5CBPB

Crystal structure of conjoint pyrococcus furiosus l-asparaginase at 37 degree c
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
127
Chain Sequence
MAVLVIKLIPGLSGDIFRAAVELGYRGIVIEGYGAGGIPYRGSDLLQTIEELSKEIPIVMTTQAMYDGVDLTRYKVGRLALRAGVIPAGDMTKEATVTKLMWILGHTNNVEEIKVLMRKNLVGELRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Conjoint Pyrococcus furiosus L-asparaginase at 37 degree C
rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
molecule keywords L-asparaginase
total genus 42
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cbpB00
2WLTA 5DNCA 5DNDA 5K3OA 3PGA1 1WSAA 2HIMA 4R8KA 5DNEA 5K4HA 1HFKA 1DJPA 1JSLA 2P2NA 5K45A 1HG0A 1AGXA 3ECAA 3NTXA 4ECAA 1WLSA 5I3ZA 1IHDA 1JAZA 2GVNA 2D6FA 1HG1A 1JJAA 1ZCFA 5I48A 2WT4A 4RA6B 2JK0A 5F52A 2HLNA 5CBPB 3NXKA 5K4GA 1HO3A 2OCDA 1O7JA 4R8LA 5HW0A 1DJOA 1HFWA 1ZQ1A 4RA9B 1HFJA 4Q0MA 4NJEB 2P2DA 5I4BA 1JSRA 1WNFA 4PGAA 1NNSA
chains in the Genus database with same CATH superfamily
1ZNYA 4PYJA 1J9ZA 1N7GA 4PZDA 1O0BA 1EUCB 2FSVA 5E6UB 4YHHB 4PWZA 3D5QA 1MGOA 2TS1A 4JA0A 2C9BA 1Q3KA 1Q77A 3L07A 4ZKDA 5AVZA 3AHDA 5GOZA 1F6WA 3DLPX 3II6X 1T13A 4WNCA 4M76B 1PS9A 5C1OA 4NV0A 4ZC1A 3ZY6A 1USWA 3H8VA 2JC3A 4H27A 4X8HA 2PO5A 5LZ8A 1E60A 1QYCA 1V3UA 4RENA 4TL7A 1PT6A 1GG8A 4YRZA 5CB4A 2BFWA 5CVCA 1XE3A 2NTEA 4AZWA 3MRXA 4R2WA 3KJGA 3QA9A 3ND8A 3GLHB 1P7CA 4LV5B 3BHNA 3G7NA 4EELA 1HLDA 2Z4RA 1KK1A 5A06A 3CCBA 1E4VA 1H3FA 3D8BA 2HU2A 1PJAA 2ANBA 3JYLA 4C89A 3CNOA 4PQYA 3CH4B 2W58A 4M1KA 4JV5B 1JSLA 1XFDA 2I7VA 2UYQA 1UAGA 3TNFA 3CE6A 3JQ6A 1SUDA 5K7SA 1XZ8A 3GMSA 2Q5IA 4EQ6A 1UDCA 5DVZA 3KRTA 4X44A 1KEPA 4CKCB 1KDRA 4D1YA 2EATA 1G18A 4G0WA 1U0BB 4L76A 2FPMA 3AHCA 2AH5A 4A6EA 5BSFA 3OU6A 4OBWA 1G4HA 1N2ZA 2X41A 3WXMA 3EJWA 3OOYA 4X6UA 4J7CA 5DF1A 5ICMA 1HOXA 3I42A 3IVMA 2X4DA 1P44A 3G02A 2LE0A 4KR9A 2OQ2A 2ZUSA 3D2LA 3M5WA 4RK1A 2ATEA 1RBYA 4MWCA 3S8YA 4LBZA 1YB5A 1NP7A 3FSRA 1KI6B 1GQYA 3LV8A 3CNEA 4G4GA 3CV3A 5AIAA 3OH8A 2GB4A 1EXDA 5KX5A 1Y1LA 3QQ5A 3W79A 1PG5A 1KO5A 4E32A 5HUHA 1I14A 5B1HA 1OI4A 1FJXA 1RQNA 1SELA 1ZD9A 3J7TA 3X1JA 1XPRA 4DDKA 1ZOOA 2GO7A 3NHUA 4MCAA 5I9MA 1IBLB 4GZLA 3NC0C 2H3HA 4CLOA 4FJ2A 2VDNB 1A98A 1Z08A 4YP7A 5HGXA 1NAHA 1N8KA 3DCIA 3LDFA 4TXMA 3OCZA 5F5LA 3G17A 1RRKA 3KSUA 3MWKA 4OL9A 1G0OA 3CN7A 3HLTA 1Q5PA 4WZBE 2J0SA 1WSAA 2B99A 1R15A 1AHIA 2HNAA 3KKMA 3QVGB 1PUIA 1WZUA 3EZLA 3AVUA 1BGXT 2MR6A 4Z99A 5J2UF 2R00A 3FPLA 3EPKA 3UN1A 3NVMB 3ZBPA 3PHCA 3V2GA 4BL5A 1MB4A 2FRDC 5BYAA 5T4BA 2JD0A 3PNOA 4F4DA 5GIOE 1V4NA 4K9QA 3FTCA 2XKJE 2IHTA 2Q9BA 3FLAA 4HAYA 1FIUA 3E9NA 4KUGA 1Y1RA 3KJFA 2IWRA 2KW5A 1F20A 1P45A 4ZEVA 5B4UA 3JQAB 3K8QA 4K46A 3E3AA 3LGXA 3NV7A 1IG0A 2E1RA 3EEOA 3URMA 2C96A 2D4AA 3CN9A 2DBZA 4JB3A 2X14A 4NV1A 4Q66C 4WKPA 3HB9A 5BQ5A 3OPXA 1JIIA 4YYZA 1GL6A 5AVOA 2JI6A 5IC6A 1TM5E 4B3GA 4IM7A 3DCYA 1UPAA 1T8UA 2C3UA 4RZHA 4U2BA 3RLFA 1GZDA 1FRZA 5HP4A 3OTIA 4DSOA 7YASA 3MJEA 4M1EA 2FF5A 2OHGA 2HYIC 2QG9A 2XRZA 2AE1A 3SIRA 2X40A 1EM8B 1SD5A 1PQYA 2XUPA 1AKQA 1RRMA 2KPOA 1W85B 1Q1QA 2YUIA 1RXWA 4JLBA 4X1IB 5F77A 5EIXA 4MWTA 1TF5A 4ESOA 4FFDA 5CBPB 1EP2B 2FPGA 4B7UA 4B32A 5ALZA 3GFTA 1G8JA 2X0RA 5D86A 3DG9A 2IKQA 5CAEB 3W8EA 2V98A 1WW8A 4H60A 3R0JA 1T9AA 3KSZO 4ZV7A 2ZBRA 1SZPA 2FSFA 1KYIA 3O4JA 3UGJA 2IHZA 1FFEA 1NVVQ 5K03A 3S2FA 2O4UX 2OB2A 4J0GA 1DTWA 5KJFA 3H19A 1XEXA 3L49A 3EMKA 4XIIA 4ARVA 2G1KA 2GPYA 2YV3A 4UATA 4BFTA 1RAHA 2LDXA 4PZ0A 4RL6A 4PPQA 1NF9A 4IZHA 3FBWA 2BWJA 3MLAA 4N3CA 3F6BX 4G0ZA 4NTZA 3WK4A 3WV5A 3C1UA 4NG5A 4U7HA 4D6XA 1KOLA 2CLLB 3C87A 1F2VA 2RGBA 2MJLA 4XOUA 5G0SA 3CRW1 1R74A 4DADA 2OCDA 1V0JA 1P2GA 3LMKA 5IMBA 3G1WA 1JXAA 4M8NE 2FUNB 1TTQB 3W3AH 1TKRA 2C0QA 1P80A 3MS7A 1MOPA 2QQGA 1SWVA 2FW1A 4QTUB 5AMXA 1K8RA 1SU6A 2XMCA 5HRUA 1RYDA 3KR2A 2BMWA 2VJMB 3F9IA 4BV3A 4Y6RA 4RESA 2C4TA 1GUZA 5L7TA 5ES3A 3AEZA 1DCTA 3R6LA 2GLXA 5CFNA 1NLUA 3LZCA 1JQEA 3NTRA 4CM4A 2QP4A 1WDLA 2VO1A 2I2FA 4NNOA 1Y3DE 4RGYA 1IBSA 1S8FA 1ZKDA 4XB1A 1VG1A 2DETA 1T0HB 4NKRA 3TUZC 1SUAA 3KUCA 1K8XB 4YLYA 3E3NA 2G1JA 4UTNA 1CZUA 4BJ5A 5FDFA 1WCV1 1Y4AE 4U4AA 5EXTA 4AU1A 4AG3A 4MQLA 4DT1B 4LBVA 3A4MA 1PIWA 4EPVA 2G7ZA 5DRYA 5HCNA 1WP9A 1U0TA 2G63A 3FPFA 4RCYA 5AKYA 3FB1A 5I7EA 2Q3LA 4HAVA 2AZXA 1FUKA 1Y82A 4WFIA 5JQGF 1LLQA 4A1OA 3OZWA 1G3QA 2CWDA 5AKZA 3WBKA 4MIKA 4KE6A 3KV3O 4HYEA 3U6KA 1DAHA 3QTBA 4ZIRA 1HXHA 1PK8A 2HEIA 4UBNA 4O1MA 1QKIA 1ZSNA 4J0DA 3T61A 4JP3A 4OMCA 4RCVA 5C8YF 1KERA 3MFYA 4JNCA 4OUKX 5IASA 5IVKA 3NORA 3T1VA 1QRTA 1LW7A 3WB2A 4MWEA 3A4IA 1VYTA 2YMLA 1XVIA 4ZRMA 1DX6A 2IYOA 2D1TA 5F1OA 2CXQA 3STXA 3UQYS 3ZWCA 1QGOA 1TVMA 4EVQA 5BWCA 2JIPA 1QIMA 1S2IA 1REQA 1JI3A 2CXNA 3R5JA 5ILGA 3OFJA 2BGTA 5A9RA 1KJZA 4LECA 4PF1A 4LHWA 4BYMA 2B2NA 2MSEB 2GO1A 2BEVA 3ADOA 3OQ1A 2XIQA 1OZAA 4RIEA 4F5EA 1JLSA 1E2PA 3A3KA 4YAUA 3UPDA 1QLHA 2BLNA 3ED5A 3LPLA 4IV0A 1AQLA 2ZRMA 3TPZA 1B4DA 3K15A 1LDMA 2WQ7A 3MAAC 4QPNA 4REOA 5EMMA 2QLBA 2VHUA 3L2OB 2JLZA 2ZIZA 3PRKE 2PO7A 3KYCB 3LRPA 4J3JA 4V38A 4Y2UA 4BX3A 1YR7A 1H8HA 5DT9A 1XZPA 5LMUB 3IE0A 1BMTA 2ZRAA 2B83A 3N0XA 3KLBA 4MKGA 