2A73B 5H9PA 2ET1A 3FMGA 4JRAA 3M2MA 2Y26A 1JYCA 1NZCA 2WZR3 3KLSA 1QJY1 2WINB 5GM0A 1SLTA 1D4M1 5FLHA 5D8AC 2A6VA 1XYOA 2ENRA 4RR3B 4AFMA 2MEV3 3USUA 4Q1RA 3WQ7A 2ZACA 4FP2A 5JZGC 1PO11 4SLIA 4CDXC 5KXDA 4D7SA 4WM7C 1CAWB 2RS13 5T50A 3FLPA 5FPXA 4HFSA 2FHRA 4GH4C 4PBOA 2W08A 4X8PA 5HCAA 1XYPA 1IZ3A 3OYWB 3LWCA 2PLV1 4IEUA 1QMJA 2CL2A 4GB32 3AKTA 4QQOA 1RUE1 1YI7A 1J58A 3JB4C 4BH9A 2XB6C 3CJIA 4DOUA 2CGNA 4WM8B 3VZLA 2RM21 3R4UA 3T1MA 1HV0A 3WT3A 2Y0OA 4YGDA 1QGLA 1TMF2 1D0HA 2XLAA 5EWSA 3E6CC 1X33A 3WCRA 1FNZA 1SLBA 1QNYA 4B4QA 3R4DB 1SBDA 1V70A 3J8F3 2XVKA 4DZGA 1QJX3 2SLIA 1Z0HA 4LA2A 2KXLA 2ZJCA 4C90A 1UL9A 1AYM1 5BNOA 3AZXA 3H3UA 1MZ6A 1RUJ2 4LBLA 2RS33 5C8CB 5CFDC 4P9XA 4RHV3 1RITA 4QQLA 4Q0UA 3U0ZA 3MYXA 4Q27A 3FWEA 3OY8A 1DQ6A 2YGMA 3VDDB 1RUI2 4AF9A 1NYWA 4IERA 3WDUA 4AHXA 2Q1MA 1DFQA 4HN1A 4DMIA 4YFWA 3FBYA 2JECA 2HWD2 4OFGA 1NY71 3U07A 2CGPA 1OOPB 2IFRA 1HLCA 3AX4A 2D43A 5H9RA 1Y7BA 3AP5A 4ES9A 3ROUA 1VBC1 4YFZA 5KHIA 5T5LA 4C91A 2JG8A 2ZABA 3RI8A 4V1PA 4HVQA 2GN3A 1VBA1 1SCRA 4DS0A 1NCRC 1ZBA3 3DUIA 3O12A 3WG3A 4JGYC 2F4PA 3ALQA 5EFUA 5ACA3 4I09A 1C28A 5J7MA 4TLFA 1RUC2 4FPFA 4BWOA 1H9PA 1AZDA 4XJZA 1MS4A 1N47A 2BFUL 5CIRA 4META 1I1EA 4DRVA 4QM9A 5C4WC 1ZBE1 1GKBA 4ITCA 5D8AA 2GDFA 5L7OC 3WDVA 2C0ZA 2QDNA 2BWCA 3IWZA 4FPGA 3VBSC 1W2UA 4C1XA 2UY9A 3V64A 1DYPA 3APBA 3CJXA 4EROA 3D0SA 5JZGA 1NXD1 1QJY3 4CDXA 1D4M3 1O91A 1PO21 1C1LA 4FO9A 1FPN1 3OCPA 4LTAA 2ZGLA 1OFNA 4GH4A 4YM3A 1ND2A 3USUB 1NLRA 5FPZA 1XNKA 2WQZC 3AZZA 1UCXA 5FO8B 1PO13 4CDQC 4NVPA 1IS5A 4Q8KA 3VBUC 3DPRC 1CJPA 4MH0E 2BEOA 3EJKA 3S7EA 4E27A 1ULCA 3UKNA 2Z5WA 2DURA 1VBD2 4BHPA 1NXMA 5DUWA 1MR5A 2PLV3 3IDCB 4LR4A 5FO7B 1M06G 5FQ0A 1NA1C 2DCTA 3VKLA 2XGXA 3OGJA 1G86A 2VNGA 2XJVA 1S0EA 3CJIB 4FOWA 4XE9A 4OI1A 3ZXFA 2RM23 4K20A 2A6WA 2G9FA 1S2BA 2X29A 2JE9A 3O5SA 1OHFA 3BU7A 1URXA 3O0WA 3TNQA 2A6YA 1RHI1 1YJLA 1SFYA 5CFDA 1ENRA 5LEKA 4XQWA 3BOPA 1I9RA 4XBQA 1Z7S1 3WW3A 4ASMB 5C33A 1BZWA 1NE6A 1AYM3 2P3KA 3I2DA 5AVAA 1HRV2 3KCYA 1V6KA 4C0HA 4N9HA 2BWAA 1JUIA 1LOFC 4E2QA 1QQP1 3ZDSA 1COV1 1LOGA 3AZWA 4S2GA 2WA4A 2D6MA 4HLTA 4YW5A 2BNNA 2OZJA 3RI9A 2NLRA 1RB8G 1VBC3 4FPHA 1OQDA 1UX6A 4OVEA 4XF3A 3DKWA 1TNFA 4AG4A 3AP6A 4LE3A 3CNAA 5L7OA 3HAGA 4W6YA 2HWF1 3VBSA 1H4GA 1QH7A 2EAKA 4E4SA 2FMDA 3LA2A 4IEZA 5JI7A 5D8AB 1BK1A 5FLJA 3MLJA 2BFUS 5JOZA 4MSVA 2WZR2 1J3QA 1RL3A 5K9YA 