5CBLA

Crystal structure of the c-terminal domain of human galectin-4 with lactose
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
130
Chain Sequence
GPPTFNPPVPYFGRLTARRTIIIKGYVPPTGKSFAINFKVSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSVDTLEIQGDVTLSYVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Galectin-4
publication title Recombinant expression, purification and preliminary biophysical and structural studies of C-terminal carbohydrate recognition domain from human galectin-4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 27
structure length 130
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cblA00
3B01A 3WHUA 1DQ6A 1LU2A 3VKFC 2UURA 5EWSA 1WBLA 3QCWA 5KXDA 4GKYA 1IS5A 3ENRA 3POYA 2E51A 4YG3A 4CZSA 1G9CA 2A71A 1HDKA 1N1YA 2D43A 2CL2A 2R16A 1JYIA 3AYDA 1ENRA 3N7JA 2ARXA 1JOJA 3R4SA 3RSJA 1EPWA 1FATA 1ULFA 1W0OA 2GNBA 2WSVA 3A0KA 1ONAA 5BYNA 3V0BB 1W6OB 5GZCA 1V00A 2DVAA 3MPPG 1KDMA 3AXDA 4FPYA 4XZPA 1CR7A 3WLUA 4K20A 1GZWB 5JVVA 1C1FA 2WLQA 3KQRA 4F83A 1KDKA 1TEIA 2UU8A 4P9YA 1NLSA 5JOYA 4BLJA 5GZGA 1Q8OA 1AXYA 2V5YA 5EYYA 4XBLA 1LTEA 5JMCA 5F9TA 1FV3A 2VUAA 1WLDA 3AP6A 3UK9A 1O4YA 2VY0A 1LULA 1LOFC 2GNDA 1VIWB 4FP3A 2YXSA 5JOZA 3ILRA 5GLZA 4ATFA 1ENSA 2P3KA 1WUVA 3LSDA 4JC1A 5H9PA 4ZKTB 4R9DA 5JOXA 2ZGQA 4XBNA 5EXOA 1JN2P 1N1VA 4YM1A 1YI7A 1W6MB 1Z78A 2R49A 3N7KA 1WLCA 4NOTA 2SBAA 3OYWB 2OVUA 2A6YA 2D3RA 1BYHA 3SH4A 3UJOA 1ULDA 1DQ5A 4BOWA 1BQPA 2AH2A 2DVBA 1Q8QA 2Z42A 1LENA 1LHOA 4U2AA 5T54A 2EIGA 3WDVA 5IK5A 3ASIA 2E6VA 2V73A 3ZXKA 3POWA 2A6WA 3BODA 1LEMA 1V6JA 4FVVA 3T2TA 1FX5A 1HQLA 1SLIA 2OUJA 2RHPA 4AGGA 5T5JA 2NN8A 1DBNA 3AJZA 3SH5A 4YZ5A 4M3CF 2VU9A 3M3QA 1OKQA 1SLTA 4SLIA 3WZ1A 2CWMA 4BQ1A 1UN1A 5EYXA 2CTVA 2SLIA 1I3HA 2P37A 4FPCA 5H9QA 3DUIA 3RRDA 3AZVA 2ZKNA 1QU0A 1KRIA 2A6VA 3WUDA 3V0BA 4UW5A 5DXDA 1GYKA 3TAYA 1UPSA 3SISA 1HKDA 2ZGTA 5CA6A 1BZWA 5IT6A 3L2YA 1JYCA 2HYKA 1YXWA 3ZXFA 1YO8A 1GZWA 1KITA 4XJ9A 3FBYA 4ZXKA 1LESA 1CPMA 1MS8A 2PHRA 4WVWA 5T5PA 3WG3A 1MS5A 2ZACA 3WV6A 1W6NA 3NV1A 1CQ9A 5H9RA 1F31A 3IN9A 3CNAA 3ZSMA 2E7QA 4YGBA 5GLTA 3N36A 1DHKB 5FREA 2ZHLA 4AVTA 3V0AB 1DFQA 1WW6A 3IPVA 5DUWA 5GLVA 1DQ1A 5CAZA 1JXNA 3TB0A 4YZ3A 1AXZA 3AP7A 2D6KA 2ERFA 3BIWE 4XILA 2DU0A 3I4IA 2W68A 1X50A 2DTWA 1S0IA 3W59A 1DIWA 2PHTA 4FPKA 1Q8PA 1QDOA 4Y22B 1ENQA 4PBOA 4XIOA 2D6PA 3WUCA 4Y1XA 4AYUA 5HCAA 4K1ZA 1C1LA 1DZQA 1V6OA 1BXHA 2GMEA 4LBLA 5AVAA 1ULCA 4LBKA 1KJLA 2JJ6A 1IS4A 1LOCA 1U0AA 1VAMA 2DUOA 2DTYA 3VKMA 3ZYRA 3B69A 4XYXA 4FP2A 1MVEA 1ZA4A 2GNMA 1B09A 2YY1A 3OBTA 1DLLA 3WCRA 3USUB 1QNWA 2JDZA 4XJAA 2D44A 2WJSA 4P9WA 1W6QB 2C9AA 1CIWA 4GXLA 1H9WA 3NV2A 3O5SA 3AZWA 3WG2A 4AGRA 1AX0A 2YROA 2EALA 2XG3A 4XMIA 3ZXEA 4YM3A 4M01A 3VKNA 1V6LA 4MYEA 1YRZA 3N35A 3ZSKA 3O12A 4GKXA 1H30A 1VAVA 2G4IA 1FNYA 3O0WA 4BMBA 3N3HA 4LBQB 4UW4A 5DZFA 2ZGOA 4Y20B 3I8TA 2XB6C 4YW1A 2VW0A 5FRAA 1CN1A 3D4KA 5DG2A 2WSUA 3SH3A 3AP9A 4P9XA 1F5FA 2WQZC 2A3YA 3PJQA 1W6PA 3QLQA 2CYFA 4DS0A 1UAIA 4DPNA 5DZGA 1APNA 4RA0A 4XIKA 3WNXA 4D69A 1CESA 5GZEA 4K21A 1SLLA 5JDBA 4YFWA 4M3CA 1Z0HA 3M3OA 1CVNA 2LALA 3OY8A 4Q1PA 4FPFA 4XBQA 3POSA 1QGLA 3FFZA 4YGEA 4DRRA 5IK7A 2A6ZA 3RG0A 1QMJA 3C2UA 3BOPA 3AZZA 4FPGA 2VW1A 1CJPA 4XJWA 2ZGKA 1SLCA 1GZCA 1N1SA 2NYYA 5T52A 1G86A 1GKBA 2AGSA 1G9BA 4GA9A 2ZA9A 1DQ4A 1LOEA 1GNHA 3AZYA 4AWDA 4C1XA 5HCBA 3D5OA 4FPEA 5T55A 3HN1A 2DUQA 1SFYA 2A3WA 3M1HA 4HL0A 1AX2A 1GANA 2NMOA 3ILNA 4XJ8A 4K1YA 2EAKA 3R4UA 1LGCA 3B3QE 4YLZA 4Y1VA 3NWKA 4WVVA 3T1LA 4CRQA 3WCSA 3MW3A 3Q9OA 3PVEA 4JCKA 4XDQA 3WOGA 4Y1YA 2W08A 4KBBA 2P3JA 3W58A 2GMPA 3HMYA 5E8AA 5GLWA 5KXEA 3ZVXA 1GSLA 4XTPA 1LOFA 2ES3A 2H0BA 5CBLA 4ISRA 2ENRA 4XXPA 3SLIA 1LHWA 1WLWA 2ZHKA 5LK5A 1WW7A 3VUOA 3B00A 3HR9A 3RMYA 1IS3A 2R0HA 3D6EA 1WD3A 5GM0A 2WKKA 2ZAAA 1W6OA 1AJKA 1DGLA 3AP5A 1QDCA 4LBQD 4YM0A 1JUIA 4GWMA 5GZFA 4PCRA 1PZ8A 2ZGMA 3WHTA 1MACA 1V6MA 3LSEA 4PBPA 4LBQA 1D0HA 3JUUA 2AREA 2D3SA 1FV2A 2AENA 4NO4A 3B9CA 5KXCA 4WZFA 4Y26A 2A70A 4ATEA 1O4ZA 2EF6A 2NM1A 3RS6A 4H55A 4Q8LA 4TZDA 3N7MA 2WT0A 2AYHA 2PELA 2WT1A 1LOBA 3M3EA 3M3CA 2DV9A 1MS1A 1ZM1A 4BMEA 5JOWA 1SCRA 1BKZA 2JE9A 1LJ7A 2B7YA 2NZ9A 3VV1A 1SBDA 4Y1UA 4YZ2A 1AJOA 1MR5A 4L8QA 1MS9A 4PF5A 1GZ9A 1W6MA 4Y1ZA 3MW2A 1IOAA 2DYCA 2YZ4A 3ATGA 3IKWA 4JRAA 2ZGSA 3OYWA 5DZEA 3WDYA 4PQ9A 3ZXLA 2D7FA 1LGBA 3VKLA 5H9SA 1SACA 4LBNA 3WDWA 2GN7A 4RL7A 4ASMB 5T5OA 2ZABA 3JU9A 4CTEA 3AFKA 4GALA 2Q5TA 4Q8KA 3LCPA 3R05A 5T5LA 1AZDA 2PHFA 4XHXA 4Y24A 2ZGRA 1ULEA 4YM2A 1J1TA 2A5ZA 5HCFA 3RMXA 5DUVA 1FNZA 1NXD1 1V6IA 1UZZA 2EXKA 1KQRA 3WDTA 2ZMKA 2YV8A 5CNAA 3V65A 3ZXJA 3GNEA 4BM8A 4IQPA 2DVGA 4Q2FA 5IK4A 1LU1A 2OUHA 2ZMLA 4FPHA 4YG0A 1UX6A 1LEDA 4AVVA 2VH9A 1V6KA 1QOOA 4U36A 1G9AA 1SLAA 4YG6A 1ULGA 5IUQA 4R9BA 2JE7A 2FHRA 3O0XA 5T50A 4FOVA 4FOYA 2GMMA 3OJBA 1QF3A 5E88A 4AVSA 3ZSLA 4XE9A 2AR6A 1V6NA 2GDFA 1FAYA 4YGDA 4M3CE 2LTNA 1H9PA 4W65A 3IM0A 2A3XA 5GALA 1SBEA 2DURA 1LHNA 4Z8BA 2BQPA 1DQ0A 4DQAA 4YW2A 3AK0A 1WBFA 4DRVA 1GLHA 4FPOB 2D6MA 4LBJA 1S1AA 2ZBJA 4UW6A 4XXAA 3H0OA 3V0AA 5JLVA 1D2SA 2YMZA 1LECA 2JKBA 5DUUA 1N47A 