5CCAA

Crystal structure of mtb toxin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
94
Chain Sequence
MRPIHIAARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNTQTIPVCDLGRQIGYLLASQEPALAEAIGNAFDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mtb toxin
rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Endoribonuclease MazF3
total genus 18
structure length 94
sequence length 98
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ccaA00
5CKHA 3G7ZA 5DLOA 1NE8A 5CQXA 2MF2A 4HKEA 5CR2A 3VUBA 1VUBA 3JRZA 4MZMA 5CCAA 5CKBA 5HK3A 4MZTA 3HPWA 3TCJA 5CKEA 4OF1A 5CKFA 5CK9A 1M1FA 1UB4A 5HK0A 5CQYA 4ELYC 3NFCA 5CO7A 4ELZC 4MDXA 2C06A 2KMTA 2VUBA 4ME7A 5CKDA 5HKCA 1X75C 4MZPA 3JSCA 4VUBA
chains in the Genus database with same CATH superfamily
3CCMA 3EG0A 1VQMA 1QQJA 1MMAA 5GAOl 2HD0A 4HT8A 1NM7A 1CKBA 3LGLA 1W2BA 3VS5A 1M90U 5LJ5f 1VQ8A 4M77A 3ER0A 5GAN7 2PVDB 3A8GB 5A0GA 2L3QA 2MMPA 2KDSA 1GCPA 4DOWA 1OI1A 4DQ2A 2EBPA 3I55T 2GGRA 4GY5A 3CMAA 3X24B 1TOVA 2M0YA 2PNIA 4CC7A 4FU6A 1C0MA 5KCHA 1RLQC 2BE9B 3QPHA 1U1TA 4FL6A 3MKDA 1J3TA 1VQKA 3I55A 1OX8A 2M9UA 4MDWA 3J80E 3CPWS 4XTVA 2BE7D 2X4YA 4M75D 1YIJA 1U06A 4NL3A 4XU1A 2EJ9A 5GMKm 4F7UG 3CC4A 1NBEB 3GP8A 2VC8A 1IRXA 5FU7C 4KGVB 1VQOA 1M5Q1 3OB9A 1N9RA 4J7IA 1WQWA 4X9DA 5LJ3f 3CCLT 2ZPBB 1MMDA 4OMQA 4A63B 1ZUKA 3C12A 1N6AA 2HAXA 2HKNA 1Y07A 4HVUA 4F04B 4ZN3A 1GFCA 1RAIB 4BI8B 2NUPB 1VQ9T 1OQKA 4M75E 5CR2A 2NUPA 4HVVA 2E65A 4J8OA 4LD6A 5GAOm 1XOVA 3VS3A 2EQMA 4HCKA 1YHQQ 2RA2A 4BB7A 4RG8A 1YIJT 1BB9A 2FHDA 4AFSC 1VQ8Q 4DEXA 3SHWA 4FSSA 4PFPA 1QVFP 4LN2A 4XK8E 5KCOA 3M53A 2CH4W 1PKTA 3L2QA 2R5AA 2Y4XA 4JZ3A 2A7YA 2CP2A 2XMFA 1S72Q 3J7AF 2DF6A 1PCXA 2P0KA 4M78D 2VXFA 3S6WA 2OTLT 1Q7YU 1HYOA 4O5VA 1JO8A 1OEBA 4C8QG 2P4TA 1WJSA 4C0ZA 1VQLT 4MMKA 4X1VA 3JCMW 3JCMc 4ESRA 2LNVA 2X51A 1F1BB 1Y96A 3CCET 3T9NA 3QG1A 2QTVA 1VQ5Q 4M7DC 1M3CA 3VS2A 4JPBW 1VQKQ 1V1CA 1MUZA 3JSCA 1YJWT 2DZ9A 4R0KA 2FZKB 2OJ2A 1EIFA 3QZ5B 3JCMJ 4QVZA 3HFOA 4PLIA 2VVKA 4Y28E 1OPLA 1G2BA 1JXMA 3ZEHA 3EFOA 3NGPA 2KY9A 1FXXA 2EYQA 3CC7T 2HQEA 4L5GA 4M7AA 3RR6A 1D1BA 5AT1B 4M77F 1KD1C 2ED0A 2J05A 1KHIA 1BIBA 4XTWA 4M7DD 1NLPC 2ECZA 4GLKA 4OB3B 4RTTA 3NTHA 2J6OA 3BDUA 5LJ5j 2CH4A 1M1FA 2YXYA 4FT2A 5IHIA 5DY9A 4ZTJA 1I4K1 2HBWA 4QT7A 2FPDA 4FCYA 4DOVA 5GAN3 2MWOA 4LUEA 2O88A 3WVEB 3HFNA 