4HWKA 4UM9B 2IDZA 4FOLA 3LT1A 1LVGA 1YZNA 3KAJA 5IAKA 1AXEA 2HO5A 4RXMA 3S5JA 3SF0A 4MW1A 1N2EA 3HR4A 4LYHA 2P2CA 4HRYA 3L6UA 5FP0A 2OSVA 5EPUA 1A88A 2WJGA 1RQPA 2QVGA 3L7OA 4RE5A 2O8BB 5JY1A 3ILYA 4YECA 3P97A 1NJ1A 3K0FB 5FBKA 2YDXA 2V3WA 3BEOA 3MJVA 4UE2A 3MCTA 4QPJC 1AA6A 1Q12A 2IJGX 1Z68A 4MQ4A 1PS0A 4POOA 3ZWPA 2QHXA 3SJZA 1W76A 1U4NA 4YXFA 5AICA 3EISA 3NLLA 4AUNA 3ER9A 2ZTMA 3FW1A 5C3UA 4ZAZA 4F71A 4RO0A 2F9LA 2B7LA 1KS9A 1S01A 4WVLA 3OJFA 1KR5A 1P0FA 3CLUC 4DXDA 4HMPA 2ID4A 3KLOA 1DRWA 3PQCA 4JROA 2WU8A 5ALEA 5IBRA 5TPWA 4C5CA 4FD2A 2FMUA 3ZE8A 4AJEA 3VKUA 2YHIB 2BFAA 1P1FA 1ZSVA 4QJBA 4U6SA 5JYEA 2BI7A 2PXXA 3H2KA 3M82A 3UV6A 1LPSA 2JJQA 3CKKA 3EVBA 5FFNA 1L5LA 3IQDB 4EK9A 2GBFA 5CB4B 1NVUQ 1NQWA 1U0NA 2VQFB 2YFYA 4Y9SA 5HR5A 2JK0A 3RWBA 1S3GA 4IIEA 4TSRA 3GGGA 1EDEA 4UNSA 1GTJ1 4XYEA 4Z3OA 1IDOA 2DFDA 1RJWA 1GPWB 4WZ6A 1FVFA 4JDPA 5NLLA 2F1IA 4BMCA 1LK5A 5EE9A 5I9NA 1FSGA 2PZAA 3E1KA 1DQPA 3M1AA 4NY1A 4LSZA 3CVYA 2DHDA 1YWGO 4K9NA 4MUXA 1K68A 1TJ4A 1ZW6A 5FL7D 4X7RA 1NBME 3DHEA 2OENG 3IVCA 3LWZA 3NYQA 4FUQA 3OPQA 4ITUA 3EZ7A 5A5EA 1SOMA 1VSQA 3CRZA 3K0CA 3S2SA 5JS2A 1TJ3A 2PHZA 1MX9A 3HJNA 2VJAA 4JJEA 3VH4A 3BFJA 5E1BA 3W2HA 5C18A 3OOEA 1FTSA 3KAQA 5EPOA 1BVHA 2X3UA 1DRVA 2WFZA 1CJUC 4Z9BA 2ISSD 3LF2A 1O08A 2R86A 4OGWA 1SG6A 4YCMA 1VOTA 3GP3A 4F6RB 1YNSA 2C57A 3OMLA 3Q9LA 3CZAA 4KN5A 1SOAA 4QFBA 4KKXB 3GZJA 4MKFA 4HJXA 2BGKA 4CL3A 3ADKA 3VC3A 2O5RA 4QJ5A 5HOQA 2CLFB 2QWXA 3NU1A 2EJUA 2E21A 5D5QA 4CQMB 4AYWA 2II6A 2YY7A 4F3TA 4D44A 4G63A 2E89A 4GP7A 4DDWA 5KX5B 5D3ZA 2C2OA 2EZTA 2WD9A 2AMJA 2BMFA 3ETEA 4MCHA 4OAPA 2ZI9A 3EQ8A 5DSXA 4ZT5A 1BQ3A 3G0DA 5GVRA 1GGNA 3T15A 3QLVA 3X2EA 4KBGA 1DOZA 1DIGA 3JWJA 3LWDA 1DOAA 2ZRBA 1R0KA 1VL5A 5I9BA 1BMDA 1QIHA 5BUCA 1ZD5A 5DP2A 1NMXA 3JPWA 4G1CA 2LZ0A 3J81k 1ZLXA 2QE6A 1JBEA 1NSFA 4M0KA 2D8MA 1PJQA 2YWBA 3VZBA 2RHBA 5LYYA 3K94A 3RNLA 3QLTA 3R4CA 5TX7A 4Q9AA 2Z57A 3VO9A 4B3FX 5C8VA 5ED4A 3QVXA 1T3TA 3K4HA 4WNAA 5JO9A 4W7SA 1WSWA 1LDGA 2VS1A 1DEKA 3NOQA 4TLLB 4WLFA 5AXAA 5KWEA 1AU9A 5IULC 2WYHA 4QSMA 1F7VA 2OQIA 4L2IA 4BVKA 5AM0A 4D81A 3KOXA 3QLUA 3U9SA 2WSIA 5C51B 4LVNA 3Q5GA 4JB0A 1M2VA 3FBTA 1W8DA 3CLKA 4UBLA 2ZUUA 2WPDD 4AJJA 4CF5A 3K9FC 2YZ7A 3DAGA 3R74A 2Z4SA 3QLJA 1OFUX 5A0FA 2PUGA 1YR2A 1PGQA 4HB3A 4PAOA 2FA9A 1HEIA 2OTCA 3GLTA 1FP1D 2ZS9A 4US0R 1GNLA 1EK5A 1Q92A 1MDBA 2VHVA 3H6HA 4GO1A 5C8YA 3RUFA 2G5PA 4RV9A 4KNWA 1FEZA 2XLCA 2XUDA 2J32A 3QOFA 1D3AA 3ZIUA 4E13A 1PSZA 1SHZA 1W1UA 3SC3A 1NUUA 1W85A 4HN2A 5CW2A 4QDUA 1FJ2A 4J0HA 3V6LA 4BY9E 5A1TA 4IFTA 2GILA 1ADYA 3M3PA 3SJBA 4INAA 1PG0A 3DE3X 3S2EA 3CA8A 2A9QA 3SZUA 2X6QA 4G5SA 4R8VA 4PICA 1DTSA 3K32A 4FZ5A 5CAEA 3L0CA 3P9YA 4J6EA 3F6PA 1QF7A 4GZ5A 2PNJA 1NATA 2YWJA 1EWTA 2VF2A 3F71A 4I3FA 2C31A 4FFOA 3MOSA 3EDRA 3TZHA 2X6TA 3IEMA 2IYZA 3EFOA 3W5UA 3H2YA 3KUKA 1DTWB 4GKJB 2B6HA 3MVEA 2ZITA 4N7MA 1GXSA 4C5BA 3LC1O 5FOSA 3EIEA 3ZLTA 1QHYA 1V96A 1JKFA 1HDZA 1JNYA 3ETGA 4OQXA 1OR8A 2IEIA 4C0BA 2P91A 4XQ0A 2EDCA 3GRFA 2EFCB 3FMFA 3JVEA 2EKPA 2JFPA 3TAUA 1S7CA 3I09A 1UIRA 3JAWA 3KC2A 4WD3A 4XM1A 1HDRA 1KWKA 2BM1A 4LSWA 4BNLA 5JO0A 1DCMA 3K96A 3ZHXA 2BKEA 4CQNA 1B41A 1D09A 2IHKA 4LF6B 2ZFUA 2C9DA 4LXUA 1GQSA 4ZU3A 1XRLA 5GM2A 3B5EA 2QLJA 2X6RA 1VLVA 1VJ5A 2GYUA 3FZGA 2RH9B 1OBCA 3GGSA 4GG1A 1I4DD 2H0AA 1II0A 1G64A 2RAPA 2DBRA 3AGQA 3GAFA 3M8KA 1F51E 3NPMA 3ROXA 3A6PC 4PRLA 1AZLA 4M1QA 4RX1A 1DHTA 1RWOA 3FYHA 3MC1A 4IXMA 2F90A 4UEOA 1XZBA 3V2HA 3ILXA 2B98A 5K0GA 3LT2A 3KJEA 4O1IA 5CT4A 3UB3A 3KSAC 1X7HA 2DHQA 2ORWA 1G5FA 4NI5A 3QWHA 1VXRA 3ZJ4A 2H00A 3PDCA 1XKTA 3OQJA 1E7QA 3TQTA 1V2GA 5JBNA 3QXGA 2V03A 4A91A 4BB5A 1YCHA 5DNAA 4FYXA 1IM5A 3WK5A 4CMIA 3AF0A 1H85A 5BVHA 3F96A 1LQTA 5EMNA 4HWPA 5ICFA 2P69A 4NHOA 2VJQA 4YAKA 2YIMA 1EK6A 2FWJA 2P90A 2QAIA 4DT1A 2YOFA 3OAAA 5DXAA 1GQFA 2C0CA 4EVIA 3S68A 1RBQA 2E49A 3CRNA 3IT3A 4RAQA 1SC9A 4KX3A 4EYQA 5KQRA 2Q5QA 4FOSA 4DJFC 3DR3A 2B61A 2GEDA 2CYAA 4KQFA 3AHIA 1KZGB 3IP7A 3O3OB 4K6CA 4ZIRB 2NPFA 3IIJA 1UPTA 2DWQA 1SUBA 4NARA 2A3RA 2EZ4A 4O4HA 1ECLA 2IIPA 5AJXA 3H2IA 3AFMA 1YQTA 3A4YA 3B6IA 5ER9A 3GEDA 3KQNA 4IDFA 4HQRA 4LTMA 1MX3A 3TX2A 4LX8A 2XQVA 2YZ2A 1C4WA 1EWKA 1P0IA 1XQYA 2HQSA 1NBMD 3QM1A 4NCJA 2IXDA 4XD7A 3JY6A 3RJMA 4N7BA 3HNOA 2J09A 1WY5A 2IYFA 1POWA 5AM1A 5JS8A 4HVAA 3P9NA 4UHHA 4KUEA 1S6YA 4RZ2A 4EPYA 1IUOA 1X74A 1REQB 1HNNA 1N1GA 2Y0DA 3MHPA 3BPSA 2BEVB 4O4LB 5UKDA 4EGQA 4R1MA 1QOPB 2O7QA 2GK4A 5BOSB 1DTEA 3GJXC 3A4VA 3PNMA 1VP9A 2WKPA 1EGQA 2JIQA 4YBRA 3R77A 5I4IA 3OA2A 2W6PA 4WNYA 5JATA 5C80A 3FDZA 2PU5A 4XAQA 5K0BA 1A4XA 1RZ3A 1KP9A 1MJGA 1UEXC 2P2GA 4MVJG 1MJ5A 3DLHA 4HTFB 4J7AA 4IYRA 2I4MA 2EARA 4EY5A 1E2DA 1KYWA 2WKRA 3FTPA 3I6BA 3P27A 4A2CA 3I0NA 1FQJA 5EJMA 3TX6A 2P0AA 3AQIA 1BO6A 3NBQA 3KD3A 2CVFA 1PVOA 1DJLA 1GR0A 2QQ5A 3NHJA 2IXTA 5T41A 2Q5EA 3I4CA 1O6GA 1USGA 4K9MA 3W6OA 2RG1A 2AGVA 1T8RA 2GUGA 2H48A 1Z26A 2BR5A 2Y05A 1P9NA 2XNKA 3D1VA 2AKEA 1Y34E 2QX8A 3HVUA 3EZYA 2Q4DA 4ZYZA 1O8CA 2I4RA 4TTJA 4FINA 4KO4S 3RTDA 4ZYXA 3ACBA 5BMVA 1B42A 3OZCA 2H1FA 2VHYA 3A9CA 4OYLA 1NW6A 1E1CB 3R3WA 