4Q26A 1URXA 1C57A 1PZ7A 1G9FA 2GNTA 2CWSA 3ZSJA 1N3QA 2A75A 2WNEA 2GN3A 1UKGA 4XTMA 2P2KA 4Y22A 1W6NB 2EXIA 2DWRA 4FOWA 1UMZA 1I1EA 1Q56A 1IKPA 2ZGNA 2NP0A 3PMEA 1WW4A 2W52A 3AZXA 3FUOA 4XHBA 1S0EA 1N3PA 1A78A 2VXRA 2D6OX 3IPVB 5CB7A 4YW4A 2D6LX 1GICA 3ZPYA 3AP4A 1QOSA 1SLBA 1N1TA 4LBMA 2W39A 2DUPA 4FPJA 3ILFA 3RQ0A 1S0DA 2P34A 4BPZA 1FYUA 2D6NA 1DYPA 2WT2A 3GALA 1GBGA 2ZGUA 1LOGA 2A7AA 1WW5A 3FLPA 4FQ4A 3USUA 1G9DA 2A6XA 2UWCA 3MEPA 1S0JA 5SV8A 2JD4A 1JBCA 1W6QA 1AXKA 2C5DA 3INAA 2PHXA 4XOGA 1LGNA 3PVOA 1OQ1A 1SBFA 1UZYA 4TYSA 5E89A 2FMDA 1SCSA 3VKOA 1LODA 3A4UA 2E53A 4FPLA 1MS0A 4YZ4A 2CY6A 1WCSA 1F9KA 1CPNA 3OGGA 2R1BA 1C4RA 1W0PA 2EXHA 1VLNA 1QKQA 2PHWA 3KM5A 4R9AA 5GZDA 1LCLA 2DVFA 3BTAA 3PVNA 1MS4A 1WD4A 2R1DA 2NMNA 4Y20A 4DFSA 1LHUA 2ZHMA 3AYAA 4YZ1A 1AF9A 3WG1A 1BJQA 4ITCA 3WDXA 1G8WA 2ZGLA 4YGCA 1MS3A 2ARBA 2CNAA 1GV9A 4LBOA 4OZXA 1YIFA 1VALA 2DVDA 2I2SA 4XMAA 1OFSA 1HLCA 1R1ZA 1JHNA 3MW4A 4I30A 4FQZA 3T1MA 5KXBA 1RITA 3AYEA 5GLUA 1S0FA 3NV4A 3WG4A 2OW4A 1RIRA 4R9CA 5F5QA 2ZHNA 4M00A 1Q8VA 2JECA 3O0VA 3NV3A 1HQWA 2VW2A 2UWAA 1YYNA 1RINA 2E7TA 3AX4A 3APBA 1AVBA 1N3OA 3SITA 4HANA 1QNYA 1JW6A 4WV8A 3FUQA 5GJ6A 1UL9A 3IMNA 2ZZJA 3A0NA 3UJQA 2R0FA 3SNMA 2ZMNA 4C1WA 4BLIA 1Q8SA 1W6PB 1S0GA 3OBRA 1S0CA 3M2MA 4XJUA 3OPZA 2AUYA 3ZYPA 1QOTA 3U4XA 5DG1A 1MVQA 4M3CB 4XJZA 3WDUA 3OY8B 1CONA 4ISQA 3V64A 4UW3A 3FLRA 1IS6A 1MZ5A 2DU1A 1Y7BA 2EXJA 1XQNA 4P14A 2D3PA 2KM2A 2PHUA 1A3KA 3DGTA 5DUXA 3WVJA 2GALA 1DYKA 3AXEA 4GWNA 1LHVA 1KJRA 3UL2A 2ZGPA 4YFZA 1PZ9A 1IKQA 2P3IA 1MZ6A 1GNZA 3AJYA 3N7LA 1A8DA 4Q27A 4Q1RA 2TEPA 2UWBA 1DQ2A 4AGVA 1AX1A 5IK8A 1LOAA 1S0BA 4FOQA 3AYCA 4YW5A 3FLTA 4YW3A 5L73A 1G7YA
chains in the Genus database with same CATH superfamily
5FMBA 5LATA 1ZBA2 3IDBB 2ARAA 2B39A 3VKFC 5KXDA 1WBLA 4I3GA 1E5IA 4YG3A 3ENRA 4CZSA 3AMMA 5FPBA 1G9CA 1HDKA 5CFDC 1PNFA 3WW2A 3RPQA 3AYDA 1ENRA 2ARXA 3FHAA 2EIBA 4CCJA 4IDZA 3RYKA 1UYPA 4P08A 5FZGA 3CIHA 3VBUA 1DLCA 3A0KA 1FATA 1O8SA 1ULFA 1W0OA 4QM9A 4PIXA 4AQTA 4CCEA 1NA1A 5BNNC 5BNOA 2QQUA 1RUH2 3HVDA 2CAVA 4I01A 3MFAA 3H8RA 3WR0A 4AI2A 4H2AA 3OEBA 5CEHA 1TEIA 3PL0A 1JZ3A 1UY0A 4P9YA 5JOYA 1V9U2 1AXYA 4RS5B 2F6BA 1FV3A 2R071 1RJ7A 4FXGB 4JDMA 1YWKA 1FXZA 2BNMA 2DF7A 2BNNA 3ZX7A 4LQRA 4AK3A 2B45X 4AI8A 1GQPA 4N9IA 1BBT1 3HQUA 5FTTC 1W8UA 3ILRA 5JOZA 5GLZA 4ATFA 4GB32 1U5ZA 2QQOA 2W87A 4IE7A 1AL21 1WUVA 3LSDA 4ZKTB 3KWVA 5H9PA 5EXOA 4YM1A 2HWF1 2W2IA 3F95A 3BCWA 2WZPP 3ETPA 5KR7A 3JD72 1TMF1 3DYOA 2OVUA 2D3RA 4HSLA 4A6OA 5D8AA 4CUAA 3UJOA 5DABA 1BBT3 1F35A 2AH2A 1Q8QA 2QZ3A 4U2AA 5IK5A 3J8F1 4CDQA 4PF1A 1W03A 4PLOA 4NHYA 4C8DA 3BU0A 4MGTA 2V72A 2W46A 3BODA 1LEMA 4FVVA 4AHZA 3EXUA 5FZHA 1FX5A 5FKBA 3OGVA 1J58A 3UKVA 1VBB1 5E16A 2ATFA 2HWF3 5A7WB 1DBNA 1NQJA 3AJZA 3S6PA 4AQ2A 3O7OA 1XNAA 2QQMA 2R7EB 4QPGC 4XF0A 3M3QA 3PVBB 5B2GB 1J83A 3GHMA 2LS6A 3ZFEA 1X8EA 5CG8A 1RUJ1 3J4UH 2ARCA 1W04A 4WBBA 4FPCA 1WLTA 5C8CA 3NNGA 2A6VA 3UKNA 4CU6A 2VXJA 3TAYA 3GXUA 4PIZA 3SISA 4LO8A 5IT6A 1H1IA 1VBB3 3L2YA 5F2WA 4K40A 3PTYA 3MDPA 1JU3A 1M4WA 4XJ9A 3UKTA 3EO6A 2VOVA 1LESA 1CPMA 1MS8A 1EV12 1XNDA 4JDNA 4P02B 4ZXKA 3WG3A 1MS5A 2ZACA 4Q0PA 4R4XA 5EJZB 3U78A 1F31A 1US2A 1RUG3 2BOIA 1SFNA 5FZ1A 2E7QA 2RJ2A 1F4HA 3N36A 4LJHA 3SKJE 1XNCA 4HPKA 1RJ8A 1BVVA 3NAPA 5DDJ2 1VRBA 4CP0A 5M0TA 1Y3TA 4AFBA 2VUJA 3TRSB 3DV8A 2RDSA 4Q0SA 3TWIA 1DQ1A 4BWOA 1VB4A 4EN6B 1IPKA 2WNVA 1AXZA 4XURA 2XMLA 1H8VA 3EHKA 4L99A 4QX1A 4XF4A 2J7MA 4XILA 5DQ0A 1LNSA 1OPOA 2W68A 3BPZA 3VBFC 1X50A 2XPJA 1RUF2 2VMEA 1DIWA 4JKMA 2DBIA 1QDOA 4Y22B 4PQQA 4Q0QA 4GAZA 4LO5B 4CDWA 2XH6A 3AMNA 1U5XA 4P9GA 4A44A 4CDXA 1PO21 3E5XA 5FYHA 2FDIA 1VJ2A 2O0OA 2VMIA 2IUWA 2BZDA 4K1ZA 3HT2A 1OBNA 1YQ8A 4IE6A 4N90A 4NWVA 4DXRA 2JJ6A 1K5MC 4BQ2A 4BH9A 4H14A 3VKMA 2W5FA 4TXWA 4XYXA 2E26A 1MVEA 2FCTA 5FZOB 3OBTA 4AEDA 1DLLA 1ZRRA 1TE1B 3USUB 3WQ1A 1OKOA 4L11A 5F8PA 3THCA 1OD5A 4NHMA 2JDZA 2LRPA 3DYMA 1PO23 2QJVA 4P9WA 1FOD1 1UYXA 1W6QB 4KMQA 4Z82A 4P5YA 1CIWA 4GXLA 2IFRA 4RGAA 1OPMA 4JGYA 2XG3A 4IE0A 4XMIA 2RR13 2JX9A 2WZ8A 3T3YA 3VHRA 2R042 4QT6A 3H3LA 5IAXA 1AYN1 4M01A 3VKNA 1E57A 1YRZA 3N35A 1PGW1 3ZSKA 1Q5OA 3DECA 1YNAA 2G4IA 4BMBA 1GQGA 3N3HA 2E32A 1RC6A 5LBBA 5BNPA 4Y20B 2JG9B 3I8TA 2ID4A 1G7YA 2XB6C 4X8PA 2VW0A 3MPBA 4YW1A 3RWKX 2XBO1 4PHZA 5FRAA 3SCFA 1CN1A 3D4KA 4IL7A 1CZVA 4QDQA 2A3YA 2Y0OA 1H8TB 1UAIA 1UO9A 1WCQA 4YVWC 3WNXA 4E9KA 2GAUA 1C28A 1CESA 4MUVA 4HVOA 5FBZA 1F8VA 3ACIA 1JOPA 1Z0HA 2XDVA 3M3OA 5CFDA 4FBFA 5JSOA 2VR4A 4EZHA 2RMU2 3POSA 4RN5A 4DRRA 3D82A 5G05L 1O3RA 4QM8A 4RFRB 2ZGKA 5BNNA 2VTXA 1N1SA 3RJRA 3SMHA 1G86A 1GKBA 1PIV1 2GZWA 1RUE1 3EQEA 4GA9A 2HEWF 1GWMA 1GNHA 4IEZA 2R32A 4AWDA 4FPEA 2V09A 5FZ8A 3ZMOA 4NVPA 4LHLA 4AF9A 2MEV1 2NMOA 4D3WA 3VZLA 1COV2 5J96B 3NWKA 3P5BA 4FTBA 3NQHA 2VZRA 3NJVA 4Y1YA 2QQPA 5F5IA 4KBBA 2P3JA 4BHPA 2YPJA 4IESA 3W58A 3W20A 1OLQA 5E8AA 5GLWA 3T4HB 1GSLA 1PIV3 1RUE3 3ZR5A 2ES3A 1W0NA 3I97A 2KR2A 3MLKA 2ENRA 5GKAC 2FDFA 5LK5A 2MEV3 3WF4A 3ZPOA 1XU1A 1IS3A 5JPMB 3D6EA 2VCCA 3S5AA 5LCWL 3I3MA 2HWD3 3GDBA 3KS7A 4LHSA 3UV9A 5J37A 3B9IA 