1YIJQ 2KQWA 2YHTA 3CD6Q 3HRUA 7AT1B 3N5BB 2AZVA 3H0HA 3VS4A 2QK0A 2RQTA 5IN1A 3SD4A 5CO7A 2JT4A 2QI2A 2C06A 2C0IA 4E7SA 1QW1A 4AFUC 1CSKA 2EGCA 4J9FA 3JRZA 2HZYA 3EH2A 3OBWA 2VYTA 1WXTA 1Q86C 2IG0A 1HD3A 1PD0A 2DTIA 2DZCA 2QXFA 1NPRA 4CC4B 2EAYA 2I0NA 2K5FA 1UB4A 1LOJA 3M54A 5GAMg 4DBHA 2E6ZA 1VQ4T 9ATCB 2KRSA 2JZ2A 3H0IA 2K4YA 1U8RA 3UA6A 4BACA 3FB9A 3SB2A 1O9SA 3PT9A 2KXCA 2ESWA 1TUDA 1Q82U 1X6OA 2YWWA 5CAIA 4QQ6A 4C92B 2RQWA 1U1SA 4RTYA 2JOYA 2OTJA 4OVAA 1RABB 4Z88A 4N0AA 3A98A 3UATA 4LXCA 2VASA 4N4IA 4C92G 3JAME 1Q82R 3UF4A 1M90C 5ECAA 1TS9A 2K7AA 1SF9A 4NS5A 3FRNA 1NZ9A 3CXCA 3OS2A 4PJOB 4M7AD 1SHFA 1ZX6A 2YUQA 4M75G 3REAB 4ANJA 4M77G 5LJ5g 2JMAA 2LTOA 2O01E 2QEXT 1WIEA 4M77C 1VQ6T 1AWJA 2EKHA 4YTLA 3KFVA 5DLOA 3JCMQ 2B8AA 4ORZA 3DB3A 1YHQT 3HL8A 2JS2A 2COZA 1C6VX 4EDUA 1UJYA 5FROA 4JRKA 1YP5A 3M0QA 4M77D 8ATCB 4E7HA 1WGSA 1Y71A 2LCSA 3VS0A 3QBYA 4FSXA 1SKUB 2C0OA 1YJNQ 5LL6S 4JDSA 1MGQA 3OYMA 4Z89A 1YCSB 1IGUA 3D7SB 2JS0A 2CZ6B 3CCEQ 4M7AC 2DILA 2ZCFB 2ZPFB 5GAN2 4B6MA 2FZCB 4O6JA 4IIOA 2OTLA 5A0DA 1G3YA 1YWOA 4JS5A 1R0CB 1WHJA 2RI5A 3A8OB 1WHHA 1Z9QA 3ZBDA 2K3XA 1VQ4A 1TTHB 1YJ9Q 1AWWA 2CZ0B 4KUDK 2ZPHB 1OYXA 1KC8C 2BZ8A 3JB9F 3M58A 2KGTA 2ABLA 3CCQT 1UFFA 3OSVA 5J3BA 1UE9A 2EGEA 2DM1A 3CPWA 1KG1A 1JJ2P 1NPPA 4X34A 1UGVA 3VS7A 3E9GA 1NG2A 1G3TA 2H3JA 4UC4A 1K9MR 5C0MA 2JUFA 4C0DB 2FB7A 4PJOC 1TH7A 4BI3A 1NE8A 4C8QF 2XG8D 4FYYB 2DXUA 4C8QE 4OGCA 5KYNA 1W2BS 3OYDA 4PJLA 3URGA 3E19A 1JEGA 3CCRA 2VXEA 2AKKA 5GANh 3SDZA 3CCUQ 2FG0A 4OMFB 2DTOA 2LQ8A 1K9MU 1K73R 4PJOF 2YLCA 5IXBA 1QVPA 3I5RA 2EWNA 2RI3A 4M7AF 1B3QA 4QKUA 1JJ2A 4A4FA 1FWZA 1HSQA 4D8KA 2H8HA 4PKCC 2RQRA 3PVLA 3CCST 1Q82C 3M0SA 1QWEA 2FRWA 1M30A 4P5NA 3JB9J 1IGQA 5HY6A 3TQ7P 3Q1JA 2CT3A 3CC7A 5I22A 3P8DA 3QDFA 1RAEB 4C0FA 2F69A 2LT4A 1PRMC 2F1LA 3VJPA 3CCRT 3V8KA 4LDYA 5LJ5h 1WZOA 2HNIA 1IREB 1VQ6Q 2AT1B 1TG0A 4X9CA 3I56Q 2P0QA 2QGFB 1YWPA 4M7DA 2MCNA 2RHUA 4HCZA 4FT4A 1VQLQ 4IUUA 3CCSQ 2EPDA 3NMZC 3QKJA 2L3SA 4KULA 1QVFA 3JB9I 5I21A 2YT6A 2OI3A 4JLGA 4C92F 2JXBA 3ZFJA 1RI0A 4F7UE 2E70A 5IT9E 1ZSZB 3C0CA 1ZQ1A 1VQMT 3PNWC 3CCMT 1Y0MA 2EYYA 3OYBA 2R5MA 1D09B 1X27A 4HCBA 2BZXA 1B34B 2RK2A 1I81A 2GTOA 1GCQC 4WTOB 2DFUA 1K1ZA 2KYMA 1R77A 1K76A 2B86A 2PZ1A 2RQUA 1KHCA 1I07A 4EMGA 4RMOA 3UWNA 3L42A 3HKSA 2F5TX 1D3BA 1K8AU 4FYVB 3OW2A 3FDRA 1FMWA 