2HWB1 4AFBA 2PTMA 1SEFA 1OFSA 1IGOA 3ZN5A 5DZEA 4IQPA 5JZGB 1FOD1 1LHWA 1B09A 2H0BA 4MUVA 4CDXB 1I3HA 2MEV2 2BUKA 4WM7B 4H7MA 4M0HA 1PO23 2Z2SB 2OZ6A 3VBUA 1JH5A 3C3VA 1FPN3 3DPRA 1IPKA 4GH4B 1N3QA 5IK7A 1GQGA 2OIIA 2VQ0A 4WVMA 3KQRA 4JDOA 3V0AA 4L8QA 2RS12 2JENA 3ES4A 4KG8A 1PGL1 1S0GA 1H8TA 1NA1A 2UWAA 1RUI1 5L73A 4LBQB 3M70A 3LOIA 3HIFA 1LGBA 1POV1 4L9BA 2WNUA 3H1YA 1AR61 2VW0A 4N9IA 3BALA 1H0BA 4CRQA 5BNNC 4XFBA 4LA3A 2RE9A 1CR7A 2ZHLA 4LULA 1CAUB 1F9KA 4H3WA 2ZA9A 4NHKA 4AVSA 4XFHA 4CYDA 2XUMA 3J8F2 2K9ZA 1S0DA 1QJX2 4U2AA 2B39A 3MPBA 4PJYA 5CFDB 3D6EA 1FYUA 4RSUA 4XDQA 1Z7S3 5TSWA 5ABJA 3ASIA 2RS32 4JV4A 1O4YA 1KDMA 2GC0A 1DZTA 3MLLA 4RHV2 4Y1UA 3OD0A 3VKOA 5IK4A 3AYCA 4U36A 3UL2A 3RJRA 1IKQA 5DG1A 3WUDA 1HQNA 1H2MA 5DG2A 3VKFC 2E7AA 3IN9A 4YW3A 2Q30A 1UPIA 2K0GA 1N1VA 3WOGA 1RUG3 3USSA 2ZMLA 3AP7A 2ZMKA 2VECA 1HQLA 1QU0A 4COVA 5CNAA 1W6OA 2XJRA 4QPGC 3WVJA 3IBMA 1JYIA 3AFGA 2NQYA 1NCRB 1QQP3 4HPKA 1APNA 3TN91 4JGYB 1ZRDA 1COV3 4LBMA 3IKWA 1ZBA2 4O9EA 1R1A1 2VMGA 5DXDA 1CIWA 2XL9A 2EA7A 4P5HA 3D0JA 5FREA 4AEDA 2RR11 3POYA 2HEVF 1SMVA 5ACA2 2DVAA 3TWIA 5C4WB 2XHKA 3CO2A 2P2KA 3WW4A 4ONUA 1HX6A 2XVLA 5L7OB 3RDIA 2D3RA 3VBSB 3EO6A 1LCLA 2HWF3 2PAEA 1CGPA 2D40A 4COWA 5J36A 3FLRA 5HI0A 3WQ1A 5KHKA 3OJBA 2DFBA 3KB5A 5LK7B 5I0RA 4XTPA 4XEZA 1BQPA 4URTA 4BLIA 1NOVA 3ZYGA 3W9AA 3HWJA 1Q8QA 4UW5A 1CESA 3S7IA 1DIWA 4BE3A 5AVPA 1HV1A 1C3HA 4KWKA 1QJY2 2HWB3 4CP2A 1D4M2 4YGCA 4Q1PA 1FOD3 3TB0A 1X7NA 1VBE3 2DVDA 4CDQB 2GH2A 4GWMA 4XF9A 5I8YA 1J59A 4CP0A 1PZ7A 2Z79A 4R9DA 1R083 2O1QA 3VBUB 1IS4A 4YYOA 3DPRB 1EAH3 3VZNA 3ZYRA 1PO12 4MVTA 5EYXA 1V6JA 1YCIA 5BNQA 1LESA 2VULA 3NWKA 1UMZA 1W6PA 4LNVA 4AQSA 4NHMA 4BCUA 1IOAA 3VBOC 2GNBA 3ZYJB 2QJVA 1NA1B 5T5PA 4Y22B 3ZO0B 5A3LA 1KS4A 1NQJA 3ZX7A 1MS5A 2DWRA 4PDWC 4Y20A 3IPVA 1V6IA 3BODA 4AHYA 1EV13 2PLV2 4IEVA 3WR0A 1AR91 4IEXA 4KWLA 4QGLA 1WGPA 1WLCA 4IV1C 4QD2A 3LSEA 1D4VB 1POV3 4INDA 2RMU1 2QQPA 1WD4A 3X29B 1O4TA 1AR63 4B7KA 1LRHA 2RM22 4XJWA 1UN1A 4Q29A 1RTVA 1WBFA 5HCBA 1DGWA 1RGSA 3OBRA 4WZFA 1JHNA 1O5LA 4CTEA 1FAYA 4XETA 3QLQA 1AYM2 2I2SA 1G9AA 1AXZA 4YW4A 5KWRA 2JG9C 4LT5A 4HKOA 4Q4Y1 2ZGTA 3H50A 2WZR1 2QUOA 2WC2A 3M3OA 3ZSEA 5DUUA 2PAKA 3ZXKA 4XHBA 3VZKA 3JD71 5LK5A 1DGRN 1A8MA 4RQPA 2XG3A 2WNVA 2W52A 4XXAA 4PQ9A 1NY72 1YFXA 3O7OA 2WQ4A 1UZYA 4OULA 3WW2A 1NCQC 4M00A 1VBC2 3TN93 4CP1A 3AKRA 2WLQA