1J3PA 1GP4A 1AHSA 3CU7A 1QJU2 3LGRA 3Q8CA 5FWJA 4YM0A 4DY3A 1MEC3 3N9MA 2N7GA 5L9BA 3W9AA 3WHTA 1MACA 4A7ZA 2EVXA 4XF9A 4LBQA 4EN8B 3T09A 2D3SA 1REDA 3NSTA 5DAQA 5IVEA 3BUCA 2WNOA 4N7IA 4K6BA 3U4SA 1AR91 3TEXA 3C7FA 3ZFGC 2WT0A 1JH5A 2JDPA 3GYDA 5JWPA 1VBC2 1RXFA 2ZX4A 3ZM8A 1JI6A 1UD1A 3GCXA 1HJGA 2YGLA 4QPGA 3ROUA 1ENXA 1UF2C 3E97A 1MS1A 5JOWA 3T0BA 2WR9A 1LJ7A 2B7YA 2NZ9A 1ODNA 4TLGA 4Q4V2 3VV1A 2JB8A 4C91A 3QH7A 4L8QA 3POGA 1AR93 4D8MA 3MIFA 5I91A 4I3PA 4Y1ZA 1IOAA 2DYCA 3ATGA 2HWE1 4GH4C 2BBVA 3OYWA 1UZ0A 3VKLA 4J25A 4ASMB 5FFOC 1CAVA 4Q5OA 2ZABA 3ZN6A 3AFKA 2CHHA 3LCPA 3SQOA 2PHFA 4XHXA 3LE0A 4Y24A 3VBHB 2ZGRA 1ULEA 2HWC1 5EV7A 3ZIWA 4BDVB 4CEWB 3TN91 1IZ3A 2XGXA 2V4VA 2ZPXA 4HBNA 4NIAA 3HNYM 2EXKA 1KQRA 4YPJA 3G7DA 4I02A 1X33A 1UU4A 3GNEA 1OF4A 2HWE3 1QXRA 5CVRA 4IQPA 4Q2FA 5CG9A 5IVVA 1SQ4A 4ZPIA 3UGGA 2H6CA 2VOWA 5LASA 2VMHA 3DXTA 3ITQA 1SLAA 4COUA 5C4WB 1LR5A 1IG0A 3AKRA 5C71A 3OF1A 4Q4X3 5JZGB 1OSGA 1D4M1 2MPFA 3VBFA 1QF3A 2XJVA 4AVSA 3ZMNA 4XE9A 4FAHA 4A2UA 2AR6A 5IFTA 2GDFA 3I2JA 2WL1A 1YFXA 4YGDA 1BLZA 1W8NA 1YCIA 3POEA 1H9PA 1QQP3 3PUHA 2F17A 3C7HA 4W65A 3VD5A 2I45A 1NAEA 2BQPA 1FPN1 3MI8A 5FZ6A 1TG7A 4RR3B 1FT9A 4HT1T 5L9RA 1WBFA 1K5MA 5FMCA 2YBPA 4WM8B 5FZIA 4OHVA 3U0ZA 5KHHA 2ZBJA 1ZBA3 4H7MA 1DGWX 2D98A 2VTFA 1VR3A 3V0AA 4KQ7A 4HETA 5FY8A 4QKFA 2JKBA 4XCAA 5FYSA 4OULA 2XVLA 3FL7A 1LAJA 4NHKA 4LE4A 3WF2A 4MH0E 1FPN3 1H2NA 4RQPB 2X05A 3IDCB 2Y6JA 2A75A 3FX3A 1HB2A 4D7YA 1UZVA 1RUH3 1UKGA 4A42A 3LOBA 1X82A 2OA2A 4ES9A 1NX9A 1W6NB 2EXIA 1BBT2 2ZCWA 4IETA 4AFAA 1US3A 1IKPA 2ZGNA 3B7MA 4K9SA 1A6CA 1AL22 5D21A 4XHBA 4BZ4A 3ZN4A 3CJIA 1A78A 2HWF2 3LEIA 5CB7A 5FYYA 5J48A 1V0AA 2QUOA 3ZPYA 4N43A 4Q4Y1 3RQ0A 2BWAA 4HZFA 4BPZA 4I2OA 4YVWA 1FYUA 1C3HA 1X7NA 1W9FA 1WW5A 2A7AA 3GCWA 2JDNA 5D1IA 3ZYBA 1S2KA 3MEPA 2GP3A 2WN3A 1R091 2VNVA 4YW7A 3NNFA 2P1BA 1VBE1 4QPWA 1WMEA 2YPDA 4MGSA 4S2FA 1OQ1A 1SBFA 2RS33 3JCIA 5K0UB 4KWLA 1VBB2 2UY8A 3H8UA 4TYSA 2VNOA 4TTGA 1SCSA 3VKOA 1VMFA 3A4UA 1NZCA 3AVSA 1MS0A 1ND3C 5FO7B 5FPLA 3AKPA 2XJQA 3O1RA 3BOWA 3MIBA 4XUNA 1F9KA 4CEYB 2XUEA 4EE2A 4UOJA 2EXHA 3KM5A 3KSCA 3IMMA 4R9AA 4OI1A 4RHV3 4CDUC 3O1SA 1LCLA 3S0MA 3WP3A 1R093 1MS4A 1GU3A 2BYVE 2NMNA 2BFUS 3CKHA 4JAAA 1PX3A 4W6YA 1SDDB 4XF3A 2W3JA 4E27A 4AFMA 4ITCA 3GBFA 2ZGLA 1VE0A 1QJY1 1MS3A 4LBOA 1KGYA 3ES4A 1FI2A 1POV1 2DVDA 4CP9A 1HLCA 1QJX1 3OGJA 3LPGA 4BXSV 4FQZA 2BNOA 4QKNA 3NV4A 4R9CA 2V5DA 2YBKA 2DCKA 4QB1A 5I0UA 4HMZA 2FDKA 3PHMA 3WW1A 3S57A 3RZZA 1HQWA 4XEZA 2UWAA 1RINA 2MHFA 3APBA 1AVBA 1N3OA 4I09A 5FY4A 2K46A 5A3TA 4MGYE 1QJY3 2BGPA 2J1EA 1NE4A 4LTAA 2XUMA 3FJSA 2X53S 4MX3A 1ZYBA 1W2UA 1QJX3 2JB4A 3ZFFC 2CGOA 1Q8SA 1JUHA 2RG4A 1HRI3 5FOBB 2HBTA 2CAUA 3KV5A 3M2MA 4E8DA 2XQXA 4ES8A 3LIHA 2HKXA 2Y60A 4KU7A 1AUYA 4JKLA 4RD7A 4Z07A 5ABJC 1MVQA 4IE5A 3AKTA 3ORJA 4LXLA 3ZFGA 1CGPA 1PO22 1CONA 1JYXA 2KA3A 1ASJ1 5A7PA 2WN2A 3LD8A 3FLRA 4NPMA 2DU1A 1W9TA 1Y7BA 2EA7A 1XQNA 3VBUC 1OLMA 5HV0A 1WMXA 2KM2A 2PHUA 4L9BA 1A3KA 2RR12 3DGTA 4LLOA 2Q8CA 5JXJA 2C9KA 1DYOA 4S2HA 4H7LA 4QPYA 1S55A 2XJTA 5FP3A 2CDOA 5BV6A 5KBFA 1UMHA 2RJKA 2FDHA 3HAGA 1AR71 3I2DA 5JXIA 1ZRFA 2P3IA 1MZ6A 3AJYA 3N7LA 1SPPA 2ZEXA 3POFA 4GH4A 1CIYA 4KL1A 4MO3M 5FY9A 1YQ2A 4Q1RA 5JIUA 2JG8B 1DQ2A 1W2TA 3JBG3 1W9SA 2VZPA 1LOAA 4FOQA 3H1WA 2JD9A 4ONUA 4YW5A 5IK8A 3FLTA 1XSRA 3I3QA 4UXAA 4AVCA 5IUQA 2PXJA 3LQCA 2GC3A 4MXWA 1LU2A 1NCQC 1CZSA 5EWSA 1FMD1 1RYYA 2YYOA 4HFSA 4YW6A 2D43A 3U07A 2WNUB 3N7JA 1L7QA 1VRH1 1H6XA 2HLEA 3R4SA 2ZEYA 4XDPA 3RSJA 4MVTA 3LA2A 3P1IA 1W6OB 5GZCA 1V00A 4DNYA 4K8FA 2OQ6A 3AXDA 4ZZ5A 5FK8A 4MGIE 3VDAA 1O3TA 3WLUA 4K20A 1UOBA 4AL9A 5D8AC 4JGZC 1GZWB 1H2MA 4PT6A 4X8NA 5JVVA 2WLQA 4DEQA 4ET7A 1FMD3 3BU7A 4H3WA 5DN2A 1ND2C 5C6CA 4W6XA 1KDKA 3KHCA 1XOYA 4IXLA 2QDRA 1NLSA 3HPNA 2JDYA 3D8CA 3ECQA 4KNCA 5FWEA 3RYPA 2V5YA 5EYYA 1XXNA 3SC7X 5F9TA 2VUAA 1WLDA 4N9HA 1O4YA 2B46X 3LZZA 1LULA 2ZX0A 5EHDA 4XDOA 4DINB 2RJLA 3I3DA 1I5ZA 5CADA 4BQXA 1PIV2 4QU2A 1RUE2 2C24A 5FZ4A 1HN0A 4MZUA 3S7IA 4AFDA 1Y9QA 1ENSA 4GWJA 3UESA 4F7ZA 1RUD1 3MO4A 5JOXA 3P6BA 2MEV2 4LOTA 4MV2A 1YUDA 2RMU3 4XQ4A 2HWD2 3N7KA 4NOTA 3WNNA 3T2PA 2ORXA 4EJRA 3SH4A 5AFBA 1YFYA 1DQ5A 3H8XA 4BISA 1BQPA 3E5QA 3WDVA 2Z42A 4B7EA 4NIDA 4D7SA 3PUQA 3RWNA 2E6VA 2V73A 5A3OA 3POWA 3ZXKA 4Y4RA 2Y33A 5A33A 5FZ0A 3T2TA 3PIJA 4AGGA 1COV3 2OUJA 2VQUA 4CU7A 4B3NA 5CFCB 3SH5A 1MQTB 4YZ5A 1GWKA 4M3CF 1CAWA 4OHXA 1F4AA 3ABZA 3OCPA 3E6DA 2GC2A 2GP5A 4HG6B 4XFHA 1HIXA 3DL3A 2X29A 3HEIA 2VJXA 1BK0A 5H9QA 2JKXA 3SKVA 2ZKNA 1QU0A 4KWJA 1KRIA 4XFBA 3UGHA 5LK7B 4XACA 1OQEA 5DXDA 4L92A 2XOMA 5CA6A 1AR92 1D7PM 3TEWA 2D97A 3TEZA 1ZRCA 1YXWA 2QFEA 3D0SA 1U12A 3O14A 5FZDA 3WV6A 1ND3A 4FO9A 1OLME 1NZIA 3LPFA 4IV3B 1HW5A 5IHRA 1GP5A 3MYXA 4ORFA 5JR7B 4AEMA 1B35B 3T2OA 1DG6A 1DHKB 2PMWB 3OG2A 5I0DA 5C9AB 3POBA 5EQUA 2D5HA 3AFGA 5DUWA 1GUIA 3DPRB 5GLVA 3W5MA 2HWE2 3BB6A 2JWPA 5IW0A 3TB0A 2BPA2 5FY0A 3WP6A 2HEVF 4FAGA 1NKGA 2DU0A 4BQWA 3OPTA 3KT7A 2KD7A 1S0IA 3LB9A 1Q8PA 4NPLA 5LA2A 2GC1A 2QDNA 1ENQA 1UMIA 2Q1ZB 4B8EA 4AEJA 1F15A 1NY71 2D6PA 4Y1XA 3WUCA 4AEKA 