1VQKT 2PUKB 3OYNA 2CZ1B 1KD1R 2LMJA 3A8HB 2A08A 3LH5A 4PJOG 4ATOA 5KE3A 1BBZA 4HCCA 1LJOA 4F17A 1LNXA 2G6FX 2RNAA 1KQ2A 2HQXA 1N9SA 1WNLA 5GMKl 1K0SA 4XTUA 3M4YA 2LJ1A 3HP9A 2QA4A 2MPXC 1ZSGA 4KT0E 4M77E 2AZSA 3DB4A 3VYHB 4BY6C 3EG9B 3FIFA 1VQOQ 2NYSA 5GAMd 1WHGA 2RK1A 4NOYA 3SWNC 1LPLA 2KEAA 4OMLA 5GJWB 2DETA 2HL3A 4J6XA 2KXDA 4DBRA 3G6EA 5A0LA 1QWFA 2MIOA 2P84A 4B9WA 2D8JA 1BK2A 4JZ4A 3G71T 2EQIA 2HCKA 4PLLA 4ELZC 1X6BA 3I55Q 1M3BA 1KC8U 4IUTA 4E7KA 4PJOA 1I1JA 1D3BB 3A8MB 4Q5WA 3ASKA 3HTRA 1VQMQ 2D8HA 4OMNA 2EVRA 2MWPA 2VGNA 2LX9A 1KQSP 3EG3A 3UDCA 1FX7A 3X28B 4OMOA 2ROLA 1GFDA 3R6NA 2D6FA 5D6WA 1IXDA 3CCUA 3AHUA 5IH2A 4BI4A 2L89A 4QW2A 4J9HA 5DLQE 1M1KR 2LQWA 5GMKe 5GANf 4LDXA 2O9SA 1PC0A 2COYA 2EQUA 1FMVA 2KROA 4AT1B 1UECA 5KYWA 4M4ZA 4WCIA 1UTIA 3JB9G 1FYNA 3MEVA 1QKXA 3L2RA 3EG9A 3CMEQ 2QEXA 2FVUA 1IO6A 3QYGB 2CREA 2IIMA 3LGFA 1QVGS 4DA4A 2JTFA 3CCLQ 3MP8A 1BYMA 1YNZA 4M7DE 1H8KA 2A3LA 5KE2A 1PSEA 1VQ4Q 5GAOn 3HSBA 2PU9B 4IIMA 3RKXA 5IXFA 4AMCA 3PTAA 2FPFA 3OYJA 4A4GA 2KT8A 2DA9A 1W4SA 3JCMb 1X69A 2A0FB 1CKAA 2EGAA 3A5ZB 1SPKA 3BDLA 1A0NB 2MYSA 1VQPA 2KNBB 1D1AA 2WSCE 5CKBA 1D0YA 2AHJB 3PFSA 4ZGJB 3UT1A 4PJNA 4XTXA 1PM3A 1I0CA 3LWHA 1S1NA 4OB0B 3V8LA 4IUQA 5GMKj 2QQBA 1UEBA 4F7UA 3V7RA 1M2OA 2HQHA 2L2PA 1WI7A 3ZL7C 1WHKA 3MHXA 3OYFA 1QP2A 1VQ7T 3MP1A 4XTZA 4XAXB 2X3XD 4M7DF 1RLPC 2YUPA 4M77B 1U3OA 2GQVA 1N8RU 4M78E 1SRLA 4RTZA 2PUOB 3S3MA 1GXIE 4PJMA 3I9QA 4C92C 1JQQA 4VUBA 2QQRA 4II1A 3CC4Q 1K0XA 2BZYA 4RCCA 5HCKA 3CMAQ 2JM9A 3HPWA 3QJYA 3CC7Q 3I5SA 2CUDA 2V1QA 4F7UF 3M5AA 1Z9ZA 5KYXA 5LJ5e 2LNHB 3MO8A 5I2MA 4LDVA 3CPWP 4PJOD 2DMOA 1AHJB 4EMKA 3SEMA 2Y90A 2V8KA 1K9MC 2MF2A 1VIFA 2NUZA 4JUVA 3TREA 3JCMf 2X4WA 4M7AE 3M0PA 1HJDA 4C8QA 2L8DA 2QQ9A 3L1AA 4FIBA 1YFNA 2GQIA 1AEYA 4M78F 2H3EB 3A1PA 3OYLA 1PWTA 2CKKA 4JJCA 4IURA 1AZGB 1X43A 1M1KC 3CCVA 5CCAA 1M2VA 4JS4A 1M2VB 5FWBA 3RERA 2YLBA 5L8RE 5GANd 4C0GA 3OW2P 4XU0A 3G4SA 1GRIA 5KYUA 3TEEA 2BIVA 3EGUA 5KYWB 1XJWB 4B9XA 2AKLA 1VQ6A 3CCQA 3GLXA 1SSHA 3V7CA 1TUCA 3H8ZA 2FL7A 5D6XA 2C0TA 2V1RA 3VS6A 4LDUA 3G4SQ 4PJOE 1K8AC 1V29B 2CP5A 3EFSA 2DBMA 2X3WD 4M78A 1Q95G 5KYXB 2G3RA 2EIFA 4OMMA 2QASA 2XKOC 2GBQA 1VQ7Q 3CD6A 2OX7A 2RHIA 2DJZA 1N5ZA 1AD5A 4E7JA 3WVDB 1Q7YC 1OU8A 1BI0A 2DPPB 3QZ9B 4AFQC 1AT1B 3TVTA 1ABQA 5LJ3d 5A2QE 3C4SA 2E3IA 4GBQA 2DNUA 1V76A 