1I4EB 4C87A 3FUVA 1EJ0A 4DMHA 5AYVA 3ZWKA 2EKDA 4QJ3A 1RRVA 1JEEA 1SVOA 2I2AA 4CMEC 1R9NA 4J49A 3WADA 3C8HA 5M3BA 121PA 3KKNA 4AKEA 1U1CA 4KL8S 4NQRA 1DJPA 1R27A 3F6SA 5B58T 4HC4A 3AW9A 4FT4A 3LY7A 1YIOA 3GT4A 3M81A 1B16A 4TKUB 3W5DA 1JDJA 4TLAA 1BEUB 5B3LA 2WM9B 2OD9A 3LLUA 5KQLA 1QFSA 2VTVA 2BSQA 3WDLA 2HK9A 3IHTA 2Y27A 5FTMA 4X60A 1XI2A 4BO6A 4RBNA 4MA4A 3U37A 1YC5A 5KUTA 1ETHA 3CTMA 1MB3A 2DY1A 3V4VB 3LU1A 2IYSA 3DEAA 1AUXA 3ANLA 3RTEA 4LKRA 2VQ6A 1OYVA 4TVSA 3VZRA 1AX9A 4RQUA 1Q11A 3NHZA 5EQTA 1DEXA 1P4HA 1VCMA 2OAGA 4DL9A 1V39A 4D0SA 4C0AC 3K7EA 4GSKA 3U7IA 621PA 1D5WA 1L4LA 4AI6A 4PZCA 2PZKA 3DHVA 1QP0A 3D0QA 4DVGA 2DHCA 1AKWA 4XWKA 1WQ1R 5E8RA 1LQUA 1YL7A 1ISFA 3IA7A 4D9BA 4OK5A 2VN8A 1YDFA 1MDFA 4HBZA 3X1DA 4JJFA 1RLUA 3GIWA 4LF7B 3IUQA 5FA5A 1KS2A 1KU0A 3I5MA 4DA6A 1AZTA 4XM0A 3JQBC 4F3NA 1NNLA 3HDVA 2HDHA 1QPZA 2VPPA 5SYMA 3EF0A 4DCPA 1ZLYA 3NGXA 1CY1A 4JX9A 1WCIB 3HXMA 1TVCA 2O7NA 4MRSA 4JXXA 2DFPA 1ZD2P 3L02A 3V33A 3PR3A 4A3SA 4B31A 3HKDA 2VYQA 1EFHA 4Z86A 5FCDA 3NHAA 4A6PA 2NP6A 2O3TA 1WZNA 1O96A 3DA8A 3SZMA 2QN1A 3H6GA 2XYQA 3WBBA 3UJ7A 1HTTA 4MA5A 4RMHA 4LYAA 2PCJA 1MJGM 2AIRA 4OHMA 5AJWA 4QM7A 1MU0A 3KJNA 3DHWC 1Q83A 3IOYA 4IUYA 5AO9A 1UBHS 1XK6A 5F9HA 3VKGA 1P9RA 4YXWD 5L45A 1JXOA 4L8LA 5K0SA 4DABA 4GICA 1CU1A 3NBZC 1VPDA 3BH6A 1F6DA 1NZJA 2GRUA 2WG1A 3L0DA 3UA4A 2XQGA 4UAJA 1HZZA 3L9XA 3A37A 4WNAB 2XMQA 5A4DA 2VHXA 4GBMA 4MQ5A 1K97A 2XGMA 2I65A 1F3OA 3EQ9A 1ORTA 2O6HA 3G2LA 1SY7A 5AXCA 1JFRA 4D74A 1C3OA 2HA7A 4E46A 5L8VA 4G4IA 3D4PA 3DQQA 5BSEA 2ONKA 4QJ4A 1YQXA 3L05A 4NH4A 1FTNA 1SEVA 3JWPA 1PRYA 4PNEA 1N78A 5E4TA 2AFHA 2BZ0A 2OG2A 4NC9A 4RCZA 4U7PB 5HIIA 1U6KA 2JDID 2OGTA 3BE5A 2RGDA 1UBTS 4IOKA 4BNIA 1ZHHA 2V6IA 4NOMA 3V8MA 4C7MA 5IN4A 3D8TA 1ZI8A 4G0VA 1CQIB 1I7LA 3K9GA 1XNJA 5D5PA 2Z5GA 1UKYA 3QFSA 1ST2A 3CEJA 4LC1A 4EITA 2UDPA 2WHXA 3L6CA 3GUYA 2OLJA 4JP2A 1UFKA 3SK0A 1L4UA 3PDIB 5DCWA 3NUGA 4NULA 5FUQA 1OXUA 2VPQA 3O47A 3NT2A 1VB5A 4R9UC 2IFTA 1Y9EA 4MPRA 4YUAA 1S1MA 2AE2A 4E2FA 4QECA 1S2NA 4CDNA 3LCUA 5HX7A 4IXWA 1XTSA 1XU9A 2DKFA 3ZWVA 1KI8A 3JQRA 1JAZA 1P2VA 4QUIA 1IEWA 3L6EA 3WRXC 3BUSA 2Q3FA 3KLMX 2JVJA 5AI9A 2I6GA 1K3FA 1A5TA 1UZNA 2IYQA 2VDUE 3MYRA 4W99A 1N2HA 2H52A 4QULA 2FPSA 3UHPA 1E0JA 4TN1A 2F3QA 2CLEB 2IDMA 2R84A 3GJ5A 4XSGA 5HGJA 3TTXA 1GXSB 4ZGGA 2NMVA 3CZ5A 4Q9DA 3THYB 1A8QA 1Z4JA 1DC8A 1E99A 2JJYA 4G81A 1PF7E 2JH9A 2PPVA 3LIIA 1KFEB 1VA5A 5AVXA 4Q18A 1M83A 4DDVA 4KXFB 3RW9A 3RAFC 2Q1YA 4E15A 3TJZA 5GZ3A 5JBQA 2QUIA 1MC5A 4ER7A 4GEGA 5KSPA 3GEBA 2R8BA 1MD9A 1L1RA 3VPAA 3IOCA 1C3JA 2C20A 4EX7A 1NBIA 1Q1AA 3BTSA 3PHGA 1EFDN 3ONFA 4LYJA 5DKFA 3U44B 4PC3A 4UEJA 2YJZA 1GFIA 1KC3A 1Z4PX 4G1VA 2DUNA 5H0IA 1RSZA 2QTWB 1NIJA 4LNAA 4ZAGA 5KTNA 3U49A 3QNMA 5DHAA 4MRRA 3TS1A 4OY3A 1GEGA 1OXVA 1QMGA 1T3GA 3TAXA 4F7DA 4FX5A 1QZXA 5A5DA 3UM9A 2AC7A 1OT3A 2HSJA 3FJOA 4AULA 3AR6A 1YO6A 1IXYA 2ECKA 4M60A 2DOKA 1I2MA 4LF5B 4BNDA 4BQQA 3P7MA 1U3UA 2VUSA 4FMCF 1SFRA 3CMMA 4CMIB 5EJEA 1H0KA 3UYLA 5K09A 2IDJA 4AY5A 4NEHB 3BCHA 3D6JA 1H65A 4Q00A 1II8B 5CYGA 2BGNA 3KJZA 2QUBA 4LBYA 2QV0A 2G70A 1ZM2A 3BICA 3MD0A 4IVPA 3NM6B 4BQSA 4E0BA 4EAQA 4AUEA 4AWXA 1X3SA 1U2ZA 1JEAA 4NBVA 4YP0A 3CX6A 4JFAA 1Y9ZA 3E9CA 3N7UA 2OV1A 1A1SA 3UC9A 4O2AA 2YX1A 3EUFA 1B0PA 2RK4A 4P7GA 3ZXIA 4Q3OA 4XCVA 3AIMA 1UPXA 4O4HB 2J3IA 2R11A 3QMWA 4J1SA 4BNWA 1TVEA 4C0JA 3OQIB 3EIHA 1J09A 4L0MA 1ZOPA 3V97A 4XVCA 3GUCA 3LTNC 3OLQA 2RGWA 1E2UA 1ZJ4A 2R5FA 4IDNA 4EGJA 5GMOA 3EIOA 2P0YA 3RF6A 1VSVA 3PSHA 3HDYA 4ZREA 5H59A 1JTFA 1MGPA 4J0KA 1G3RA 4CCYA 1NFRA 3EGCA 2C95A 5BXYA 2QZSA 5L4LA 3Q4GA 3VRHA 1EUDB 3TN7A 3PBKA 4H17A 4QOGA 3V8BA 4IRXA 1W4RA 1ZH6A 2OM2A 1OX4B 4O4LA 2X3YA 2Y2VA 3I01A 4ALMA 1GZHB 3P9IA 4DLKA 1K8ZB 3WRYA 4IEFB 4U9HS 5AW8A 1I2ZA 1RQXA 3V5NA 3KQLA 1RYFA 1V16B 1D2CA 4KVAA 4OHOA 4PO1A 3I5AA 3PL1A 5AW4A 3M6VA 5KYYA 3FB4A 3W5BA 2XZDA 4PNPA 4UNRA 2J6CA 2XB2A 3DBHA 4HEA6 1A82A 1KO1A 4QWMA 1ZSYA 2Y0PA 3GVCA 4MB2A 3S8MA 2VAPA 4AJ1A 3ZC3A 4UOZA 3EVNA 3AFGA 3AILA 3DFUA 3EXHA 3DE5X 4QRHA 5CJJA 3UOWA 4GKKB 3QE4A 4LXYA 1NXTA 3TZKA 1U3FA 2GN4A 3HU3A 5IUJC 2IZ5A 5BUSA 2R8XA 4FBMA 3DMTC 3HJGA 4CV3A 3WYGA 4OXXA 5IAAA 5JSFA 1D0VA 3BHMA 1MKYA 3NBUA 2IW3A 2UZ4A 5AVWA 1P2BA 3Q0IA 5DIFA 5TF0A 4MVJH 3JRXA 4D9JA 4K9PA 4OKSA 2JLWA 3L9WA 4V39A 3UGQA 4C6TB 5I8PA 2DTDA 4EBFA 1JV2B 1C8KA 1KNXA 1DKNA 5AFSA 2B8TA 1NJ2A 5CUQA 6Q21A 4MKIA 4BFUA 3QG5A 4Q3AA 1ZISA 2QP9X 5EIHA 3UMJA 2OV8A 2AJLI 1CHNA 1ZKMA 4ERNA 4CLRB 1X2BA 4QO8A 3AKZA 4U9IS 4TMZA 2J3KA 1HTBA 1L2TA 4I55F 4RULA 2D8AA 4NFSA 4KWTA 3AKYA 3B3AA 2J6IA 4FZVA 3V34A 5KNLA 4R0VA 5JXJA 4HGOA 3T1TA 3SEQA 4BVJA 3OIWA 1PFUA 1ULBA 2OR3A 3ELUA 3U4QA 2JG3A 1GPDG 3NFRA 3R24A 5MFPA 4TKUA 5G53C 2RGNA 2G82A 2VCHA 2JB9A 1HE3A 1R4NB 4BFWA 4QFDA 5I7VA 4O3MA 2HY7A 4WOCA 1KI3A 2H5LA 3CBGA 3SC2B 4QXAA 4MP6A 4RY9A 4AJ4A 5CG1A 3S1LA 2V5VA 1MXFA 2Q5HA 3ORFA 1MVNA 3VPXA 1Z3IX 4X7PA 1UKBA 2IUFA 3FHTA 3ITDA 2AXPA 1HUQA 5ALIA 2FR0A 2QSUA 3Q9SA 4IHJF 2Z08A 1THMA 4L5BA 5EWJA 5E7MA 4D96A 1NTOA 1VFNA 4ZMBA 5JASA 4FNOA 1Q7BA 5LOVF 3PZRA 2CHVA 2JI4A 1FW8A 1L9XA 