5LW9A 2WQ4A 3Q8BA 1QQP2 1V6OA 2GMEA 1BXHA 4Y5TA 3S5QA 3JQWA 2FCUA 3VBRC 1LOCA 3DEMA 3H8OA 1U0AA 2DUOA 3ZFFA 3UYJA 4QX5A 4QPIB 4FP2A 4FSJA 2Y6GA 2YY1A 1D4M2 3WCRA 4YVSC 2VZVA 1QNWA 4XJAA 5F5CA 2WJSA 5ABJA 2C9AA 4GD4A 2K9ZA 1RUI3 4IEOA 4M4PA 1H9WA 4QGLA 1W39A 3O5SA 4INDA 1HB3A 5A7OA 4QKBA 3WG2A 4AGRA 5I0RA 2IXKA 3I3EA 3TNPB 4Z92B 1H1AA 2WFF3 1FPN2 1U5IA 1PK6B 4W8JA 2EIDA 5CZKA 5EJ1B 2YFZA 1WMFA 4XQWA 4HOOA 4MYEA 1R083 2VD7A 4ZU4A 4QGMA 3O12A 4GKXA 1PGL1 1H30A 1YQ6A 3O0WA 5A6ZA 5I0SA 4EWEA 5DZFA 2ZGOA 2J1VA 4AI0A 4HKOA 3U14A 3I7DA 1I5PA 2W94A 3I2GA 4G4FA 4MOAA 2WSUA 3SH3A 3AP9A 3L9JT 1F5FA 4OI2A 1ZZ7A 3PJQA 3QLQA 5AFEA 3WP5A 3HQRA 4WM7B 1GFF2 2B5HA 4XFCA 3GZTB 1APNA 4MGZE 1NCQA 1QJFA 5GZEA 1SLLA 4QDSA 4E2QA 5A1FA 2WAOA 2VZSA 4YFWA 1U5YA 3QD6A 4BE3A 5JDBA 1CVNA 3OY8A 4Q1PA 4YGEA 3CLPA 1C5HA 4FPFA 1QGLA 3FFZA 4XBQA 3FE5A 5FYMA 3RGBA 2A6ZA 4D7TA 1BCXA 3ZIXA 3DN7A 2VW1A 2RS32 4A7KA 1CJPA 4XJWA 3BN6A 2VO5A 3NVCA 5FDBA 2VMGA 2YG0A 2R073 2ZA9A 3VDDB 2ADEA 4A7YA 4BIOA 4C90A 4OFGA 4JGZA 5HCBA 3SXWA 2X5IB 2P6CA 3HN1A 1POV0 2B4KA 1SFYA 1ND2A 2A3WA 4XJ8A 1AX2A 1NE6A 5FYUA 4RHV2 4K1YA 1BHGA 1LGCA 3B3QE 2JDHA 1R092 3ME2A 4UBHA 4YLZA 3T1LA 3Q9OA 4XDQA 1AL23 1HQNA 5DAXA 1VBE2 5F5AA 3NJXA 3VDBA 2IXHA 1UIKA 4ZZ8A 4FFHA 2DCZA 5KXEA 3NNJA 1W8FA 3RVHA 1XSQA 4XTPA 1YI9A 1TMF3 3LA7A 4N53C 2H0BA 2RE9A 2XJPA 4JV4A 4AFCA 4ISRA 1VMJA 2XHKA 4XXPA 4C0HA 5I8TA 1WLWA 5FBJA 4CYDA 3VUOA 1H0BA 3B00A 5EZWA 2P6HA 3LOIA 4RQPC 4ZU5A 2QZ2A 3J8F3 1XC6A 5GM0A 1KS4A 1WWYA 5FYVA 3ALQA 4GMP1 2HYXA 5J7MA 4AVAA 4KWUA 3AP5A 1JUIA 1QJY2 3GJBA 2ZGMA 3AMPA 5FQ0B 2CGPA 1KFXL 1POQA 2XL7A 5FZ9A 2HWB1 1S4CA 2OXBA 3JUUA 3O1TA 2AREA 3KT1A 1FV2A 3M8LA 3MLJA 3MZHA 1QJX2 4AHWA 4COZA 4B4RA 1L3JA 1RUJ3 1HRI2 2BU9A 5A80A 2A70A 4JZRA 3TYJA 1CJDA 1O4ZA 3RS6A 3QACA 1VBA1 3OUHA 3P3NA 4IGQA 5IVYA 4CPBA 5IVJA 2BUKA 2WT1A 2WINB 5FZAA 5IAVA 3M3EA 5ANQA 4BMEA 4FTEA 1RUOA 1PVC1 1ZBE1 2CGNA 2HWB3 4Q4W1 1YHFA 1NA1B 4AQSA 1OC1A 4B7KA 5BNOB 5FUIA 1H4HA 3IDAA 3KD4A 1MR5A 4KGGA 2C1FA 2OKXA 4KG0A 5K9YA 1W6MA 1REEA 3ES1A 3IKWA 2YZ4A 4CCDA 4JRAA 3CZUA 3H7YA 4F8AA 1UKRA 1LGBA 3MGUA 3WDWA 1QWRA 4RL7A 3E6CC 4CTEA 5KHIA 1IG3A 4Q8KA 1ASJ2 3JBG2 4N8MA 1J1TA 1GQHA 2BGOA 3GZEA 4I0AA 4I0BA 5HCFA 3RMXA 3NL1A 1FNZA 5DUVA 1NXD1 3ACHA 1TME1 1UZZA 4URAA 3WDTA 4XAEA 3RI8A 4L97A 3O1PA 4BM8A 1ODMA 2DVGA 1AR72 1QXJA 2OUHA 2PFWA 5FIXA 2XWBB 1UX6A 2FD8A 4AVVA 1PNGA 2VH9A 3EJKA 4DXSA 2JENA 2W47A 1GP6A 2E31A 1DGRN 4YG6A 1ULGA 4R9BA 5L7OC 1JU4A 4FOVA 4FOYA 1ZVFA 2QQWA 1QEXA 1RB8G 5E88A 3BGAA 1ZRDA 2XKPA 4IEPA 4YZ1A 1FMD2 5FMDA 1W06A 4BQ3A 3FC0A 5JMOA 4NAOA 2XWJB 1OA2A 3ZYHA 1JYWA 4SBVA 4CDQB 2VC9A 1FOD3 1DQ0A 5FY5A 5J1XA 4KU8A 1J84A 3CJIC 4UFKA 4AXOA 5IATA 4JTNA 1WZXA 1BK1A 1NLRA 3U37A 1K3IA 3MUY1 3VBRA 3VB9A 4KI5M 1GLHA 4N43C 4LLFA 2JDKA 3ZFEB 3NO8A 4O9GA 3BVCA 2PAEA 5B4XA 4QX8A 3RYRA 5HPOA 3GZUC 1AYN3 3E6BA 5C8CB 5LRSA 4ASKA 4YVSA 3HNBM 2YMZA 3KCYA 3H9AA 4NAMA 1CAUB 3MF6A 1C8M1 5LBEA 4Q26A 4QHOA 4QD2A 3T08A 1A8MA 1KFUL 3LIGA 3K4AA 4LK6A 4LT5A 1N3QA 1W2OA 1TQ5A 1XJAA 1ZZ9A 1H2KA 2XBO3 2Z2SB 3SHRA 5C3RA 3O1MA 1BEV1 1X8MA 2GN3A 4JDOA 2BTVC 2P17A 3ACLA 1H2LA 2DWRA 4FOWA 1UMZA 3K3OA 2I07B 1I1EA 1Z7S1 3IB3A 2FZ1A 1X9PA 2NP0A 5FZ3A 2W52A 4HPKB 4NRQA 3S30A 4XFAA 1S0EA 1N3PA 3NAPB 5D2AA 5LY2A 4BK4A 5JR2A 5FP8A 4KG8A 3AP4A 4LBMA 1JYVA 1N1TA 1BEV3 2W39A 2WNVB 2ZTNA 4FPJA 4LR4A 3A7QA 2VL4A 2BGCA 1DYPA 4Z2WA 3HBKA 2ZGUA 1G9DA 2ZEWA 3WNMA 2UWCA 4N7UA 2O1QA 1YC61 3H3ZA 2C5DA 4QB2A 3U10A 5C4WA 1LGNA 1PO11 1WMDA 4CDWB 5FZCA 1UOJA 2Y6FA 4CDXB 2XQRA 1OD3A 2E63A 4QU1A 4URTA 2FMDA 5FR3A 5LA9A 3WT3A 1EUUA 1WCDJ 4R8HA 2EICA 4D94A 5ANNA 5LBFA 4YZ4A 2Q8OA 4AI3A 2E7AA 2PHWA 5E1RA 4OUMA 3N9PA 1EPZA 4OLLA 4DFSA 4ZXEA 5A6YA 1LHUA 2B8MA 2W95A 2ZHMA 3K4DA 1PO13 1OOPC 1AF9A 3P3PA 2FDJA 3WINE 1BJQA 1HV1A 3WW3A 4YGCA 3BTYA 4JX0A 2WUHA 2ADDA 3AL6A 1RXGA 1OFSA 1D0GA 4JGYB 1R1ZA 1AR61 4OHWA 3MW4A 4N53A 4I30A 3T1MA 3ZLIA 1D4VB 1RITA 3IWZA 1S0FA 2ET7A 1W8HA 1SEFA 1RIRA 3WNOA 4E4ZA 1DZRA 2ZHNA 5A6QA 4LK7A 3ZOIA 4RQPA 1GMMA 2YC2A 3O0VA 3NV3A 1YYNA 3CL1A 1O7FA 3VHNA 3OEAA 2BW8A 1QNYA 3HQXA 5BNPB 4QQ2A 3U75A 3GHNA 2Y38A 3A0NA 1XYPA 2ZMNA 4PDWB 2PLV1 3D0JA 3MIGA 4GJYA 5LWBA 2WWUA 4OMDA 3OBRA 4EQVA 2XJUA 4NRMA 5EIYB 1S0CA 1T2XA 2WA4A 3OPZA 3ZYPA 3ZYJB 4HK8A 4WVMB 1H6YA 3WDUA 4BYYA 2VZQA 5FPVA 1A34A 1RUI2 2R30A 3V64A 2Y8KA 2EXJA 4LKDA 4EWDA 5IVCA 4O65A 2PLV3 2WFF2 4J1XA 3ZKUA 5DUXA 4W50A 3WVJA 5K0UA 5BNNB 5KHJA 2XJRA 4P9LA 3ZXDA 4IV1C 1YJKA 4QX3A 2HWC3 5FY1A 1OUSA 5A32B 2VCMA 5AVPA 4NJ4A 3TN93 4CCNA 2X10A 1R082 5J98B 4NR1A 1QHDA 3PU3A 4JKKA 2JXAA 2C4XA 1GNZA 2UY9A 3PNAA 4BXFA 5EJ3A 4Q27A 4IV3C 2IXIA 4LHKA 5FXXA 4AHYA 3N9NA 1KXGA 1XNKA 1RVF1 3AM2A 4DUVA 5CYYA 4YW3A 5FO8B 4Y3OA 3B01A 4LA2A 4COWA 4KWKA 4V1PA 3BI3A 4ZS2A 3C3VA 5FPZA 2UURA 3QCWA 4MHRA 4ASLA 2A71A 1D4M3 2CL2A 5FZLA 3VD7A 1ZZBA 3VL9A 1JOJA 1REFA 3T30A 1EPWA 4NN0A 3LKJA 5BYNA 2VZ1A 3V0BB 1ONAA 2AZ5A 1RVF3 2DVAA 1NCRC 2XVKA 3MPPG 4FT8A 4FPYA 2NLRA 4NUBA 1CR7A 4PJYA 3C7EA 1Q3EA 3LDBA 3LEGA 3VHPA 2R072 5L7OA 3EYPA 3CHXA 4XUOA 3KQRA 4F83A 1ZREA 