1QKWA 2CP0A 3M57A 3LWIA 3WXMB 4GLMA 1H3ZA 1UHCA 1MMGA 2JN0A 5GAMf 3TU4K 4LD9K 3NTKA 1X2KA 2ENMA 3RKYA 2ZAEA 1N27A 1EFNA 1YN8A 3I35A 1RAFB 2DL8A 1BIAA 1VQ9A 5CQYA 1NLOC 3NFCA 1W6XA 2RJCA 3PE0A 2F5KA 3BFMA 1XQHA 2NUTA 4HKEA 2K9GA 1O75A 2WSEE 1R0BG 1P92A 2DTHA 2A28A 2DRKA 1M4ZA 2LCLA 1Y57A 3U23A 5LJ5d 2XD0A 5FW9A 3R6OA 4LUDA 1VQNT 1M3AA 3NTIA 4BE1A 2DL5A 2CSIA 4EMKB 3CQTA 3G7ZA 3O5ZA 4R56A 1S72T 2VWFA 2DLPA 1AZEA 1I5OB 3EGXA 4QVCA 1U5SA 2KRNA 3VUZA 2E3HA 1OV3A 4EIKA 2M0OA 1H92A 1EZZB 1TWBA 5IAYA 1HXDA 2FYKA 3M59A 2VUBA 3RUXA 1ABOA 3JCMX 1RADB 4J9DA 2NUTB 4E2FB 2PVOB 4JRQA 2LJ3A 4C0DC 1ZA2B 2XICA 2LQNA 1VQ5T 2HL5C 1OZ2A 1YJNT 4OF1A 1JB0E 3OBYA 1SHGA 4QQDA 3OYHA 3OS1A 4IUPA 4BE2A 2RHXA 1PKSA 3JCMg 3CBPA 2YRCA 2DK3A 5LJ3h 4J9EA 3MCAB 2J6KA 3OYAA 1PRLC 2A37A 2LDMA 1NEBA 2EJGA 4D6WA 2DXCA 3HRTA 3JV3A 4J83A 2HMAA 4FYWB 1UGQB 4D8DA 3CMEA 3QO3A 3CCUT 5HK0A 2LJ0A 2XK0A 2E5QA 1G83A 2HSEB 3LH0A 2RI2A 4OP0A 2PTKA 5FLXE 1PNJA 3EGXB 2GFAA 5LJ3e 3JCMV 1MNDA 1SRMA 1GBQA 1RAAB 4M78B 4DBFA 4V2SA 4AFZC 1AWOA 3H9NA 3VKIA 5GANj 1ACMB 5CK9A 2DD5A 2KSSA 3M0UA 1E7OA 2GNCA 4DEYA 1AVZC 2HDAA 2EJFA 2P0PA 3OQ5A 2KE9A 2RO0A 2O2OA 1JJ2S 3RMQA 1R8OB 3JB9D 4E7LA 2ATCB 1T0HA 1UUEA 3CXCP 2F2WA 1YJWA 3FJ5A 4L6V5 1OU9A 1BU1A 1D1CA 1D0XA 1KQSA 1I8FA 2CUBA 1NJIR 3RESA 2I2LA 4AG2C 3HHTB 3OW2S 2SRCA 4BY6B 1X01A 4IUVA 3RKWA 2KBTA 2O9VA 1YJ9A 4EMKC 2CS7A 5GMKh 4PFOA 1IB8A 3A8LB 2DL4A 3V7SA 4LDWA 1YITA 2JM8A 1QLYA 2K6DA 5EG2A 3BE3A 3I56A 3S3OA 2EKOA 3LW5E 2DXBA 1WDXA 3JB9H 5FWCA 1T3SA 3P8BB 4OMPA 2O4XA 4PNOA 4M7AG 1UGPB 4MZMA 5FU6B 3L2VA 1RAHB 2CP7A 2DRMA 3FLGA 3OYIA 2MK5A 2DERA 3CD6T 1GL5A 1M1KU 2J6FA 3OMCA 1IHVA 5CIUA 2LC4A 3QDRB 2QTXA 3KBGA 2BKDN 4ZN1A 2DVEA 4M7AB 1RL2A 1B34A 1WJRA 1VQ8T 1M90R 2OTJT 3LX7A 3NPFA 1VQNA 2XDPA 3BW1A 1YI2T 3KXTA 2BTTA 1M27C 3HRSA 3P8HA 4FW1A 3CCEA 1MNEA 3AT1B 1TXQA 1E6HA 2E41A 4RTWA 4HXJA 1KJWA 5GAOp 4XU3A 4JJBA 3GNFB 1YHQA 1H641 4IKFA 3QWYA 2SEMA 2E6NA 4M78G 1MHNA 2RPNA 4PJJA 3JCMh 4A54A 1MMNA 3CCVT 2DX1A 2DVJA 4RUGA 3JCMP 4M78C 3E2UA 1N8RC 1QCNA 2E12A 4HVWA 5CKEA 3GNGA 4BE0A 1RI9A 1G3WA 4RG2A 3OS0A 2X9HA 1VQLA 1XTDA 3X25B 1KQ1A 3X20B 2E64A 3CCJA 4JRPA 2R57A 3NHNA 2XU8A 1OX9A 2RQVA 2HSPA 2P4RA 4XQ3A 2FPEA 1S72A 2QDLA 5D6YA 4OB2B 3GIBA 2RH2A 1YCYA 2EYWA 2KMTA 2XIDA 1EX4A 3JCMd 3GPLA 2RD1A 1B07A 1VQPT 1RAGB 2F2XA 