3A70A 5LZ9A 1NI3A 4FNMA 1CY8A 1KBOA 1OUMA 3QVOA 4ZO7A 1CP3A 4AF8A 1YBVA 3EF1A 2XNCA 2ORED 3LYHA 3DJYA 4FHGA 5EJ2A 4NK4A 1CR6A 3ZN2A 2PT6A 3GELA 3G3EA 5KC8A 1WM1A 2JHPA 2EWMA 2WOOA 3CU5A 2W2LD 1JVNA 5COQA 4ZAFA 1GSIA 3GQVA 3TLCA 1AKUA 1Y3HA 2BZ1A 3CINA 4LTNA 6PFKA 2XCUA 2B6NA 1RP7A 2BN4A 1HNWB 1T5LA 4EP1A 3O93A 4TYPA 3HJFA 1ILWA 3GFFA 2AYXA 2D2XA 2DPLA 2ZRIA 3Q85A 2OBMA 1CY4A 2UAGA 4GSYA 4HZUB 4EFNA 1VBFA 4BKPA 1PQUA 3U3RA 1ORDA 2MYNA 3L7DA 2QLTA 4NICA 4G67A 4ZYTA 3EASA 3U3MA 2IY7A 1IFXA 4P1ZA 2OMKA 2QU7A 2ZIWB 4PZEA 1UBJS 2NUTB 3PE4A 5L7YA 1EK0A 4B83A 4B6FA 4C7KA 1CFJA 3PDJA 6REQB 4MQFB 5EMJA 3HO8A 4EKDA 1J5XA 2NYRA 2P9CA 3L46A 1YL5A 3WWDA 1H66A 4PNHA 4YJDA 5HJ5A 3RVSA 4OXQA 2GBCA 3I04M 3CZQA 4HCJA 3URKA 1QRUA 4L7VA 2L2QA 1JR3E 5EGSA 1E9FA 1EGVB 4TUYB 1TB4A 2Z2JA 4I5FA 4IIXA 1I5OA 1J99A 2ETVA 2OA0A 1Z73A 3RYHB 3WWOA 2FSSA 4HWTA 1XLVA 4BQEA 4TN5A 4OOFA 1JR2A 4ON9A 1YRYE 1JDBB 5JR3A 4UREA 5H68A 2NXJA 1P0CA 1QS0B 5A7FA 3BH7A 2QSYA 4AO7A 1P0PA 1R50A 1UBKS 1W0CA 2OZPA 2PX0A 3HZOA 3UY4A 3ACCA 5LDDC 2I54A 1PSWA 4Q7KA 1V3QE 1CQIA 2VAMA 1TZBA 2Z5LA 2ZBQA 3AJ9A 3TR6A 3WNCA 3EGWA 1W5AA 2B78A 3TLKA 3C1OA 4LE2A 2DY0A 4B82A 1BWPA 4BBPA 1NOJA 3OKPA 5J2TF 3SDSA 1OFIA 3TDNA 4BTVA 1NYTA 4PGHA 1J8YF 1RJFA 2HWUA 1Z5GA 3BC1A 4JJAA 3D7MA 3WA6A 3V9PA 5GIPE 3CSDA 2QG4A 2OCLA 5AM2A 2PXHA 3AB8A 4XLTA 3ZE7A 1RYZA 3WK6A 1HF3A 4LEIA 2G4LA 2Q5CA 4DCNA 5BQ3A 4D8TA 1XZKA 2YJ4A 4X41A 3U4DA 2G17A 4S1OA 3FKSA 5FA8A 3F8TA 2WRZA 2FLKA 1UWVA 4RADA 3T9CA 1FL9A 4MOWA 1ZUNA 3OQMA 1U3CA 4AJNA 1TU3A 4GHWA 1O5IA 3M4NA 3TJRA 3S1SA 3DKVA 3MERA 4NCNA 1BC5A 2IE8A 5FUXA 3ZDBA 1J0CA 5E6SA 4LRUA 3W6NA 4ALNA 5IDXA 3OMXA 2F1OA 3E8XA 5ALGA 2PSEA 2ZYAA 3MMNA 4H9GA 4J2TA 4QEZA 3UXYA 4MDEA 1X8XA 1SHJA 2B5VA 3NOVA 4MS4B 2EOAA 1XCGB 1ZD3A 1K98A 2SECE 4PHGA 3OF5A 4L4SA 4B2IA 2AQIA 2GEVA 3Q3EA 4KYTA 3PWTA 1D6SA 1RAFA 4DUYB 1KF0A 2FP4A 3IEIA 3A9TA 4ILKA 2OXTA 1G6HA 1Z0KA 4BUZA 1O94C 1NXWA 3FCAA 1C1DA 2AHRA 3BMNA 2Z8YM 3L4EA 4FCVA 4LCEA 5DU2A 5BYBA 4CDMA 2GEUA 2IYEA 3KEMA 3MW8A 1QQAA 4C9BA 4JZKA 4DGSA 2YOGA 4KB5A 4DAOA 1CUJA 4OEHA 2O3UA 3W1WA 1T0JB 1JN0A 1OGYA 3I2KA 4CM7A 4D45A 3B1KA 2M1XA 2PQ6A 4LZNA 3FKJA 3W8DA 5H1YA 4YX9A 1JSXA 1K63A 4G41A 2BD0A 4BE4A 4BX8A 5AHXA 2NUAB 4P86A 4GM4A 1T3ZA 4P5PA 4B0PA 1R12A 2A9FA 5IP5A 3PUJA 1VCOA 2Y1CA 1ZQ9A 2NG1A 3GY0A 5E6RA 1E32A 4PPNA 4OJTA 3U3ZA 3QJ5A 4BCBA 4U8GA 1L5HB 4Y8VA 2IZZA 4BNNA 1CZRA 1KFCB 1RLJA 1XTIA 3C3BA 2P75A 2O1XA 3FMIA 5JQGA 4W5OA 1CS4C 4Q1AA 3AM4A 2ZT7A 4MMZB 1LJ8A 1Z6AA 1BHQ1 2P1ZA 2GJ8A 2VHZA 4JLMA 1C81A 4UTZA 3WL4A 1LNSA 3B9PA 3CLRC 1FF9A 5TQ0B 4OXYA 1I3OA 3F4BA 4O2AB 4C78A 4QASA 1NNSA 2Z1DA 4OQFA 2A86A 4GPBA 1GO2A 1OFTA 1NJGA 2EGGA 2HHJA 2ZUCA 2AR7A 3EGXA 3G8DA 4NR0A 4S2UA 4BIIA 4C7XA 1SN7A 3R3UA 4BN5A 4YDRA 2YV2A 5FNZA 2P2NA 2BTQA 1WETA 2CLDX 2LW7A 3M1IA 4QUGA 3T1NA 2SCUB 3JYQA 1GPAA 1GU0A 2F3PA 4GH5A 4U6QA 4JSRA 5IBQA 1TA9A 1FDRA 3Q3IA 5G4KA 1Q16A 1BQEA 1NASA 1IYZA 1EUDA 2I2DA 4HLUC 1TKCA 4KIWA 4GZ6A 3IKMB 3PC7A 2PMKA 4KBFA 1W1WA 4WXPA 4J16A 5DMXA 3LC0A 1BYUA 3N8HA 5EKSA 1ZIXA 2RI0A 4RH1A 2JVIA 3L7CA 1OX4A 4IXNA 3I6IA 4D9MA 4DWJA 1K66A 5DHQA 1XNQB 3FWKA 5FA6A 1KSFX 1RWBA 5IH3A 1GQQA 4MR8A 5KVCA 4HOYA 5KTOA 2R1ZA 3QVJA 3THXA 5KYYB 1T1GA 4LV8B 1TCVA 4R8RA 1IBMB 1BGVA 4XM2A 3VNQA 4UXJA 5EJ5A 3ZU4A 3QFFA 5A7GA 1N5JA 2QK4A 4ESVA 1RAGA 5AOBA 3SICE 2I0FA 3LC7O 4H31A 4K5QA 5JHHB 3ND5A 2WDPA 1DI0A 3EH2A 3GDWA 2CL6X 4L85A 4ZA2A 2G5TA 1BNCA 3R9IA 5J1SB 2GM3A 3GFPA 5M2QA 3EEQA 2ATXA 4GQAA 2OXFA 2P35A 1UBMS 3R0QA 2GBPA 4JB8A 5DWVA 2DQSA 1FXSA 3FNEA 1XEAA 3GP8A 1UWLA 4YALA 2PL1A 3RIYA 4HQ6A 3JQPA 1L4HA 2EHDA 4M4SA 1WUTA 4B34A 5F1YA 1UKVY 2FEAA 2VZ0A 1P9WA 2PJZA 2W90A 3KSRA 4OO3A 2D0OB 2GAFA 5GM1A 5B3JA 3MGBA 1W94A 1JFVA 4M9RA 5DTMA 3RJZA 4P35A 2BE9A 1K4MA 3F67A 3KNZA 4JBNA 2GDJA 1VM6A 1EJBA 3Q0TA 1M34E 4Q19A 4F5ZA 6YASA 5C9ZA 4DTIA 5JCOC 1ZIYA 2DC1A 3RHZA 5F51A 2EV9A 4HLCA 3C97A 4FC6A 4YK7A 4D25A 2O5EA 2A0YA 1E1RA 1LK7A 4GC9A 4NJOA 5U4QA 1M6NA 5B53A 3A2NA 2HGZA 3BRSA 4EDFA 4V3CA 2QLNA 3ZHZA 5EJ7A 4RPKA 2H11A 1K7YA 3LP8A 1JIVA 3PXEA 1EB8A 2O2ZA 1X1AA 1T0UA 3DE4X 1AM4D 4C4AA 3GR6A 4CQLA 3U4QB 1YMQA 3IQIX 1IWBB 1E3QA 2CLOB 3A58B 5IXJA 3FOEC 2VI5A 1A9XB 1YZUA 1YZ3A 2Q3EA 2W2MA 1U2TA 3C2QA 4JKOA 1UXIA 5I7UA 2OYRA 1KMCA 5JH7A 2CUKA 4I5GA 1FMFA 2PH3A 3W6PA 2WYWA 3TRHA 3I64A 1IJKA 2IIQA 2PQMA 2H4XA 4KTTE 4RE6A 4KVZA 4C29A 1UBGA 4WLNA 5F9MA 3GXOA 5ENZA 3V2IA 1P5FA 2VJBA 1I01A 2FWBA 2OMEA 1JQ3A 4H18A 4FKBA 1NE7A 4ZVNA 4WKBA 4YUWA 4CIDA 3A27A 1KFKB 2Y0CA 2ZYRA 2G9UA 3EZGA 4QGHA 4FJ1A 1A7KA 3WP0A 4CM5A 4YMUA 4BKMA 3NZEA 4NL4H 4DIMA 3NTLA 1QUFA 4W63A 2W48A 3HA7A 4RM2A 3DVQX 4WK4B 1EINA 3SYTA 4V2UA 3KQKA 1V7ZA 2OV2A 4XGRA 2I9PA 5DV9A 4FFPA 2VF5X 5HDQA 3G9UA 1LS1A 4GPEA 1N5KA 2VT6A 3CR7A 4OCZA 2OCAA 2ODTX 2V6BA 1JA0A 5DFAA 1HPLA 1ZUIA 5KX5F 3CM0A 2NV6A 3MMZA 5HKBA 2I9KA 1X0XA 4D3SA 4B87A 4RFSA 2P8JA 2HA5A 4ZDKA 2O4CA 4HAOA 1RWXA 1NP3A 2NNWB 2WVJA 2XXAA 4KVGA 3KXLA 4X20B 1LBHA 1ZO8A 2EIXA 2Q1WA 3U09A 4FE3A 5F7JA 2IH2A 4DLSA 3IP1A 1FW6A 4JYAB 4HZUA 3HDQA 4CT4B 5FQOA 3FCSB 4C4OA 