1OF3A 3K77A 3LA3A 4FFIA 1BMV1 4BLJA 3CDZB 3VBOB 4P5HA 4XBLA 2Z5WA 5JMCA 2R6QA 3VBSC 2IVJA 2Q0AA 3AP6A 3UK9A 4OI0A 1T6GC 3JB4C 3WQ7A 1YFUA 3LEKA 1SZBA 4LO7A 5FZFA 3POJA 1LOFC 4DOUA 4GMP0 5A3NA 1NOVA 3KGLA 2BDRA 1VIWB 3N4MA 1OQDA 5DAWA 1J3QA 1OLRA 1TMF2 3ZKYA 5CISA 2JE8A 2RS51 4ARYA 5EP9A 1D2QA 2RM21 1KEXA 4JC1A 1EYBA 1O5LA 4Y4YA 4DEVA 5FPUA 2ZGQA 4JRLA 4XBNA 1JN2P 1N1VA 2FQPA 1YI7A 2Y6KA 2JDUA 1Z78A 3J8F2 4HONA 4QXHA 5K8SA 1O3SA 5J09A 4LNVA 3OYWB 2ZX2A 1T6BX 1IPJA 2ET1A 2O8QA 1QJEA 3KMHA 1XNTA 1ULDA 2K2SA 2VQTA 4QGNA 1XPWA 4S2DA 3ZN6B 2BJSA 2GC0A 4BOWA 2VQAA 5T54A 1CAXA 2EIGA 2ZJCA 4Q4Y3 2RS53 4QXCA 3UT0A 1Y9GA 2Q30A 5C7GA 3M4FA 5ACA1 2RM23 3JD71 4B1LA 4RS5C 2HEYF 5FUNA 1RUJ2 3PUIA 4FI9A 2LUWA 1SLIA 2RHPA 3CZJA 1WCKA 4JTOA 5FZMA 2RVAA 2V4AA 1VBE3 2H0VA 1P8JA 3HJRA 5HI0A 2W91A 3ZSEA 5LA1A 1DZTA 1SLTA 5FJKA 4FTSA 4IEWA 4BQ1A 4RGKA 5JCTA 5EYXA 2CTVA 3RRDA 2HWB2 3DUIA 1JODA 2RDNA 5ACA3 3E5UA 3WUDA 1Q43A 1H4GA 2C6SA 3F2ZA 4LHNA 3VBFB 3I59A 1F2NA 1HKDA 2YU2A 2ZGTA 1JYCA 2HYKA 2QKDA 3ZXFA 1YO8A 1GZWA 4MXVA 4G9SB 1GOGA 3A22A 4AI9A 3FBYA 4WVWA 2Y34A 1W9WA 4XABA 3T0AA 1JTZX 4OMCA 3NV1A 4UF0A 1CQ9A 1PVC2 1ZBE2 1POV3 2AEZA 2XXZA 1K5MB 1IPSA 3AMHA 1JZ6A 1AR81 4LKEA 5GLTA 4KBZA 2DFBA 2ZHLA 1EV11 4OQ8A 3Q8FA 3AC0A 3GBWA 1DFQA 1WW6A 1OOPA 3IPVA 3PJYA 5CIRA 3V0AB 3LFMA 5CAZA 1JXNA 2D93A 2W1WA 2P5BA 3NKTA 4HKLA 2FMYA 4YZ3A 5FXWA 3WNKA 4AW7A 4CP1A 2W0XA 3J7NA 2CDPA 5FZEA 2JDMA 2NPIA 3J7LA 1CX4A 3BIWE 5HXMA 5FXZA 4HLTA 5J36A 3K75B 1ZZ8A 2VQ0A 4TSVA 2PHTA 4UBGA 1AR83 2VZTA 3VZOA 3VZKA 2OQ7A 3CEWA 3EMRA 1VMHA 2BVVA 4PBOA 3MV01 1JYTA 4D0QA 4HXCA 2J22A 4NIGA 4B29A 1C1LA 1DZQA 1RUF1 1UXZA 5HCHA 5CKMA 4LBLA 2VG9A 2QQJA 4LBKA 1CX1A 1FOD2 1IS4A 3W5NA 1ASJ3 2RDRA 3GZAA 2DTYA 3TNQA 5KC5A 3B69A 1M06G 2GNMA 1UW8A 5I8SA 1B09A 1MQTA 1Y43B 4YVWB 1RMU1 2PHLA 1NXMA 2WQ8A 3BPSA 3TOJA 1PM7A 2VZUA 1AYN2 1O6UA 4A45A 1MZFA 1VPHA 3K2OA 5FLHA 2PN5A 1OH4A 1AR73 1PGW2 3AZWA 3M3IA 2RDQA 3ZN5A 1AX0A 3K46A 3THPA 1L7LA 2EALA 4S2GA 4MADA 2YHJA 5FJHA 2G9GA 2XBO2 4ZS3A 4PI0A 3PMSA 3J9SA 4X6QB 3ZXEA 1V6LA 2DFCA 4P9IA 2YBSA 1RMU3 2DDUA 4IV1A 1OI6A 3KB5A 1OVSA 1VP6A 4QXKA 2R041 2X8KA 4Q0VA 5DMYA 5K4LA 4IV3A 1PGSA 4FXKB 2OZ6A 4P9XA 1VRH3 3JZVA 4XUPA 2WQZC 2ZZQA 5C3QA 1W6PA 4YRDA 5A3MA 2CYFA 4DS0A 1BVP1 1NT0A 3DPRA 1BEV2 4NWWA 4RA0A 4XIKA 3T4VA 4D69A 2VZOA 5FXVA 5IWFA 5IVBA 3KCCA 4M3CA 4CA9A 1SG3A 4CXXA 3ZYGA 3EB7A 4GJZA 4UT5A 1UU5A 3C2UA 3JXSA 4FPGA 2A73B 3THTA 3URFA 2AACA 4AE2A 3OBAA 1GR3A 3UETA 3HT1A 3N9LA 4OI4A 2NYYA 4EN7B 1NCRA 2AGSA 1H1MA 3DCQA 1DQ4A 1LOEA 1OUXA 2PAKA 3D5OA 4UFJA 5T55A 4QQPA 2DUQA 2JG9C 3M1HA 4YSFA 2VVEA 1GANA 1O59A 2EAKA 2VPVA 2C26A 5FLIA 4CRQA 2DBNA 3MW3A 3WOGA 4JCKA 1RUD3 1PO12 1H8TC 2W08A 1E5SA 4QPIA 3VBSA 4DB5A 1IHMA 3ZFGB 1PVXA 2GMPA 2GU9A 4YNIA 4D6QA 1LOFA 3QBQA 3J7HA 2OX0A 5FMOL 1LHWA 2ZHKA 5JIAA 5BUVA 3WD5A 3HR9A 5FK7A 3WY6A 5FYZA 1WD3A 1OFNA 4A3ZA 2WO1A 1PM4A 3MLLA 5C3PA 4AG4A 1XB9A 2WABA 1SPPB 5GZFA 1JMUB 5JI7A 2FBEA 4W4ZA 4LA3A 3LSEA 5F3EA 3AB0A 1D0HA 2HBUA 4HSJA 3LFIA 3FZ3A 3NRUA 3NJYA 4AQ6A 3B9CA 4XFGA 4AAXA 2HJIA 3T0DA 5I0TA 4MXWB 4Y26A 4XAAA 2NM1A 2EF6A 2VBDA 4RS5A 5A7QA 4BB3A 2AC1A 3N7MA 4E4SA 5BY5A 1WA6X 2B42B 4O9EA 2AYHA 5JAXA 2Y6HA 4RSUA 1LOBA 3DF0A 5F1RA 1W9YA 2WO2A 1HXS1 1ZM1A 1PMIA 4XW3A 1SCRA 3MBWA 3I2HA 3C7GA 4EYUA 1QXPA 4YARA 2CV6A 2VZ3A 4IE4A 1RUC1 2PLV2 5F37A 4HN0A 4XC9A 2P4EA 1F5JA 4PF5A 1IQDC 1MS9A 4LKFA 4UFMA 1W3VA 4TWTA 2HWC2 4IW3A 1GWLA 3TN92 2ZGSA 1W99A 4PQ9A 3VDDA 3ZXLA 5H9SA 1SACA 1AL0G 1AYM1 3KV9A 4OUSA 5T5OA 3IT8A 2W1UA 4GALA 1HXS3 2Q5TA 2B9VA 1HJFA 3HWJA 5T5LA 3R05A 3NW4A 4YM2A 4M0HA 5FYCA 4Z1VA 1RUC3 2J42A 3H50A 1V6IA 2B9UA 2QQKA 3K4ZA 5EPAA 4CU8A 2ZMKA 5A7WA 1ULOA 2Y26A 1OA3A 2YV8A 5CNAA 5HXVA 3SEPA 1UCXA 4LE3A 1VB2A 4QWNA 5IK4A 2ZMLA 3JQXA 4Z2AA 1AYM3 3PU8A 3ZR6A 5B4NA 1V6KA 1W90A 2R061 4HK9A 4WVZA 5I8YA 4U36A 5JSPA 1G9AA 3CQOA 4QB6A 5F32A 2WS91 1IQAA 1RVF2 2FHRA 3O0XA 3PUSA 2XVGA 5T50A 3C7OA 2GMMA 1HN1A 2WZR1 4ZY9A 2YB7A 4LUKA 1KS5A 4MG2A 3HD8B 5FQ0A 1SMVA 4CUCA 4Y5SA 4M3CE 5C70A 4PDWC 3FMGA 1X36A 2LTNA 4CUBA 1XBFA 1SBEA 2QQLA 5A33B 1LHNA 2J1SA 4Z8BA 3VBHC 2R063 5CU1A 4DQAA 1EY2A 4CEWC 2VCBA 5LZ6A 4YW2A 2WS93 1NYWA 2J1TA 1CAWB 1CD3G 1XNBA 2DCTA 4NHXA 4FPOB 2D6MA 1S1AA 3PUAA 2WZR3 2IFWA 2P3YA 3IBMA 2XLFA 4Q0UA 3QOPA 4XXAA 5FPAA 3KV6A 3H0OA 2WIIB 4ZONA 1JZ4A 1YJLA 4KGQA 1D2SA 3LF7A 1LECA 1SFPA 5HBAA 5FAXA 3I49A 1BMV2 3WNLA 1URXA 2VUDA 3W21A 4XUTA 4CCOA 5C4WC 1C57A 1G9FA 1O4TA 2JICA 1UY2A 5JZGC 4E2SA 4AR2A 3SEEA 2VMDA 2W9XA 1GOHA 5FUPA 4CXWA 5C3OA 3ZDVA 4BJ0A 5KHKA 2P2KA 4Y22A 1NUKA 1ND3B 2IWGB 4Q4Y2 2QE3A 2RS52 4COVA 3PMEA 1WW4A 2RM22 4OQ9A 4C0BA 4CDUB 3VD9A 3IIAA 1R1A1 4RR3C 4AZZA 3RNSA 3TEYA 4L2NA 5LBCA 3DXUA 4QKDA 3CJXA 2D6OX 2E9QA 4YW4A 2QTWB 4WM8C 1GICA 4CCMA 3MF9A 1SLBA 5IYYA 5A7NA 5FZOA 3VD3A 1DP0A 2D6NA 3GALA 5FY7A 2VM9A 3KHBA 3USUA 1LOGA 1W05A 2O14A 4B4QA 2J1UA 1UY3A 2A6XA 1S0JA 1JBCA 1W6QA 4NRPA 4AHXA 1UPIA 5ACA2 3INAA 1PHMA 2PA7A 2VMCA 2PHXA 1R1A3 4B1MA 2LM3A 4W6WA 4A4AA 5E89A 2VULA 2Y6LA 1EAH1 1UIJA 1DDLA 2E53A 3EBRA 1OXCA 3ZDSA 5ISLA 4FPLA 