5DM7R 3FJPA 5HK3A 1M9SA 2IPOB 1BI1A 3META 3TSZA 3C95A 4M7DG 1Q7YR 2E10A 5CKFA 3QUIA 4ZTFA 2GTJA 4XTYA 4J6YA 4ELYC 1UGSB 1ARKA 3OYYA 1QVGP 4A4EA 1X75C 3EG1A 5GAN6 3G6EQ 2L3PA 1OPKA 4TVRA 1M1GA 1KC8R 2DL7A 4CI0C 2KK4A 1VQ7A 1G3SA 3MP6A 2NLUA 3M0TA 2ZPGB 4CC2A 3OA6A 2ZZDA 3QXEB 3REBB 1IHWA 4FYXB 3UPUA 2CYZB 2LX7A 2OTLQ 5FU7B 1NYGA 1UG1A 1Y7XA 2Y4YA 3CBOA 3RDVA 2VKNA 2FEIA 4PK4A 4XU2A 4A4KA 1ZA1B 3CCJQ 2EFIA 2DIQA 5GANg 2MOXA 3CC2Q 2PVGB 1X2QA 4F14A 1UJ0A 1QP3A 1ZUYA 4J9IA 3M9QA 4M75C 1KFZA 1ZSZA 2YUOA 1H3HA 3EHRA 2X4XA 2CP6A 3RMSA 1MV3A 3OYGA 2QYZA 2QAZA 2D9TA 2E5KA 3SFMA 1UDLA 2O31A 3EGDB 3G1JA 4RCBA 4JLIA 3EFRA 1G8XA 1KK7A 1QMCA 1T0JA 1QCFA 1Y96B 4CC3A 2GFUA 1NJIC 2KI7A 2XDBA 1VQPQ 2RB6A 5GAOr 4HT9A 4NL2A 3VU3C 2M1HA 4C8QB 3DKMA 2DYBA 2DL3A 1M8VA 5GAN8 1C1AA 3L2UA 3MEWA 1K73C 5D7UA 2E1HA 2LP5A 1BKBA 4J9BA 3KUFA 2LVMA 2DYIA 4MZPA 1NEGA 2OAUA 5C6SA 2RMOA 4PL6A 1WYXA 5EC7A 2QQSA 2R58A 3E1SA 2KVQG 1TU0B 1FMKA 4J9GA 5GAMh 3CCJT 3LYIA 4KRTA 1JBMA 2DAQA 2JMCA 2VV5A 2K2VA 3L2WA 1B7TA 2K3YA 1QVFS 4C5GA 4ME7A 3CBMA 2W10A 1ZBJA 1VQNQ 2XI9A 3V8JA 3QHSA 3C94A 3VRYA 3E9FA 3GF5A 2YDLA 5FRNA 2K3BA 1YJ9T 4J5YA 5AYFA 2BUDA 3OS5A 4RTXA 2QGGA 3PMIA 1NJIU 4RTUA 3G4ST 1YJWQ 2RM4A 2KAFA 3SWNB 2LRQA 2MAMA 3CCMQ 3EG2A 2DE0X 1AOJA 2EYXA 5CVIA 1GCQA 2YSQA 4Y92A 2MI6A 1YITQ 1D0ZA 1PG5B 2JTEA 1WQ7A 5GMKi 1K9AA 1QVGA 1WA7A 2D0QB 2QA4Q 3G71Q 5CKHA 2DD4A 1WXUA 3OMGA 4KH0B 4N4HA 3G71A 2DKGA 4C92E 4KH1B 4A4HA 1M8MA 3CMET 5IHNA 1YITT 1UHFA 3G6ET 2E4HA 4EPCA 5FU6C 2WSFE 2RHYA 2L0AA 5GAMj 5GAN5 1MV0B 2QG9B 4C92D 1YBYA 5J26A 2FZGB 3EFOB 2HBPA 2WACA 2KT1A 4A53A 4BD3A 2DEUA 1W70A 2CDTA 3F70A 2JVVA 4M75B 2DIGA 3VS1A 4M75A 4Z02A 4WF2A 5IHKA 3SWNA 2AK5A 1ZSZC 1SG5A 4FW2A 4JJNK 5M9OA 4M75F 3RBBB 5KH6A 3OY9A 4LNPA 2XDDA 2V8JA 2ZGWA 2QDYB 4LE9A 3JCMe 4MZTA 4C5IA 5LJ3g 3CXCS 3CC4T 2VB6A 4BDYA 2J06A 1NYFA 1VQ5A 5GAOq 1KQSS 4K11A 2LZ6B 4FM4B 4C5EA 3CPFA 1WJQA 1KIKA 2RHZA 3VRZA 4PFZA 2RJEA 3QJ6A 2EQJA 3CCRQ 5CKDA 1PSFA 1WHMA 3CCQQ 3LLRA 4MMLA 1BCMA 3IQLA 5I2SA 2K2MA 3UA7A 1VUBA 2X35A 4ZNXA 3CC2T 4Z8AA 1ZLMA 2K79A 5KYYB 2L3RA 2CSQA 3PVQA 1BI3A 3S3NA 3MJXA 3RIRA 2CZ7B 5GAMe 4DBQA 3L2ZA 3OYKA 1Q81C 1UGRB 3RNJA 2QA4T 6AT1B 3VYGA 2M16A 3PIOA 1WX6A 1Q81R 5CQXA 1RACB 4KUIA 2K57A 1JRIA 4E7ZA 2OAWA 1LVKA 3TCJA 3OYCA 3QSUA 3PMTA 3CMAT 2KRMA 4OGEA 5GJVB 2W0ZA 2LT1A 