1H4VB 2D1QA 3TZQA 1E2IA 1Z56C 1T9DA 4RZXA 3QF7A 3QENA 2YV4A 1FFDA 2QGNA 4DRXB 1QVVA 5COBA 5CU7A 3GB9A 5EZSA 2CCGA 3W2IA 2NTNA 2NYAA 3QBVA 1ZVKA 3A6KA 2ECPA 1Z4QA 2CXRA 1RWQA 3T3EA 4LBWA 4CF3A 3H3FA 2ZIFA 4C14A 5LU8A 2BFFB 3ORYA 3QI2A 4QUBA 3DFFA 5KTYA 4WBSA 4DMGA 4X8LA 1DP4A 1RM5A 3NB0A 2VTEA 1VI6A 3H4MA 3N8GA 3E7FA 1C29B 2FPWA 3IKTA 2IYXA 3K5PA 4H7DA 1UMBA 5F1PA 5B3KA 2A9OA 1S4MA 1PTJC 4PX3A 1TJNA 3RYHA 4KU4A 4URFA 2WFMA 4K7JA 4WV3A 5AK0A 3IA2A 4TSFA 3QFCA 4W9NC 5FI0B 5CFLA 2O8FB 2I6UA 4BKUA 5TPZA 2GHIA 1N5MA 3WGZA 1EFCA 4DYDA 4KXQA 3V8PA 1RDFA 4DZRA 1QS0A 3IQGX 4LSGA 2CV1A 2QM3A 1OJLA 2WABA 3EZ2A 2WG2A 4P9NA 3VTKA 5B64A 1CT9A 1ZA1A 3AP1A 4I9HA 4L6AA 3HYTA 4KXVA 5DEIA 3VVCA 4DKXA 5CIYA 1HX7A 4F11A 4BNYA 4KQ2A 3K1AA 3ELBA 3WGLA 4ER3A 5E4YA 5GVSA 4AY3A 1TIKA 3PGVA 4KI7A 4DEYA 1EUYA 2H1IA 2HO4A 2Z6QA 2PA3A 4CV0A 2XBLA 3P52A 1FLNA 4IWYA 3SOZA 5I9TA 2C4WA 2FEXA 3O26A 3ML1A 1Q17A 4G23A 4R69A 3P45A 1UBCA 1X15A 4HDCA 4M0DA 3GDOA 3A1VA 3WLEA 4EPWA 2D3WA 1JLMA 1DC7A 1LX6A 4FHEA 4N4AA 4LNUB 1E3IA 4M1TA 4QHSA 4YQEA 1V8BA 1KY5A 4M1ZA 4BO7A 3IV9A 3FMOB 3IDOA 5D3KA 3DL7A 5HDBB 2W43A 4Z4CA 3SYLA 1YKGA 4TV9B 1GRVA 3S2GA 5B57C 1XDGA 2P1DA 2PGJA 5JCZA 2VTBB 1ZUNB 3RTCA 3HRIA 1GZ7A 3SEZA 5CA1B 4DDHA 2AG5A 2WTMA 4D4MA 2WUWE 3A4TA 3K0AA 2H06A 3MJRA 2WHQA 4W5NA 1VL6A 3PWZA 4E03A 1KZ1A 5HYVA 2FOXA 2YFHA 3TLYA 1QQ6A 4E6EA 3V7YA 3S70A 4LJ5A 4MS4A 3LE8A 4YC7A 3UAYA 1ODLA 5D6OA 1KKUA 3S7ZA 3DDUA 3FUWA 2PPLA 1W2GA 2W22A 5FWDA 3HNPA 1DBVO 1JEQA 1ECFA 3KKEA 1OIVA 5AHKA 4L8FA 5T7BA 2QTAA 1C1DB 3PD7A 4J1TA 1IZ8A 5JXIA 2CL7X 4HY3A 3TXYA 3RC2A 1FTGA 1JQLB 1L3CA 1RBMA 3WHLA 5I48A 1H4QA 1YL6A 4HSEA 1NUSA 5L3RA 1JG3A 1FS5A 1QE5A 2JH3A 4JT4A 1G8GA 3D7KA 3MAJA 3K2BA 3MGKA 1OZ0A 5G0WA 3SZGA 3U1TA 5KNBA 2Q0XA 1PFYA 3WL3A 4WK2B 3WMFA 4E31A 1RLIA 3RF7A 4YO8A 1N3LA 1ZNQO 2GM4A 5C8XA 2ICAA 1Z7BA 4YRMA 2NUAA 4F85A 4UMVA 3LT5A 6LDHA 3D3WA 5E6RB 3IB6A 1D2GA 5CX1A 1PD0A 2OO5A 1L5HA 3RKSA 1EVEA 4F7WA 4I4TA 3C98A 5JQGB 2DERA 3PQ8A 5KMGA 3OCYA 4IGFA 4HYQA 3M6AA 3NONA 4X7BA 1SXJB 1IN7A 1LPMA 5K4AA 4EHHA 1CC1S 4IGEA 1U0LA 3NHMA 1JPNA 1DAMA 2RHGB 4JN6B 4OP2A 1Z7WA 5TQ0A 5ARBA 4YAGA 4OB7A 3RCBA 3A6LA 2RSLA 1T36A 1OLXB 1O8BA 3NHFA 1FNDA 4LC9A 5CD9A 1XXHE 4PRYA 3ES9A 5GJWC 5K8VA 4JS0A 1N0UA 1D6JA 3GI1A 4M7PA 3O4RA 3G0GA 2W00A 3C3KA 4TTTS 4BQOA 1GAJA 4UFNA 5JVDF 4C30A 3PFHA 4I6JA 2QOEA 3BCSA 4U7GA 2SCUA 4F93B 5EXSA 3RSOA 4X85A 1BE0A 3OT1A 5G4KB 4ZHQF 3NR2A 3TL3A 1WOYA 2I7DA 5IJZA 3JQ8A 5KYWB 4BO0A 3S2IA 2ZJBA 1SBIA 2EBHX 1J1UA 3HCFA 3N87A 5K20A 3ZI0A 4YAWA 1YXMA 1KIAA 2RCYA 2C5HA 2JLYA 1YTLA 4OHUA 2RI6A 4NCBA 1T3SA 4FYWA 4BNKA 3JVUA 5KZMB 1BMFD 2QIPA 3PYMA 1N2CB 2Q1UA 1FYEA 3O2QB 1N2GA 1W52X 2J30A 1WZIA 1M2OA 2HA4A 2HWKA 5KB3A 2BUCA 2D2IA 1J8FA 1VECA 2VC2B 5AWFC 3VJMA 4E3ZA 2HPZA 4YMWA 4C4ZA 1GNPA 3LY9A 2GPSA 3F7NA 3N6VA 5EUBA 4NWIA 1PTJA 1H5UA 5IDVA 5ISMA 5K0ZA 3DCJA 1DFIA 4I5EA 5JSHA 4JYPA 1CUAA 1Q6ZA 5CIWA 4QVIA 4YASA 4ZXFA 5CB6A 2DTXA 3IQZA 3FPGA 1GQ2A 1P2DA 2JFZA 3T4UA 2J3JA 5CLIA 3UG6A 2QJFA 4NZMA 1AHPA 2Z9CA 2ID7A 1QDLB 4NBUA 4G37A 2F1RA 4CR7A 4G0PA 4I08A 2IYAA 1O9HA 1E3TA 1H1TA 2EW2A 3E4DA 3NGMA 4L5YA 4YAOA 4HNAB 4ZPJA 5DYIA 3WGGA 2OL4A 2VRWA 2YH2A 5F7OA 5JT1A 4PAGA 3ICEA 1DO2A 4MROA 1FUUA 4UHCA 2PUDA 1BWSA 1PX0A 3E84A 2FN8A 4NU6A 1X9HA 3U13A 3GH1A 2WF6A 4AUMA 3NH6A 4BXOA 2WZBA 1KGDA 1G8HA 3T3MB 2ZUVA 4FFWA 4ENTA 3TXXA 5FEMA 5EJ8A 3G85A 3MTBA 4ZO8A 4DIBA 3NM5A 1C9KA 1HE2A 2Q4EA 3E5MA 3ADDA 3VSEA 4AM8A 4GMXA 2C9YA 3QUCA 1DDIA 5HW0A 1JT2A 1M6EX 5LKAA 2P65A 1H8ED 4X97A 3D0RA 4ENQA 3R76A 5JXHA 5CNMA 3SWWA 3KB6A 1HDOA 2XRYA 3SIWA 3VBEA 1ZJYA 5IVHA 5FIUA 2J3DA 4MGYR 2ZI7A 2IS6A 2HRQA 3NYIA 2JS7A 1Q1BA 2ON6A 4WW0A 2NPOA 1FMLA 2PGNA 3K9WA 5HCUA 3IALA 3H13A 1NE2A 1XAGA 3ENNA 4FFBB 2ERCA 4FN4A 2X5NA 2IPMA 3H83A 4HDRA 4BV9A 5IBCA 3SSMA 1D1PA 2CBXA 4WIAA 3NHSA 1Z8NA 2BHRA 2O3RA 1XLTA 4BZWA 4AY6A 2F2TA 2HA2A 3FPKA 3H0EA 2ALJA 3DOOA 2WF7A 2QZ9A 4YCCA 2RB4A 2HC9A 5LJLA 2EVWX 1A9SA 1YVRA 1B23P 1W75A 2BGUA 2KMLA 3EBOA 4FD3A 3ZE6A 1YS2X 2ZQ5A 3LPAA 2JANA 1RPTA 1T8YA 2NO1A 4N40A 3TNYA 1ZRNA 5GQSA 4H1TA 4B5KA 3N0WA 2JI9A 4ND7A 3O92A 1OI7A 2MYTA 4OB8A 4RACA 3RQSA 3WL5A 4I1RA 4XD2A 2HJVA 1M1XB 2LKCA 4Z49A 9ATCA 1RWVA 3H3XA 2V5UA 4BKRA 3ZWWA 2H85A 2YNMA 2QTMA 3MXTA 4MZDA 1GGVA 4XGKA 3E27A 5AM4A 3VHXA 4MJ7A 3QHQA 2QL9A 4RY8A 3PCXA 4X24A 1H8HD 4YONB 5THXA 2TECE 3DDWA 2C2BA 3OWHA 3LA6A 3NRJA 4GLJA 1ZA2A 1VBNA 1JU9A 2G40A 2QI9F 3OLWA 5EXEA 3T38A 4ZDIA 1WUIS 3P2OA 4MUGA 4FR2A 1NN3A 2IHYA 4EL0A 1ZS9A 1EUQA 3AR3A 1OZHA 4DR1B 4ZALA 4BJ6A 5JD4A 1QZTA 1UP4A 3IJPA 3WYBA 1JTEA 5LN1A 1FU8A 1HT3A 1UMBB 5L51A 1UZMA 3NETA 3X2SA 3QKWA 1IXKA 1HH4A 1KXZA 4JMLA 3C3DA 4MPDA 4E5KA 4JUDX 5C8DA 2XYPA 2RGCA 4M1YA 4K9SA 5JMPA 2HXSA 1PWXA 5EL0A 4LE0A 4DY6A 4I4CA 2QE7A 4MUAA 1EWYA 7ABPA 3WA7A 2XNSA 3AOEC 4HPJB 5EP1A 5G3YA 2ZZKA 1AQNA 3QE9Y 5B36A 1G21A 4R1NA 2Q21A 3UEOA 3ZKWB 3TMKA 5FB3A 2HWYA 2BGMA 1NKVA 2EF0A 2R4UA 1O95A 2LCFA 1J70A 2WPDA 4RDCA 1WXXA 3K1AB 1RKXA 1NVMB 5HF8A 4KFCA 3IH5A 2BF7A 5G40A 1JDUA 1O77A 1SQ0A 1IAQA 4E4YA 2BP7A 5EXXA 3KXDA 