2VOTA 3VBOC 4BU2A 4HKWA 3ELNA 5F39A 3ACFA 1CPNA 3A23A 2YUEA 2ETEA 1C4RA 2WYSA 3OGGA 1QKQA 5F3IA 3ZFFB 2DVFA 4Y20A 2JG9A 1WD4A 1TNRA 3RDIA 1J1LA 5C3SA 5I93A 5DAVA 2WZEA 1W2NA 4BQYA 1H8TA 3KGZA 5BXXA 2CNAA 1GV9A 5ABJB 1EAH3 1YIFA 3BALA 4GMP3 2X09A 1RUG1 1VALA 4YYOA 1UZWA 4XMAA 2MNGA 2QVSB 1UOFA 4RGGA 1CAUA 1XYNA 3VBUB 5KXBA 3O1UA 3AYEA 3WG4A 2OW4A 2O8OA 5FP4A 5K0UC 4PIYA 1AR82 2W1SA 1K12A 1G6NA 2VW2A 4J1WA 3WF0A 3SITA 3MIDA 1UQXA 1VBA3 4HANA 5FKCA 1W8OA 4DUWA 4META 5FYBA 5J3UA 4CEYC 2IXCA 5F6KA 3OOXA 4HVQA 3U1XA 3SNMA 3B94A 5FYTA 3R6SA 4C1WA 4BLIA 4LIVA 3KV4A 1S0GA 4EWAA 3GM8A 1PVC3 1ZBE3 4Q4W3 5FV3A 1LB2A 3PLQA 2YC0A 4XJUA 4A6SA 1UOGA 2WFPA 3IZOA 2ZX3A 1QOTA 1I6XA 1NCQB 5DG1A 2GH8A 4LO6B 4J6GA 2GSYA 4XZUG 3OY8B 4ISQA 1CZTA 4O7XA 3OUIA 4QX7A 2HH9A 5ERLA 4P14A 1IS6A 1MZ5A 5FP9A 3LDKA 4LOSA 3FFQA 1DYKA 1KJRA 2ORZA 4RFT0 3RZJA 4FFFA 2WA3A 5D8AB 4JGZB 5A70A 4CE8A 2FCVA 2XJSA 4WZCA 1IKQA 1RMU2 2QQIA 5SV5A 5KHGA 1TME3 1ND2B 1ZZCA 1ACCA 3WX5A 2RR11 3POIA 2UWBA 1JOBA 4AGVA 1AX1A 3LEMA 4TN7A 3SCGA 2BERA 2Q8EA 1ST8A 5L73A 1W2AX 3WHUA 1VRH2 2QCSB 2IVIB 5FZ7A 3BIEA 5APAA 1DQ6A 4GKYA 1IS5A 2WYFA 3POYA 2E51A 3KZ4C 4UAPA 3BTXA 1N1YA 2R16A 1DGWA 2OZJA 2PYTA 1JYIA 1XE8A 3Q8EA 4F3JA 5FOJB 3HIFA 5A3UA 2RS11 2PHDA 2VE1A 5IJRA 3ZXAC 2A1XA 2GNBA 2WSVA 4GZ9A 3RZKA 1KDMA 5FO9B 4XZPA 4O61A 4UFHA 1C1FA 1S2EA 2QBXA 3CMGA 3RZHA 4COYA 4IEVA 1ZRIA 5LRRA 2UU8A 4DXZA 2JG8C 4V2VA 3FN9A 4JHZA 4DIQA 1Q8OA 5GZGA 1OURA 2RS13 4PDWA 1LTEA 4XFFA 3FHIB 4OYUA 1C8M3 1RUD2 2K0GA 3VBHA 2VBPA 2VY0A 4CEWA 1JYNA 4WVMA 1GNYA 2GNDA 5C5UA 4FP3A 1STMA 2QQNA 2YXSA 5TSWA 3MIEA 4JVAA 4AOCA 4BCUA 5L36A 1I9RA 2WNUC 3HOBA 2BRTA 2J1RA 4CUGA 2P3KA 1VBD1 2ZOEB 4R9DA 4HN1A 5F3GA 3TBDA 4X6RB 1Z7S3 1W6MB 2ZXQA 2R49A 4GIQA 4P9JA 3WQ0A 3RJ2X 1IGOA 1WLCA 2XLGA 2SBAA 2A6YA 5A32A 1BYHA 5JZGA 1Y9MA 3OSDA 2DVBA 1LENA 1LHOA 3VLBB 3ASIA 1XU2A 2G1MA 3AKSA 1EUTA 2HWD1 4XVHA 1VBD3 2A6WA 5FP7A 2YDEA 1V6JA 2BVBA 3VL8A 1HQLA 1MEC1 2VAUA 3GGLA 5T5JA 2NN8A 5A3LA 4RR3A 2C0ZA 2Q1FA 4AEDB 2VU9A 1OKQA 4WM8A 3J7MA 4SLIA 1C8NA 1O91A 3WZ1A 2CWMA 1UN1A 2VVDA 2SLIA 1I3HA 2P37A 3R4DB 4QAWA 3AZVA 3N9OA 2Y64A 2TUNA 4UW5A 3V0BA 1GYKA 1UYZA 3M70A 1UPSA 3NNLA 5AC91 4QHBA 1BZWA 1SDWA 3IDEA 3L2HA 3MV11 3WW4A 2IXJA 2QNKA 1KITA 3PIGA 3VHOA 2PHRA 4M4RA 3PTRB 1UY4A 1TVGA 2Z4FA 4JQRA 5T5PA 4CPBD 1RL3A 1HXS2 1W6NA 3OUJA 3ZYIB 3H1MA 5H9RA 5BPXA 3VBOA 3WP4A 3IN9A 1ZA7A 3CNAA 3ZSMA 3VBRB 3QH6A 1K45A 2WWSA 4YGBA 1AR63 1RUC2 5FREA 3IAPA 5KC6A 3VD4A 1ULPA 3K48A 5AC93 1MQTC 5CFCC 4AVTA 3OB8A 4YVSB 3VZNA 5DAPA 1OA4A 4E4DX 1UU6A 4MHUA 4UYBA 1XRUA 3AP7A 2WC2A 2YFUA 5LY1A 1AYM2 2D6KA 5K7PA 4IEUA 1RHI1 4IUGA 2ERFA 5CFDB 4PLMA 5C8WA 1NY72 2L9LA 4AAPA 2VMFA 3I4IA 2F4PA 2VNGA 2DTWA 3W59A 3NMBA 2OIIA 3MHZA 4FPKA 5LEJA 1YLLA 4MGKE 4CU9A 5C5TA 2XHNA 3K51A 3LDRA 3B02A 2ZEZA 4XIOA 4V2WA 5IFPA 5HCAA 4AYUA 2G9ZA 2OT7A 1HRV1 4Q4X1 5AVAA 4LPLA 2JEMA 1ULCA 1RHI3 1KJLA 2R062 2XR4A 3KVBA 4IEYA 4CEYA 1B35C 2UYAA 1VAMA 3DYPA 2WS92 3NNMA 2LW8A 4G3YC 4NHLA 3ZYRA 2TNFA 4CVUA 5C9AC 1ZA4A 3N9QA 1DCSA 2KXLA 1W28A 3CO2A 1QQP1 3DPRC 2WZR2 4NPRA 4QXBA 2D44A 2FZ2A 1ZZ6A 3NV2A 4DO0A 1HRV3 1HX6A 1PGL2 2YROA 4K3UA 2XKOA 4QQHA 3RI9A 4OZOA 1W8TA 3GF6A 4LMFA 4UFIA 4E4HA 1ZBA1 3USSA 4R4ZA 2LROA 5FPXA 1QH7A 4YM3A 3RZLA 3VZJA 3VZMA 3I54A 3NKGA 2Y0IA 4MSVA 1VAVA 4XPVA 1FNYA 4AI1A 5A1AA 4LBQB 4UW4A 4XQDA 3AL5A 3H42B 1LKNA 4MGQA 5E6HA 4QMAA 5DG2A 1RUH1 5F6LB 2PQSA 3U11A 2VECA 3KLSA 4QPIC 3D3AA 1UY1A 4CSWA 1GOFA 2VOKA 4DPNA 1O8PA 5A1LA 1DGRA 5DZGA 4QPGB 3C8XA 3KF3A 3ACGA 2UYBA 1Y4WA 1V9U1 4K21A 4N53B 3VN4A 1J59A 2LALA 3FBMA 5IK7A 1W8WA 3RG0A 1QMJA 4AVBA 1R1A2 3BOPA 1PK6C 3AZZA 4QDRA 4DY5A 5F7UA 1LRHA 1SLCA 1GZCA 2TBVA 5T52A 2BP6A 2D5FA 3LWCA 1O3QA 1G9BA 4OHYA 3AZYA 5L9VA 2VVFA 3WEZA 4GB31 4C1XA 1HB1A 1CAVB 2G9FA 2WRAA 4CCLA 2E33A 3BKZA 1RUNA 2CSGA 1V9U3 4HL0A 1L7RA 1NQDA 2F4LA 2RS31 3ILNA 4Y33A 3O1OA 3R4UA 3WXPA 2JG8A 4Y1VA 4WVVA 2WAAA 3MICA 3WCSA 3PVEA 1NG0A 1XE0A 2IC1A 4LO4B 4WM7C 3HMYA 4YWAA 3ZVXA 1VAKA 1EAH2 3OBZA 4RHV1 2Q4SA 5CBLA 2BV4A 4GB33 3SLIA 1JS9A 2ZS6B 4L0PA 1WW7A 4OVEA 2WNUA 4OCTA 2WLPA 2NQYA 2R0HA 3RMYA 4EROA 2BEOA 3V56A 2WKKA 1PMJX 2WBKA 3MUZ1 3JD73 2ZAAA 1W6OA 1AJKA 1DGLA 4LBQD 1QDCA 5A3PA 5FZBA 4MLOA 4GWMA 3FHQA 4PCRA 3VDDC 1VBA2 1PZ8A 3I3BA 4XCBA 2IZWA 1V6MA 4PBPA 2X5IC 1RUG2 3I2KA 1HB4A 2ZAHA 3K3NA 3KQ4B 4BIFA 2AENA 2BFUL 1K5JA 3H7JA 1R64A 1UNBA 4NO4A 3WF3A 4WZFA 5KXCA 4ATEA 3CF6E 1TZOA 4Q4W2 5BNQA 4H55A 4Q8LA 4TZDA 5LA0A 5C33A 1WGPA 2PELA 4NROA 3FWEA 3M3CA 3KCXA 4QX2A 1SHWB 2DCYA 5CKQA 2DV9A 1JZ7A 3VGIA 1HRI1 1BKZA 3OD4A 2JE9A 4GWIA 4A41A 4ARXA 5JSRA 3WF1A 3IIIA 3I2OA 4EZ4A 1SBDA 4Y1UA 4YZ2A 1AJOA 5JI9A 4KH9A 4HVRA 4CCKA 2YC4A 3E1F1 5DDJ1 5L7OB 1W8ZA 1GZ9A 2J1AA 2OS2A 3MW2A 2VBBA 4R52A 4P00B 5DZEA 3WDYA 3R0RA 2D7FA 2W92A 1TME2 3PDQA 4LBNA 2AEYA 1EV13 2GN7A 3MIHA 3PURA 4EV0A 3JU9A 5JPNB 1ZNPA 1QY4A 3UNPA 4IGOA 3IAQA 4QQOA 4LEJA 5IVFA 1AZDA 5FCCA 2WWJA 4LIUA 2A5ZA 2XONA 3CJIB 4BQ4A 3AVRA 2GH2A 1E5HA 5DDJ3 2VUCA 2EAAA 4N43B 4I0WB 3V65A 3ZXJA 2FDGA 5CFCA 3B5LB 5HV4A 4JHTA 2Q1MA 3JBG1 1ZX5A 