2K5LA 1QCOA 1T3LA 1ZBXA 4KGZB 2XHCA 2CP3A 2ROTA 2D0NA 4E47A 5L23A 4QQGA 2EQKA 3M55A 2LCCA 2KR3A 3QIIA 1YI2A 5I11A 3X26B 4R55A 1VIEA 4KGXB 4ZGDB 1JXOA 2M51A 4AG1C 3CCSA 2KYBA 3TSWA 3EAEA 1ZUUA 1LCKA 2JW4A 1VYVA 3ULRB 4C92A 3PGGA 2IVWA 1E6GA 1G5VA 3ME9A 3J81E 3MEUA 2JTMA 1GBRA 3OYEA 1TUGB 3PIPA 1IZ6A 2DBKA 3M56A 4BDZA 1WXBA 2QEXQ 2QQAA 5KYUB 5KYYA 2F2VA 3GBQA 2RN8A 1BCOA 1OOTA 2LQKA 3H0FA 5GANe 2V26A 3DLMA 4M7DB 3I56T 1BI2A 2JJ9A 2V8IA 1WPYA 1OULA 1VA7A 2ZPIB 3EGDA 4L59A 3M0RA 2YUNA 2VGMA 4BUGA 4C5HA 2K5IA 3MEAA 2L5QA 2DEQA 2EW3A 1VQ9Q 4J9CA 4RKUE 4C8QD 1K4US 2GCXA 3GOXA 1SEMA 2CGHA 4C8QC 8AT1B 1PD1A 4MDXA 2HKQB 3H41A 1K8AR 1WFWA 4JRIA 4EMHA 1WLPB 2EYZA 2AIRB 3OSSC 3FEOA 2NWMA 3O8VA 2COWA 1RUWA 1HK9A 3H6ZA 1W1FA 2M02A 1VQOT 1VOMA 2OTJQ 4J6WA 3CEYA 4JJDA 2D1XA 1PHTA 2ED1A 2YRVA 1AWXA 2A36A 2O4XB 4F7UB 1YJNA 3FC3A 2ZPEB 4KBMB 2RJDA 2J7IA 1OZ3A 2DO3A 2FRYA 4CRIA 3CCLA 3VUBA 1KD1U 2RF0A 2YRDA 2Z0WA 2GF7A 2RJFA 4E7IA 1X6GA 3QYHB 1W2BP 3M4GA 5LJ3j 3EH1A 1Q86U 4OB1B 2FO0A 1DJ7B 1SSFA 3DLLA 1K73U 3CC2A 4RTVA 5FRMA 3VV0A 3BY7A 2JNGA 3CCVQ 4QVDA 4E6RA 1WHLA 3QWXX 4J7FA 1I5LA 2HEQA 3MPUB 4Y91A 1Q86R 1ZHIA 4N0AC 1N8RR 2X4JA 1JU5C 5J39A 4ZGEB 1KSWA 1XNIA 1TSFA 2DJQA 1VYUA 2CT4A 3INZA 3THKA 1Q81U 5GAN4 2DXTA 5HKCA 4HA8A 2PQWA 4F16A 1YI2Q 4N4GA 1VYTA 3EHQA
chains in the Genus database with same CATH topology
1TH7A 2RHIA 2DJZA 2X4XA 4BI3A 1NE8A 4C8QF 3CCMA 2XG8D 1VQMA 2DXUA 3RMSA 4OGCA 4C8QE 3OYGA 4E7JA 3WVDB 1W2BS 5GAOl 1Q7YC 3OYDA 2HD0A 4HT8A 1BI0A 2DPPB 3QZ9B 3E19A 2D9TA 3LGLA 3URGA 3CCRA 1W2BA 1M90U 2VXEA 5GANh 3SDZA 5LJ3d 5LJ5f 1VQ8A 3SFMA 5A2QE 4OMFB 1K9MU 2DTOA 2LQ8A 4M77A 3ER0A 3C4SA 2PVDB 4RCBA 5GAN7 4JLIA 2YLCA 3EFRA 4PJOF 1QVPA 3A8GB 5A0GA 2MMPA 2EWNA 2KDSA 4DOWA 2RI3A 1OI1A 4DQ2A 4M7AF 1Y96B 3M57A 3LWIA 3I55T 3WXMB 1H3ZA 1JJ2A 4A4FA 1FWZA 2JN0A 4GY5A 5GAMf 2GFUA 3CMAA 1NJIC 3X24B 3TU4K 2XDBA 4PKCC 4LD9K 3NTKA 4FU6A 5KCHA 2RB6A 3CCST 5GAOr 4HT9A 4NL2A 3RKYA 2M1HA 3VU3C 3QPHA 4C8QB 1U1TA 3DKMA 1Q82C 1N27A 4FL6A 1M8VA 1VQKA 3I55A 5GAN8 3L2UA 3MEWA 1K73C 4P5NA 2E1HA 3JB9J 1BIAA 2M9UA 1BKBA 4MDWA 5HY6A 1VQ9A 3J80E 3Q1JA 3CC7A 3KUFA 5CQYA 2LVMA 3P8DA 3CPWS 3NFCA 4C0FA 2RJCA 2F69A 4XTVA 2LT4A 4MZPA 2OAUA 3VJPA 3CCRT 5C6SA 3V8KA 2F5KA 4LDYA 5LJ5h 3BFMA 2X4YA 4M75D 1YIJA 1XQHA 4PL6A 4XU1A 4NL3A 2EJ9A 4HKEA 1O75A 2HNIA 