1U7OA 1AMUA 1K4YA 2HA0A 1T9CA 5AVVA 2I4LA 3LCMA 4JGBA 2E37A 3OZXA 5H83A 4JLJA 1WULS 2ZR9A 2BKVA 5DCUA 5DGIA 2M9MA 3OPNA 2HU8A 3QP9A 2AG0A 1GRQA 4JI6B 4DA8A 5C5CA 2V7WA 1WUHS 4URWR 1DWOA 1BXGB 3DZDA 3LQ1A 4KHZA 2D5BA 2C3YA 5IYZF 4CT0A 2C2MA 4B40A 4BEJA 2ZEJA 4TV9A 2ZR0A 2Q27A 4ZHQB 3IPCA 5BVGA 4RZSA 2VTBA 5HKKA 2V0GA 4L3WA 4MO9A 2FUEA 3BHJA 5CA1A 4R31A 3SXUB 1U8YA 3L0PA 3MRSA 3NRCA 4HGYA 2VYVA 5JVDB 4AZSA 1NQXA 3U7HB 3WRYC 1SXJC 4FKMA 3IL2A 1MB9A 4TWZA 3ITEA 4OHYA 4QPZA 2ZYDA 5GAJA 1MT0A 3U4AA 1XMOB 4HRXA 1F2UA 2IKSA 4FT2A 4EKIA 2EIHA 1F0PA 1E7YA 4XJSA 1OV4A 1URPA 2H92A 3QVUA 4ZQBA 3GIDA 5G2OA 2NU8A 7ADHA 3FWHA 1XLWA 4D7AA 5T67A 3MRTA 4HH3C 3QFRA 4ICIA 4WLUA 2YXDA 4RKQA 1HTWA 2XA1A 5DBEX 1E7MA 3C7TA 1K7XB 2V55B 3DEFA 4PZLA 4EECA 2FPXA 5DDIP 1SCUB 5I45A 2AOVA 2F48A 4MW6A 3T95A 3VTAA 2RE8A 5BV1A 5ITWA 2A58A 2VT3A 3BSWA 3KZOA 3LM8A 3NJRA 2ILTA 3B1XA 1Z63A 3RAGA 4OU4A 3ZDCA 3GCWA 4X92A 4BZZA 5LQCA 2PZJA 2E4WA 4IEEA 5KYGA 2J9GA 1XG5A 2IZ0A 4PZAA 1SUFA 5AVQA 3FPSA 4HVLA 5F7XA 3NOXA 1RM4A 2OZLA 4UHJA 4OHFA 3A1UA 1GG2A 4IBOA 2GFIA 1V1MA 1XD8A 5CX1B 4AIIA 1L4MA 3T4XA 2J85A 2Z6AA 1PQWA 3ZGXA 4AF7A 3OLYA 2V8BA 1J9GA 5ADVA 2E0IA 5KMGB 3HN7A 4KGXA 1QYIA 4GOXA 2A0FA 1ORWA 2Y1KA 4HH1A 3AG6A 4IJMA 1V45E 4GC5A 2CB0A 3U4IA 4H1UA 5AI0A 1A8IA 3FLBA 3D3KA 3ZI4A 1C3XA 2GFQA 3ZJTA 3B2NA 1DC5A 1L7RA 1OXMA 4PEVA 1OLXA 3EOZA 5BUQA 1A7AA 3P4UA 2CNDA 2XA2A 4A5OA 2I67A 4AL4A 1AK1A 3EPPA 4KH0A 4XWOA 4KZKA 3DC7A 3KQTA 4NFYA 3EOAI 1T9GS 5TEVA 4IICA 5LMCA 5HOEA 1L4KA 3TOXA 3BRWA 4K26A 1EVQA 1C9YA 1GFSA 3MS4A 3DOJA 3QJYA 5CNIA 4IJWA 5BV0A 3ZV3A 2Z98A 4POAA 4N5LA 2REQB 4IKPA 4Q48A 1O95D 4E22A 1U1GA 3HBJA 3WR5A 4HGPA 4K8RB 5EGNA 3ELYA 5LA6A 4KXMA 2YNMD 5EE1A 3LGAA 4K81B 3K70D 4QODA 1XELA 2B0JA 3PXDA 3L43A 4FYMA 4GBJA 5FBRB 2PS1A 2A0UA 5B12A 4GL4A 5K8LA 1JIXA 3TW8A 2D3TA 1IUNA 1H1LB 2DHEA 4P54A 4RNDB 5HQ3A 4IDEA 3ZCTA 3LS2A 4CVNA 2VRCD 1GAEO 1U8CB 2AEJA 3DZBA 3BXPA 3EVDA 3L04A 1SHTX 4JBHA 4ZZ0A 5KWIA 4YT4A 1I2DA 3QXCA 1TAUA 4X8OA 3HXTA 3REOA 3V1UA 3WSVA 2GJAA 3IP9A 4JUIA 4UBKA 2NO4A 4UUBA 3I6MA 2EZ9A 3B82A 4X00A 3INGA 5TEWA 1E1KA 2NX2A 2G6BA 3AY0A 4PG4A 4EMTA 4G5XA 2F43A 2E5LB 1EDBA 2HL6A 3WYEA 1UQRA 2R9VA 1L4EA 1TYEB 2PKCA 3MT9A 4OP1A 4PXSA 3HJBA 3O82A 3WLLA 1PFVA 3M9LA 2GM9A 1EG2A 3QPUA 1SULA 3V8NA 1W6UA 4GI1A 4F38A 1Z6QA 2HAEA 3B8EA 4GOLD 2AMFA 2R6AA 4J03A 3LXXA 3ORRA 5FOWA 3VSAA 4J2OA 4HNAA 3DUFA 1UFOA 2WB4A 3EBPA 5B6JA 4ZJYA 3KFLA 3SBEA 3IIMA 3P4XA 3UB4A 3JRWA 3EA0A 3ZYZA 5ANRB 3GCDA 3OF2A 3NIBA 4Y2JA 3O3NB 3RFTA 2J5RA 3IB3A 3FTDA 3VR3A 4QUDA 2B21A 4IFIA 4F2HA 4J4TA 4DBLE 5LDHA 4WY5A 3EC2A 2CNWD 5IS2A 4D3XA 1YS4A 4HQKA 5LM3A 1N92A 1JFLA 1KHHA 1TOAA 2PRZA 2NVBA 1OW3B 4P81A 5J4HA 4XCXA 4RKFA 3F8SA 3LLCA 3CUSA 2RK3A 3HHEA 3QVMA 4FEGA 3UICA 1SZJG 2ERYA 4L27A 4ENVA 2OUIA 2XTZA 4EYEA 1G17A 1U2SA 1P1KA 4HF7A 5CFMA 4V0KA 5GINE 2IOFK 3RTAA 4A0SA 2XCOA 3SJCA 1TZMA 3K8OE 5JY6A 2D7JA 3JASA 3GBSA 2VR1A 5LFAA 3BD9A 4DARA 5CVTA 3W7VA 4OLBA 4CUZA 3JVIA 3I28A 1N9GA 5HXAA 5JALA 1MTZA 1LGYA 1JJVA 1TNDA 1XHFA 2ZK7A 3NI2A 4HUJA 5IDYA 4F84A 3U48A 4GQIA 2CEAA 3L7IA 2GF9A 4PTLA 2WAMA 2UYCA 4M7WA 5EI5A 3UW1A 3HCDA 4JI0B 4MDHA 3H5VA 4N03A 1GGHA 4N82A 4WL0A 3MMPA 4XUDA 1Z74A 2JFYA 4HDRB 4J76A 5BSGA 2X76A 5CFOA 3KOZA 4MWBA 3WGYA 2A5DA 2O0HA 2AOTA 3JTMA 3KO8A 3QWFA 4JR2A 3NTOA 1F0KA 2RIPA 3QSGA 2FI1A 3WKEA 3ST7A 3O7WA 1I10A 1U5BB 2PGIA 2ISQA 1RPJA 5IJ9A 3WICA 3WLPA 1PL7A 1GKKA 2JFNA 4BNZA 4B3IA 2XDYA 2QP3A 1NOKA 5BV7A 3PC8A 3K0CC 1NBAA 1L5RA 4ZODA 1GLVA 3GLRA 5H3HA 5TE9A 3UB2A 5LVAA 1MEOA 2KE5A 4OHXA 1P9LA 5LXTA 3EWIA 3IESA 2P5UA 1PZEA 4JI2B 2ZYGA 3ABSB 3QNUA 4KQ9A 1ZCFA 2MWMA 1SIBE 3BN3A 1W5EA 4OYYA 4YMIA 1FP6A 3BORA 3B38A 3VHXB 2FXIA 5JNWA 5FH9A 3RRNA 1ZN7A 1ZM7A 2NO9A 1TIBA 3GLKA 4BECA 2H2WA 2E85A 4URVR 3DBIA 3NWBA 3QF4B 3TLMA 4O0LA 3ICCA 5AI4A 3F3YA 5AKEA 1NPDA 3TB4A 1V71A 2I4TA 4TSFD 3ICWA 1O6FA 5LP6B 3LF1A 2A14A 1DELA 1NQVA 2XY4A 1BJKA 4E2YA 1KORA 4LHZA 1N25A 2QRGA 3INYA 1CY6A 1I2BA 2Q3DA 4ILEA 3PNQA 3M3DA 3MWEB 2RGEA 4JEUA 3HE3A 1MIOB 5TLSA 4G8JA 4FE4A 1A76A 4UD6A 3WIBA 4YIHA 1PV2A 1U7TA 4X0EA 2F67A 2FPPB 3EAQA 3PFNA 2BTEA 3LDUA 2QRQA 4XW2A 3HP4A 4CUJA 3DD5A 1BOFA 1FZQA 1G21B 3PQ2A 2JFGA 3M5CA 1RAAA 2DJIA 4JNKA 3ZKWA 4UEQA 5CBKA 4N0EA 5GONF 3S1AB 4YRAA 3C8ZA 2JDIA 3GD5A 3LQKA 4G56A 4F97A 2OXCA 3K6RA 3LBFA 4JLPA 5EJAA 2OILA 2O3SA 3HBLA 3TZCA 4CIVA 3TPFA 2CNLA 3L7LA 4BLVA 2J7KA 3KE9A 2A5JA 4XWTA 3ZHOA 2OFWA 2X1MA 3QW4B 3LDHA 5AIBA 2E4XA 3DKIA 4FHDA 2C59A 4LUCA 2R8EA 1T1JA 4P3PA 4H15A 1LH0A 3RRJA 4P08A 4LZWA 4OQLA 1PDWA 1M2NA 2IPOA 1WOMA 4L4ZA 2CLCX 3BE6A 4OHPA 2Q1XA 5F3RA 3ZY5A 3FUTA 3GBVA 3JS5A 4EHNA 1V1RA 2XKBA 3PI6A 4J7UA 1BXGA 5LZ2A 4IHAA 5AQEA 5CVDA 1H93A 1S1CA 1CNEA 1T8TA 5FOQA 5BVGB 2IQ5A 4N47A 1IY1A 4HLNA 3LHSA 2VCYA 4A6XA 4LWPA 3GUVA 3ECCA 4D8WA 3FMVA 1T9GR 3HEBA 3RBZA 3QV1A 4TMFA 1XDBA 5JVDA 4ZTBA 2QD5A 2EQAA 1YZVA 2EQBA 4NX2A 1ZUHA 4YAJA 1OZGA 2UZ1A 2GEJA 4B7XA 2BMVA 1FXWF 2W8ZA 2F1HA 3PICA 4TS9A 5TQ2A 3WFZA 3QUTA 5CDUA 3I5UA 5AW6A 1ISRA 1R6TA 3M89A 5H70A 1QYDA 3OCWA 1TLTA 1U1DA 4Q4AA 3CW9A 4HFMA 