2BBAA 3S7EA 1LU1A 4YG0A 4FPHA 1LEDA 5LEKA 1NA1C 3KT4A 5BNOC 1QOOA 1DU3D 1C5IA 1UX7A 1RUF3 3OGRA 3MFCA 2JE7A 1GZTA 4DUXA 3BTZA 1HV0A 3OJBA 3M7AA 3ZSLA 3G6JB 2JIGA 1MPXA 1CAXB 1V6NA 1FAYA 4OHZA 2RV9A 2W1QA 1K42A 4CXYA 4Y5Z0 3IM0A 2A3XA 5GALA 3Q8AA 1ALYA 2DURA 1WCUA 2RS12 3OPWA 3SCHA 1CWPA 1C8M2 1EP0A 3AK0A 2DCJA 4GULA 4DRVA 2OYZA 4E8CA 1B35A 1UXXX 4LBJA 4UI9L 3UGFA 3DKWA 4UW6A 5C9AA 2VGDA 2JDAA 4CP2A 3HN3A 4CP9B 5T3NA 5JLVA 5DUUA 1N47A 4LUMA 3OD0A 1S2BA 3I59B 4UFLA 2PTMA 4BA6A 4DMIA 1Z7S2 1PZ7A 4K8RB 2GNTA 1OVPA 2CWSA 3ZSJA 1MZEA 2R043 3HBZA 5JXHA 2ILMA 4OUEA 2WNEA 1TNFA 4XTMA 2G19A 4QQLA 4XUQA 5FLJA 4UF0B 3B93A 3CBNA 5DPNA 5G04L 4A3XA 1Q56A 4NE9A 4NMIA 2RMU1 2WO3A 4CDQC 4EN9B 1VBD2 3THDA 2OPWA 4BQ5A 4E2GA 3FUOA 3AZXA 3HNMA 4XF1A 1OMIA 5EFUA 4QX0A 2VXRA 2WO7A 4JQTA 1QH6A 3IPVB 1OOPB 4LKSA 3O1VA 2D6LX 3ZFEC 1QOSA 1XE7A 3WQBA 4IEXA 2DUPA 3ILFA 1S0DA 2P34A 3DKQA 1OHFA 4LITA 2WT2A 1PX4A 4FQ4A 5C8CC 1GBGA 3FLPA 3ST7A 1COV1 1JZ2A 5SV8A 2JD4A 5FMOS 1AXKA 1J3RA 4XOGA 4M0NA 3PVOA 3WSOA 5JXGA 4NIHA 5JUVA 1UZYA 2YU1A 1MEC2 3BYWA 3A21A 4FFGA 5FZKA 3WNPA 1PK6A 1LODA 1QJZA 3JB8A 4BK5A 1V70A 3RZMA 3H3UA 4GH4B 2CY6A 1WCSA 1YIPA 2R1BA 1W0PA 4ZHNA 1VLNA 4FCAA 3I2IA 3OTFA 4RYDA 5GZDA 4UWDA 3PVNA 3BTAA 3KF5A 2R1DA 3NAPC 3ETQA 1AR62 4LORA 3AYAA 1QJU1 3WG1A 1UWWA 2VCAA 4B4PA 5AC92 3WDXA 1JZ5A 1G8WA 5A6XA 4EN0A 2WNVC 1RTVA 2ARBA 4IGPA 4OZXA 3GBGA 3T2QA 4D6RA 4WM7A 5A3WA 4ZU7A 1PMHX 2I2SA 2YGMA 3GJAA 5F3CA 3X29B 4XETA 4Q29A 1JHNA 2IXLA 2EIEA 1JHJA 1XYOA 2I74A 2BWCA 5GLUA 1KD7A 3ZXGA 2H6BA 1RGSA 5F5QA 1WKYA 1OT5A 1W3XA 2XL9A 4CDWC 4CCCA 4DXTA 5L19A 4M00A 1Q8VA 4CDXC 2JECA 1VBC1 1QJU3 4IV1B 1YFWA 5A7SA 1JZ8A 4QHZA 2E7TA 3OGSA 3AX4A 2D40A 4WV8A 1JW6A 3RFRA 3FUQA 2VTXJ 5GJ6A 2QQVA 1UL9A 3IMNA 2ZZJA 1NLQA 2R0FA 3J26N 3ON7A 4IERA 4K7JA 4PLNA 4Q4V1 3UJQA 4CDUA 1X9TA 1RHI2 1E5RA 2X5IA 5F2SA 1W6PB 4AEDC 1YEWA 4PI2A 3ZO0B 2AUYA 2PQQA 4NIIA 2PAMA 3U4XA 1VBC3 5CKNA 1O5UA 5KWRA 3RZGA 4LULA 2WDBA 4M3CB 4XJZA 3ZYFA 2BOJA 3AMQA 4JGYC 1UYYA 4UW3A 2VNRA 3I2FA 1HRV2 2CU5A 4GQ7A 2Q8DA 4Q4V3 4Q4X2 1OH3A 2D3PA 2Z79A 2JIJA 3AKQA 2GALA 4XFIA 1NCRB 1WA4A 3AXEA 3KVAA 4GWNA 5LB6A 1LHVA 3UL2A 2ZGPA 4D6SA 4IEQA 1RUI1 1YQ5A 4YFZA 1PZ9A 5BNPC 4DZGA 3LAGA 1A8DA 3H1YA 5FYIA 2OPKA 2WFF1 2ZX1A 1DF0A 1QIQA 2TEPA 2XLAA 3VDCA 1S0BA 3AYCA 1YQCA 3VBSB 4TLFA 2Z69A 2VOXA 3NJZA 2ZKLA 1R081
chains in the Genus database with same CATH topology
1ZBA2 3IDBB 2B39A 3VKFC 5KXDA 1WBLA 4I3GA 4YG3A 3ENRA 4CZSA 3AMMA 1G9CA 1HDKA 5CFDC 1PNFA 3WW2A 3RPQA 3AYDA 1ENRA 2ARXA 3RYKA 3VBUA 3A0KA 1FATA 1ULFA 1W0OA 4AQTA 4QM9A 4PIXA 1NA1A 5BNNC 5BNOA 1RUH2 2CAVA 4I01A 3MFAA 3WR0A 4AI2A 1TEIA 4P9YA 5JOYA 1V9U2 1AXYA 4RS5B 2F6BA 1FV3A 2R071 1RJ7A 4FXGB 4JDMA 1YWKA 1FXZA 2BNMA 2DF7A 2BNNA 3ZX7A 4AK3A 2B45X 4AI8A 4N9IA 1BBT1 5FTTC 5JOZA 3ILRA 5GLZA 4ATFA 4GB32 1U5ZA 1AL21 1WUVA 3LSDA 4ZKTB 5H9PA 5EXOA 4YM1A 2HWF1 2WZPP 3BCWA 3JD72 1TMF1 2OVUA 2D3RA 4HSLA 5D8AA 3UJOA 1BBT3 2AH2A 1Q8QA 2QZ3A 4U2AA 5IK5A 3J8F1 4PLOA 3BODA 1LEMA 4FVVA 4AHZA 3EXUA 1FX5A 4CDQA 1J58A 3UKVA 1VBB1 5E16A 2ATFA 2HWF3 3S6PA 1DBNA 1NQJA 3AJZA 4AQ2A 3O7OA 4QPGC 4XF0A 3M3QA 3PVBB 5B2GB 3GHMA 3ZFEA 1X8EA 5CG8A 1RUJ1 3J4UH 4WBBA 4FPCA 1WLTA 5C8CA 2A6VA 3UKNA 3TAYA 4PIZA 3SISA 4LO8A 5IT6A 1H1IA 1VBB3 3L2YA 4K40A 3PTYA 3MDPA 1M4WA 4XJ9A 3UKTA 3EO6A 2VOVA 1LESA 1CPMA 1MS8A 1EV12 1XNDA 4JDNA 4ZXKA 3ZYJB 3WG3A 1MS5A 2ZACA 4Q0PA 4R4XA 1F31A 1RUG3 1SFNA 2E7QA 3N36A 1XNCA 4HPKA 1RJ8A 1BVVA 3NAPA 5DDJ2 4CP0A 1Y3TA 4AFBA 2VUJA 3TRSB 3DV8A 3TWIA 4Q0SA 4BWOA 1DQ1A 1VB4A 4EN6B 1IPKA 2WNVA 1AXZA 1H8VA 3EHKA 4L99A 4XF4A 4XILA 1OPOA 2W68A 3BPZA 3VBFC 1X50A 2XPJA 1RUF2 1DIWA 1QDOA 4Y22B 4Q0QA 4CDWA 4LO5B 2XH6A 3AMNA 1U5XA 4P9GA 4CDXA 1PO21 3E5XA 1VJ2A 2O0OA 2VMIA 4K1ZA 3HT2A 4N90A 4NWVA 2JJ6A 1K5MC 4BH9A 4H14A 3VKMA 4XYXA 1MVEA 3OBTA 4AEDA 1DLLA 1ZRRA 1TE1B 3USUB 3WQ1A 4L11A 1OD5A 4NHMA 2JDZA 4Z82A 1PO23 2QJVA 4P9WA 1FOD1 1W6QB 1CIWA 4GXLA 2IFRA 4RGAA 1OPMA 4JGYA 2XG3A 4XMIA 3VHRA 2RR13 2JX9A 2R042 4QT6A 1AYN1 4M01A 3VKNA 1E57A 1YRZA 3N35A 1PGW1 3ZSKA 1Q5OA 1YNAA 2G4IA 4BMBA 1GQGA 3N3HA 1RC6A 5BNPA 4Y20B 2JG9B 3I8TA 2XB6C 1G7YA 4X8PA 2VW0A 3MPBA 4YW1A 2XBO1 5FRAA 3SCFA 1CN1A 3D4KA 4IL7A 2A3YA 2Y0OA 1H8TB 1UAIA 4YVWC 3WNXA 4E9KA 2GAUA 1C28A 1CESA 4MUVA 4HVOA 5FBZA 1F8VA 1Z0HA 3M3OA 4FBFA 5CFDA 5JSOA 2RMU2 3POSA 4DRRA 3D82A 1O3RA 4QM8A 2ZGKA 5BNNA 1N1SA 3RJRA 3SMHA 1G86A 1GKBA 1PIV1 2GZWA 1RUE1 3EQEA 4GA9A 2HEWF 4IEZA 1GNHA 2R32A 4AWDA 4FPEA 2V09A 3ZMOA 4AF9A 4NVPA 4LHLA 2MEV1 2NMOA 4D3WA 3VZLA 1COV2 5J96B 3NWKA 4FTBA 2QQPA 4Y1YA 4KBBA 2P3JA 4BHPA 2YPJA 4IESA 3W58A 1OLQA 5E8AA 5GLWA 1GSLA 1PIV3 1RUE3 2ES3A 3MLKA 2ENRA 5GKAC 5LK5A 2MEV3 1XU1A 1IS3A 5JPMB 3D6EA 2HWD3 3KS7A 3UV9A 5J37A 3B9IA 1J3PA 3CU7A 1AHSA 1QJU2 3LGRA 4YM0A 4DY3A 1MEC3 2N7GA 3W9AA 3WHTA 1MACA 4A7ZA 2EVXA 4XF9A 4LBQA 4EN8B 2D3SA 1REDA 3NSTA 4N7IA 4K6BA 1AR91 3ZFGC 2WT0A 1JH5A 3GYDA 5JWPA 1VBC2 2ZX4A 1UD1A 4QPGA 2YGLA 3ROUA 1ENXA 1UF2C 3E97A 1MS1A 5JOWA 1LJ7A 2B7YA 2NZ9A 3VV1A 4Q4V2 4C91A 3QH7A 4L8QA 1AR93 3MIFA 5I91A 4I3PA 4Y1ZA 1IOAA 