5GMKm 1IREB 2QQSA 2WSEE 4F7UG 1P92A 3CC4A 2R58A 4X9CA 2DTHA 2P0QA 3E1SA 2KVQG 3GP8A 2VC8A 4M7DA 1M4ZA 2LCLA 5FU7C 1VQOA 1M5Q1 3OB9A 1N9RA 2RHUA 4HCZA 4J7IA 4C92C 4FT4A 5GAMh 4IUUA 1WQWA 3CCJT 4X9DA 5LJ3f 5LJ5d 2XD0A 3LYIA 3QKJA 3CCLT 2ZPBB 3R6OA 1JBMA 4KULA 1QVFA 2DAQA 3C12A 3JB9I 2VV5A 1VQNT 2K2VA 5I21A 3L2WA 1N6AA 2K3YA 1QVFS 4C5GA 2HAXA 4JLGA 4C92F 3NTIA 4BE1A 4ME7A 1Y07A 3ZFJA 3CBMA 1RI0A 4F7UE 4EMKB 2E70A 5IT9E 4ZN3A 4BI8B 2XI9A 1ZQ1A 3G7ZA 1VQMT 3V8JA 3QHSA 3PNWC 1VQ9T 4M75E 3CCMT 3C94A 5CR2A 4R56A 1S72T 3E9FA 3GF5A 2E65A 4J8OA 4LD6A 5GAOm 3OYBA 1XOVA 2R5MA 2EQMA 4QVCA 5FRNA 2RA2A 1YJ9T 4HCBA 2RK2A 1B34B 4J5YA 1I81A 3VUZA 4BB7A 4RG8A 5AYFA 2BUDA 1YIJT 3OS5A 3PMIA 2FHDA 2M0OA 1NJIU 3G4ST 5IAYA 1HXDA 1KHCA 2FYKA 2VUBA 3M59A 2RM4A 3RUXA 4EMGA 4XK8E 5KCOA 2KAFA 4RMOA 3UWNA 3M53A 3SWNB 3L42A 2LRQA 2MAMA 3JCMX 3HKSA 2F5TX 1D3BA 2PVOB 3L2QA 1K8AU 2R5AA 3OW2A 4JRQA 3FDRA 2Y4XA 1VQKT 4C0DC 2XICA 5CVIA 2PUKB 2A7YA 1VQ5T 3OYNA 1OZ2A 2CZ1B 1YJNT 4OF1A 1JB0E 3A8HB 3J7AF 2MI6A 3OBYA 4QQDA 3OYHA 3OS1A 4IUPA 4BE2A 4PJOG 2RHXA 3JCMg 1WQ7A 3CBPA 5GMKi 4ATOA 1QVGA 2P0KA 4M78D 5KE3A 2VXFA 3S6WA 2OTLT 1Q7YU 2DK3A 2D0QB 5LJ3h 4O5VA 4HCCA 1LJOA 3MCAB 1LNXA 3OYAA 1KQ2A 5CKHA 2HQXA 4C8QG 1N9SA 2DD4A 2LDMA 2P4TA 3OMGA 1WNLA 1WJSA 2EJGA 4N4HA 4D6WA 4C0ZA 5GMKl 1VQLT 4MMKA 3JCMW 3G71A 4XTUA 2DXCA 3M4YA 3JCMc 3HP9A 2DKGA 3HRTA 4C92E 2LNVA 2QA4A 4J83A 4A4HA 1Y96A 3CCET 3CMET 1UGQB 4KT0E 3CMEA 4M77E 3QO3A 3T9NA 1YITT 3QG1A 3G6ET 3DB4A 3CCUT 3VYHB 5HK0A 4BY6C 4EPCA 5FU6C 4M7DC 2WSFE 2XK0A 2E5QA 2RHYA 3FIFA 5GAMj 5GAN5 4C92D 1YBYA 5GAMd 3LH0A 3JSCA 5J26A 2RK1A 4NOYA 3SWNC 2RI2A 1YJWT 4OP0A 2DZ9A 2HBPA 5FLXE 1EIFA 3QZ5B 3JCMJ 4J6XA 2GFAA 5LJ3e 2WACA 3G6EA 4QVZA 3HFOA 3JCMV 5A0LA 4PLIA 4Y28E 4A53A 4M78B 4BD3A 4V2SA 3F70A 3VKIA 3ZEHA 5GANj 2JVVA 4B9WA 5CK9A 2DD5A 2KSSA 2KY9A 4M75B 3G71T 2DIGA 4M75A 1FXXA 4PLLA 2EYQA 4ELZC 2HQEA 3CC7T 4L5GA 4M7AA 1KC8U 4IUTA 4WF2A 2EJFA 4Z02A 4E7KA 3SWNA 4JJNK 5M9OA 4PJOA 4M75F 1D3BB 3A8MB 2P0PA 3ASKA 4Q5WA 5KH6A 3OQ5A 4M77F 3OY9A 2XDDA 2RO0A 1KD1C 2MWPA 1KHIA 2VGNA 2LX9A 2V8JA 2QDYB 2ZGWA 1BIBA 4XTWA 1R8OB 3RMQA 3JB9D 1JJ2S 4M7DD 3JCMe 4MZTA 4C5IA 4GLKA 5LJ3g 3CXCS 3CC4T 4BDYA 3UDCA 4E7LA 4OB3B 1YJWA 3NTHA 5GAOq 1VQ5A 1KQSS 1FX7A 3X28B 4L6V5 3BDUA 4FM4B 4C5EA 5LJ5j 3CPFA 2D6FA 5D6WA 1KQSA 1WJQA 2RHZA 