1KARA 3EWSA 3ZIAD 5KNCA 5HS6A 4MGKR 2XCSB 5LPNA 3FNBA 5IVPA 3ASYA 3GEEA 3UWOA 4DG9A 5HFNA 2VYND 4OSPA 2ZKLA 4GXNA 4MVYA 2V3VA 4OSOA 1FCJA 1E1QD 1JMKC 1KKMA 2BW0A 4R8KA 2SKDA 4X1YA 1WO8A 1GRNA 1PLKA 4NYMR 1JWBB 1NT2A 1OFUA 2BI4A 2PLFA 4EI2A 2V7PA 4ZI7A 2DFKB 4V1CI 3CBQA 1Z47A 1JBKA 3EW7A 2O23A 2Q2OA 3QXXA 4HDOB 2REBA 1NM5A 4B84A 5AW1A 4Y2PA 1SEPA 4JCOA 1YS7A 1Q1ZA 4NOJA 4R5MA 3S27A 3WYCA 2OZLB 1PN3A 2H5IA 3E7PA 4N76A 2JJ8A 2WHEA 3Q6IA 1V1MB 1GPYA 1ND5A 1EFVA 4KN9S 3UHFA 1TM7E 1E4OA 1RM0A 1SHKA 1RC8A 5AT1A 2WMDA 3BH0A 3M4XA 1I6MA 3F6CA 1XCMA 4GDMA 1LBSA 2ODQA 2C2GA 1X7DA 1V6AA 3LDAA 4DLUA 4PYNA 4S24A 5E7QA 2O50A 2R44A 2Y1GA 3LFTA 4X63A 5HILA 4DPMA 2EXXA 4NF2A 4BGIA 3VH3A 1JHRA 4QX6A 2VF4X 4LI0A 5TDHA 1Q57A 5SY9A 2VZEA 4I7EA 1FNBA 1LBIA 2FE4A 3LL4A 3OESA 3CPSA 4IQFA 1GSOA 1KQOA 3ENQA 1EP1B 5K8TA 4CEIA 1BA2A 2BJHA 2F4NA 3HA2A 4J9UE 5JFOA 2F00A 3WJ2A 3OJEA 4D4LA 3ZD7A 2IRWA 3GJQA 2ZKIA 1F4LA 2XOEA 1MAWA 2YVQA 4FGSA 3N86A 1ZICA 1KQ3A 5CA1F 1U1IA 4R6WA 1X7ZB 4PGMA 4PAWA 3PQDA 1K2VN 3LKDA 3LHIA 3SQWA 3FNGA 1U9ZA 1I5EA 2R60A 4TV9F 5DHTA 2VDVE 5HUQA 3PK0A 4DR6B 4Y2QA 3GVXA 4BUJA 1I33A 3FYUC 2NZWA 2W2VA 3IT1A 1UM8A 3CXRA 3OIVA 3TW8B 2IHUA 2QQEA 2O20A 4M3NA 4V02A 2GEFA 3W77A 4BVAA 1H1LA 1UZUA 5DSTA 4BWGA 4EA9A 4F9TA 5CITA 5HQ3B 5KJ1A 1ONSA 3MTDA 2JAWA 3SD7A 1FUIA 2QDKA 1D04A 2CDBA 1SXIA 1DSSG 3DYIA 3E82A 5J4KA 3H99A 4Q82A 1VIVA 2X0NA 2B0CA 1ZK4A 3RSZA 2V7UA 1CCWA 4UCXA 5AOCA 2X5JO 2ZSUA 2ZYSA 5KNDH 4EGSA 3QKRA 4EHKA 2R65A 1QB7A 2C4MA 4JOQA 4O08A 4E2XA 4OQEA 1P3DA 3RYTC 3TUIC 2Y6UA 4CR6A 5BWMA 4FR0A 2J9YB 3PFBA 1E4YA 2WHRA 4CJXA 1NI5A 3GAZA 2PK3A 3HA5A 5CCEA 3EXG2 4PINA 5LLTA 1KP2A 1LRLA 3OHPA 2HHCA 4MAMA 1YI8A 4TTIA 4ALLA 3G6WA 3A9SA 3OECA 1WLYA 2QRUA 1F8YA 2Z30A 1XYGA 3AYXB 4O8ZA 4J0IA 1U3TA 5I7AA 4ROSA 3VSBA 5K4GA 1BMFA 4EY8A 4AG6A 1NJ6A 2FX5A 3RDPA 1FFBA 2PTGA 3BTOA 4TQUS 4DJTA 2W2QA 2BH2A 5EIAA 4FM9A 2OZKA 4UUMA 2CXTA 2RH4A 4BO3A 4HEA1 2GEKA 2G4CA 2RI1A 5CRIA 5KYUB 1PO7A 4B80A 4FLEA 2JW5A 5EZ5A 3RG8A 3GYBA 2AMLA 1F2TB 2B82A 2H1HA 4ZVKA 2GN0A 3TEJA 4E21A 2ZDHA 4EUSA 2ENUA 4HDMA 4N3NA 4CG0A 1UT5A 1Q7GA 3VR6A 4HGZA 1TCUA 5D3MB 3G0BA 3HSKA 2OPHA 5IF3A 1U9IA 1D2AA 4WCFC 3RSSA 5JSYA 3R20A 4J1QA 4P5EA 2PRYA 3BJRA 3KQQA 4IMIB 3JASB 3G9XA 1IY8A 2PVSA 1XMSA 2B3DA 3O7MA 5HBRA 4YRGA 4C1BA 1N9GB 1M6VA 2IIBA 3IMGA 3IO3A 1F06A 1JHOA 2RAVA 1E66A 3BIXA 4WTOA 3QPAA 2NVUA 1YDHA 4ZEXA 2D0DA 5DCYA 3E7XA 1Y8QA 2ZR7A 3A4LA 1E61A 1V47A 5FWAA 4ZJZA 1M2FA 2FCRA 4PSKA 5E7JA 2BMAA 3VH2A 3PNBA 2CFTA 2O9JA 1EQUA 2XE4A 1B73A 4Z0TA 2AFIA 3JQ7B 3BIOA 3EXEA 1QORA 2AOWA 4PYLA 3DVSX 2MDTA 2O0MA 1MX1A 1W2WB 1GTZA 2CJPA 2D2VA 1NVGA 4IDBA 4Q21A 3DZFA 1EDZA 4X90A 5DNWA 3AO0B 5TB5A 1G9XA 5IJ9B 2F9FA 4D42A 1TQDA 1YVUA 2IHBA 4XX1A 1T6ZA 3A9RA 2QKYA 3LNCA 3D9QX 3DMDA 3KKKA 3B6ZA 1WF3A 3V1NA 4U5QA 4Q9JA 2D00A 5ALXA 1WXIA 4EY4A 3HGMA 3VJRA 2G09A 4ZK2A 3SJ7A 1DXQA 1GA4A 1YFKA 1Z2CA 1QQ7A 4US1R 3AZPA 1E2BA 1CUCA 3JSAA 3O90A 4GNKA 5CLHA 3U80A 1G7SA 1A9YA 1IHXA 3P9RA 4OKIA 4HNTA 5JMTA 3QSYA 2FN7A 2H8KA 4YTEA 5LKRA 2H7CA 1W0KD 2BFEB 2IGTA 1J8MF 5BWBA 3SKVA 5H4GA 5IX8A 3K2EA 4I55B 3P32A 3CVXA 4MCIA 3HWX1 2FHSA 1DDGA 1EEHA 1R0CA 2C03A 2ZE8A 5C7IO 1K5HA 2IBMA 5LP6A 4H6PA 3PS9A 4QUAA 4LCJA 1W93A 3LT0A 3UJ9A 2Z9DA 4HFRA 4HNGA 1CRPA 5CW1A 3MTQA 4IUCS 4MYRA 1TDJA 2PR7A 1BROA 1N2JA 1V5EA 2M2IA 4P2GA 4EW6A 2I03A 1KZ4A 2A9JA 4TMKA 1TVKB 3KEOA 3MWEA 5TNXA 4AJLA 3K4QA 4LJRA 1P8JA 3VYTB 4EFDA 4GWKA 2IZOA 4G5YA 5AOVA 1J5PA 4QLAA 1L7BA 3GL9A 5C0OE 5A2QA 3HCCA 4FYVA 1TZKA 1ZEMA 1YCFA 3L0BA 3ZEIA 3DDSA 1X80B 2J9FB 2B1IA 2W2KA 5EMHA 3AHGA 3HI4A 5IVIA 1ZX1A 5ARDA 3K3PA 3IBCA 2J5QA 4JQSA 4JVLA 3FPBA 4Y1EA 2XMGA 5L3ZA 4BLQA 2VYVD 3KDSE 2GCGA 3S1AA 2P5SA 1CEQA 2F55A 2CLMB 1ZK2A 1SIUA 1XWIA 2FZEA 3OKFA 4WKNA 4ALKA 3AJRA 3D4LA 3O8OB 4IH9A 4ZQEA 1M6YA 1JHDA 1SCQA 3K4PA 4YN3A 4PYIA 3VAYA 5HQTA 1KEEB 1SQ5A 4RK7A 5CDYA 2JEOA 1HEUA 4AKHA 1RT9A 4R4JA 3R9KA 1IC6A 1W47A 5JNTA 1U9YA 2QUZA 5EMKA 1L7MA 2Y2UA 3BF7A 2VPTA 1YFJA 4FB4A 3A6FA 4LX0A 9ABPA 1Z39A 5CVUA 3VISA 4XIYA 2H5JA 4AC9A 4WFKA 4B3SB 4PBRA 2IXFA 3STTA 1ARZA 2N1BA 1RKVA 2XGJA 4K6GA 1CUZA 4HDKA 4QQNA 1DAKA 5JZVA 5IWAB 1W4LA 3DCNA 4LYYA 4WUTA 4TWRA 1Q95A 2QV7A 2X8LA 2YVAA 4HH4A 2ZBGA 3ESCA 3I4LA 4YACA 4ENWA 1KU6A 4K6FA 2FOIA 4KQHA 4B3MB 3ME5A 1FBNA 3B2EA 4G01B 5C35A 3STVA 2R6HA 1X94A 4MDFA 1E6UA 1C41A 1FTWA 4O4HF 1T9KA 2BPOA 5J40A 2I33A 2XUJA 4Q4JA 1L7DA 2I5PO 4A0FA 4LKOA 1KOJA 2G9RA 1TECE 2I4NA 2JNWA 3B5IA 3NATA 4Q4AB 4WXRA 3WP1B 1DRKA 1L3IA 1NVKA 2JAQA 1PLLA 3W7BA 4AB1A 3G1UA 3WKBA 3L8FA 3BQNB 2JASA 3IV6A 3BXEA 4O2AF 4URYR 4AUKA 3AEXA 5L3SA 1IPFA 1P6XA 2APJA 4PV7A 5AKJA 3TOZA 2BC9A 1JVSA 3GA0A 1U6JA 2VNHA 3LFUA 5M5BA 1VE5A 4PFJA 4OHBA 4UVDA 1AO3A 4X1YB 1DUSA 5DW3A 1P4JA 4QTTB 5TGDA 1PTKA 3CPHA 4FCCA 2VJLA 1LD3A 3S7TA 4LZJA 3VDMA 1ZIOA 2HF7A 1L6RA 1MV8A 1E8MA 2Q5JA 4FMCB 1K0FA 4G0YA 4W1SA 3CLRD 4RV4A 1LWNA 2ONYA 1Q1EA 3NTXA 3L8YA 4FGUA 2JZCA 2GX6A 4M0MA 4U7WA 1D5CA 2VWHA 5DM1A 1IU9A 2GXAA 1PX2A 2PD4A 3BSFA 1O03A 3A14A 3H1PA 2VRBA 1ESDA 1I13A 2ZBUA 1TZ2A 3A05A 4XDYA 1GD1O 2EFYA 