2DYCA 3ATGA 2HWE1 4GH4C 2BBVA 3OYWA 3VKLA 4ASMB 5FFOC 1CAVA 2ZABA 3ZN6A 3AFKA 3LCPA 2PHFA 4XHXA 4Y24A 3VBHB 2ZGRA 1ULEA 2HWC1 5EV7A 3ZIWA 4CEWB 3TN91 1IZ3A 2XGXA 2ZPXA 4HBNA 2EXKA 1KQRA 3G7DA 4I02A 1X33A 1UU4A 3GNEA 2HWE3 1QXRA 5CVRA 4IQPA 4Q2FA 5CG9A 1SQ4A 2H6CA 2VOWA 2VMHA 1SLAA 4COUA 5C4WB 1LR5A 3AKRA 3OF1A 4Q4X3 5JZGB 1OSGA 1D4M1 2MPFA 3VBFA 1QF3A 2XJVA 4AVSA 3ZMNA 4XE9A 4FAHA 4A2UA 2AR6A 2GDFA 2WL1A 1YFXA 4YGDA 1YCIA 1H9PA 1QQP3 4W65A 2I45A 2BQPA 1FPN1 3MI8A 4RR3B 1FT9A 4HT1T 1WBFA 1K5MA 4WM8B 3U0ZA 4OHVA 5KHHA 2ZBJA 1ZBA3 4H7MA 1DGWX 2D98A 3V0AA 1VR3A 4KQ7A 4HETA 2JKBA 4OULA 2XVLA 4NHKA 4LE4A 4MH0E 1FPN3 1H2NA 4RQPB 3IDCB 2A75A 3FX3A 4D7YA 1RUH3 1UKGA 3LOBA 1X82A 2OA2A 4ES9A 1W6NB 2EXIA 1BBT2 2ZCWA 4IETA 4AFAA 2ZGNA 1IKPA 3B7MA 4K9SA 1A6CA 1AL22 4XHBA 4BZ4A 3ZN4A 3CJIA 1A78A 2HWF2 5CB7A 5J48A 2QUOA 3ZPYA 4N43A 4Q4Y1 3RQ0A 2BWAA 4HZFA 4BPZA 4I2OA 4YVWA 1FYUA 1C3HA 1X7NA 2A7AA 1WW5A 5D1IA 1S2KA 3MEPA 1R091 1VBE1 1WMEA 4S2FA 1OQ1A 1SBFA 2RS33 3JCIA 5K0UB 4KWLA 1VBB2 2UY8A 3H8UA 4TYSA 2VNOA 1SCSA 3VKOA 3A4UA 1NZCA 1MS0A 1ND3C 5FO7B 3AKPA 2XJQA 3BOWA 3MIBA 4CEYB 1F9KA 2EXHA 3KM5A 3KSCA 4OI1A 4R9AA 4CDUC 4RHV3 1LCLA 3S0MA 3WP3A 1R093 1MS4A 2BYVE 4JAAA 2NMNA 2BFUS 4W6YA 4Z1VA 4XF3A 4E27A 4AFMA 4ITCA 3GBFA 2ZGLA 1QJY1 1MS3A 4LBOA 3ES4A 1FI2A 1POV1 2DVDA 1HLCA 1QJX1 3OGJA 4FQZA 2BNOA 3NV4A 4R9CA 5I0UA 2DCKA 4HMZA 3PHMA 3WW1A 3RZZA 1HQWA 4XEZA 2UWAA 1RINA 2MHFA 3APBA 1AVBA 1N3OA 4I09A 4MGYE 1QJY3 1NE4A 4LTAA 2XUMA 3FJSA 2X53S 4MX3A 1ZYBA 1W2UA 1QJX3 3ZFFC 2CGOA 1Q8SA 1JUHA 1HRI3 5FOBB 2CAUA 3M2MA 4ES8A 2HKXA 4KU7A 4RD7A 1AUYA 4Z07A 5ABJC 1MVQA 3AKTA 3ZFGA 1CGPA 1PO22 1CONA 2KA3A 1ASJ1 3FLRA 3VBUC 2DU1A 2EA7A 1Y7BA 1XQNA 2PHUA 2KM2A 4L9BA 1A3KA 2RR12 3DGTA 4LLOA 4S2HA 4H7LA 4QPYA 1S55A 2XJTA 5BV6A 5KBFA 2RJKA 3HAGA 1AR71 3I2DA 1ZRFA 2P3IA 1MZ6A 3AJYA 3N7LA 4GH4A 4KL1A 5JIUA 4Q1RA 2JG8B 1DQ2A 3JBG3 5IK8A 1LOAA 4FOQA 3H1WA 4ONUA 4YW5A 3FLTA 4UXAA 4AVCA 5IUQA 2GC3A 4MXWA 1LU2A 1NCQC 5EWSA 1FMD1 2YYOA 4HFSA 2D43A 3U07A 2WNUB 3N7JA 1VRH1 3R4SA 3RSJA 4MVTA 3LA2A 1W6OB 5GZCA 1V00A 4DNYA 4K8FA 3AXDA 4MGIE 1O3TA 3WLUA 4K20A 4FAGA 5D8AC 4JGZC 1GZWB 1H2MA 5JVVA 4X8NA 2WLQA 1FMD3 3BU7A 4H3WA 1ND2C 5C6CA 4W6XA 1KDKA 4IXLA 2QDRA 1NLSA 3D8CA 3RYPA 3ECQA 4KNCA 2V5YA 5EYYA 1XXNA 5F9TA 2VUAA 1WLDA 4N9HA 1O4YA 2B46X 3LZZA 1LULA 2ZX0A 4DINB 2RJLA 1I5ZA 5CADA 1PIV2 4QU2A 1RUE2 4MZUA 3S7IA 4AFDA 1Y9QA 1ENSA 4F7ZA 1RUD1 5JOXA 2MEV2 4MV2A 1YUDA 2RMU3 4XQ4A 2HWD2 3N7KA 4NOTA 4EJRA 3SH4A 5AFBA 1YFYA 1DQ5A 1BQPA 3E5QA 3WDVA 2Z42A 4B7EA 4D7SA 3RWNA 2E6VA 2V73A 3ZXKA 3POWA 5A33A 3T2TA 4AGGA 2OUJA 1COV3 4B3NA 5CFCB 3SH5A 1MQTB 4YZ5A 4M3CF 1CAWA 4OHXA 3OCPA 3E6DA 2GC2A 4XFHA 1HIXA 3DL3A 2X29A 5H9QA 2ZKNA 1QU0A 4KWJA 1KRIA 4XFBA 5LK7B 1OQEA 5DXDA 4L92A 5CA6A 1AR92 2D97A 1ZRCA 1YXWA 2QFEA 3D0SA 1U12A 3O14A 3WV6A 1ND3A 4FO9A 4IV3B 1HW5A 4ORFA 3MYXA 4AEMA 5JR7B 1B35B 1DG6A 1DHKB 5C9AB 2D5HA 3AFGA 5DUWA 3DPRB 5GLVA 2HWE2 3BB6A 3TB0A 2BPA2 3WP6A 2HEVF 2DU0A 3KT7A 1S0IA 3LB9A 1Q8PA 2GC1A 2QDNA 1ENQA 2Q1ZB 4B8EA 4AEJA 1NY71 2D6PA 4Y1XA 3WUCA 4AEKA 2WQ4A 1QQP2 1V6OA 2GMEA 1BXHA 3JQWA 3VBRC 1LOCA 1U0AA 2DUOA 3ZFFA 4QX5A 4QPIB 4FP2A 4FSJA 2YY1A 1D4M2 3WCRA 4YVSC 1QNWA 4XJAA 2WJSA 5ABJA 2C9AA 2K9ZA 1RUI3 4IEOA 1H9WA 4QGLA 1W39A 3O5SA 4INDA 3WG2A 5I0RA 4AGRA 2IXKA 3TNPB 4Z92B 1H1AA 2WFF3 1FPN2 1U5IA 1PK6B 1WMFA 4XQWA 4MYEA 1R083 4ZU4A 4QGMA 3O12A 4GKXA 1PGL1 1H30A 3O0WA 5I0SA 4EWEA 5DZFA 2ZGOA 4AI0A 4HKOA 3I7DA 4G4FA 2WSUA 3SH3A 3AP9A 3L9JT 1F5FA 4OI2A 1ZZ7A 3PJQA 3QLQA 5AFEA 3WP5A 4WM7B 1GFF2 2B5HA 4XFCA 3GZTB 1APNA 4MGZE 1NCQA 5GZEA 1SLLA 4E2QA 5JDBA 4YFWA 1U5YA 3QD6A 4BE3A 1CVNA 3OY8A 4Q1PA 4YGEA 3CLPA 1C5HA 4FPFA 1QGLA 3FFZA 4XBQA 3FE5A 4D7TA 2A6ZA 1BCXA 3ZIXA 3DN7A 2VW1A 2RS32 4A7KA 1CJPA 4XJWA 3NVCA 5FDBA 2VMGA 2R073 2ZA9A 3VDDB 4BIOA 4C90A 4OFGA 4JGZA 5HCBA 3SXWA 2X5IB 3HN1A 1POV0 1SFYA 1ND2A 2A3WA 4XJ8A 1AX2A 1NE6A 4RHV2 4K1YA 4YLZA 1LGCA 3B3QE 3T1LA 1R092 3ME2A 4UBHA 3Q9OA 4XDQA 1AL23 1HQNA 1VBE2 2IXHA 1UIKA 2DCZA 5KXEA 4XTPA 1YI9A 1TMF3 3LA7A 4N53C 2H0BA 2RE9A 2XJPA 4JV4A 4AFCA 4ISRA 4A7YA 2XHKA 4XXPA 4C0HA 5I8TA 1WLWA 4CYDA 3VUOA 1H0BA 3B00A 5EZWA 3LOIA 4RQPC 4ZU5A 2QZ2A 3J8F3 5GM0A 1KS4A 3ALQA 4GMP1 5J7MA 4AVAA 3AP5A 1JUIA 1QJY2 2CGPA 2ZGMA 3AMPA 5FQ0B 1KFXL 2XL7A 2HWB1 3JUUA 2AREA 3KT1A 1FV2A 3M8LA 3MLJA 3MZHA 1QJX2 4AHWA 4COZA 4B4RA 1L3JA 1RUJ3 1HRI2 2A70A 3TYJA 1CJDA 1O4ZA 3RS6A 3QACA 1VBA1 3P3NA 2BUKA 2WT1A 2WINB 3M3EA 4BMEA 4FTEA 1RUOA 1PVC1 1ZBE1 2CGNA 2HWB3 4Q4W1 1YHFA 1NA1B 4AQSA 4B7KA 5BNOB 1H4HA 3KD4A 1MR5A 4KGGA 2C1FA 4KG0A 5K9YA 1W6MA 1REEA 3ES1A 3IKWA 2YZ4A 4JRAA 3H7YA 4F8AA 1UKRA 1LGBA 3MGUA 3WDWA 1QWRA 4RL7A 3E6CC 4CTEA 5KHIA 4Q8KA 1ASJ2 3JBG2 1J1TA 1GQHA 4I0BA 4I0AA 5HCFA 3RMXA 3NL1A 1FNZA 5DUVA 1NXD1 1TME1 1UZZA 3WDTA 3RI8A 4L97A 4BM8A 2DVGA 1AR72 1QXJA 2OUHA 2PFWA 2XWBB 1UX6A 4AVVA 1PNGA 2VH9A 3EJKA 2JENA 1DGRN 4YG6A 1ULGA 4R9BA 5L7OC 4FOVA 4FOYA 1ZVFA 1RB8G 5E88A 1ZRDA 2XKPA 4IEPA 1FMD2 3FC0A 2XWJB 1OA2A 4SBVA 4CDQB 1FOD3 1DQ0A 4KU8A 3CJIC 4AXOA 4JTNA 1BK1A 1NLRA 3VBRA 1GLHA