2POQX 5T3YA 3ZHRA 5I47A 5JWOA 3S81A 1G8MA 3COJA 1YVDA 2Q99A 5F52A 4TV8A 4ZCSA 4M6WA 3RYCB 3EPRA 3E35A 3OJLA 3EA5A 3L7MA 3WHPA 5BR7A 1DIHA 5BNTA 3UJNA 1NSTA 1WZ2A 3UMBA 1TQHA 4AECA 1AZWA 2WMYA 4QGFA 4UFPA 1M0EA 3ESRA 4WDQA 2ANCA 1KZ9A 1R7RA 2R1TA 1I6WA 1SU7A 3QMMA 1TEXA 2GBIA 4MI6A 4YRNA 2LIVA 3ND7A 4LIPD 1RKQA 4LDPA 3DJFA 2I1VB 2ZJ0A 3OFVA 2OD7A 3DNMA 2G28A 5CDTA 3NHKA 3T3DA 3GCZA 2XHZA 2WJZB 3K6SA 5BN3A 1F48A 3VHQA 2CMDA 5M29A 4GXTA 3BFXA 4HEJA 2YWRA 2O1WA 3QYFA 4OHCA 1VPEA 5CCXA 1PJCA 1E0KA 5HF9A 3T7EA 3P2JA 2CLSA 3RVJA 1PT7A 1Y89A 2AFIE 2WP0A 4AAYA 3E9DA 3NPAA 1T2NA 4DYVA 4F21A 1GU7A 1LBEA 2ZYVX 4BGUA 2RGAA 2QBYB 4EZEA 4XDZA 2BBTA 5MDHA 4HZIA 1LX7A 1NBEA 4YV0A 3EQ2A 4BASA 1XO1A 3GLHE 1PT5A 3C14C 4TROA 1FX0A 4HBGA 2ZT5A 4RHFA 4ID9A 3UAOA 1KJ9A 3OZVA 1HQYE 3GJTA 1YV9A 3D1LA 3DQZA 1Q2XA 3K6KA 4EABA 2HPVA 1ATIA 4DCGA 4Z9AA 5BSKA 4JLVA 4O6VA 4A2WA 4GM1A 2C7VA 1J24A 2CHEA 2VXYA 4KPUA 4YIKA 3RVOA 4MI3A 4ZD6A 3N8NA 1EE1A 3DBLB 5J2TB 3DS8A 4C88A 4UBMA 4IY1A 1BX3A 3EF3A 1Z83A 4D26A 3QKRB 4O8CA 5AHOA 521PA 1PS8A 4MWOA 3Q8LA 2B1GA 1EPUA 2YQ4A 4EZBA 4H6WA 2AOUB 2J87A 3SLKA 1R0RE 4P82A 3AF3A 1GSHA 4KC0A 2CEKA 2PZLA 4ND3A 1NVVR 3D8RA 3EEYA 5CCDA 2VDWB 5LUBA 5A6VA 4EYGA 5ALTA 2AEMA 5ALVA 3AEKB 1N5OX 3FRJA 1UOEA 1EBUA 3WRWA 1NUPA 4E1AA 1SCJA 2X15A 2CL5A 4ADSG 2NTYC 3GCGA 1L5QA 2BVNA 5BQFA 1ISIA 2XCRB 1E92A 3TIIA 4BMOB 1JH9A 2Y1FA 3PXBA 1YCGA 1YZFA 1QH1B 1V3TA 3EZ6A 4WXMA 2YNMC 3LYUA 3OWXA 2IEZA 1F4PA 1VDMA 2AG6A 4E5MA 4H7HA 1Y0BA 1S2MA 4IX9A 2DLCX 3IR6A 3HZZA 3DKKA 3SEAA 1H2EA 3M6LA 4WCFB 5DXJA 3IV7A 1QO7A 4MQ6A 4B76A 1VLQA 3CZCA 4CU2A 1E62A 1UK6A 4LFCB 2QXUA 2XQFA 4HN4B 5EHNA 4F1WA 2XECA 1V6SA 4IZOA 1T5TA 4MVJM 3OX3A 2HX1A 10MHA 3LQ2A 3T5BA 1WB4A 5LWHA 3E1GA 2GPJA 3CUYA 4G2NA 2W6QA 3F3MA 4RS4A 1K1EA 3PSAA 4KNVA 5LQMA 2CVQA 4C03A 2FB9A 2XVXA 3L40A 2GAJA 1W36D 1Y98A 3RASA 5CTJA 1QNFA 4RHXA 1M6VB 1JJBA 4EW2A 1TYBE 3WJAA 2VAVA 3RYFA 4BJ3A 2X86A 5KWVA 1GAXA 1C9EA 1OGJA 2H7XA 2MMGA 2VL7A 2HWXA 2WWGA 1ODTC 2XYGA 1XN1A 1YGPA 2YJTD 2YIDA 3E2MA 3MLBA 4JXJA 3FZQA 2HXGA 4GX5A 2WIKA 4ZO6A 5CFRA 4LFBB 4HDQB 1J8DA 4ZZ3A 4XE5A 2PVCA 1F4VA 2ZB4A 3HV2A 3W4IA 5BWOA 4DYHA 4KAJA 1ZZGA 2FGKA 2AFIB 1RTTA 1XRMA 2Y1LA 2PX3A 3EXEB 2CNNA 2GAIA 3RRZA 2Z1MA 1VE3A 1P1IA 3NWOA 5CURA 2XNJA 1IB6A 2OFOA 4FCTA 2G08A 3L1JA 2QAJA 1WTAA 1ETUA 1FVXA 2BIFA 2KI5A 5ICEA 4IHJB 1PFKA 1PUJA 2QRLA 1BCSB 3RVBA 2B20A 2QJOA 3X1YA 4ZK6A 4M8KA 1YF3A 1BKSB 1IH8A 2E1PA 1GPLA 1IHPA 5DIZA 1NP6A 2QMQA 1R4ZA 4GWGA 3SDBA 4LS3A 4W9RA 3TQRA 2NADA 1RIFA 3CC8A 1AGNA 4LE1A 1DBWA 4YAIA 2YW2A 4I6GA 4Q3CA 4QD3A 5CFPA 5F3WB 4MGZR 1NTRA 2WJVA 4I0WB 5JECA 1TYCA 1GEEA 5CXXA 4B7ZA 5B58C 3JQ9A 5BW6B 1LQ2A 4PLZA 8AT1A 3EVCA 3PVSA 4L5CA 4OHRA 1M2KA 3AUUA 3UUFA 2AFVA 1M1ZA 1OAOC 2C88A 1ULHA 2P9FA 2BFEA 1YRQA 2WUEA 4KGDA 1KAGA 2X8AA 3AVQA 2H2DA 1ZJWA 4I55A 4CMAA 2IUTA 4A4DA 4W8OA 2C8LA 2DPXA 1KQGA 5HZMA 4JWKA 5KOHB 5FF9A 2XAUA 4N48A 1WCXA 1HI9A 3REGA 1A27A 3PQEA 4OGFA 2FRXA 1P1HA 1Z0JA 3IX7A 1QBKC 1WEKA 2AZTA 4XVQA 5DM2A 4EBBA 2OGUA 2WUFA 1CR1A 3C41J 3I62A 3B7GA 1N77A 4X1KA 1TW2A 3ZHQA 4CLXA 1ZGGA 5MN6A 1YZTA 3DDZX 2HJ9A 3BEDA 2H9IA 1XCLA 4ZAVA 1K7EB 5TS3A 3CNBA 5M34A 1UC8A 1QFXA 1X13A 2R7AA 4UUQA 1XCPA 5HZGA 5JTUA 2RC5A 1Z4NA 5ESRA 2ZRJA 4ZV9A 4HXEB 2Z0MA 4OX9B 4B3XA 4MX8A 3QWIA 2IEDA 1KETA 3D2BA 4N9WA 4U3JA 4MVJF 1ODCA 1R9JA 2FSVC 3HYCA 2GBGA 5LQJA 2J45A 1XWWA 2VHQA 3K09C 3C8UA 4RPHA 1KAQA 1J8QA 3WWCA 5JROA 1VLJA 5F2NA 2HJRA 2ASEA 4RKEA 3A2KA 2DPMA 1EGAA 5C1PA 3AM5A 3UWPA 2HRZA 3QWBA 2IA5A 2OZVA 1BHSA 2OCPA 3DV0A 3KOOA 3RI3A 3O8OA 3RRFA 3T12A 1EX9A 4DA7A 4K6KA 3ZTWA 4JVOA 1M73E 4FC7A 2KJQA 5H16A 4U02A 2A9VA 2VLBA 1ITZA 1G20A 3WK9A 1QQ5A 3DVAB 3IMKA 3MWLA 2WJYA 3EWAA 1VJ1A 4UHKA 2QTVB 1WL8A 3RS9A 4DLAA 3H9GA 3N3AC 4Q4CA 5I7RA 1Y9AA 3C85A 3IDAA 4I1IA 1IMJA 2DR3A 1AMNA 4E70A 5LC1A 4YI3A 2PJRA 4JBWA 5JSUA 4TYNA 4OFWA 4MV3A 4R16A 1YBAA 2QVXX 2BOVA 2OD2A 4MW4A 2P4EA 3HMKA 4L28A 4XTRA 3PT9A 4RTMA 2K7FA 5FBWB 3UH0A 1M0SA 1M34B 1LB1B 4HVTA 2MSWA 3I1YA 3S5UA 3WBFA 1Y4ZA 4AS3A 5CEJA 3UJAA 3FYUB 4OJQA 5KTTA 4QYXA 4UMDA 4EG5A 4TQ9A 3SJUA 3W5CA 2NAFA 2R3SA 2NU6A 4KG7A 1HQKA 1J1ZA 2QTNA 2WJ6A 3DNFA 1COZA 4B45A 2C4UA 3EGDA 3I1FA 3I04A 3IOEA 3N2YA 3K30A 5B30A 1KMQA 5IWCA 5EEHA 2WWIA 3U1VA 3VJLA 5EJ9A 1NWHA 3EUWA 1UKAA 4V3BA 3DOCA 1G8FA 3M4ZA 3OPMA 3QVKA 1J2YA 1E6LA 3ZNNA 4NMLA 4II3A 1PJZA 1WAMA 2QM0A 3JD1A 1A77A 1RI3A 2P41A 3ANYB 1M2HA 3R3HA 4RLHA 4Z8YA 3VO1A 1CZHA 3DEIA 1V4VA 3R7BA 4C3OB 3K2QA 1UOQA 3AEQA 4A8JA 1TLFA 1R2QA 1YS6A 4YRBA 4CDRA 4OVKA 1VSBA 1HL7A 3LCCA 1B8VA 1FVHA 1HDIA 3LA8A 4LDQA 2FQYA 2V7EA 4HEHA 3R7AA 3U3KA 4EFKA 2IVZA 5K3CA 2DQ4A 4RL4A 1GGEA 2XE8A 3DMFA 2XTJA 5DBFA 3ZJYA 1DIAA 3GJ6A 1I2AA 2GEBA 7MHTA 2NZYA 3KT3A 4KOEC 2IELA 4FOOA 1UPFA 3QG1A 2QPAA 1GPBA 1WUYA 3GJ0A 4LQDA 4M6WB 1ODIA 1XTJA 3H5OA 2JZNA 2AVNA 1JR4A 2YDYA 2ZJ5A 1CXZA 4G4SO 4XVHA 3SU8A 1SRQA 1I8TA 5EEGA 1LWOA 4GWLA 4Q5IA 3HR7A 3WFIA 4F6LA 2XF8A 1A2BA 1OTHA 1OYWA 3OEYA 3PVZA 4PU0A 3Q12A 4DXAA 3OEHA 3OM0A 3QKTA 1MAVA 1YUMA 3B53X 4BWFB 6ADHA 5DNVA 2YMMA 1RWNA 4GAEA 4CV2A 4DB4A