1M1FA 2RJEA 3QJ6A 4FT2A 3CCUA 1U8RA 3AHUA 4BI4A 1I8FA 2EQJA 2L89A 4QW2A 5DY9A 1I4K1 4ZTJA 5DLQE 5CKDA 4DOVA 5GAN3 3RESA 1PSFA 2MWOA 2I2LA 5GMKe 3HHTB 3OW2S 3LLRA 3WVEB 5GANf 3HFNA 4MMLA 4LDXA 2KQWA 2YHTA 5I2SA 1VUBA 3HRUA 2X35A 3CC2T 4BY6B 2EQUA 1X01A 4IUVA 3N5BB 3RKWA 1YJ9A 2L3RA 4EMKC 2CS7A 1BI3A 5GMKh 3JB9G 3S3NA 3A8LB 2CZ7B 3RIRA 4LDWA 3V7SA 3MEVA 5GAMe 3L2RA 3L2ZA 5IN1A 3OYKA 1YITA 3SD4A 2QEXA 2FVUA 1Q81C 3QYGB 1UGRB 5CO7A 5EG2A 2QI2A 3LGFA 2C06A 1QVGS 2QA4T 4DA4A 3VYGA 3I56A 3S3OA 2JTFA 2EKOA 1QW1A 3LW5E 2DXBA 2M16A 3PIOA 3JB9H 3MP8A 5CQXA 3P8BB 1BYMA 2O4XA 4PNOA 4M7DE 4M7AG 3JRZA 1UGPB 3OBWA 4KUIA 2VYTA 4MZMA 1Q86C 2IG0A 5FU6B 3L2VA 2DTIA 2K57A 1JRIA 2A3LA 2DZCA 2QXFA 1NPRA 1PSEA 3TCJA 5KE2A 3OYCA 3QSUA 3PMTA 3FLGA 5GAOn 3OYIA 3CMAT 3HSBA 2PU9B 4OGEA 3RKXA 3CD6T 3PTAA 1M1KU 2EAYA 3OMCA 2K5FA 3OYJA 1UB4A 1LOJA 3M54A 5CIUA 5GAMg 2E6ZA 2LC4A 4A4GA 3QDRB 1VQ4T 2LT1A 2JZ2A 2K5LA 2QTXA 3KBGA 1W4SA 2BKDN 2DVEA 2K4YA 4ZN1A 1ZBXA 4M7AB 3JCMb 1RL2A 1B34A 4BACA 1WJRA 3A5ZB 1VQ8T 2XHCA 3BDLA 3FB9A 3SB2A 1O9SA 2OTJT 1VQPA 3LX7A 4E47A 3PT9A 1VQNA 2XDPA 3BW1A 2WSCE 2EQKA 3M55A 2LCCA 4QQGA 3QIIA 5CKBA 3KXTA 1YI2T 1YI2A 1Q82U 1X6OA 3HRSA 3P8HA 2AHJB 5CAIA 3CCEA 3PFSA 4ZGJB 4QQ6A 3UT1A 2E41A 3X26B 4C92B 4R55A 4PJOC 1VIEA 1U1SA 4XTXA 4ZGDB 2JOYA 5GAOp 2OTJA 4OVAA 4XU3A 3LWHA 3CCSA 4N0AA 3GNFB 4OB0B 3V8LA 1YHQA 4IUQA 5GMKj 1H641 1UEBA 2QQBA 3EAEA 4IKFA 4N4IA 4C92G 4F7UA 3V7RA 3JAME 4C92A 2E6NA 2IVWA 3PGGA 4M78G 1M90C 1MHNA 1G5VA 3ME9A 3JCMh 4A54A 3J81E 3CCVT 3MHXA 3MEUA 3OYFA 2JTMA 3OYEA 3JCMP 1QP2A 4M78C 3PIPA 3MP1A 1VQ7T 4XTZA 4XAXB 1IZ6A 1N8RC 3FRNA 4NS5A 1NZ9A 2E12A 3M56A 5CKEA 3OS2A 3CXCA 4BDZA 4M7DF 4PJOB 4M77B 2QQAA 3GNGA 4M7AD 4BE0A 2GQVA 4M75G 1N8RU 1G3WA 4M77G 4M78E 4RG2A 5LJ5g 2LQKA 3OS0A 2LTOA 1VQLA 1XTDA 5GANe 2O01E 2QEXT 2PUOB 3DLMA 4M7DB 3I56T 1BI2A 3X25B 3S3MA 1GXIE 1KQ1A 4M77C 3X20B 2E64A 2V8IA 4VUBA 2QQRA 1WPYA 4II1A 2R57A 3CCJA 4JRPA 1VQ6T 4YTLA 5DLOA 3JCMQ 2ZPIB 2XU8A 4RCCA 4L59A 2B8AA 3DB3A 2VGMA 4BUGA 1YHQT 3HL8A 3HPWA 4C5HA 2K5IA 3MEAA 2L5QA 3QJYA 2DEQA 4XQ3A 4RKUE 4C8QD 4EDUA 5FROA 2GCXA 4F7UF 3GOXA 1S72A 2CGHA 3M5AA 4C8QC 5D6YA 5LJ5e 4OB2B 3GIBA 4MDXA 2RH2A 4JRKA 1YCYA 2KMTA 3MO8A 5I2MA 2XIDA 4LDVA 4JRIA 3JCMd 4PJOD 3GPLA 2RD1A 1AHJB 4EMHA 2Y90A 4EMKA 2V8KA 4M77D 1VQPT 4E7HA 5DM7R 2MF2A 1VIFA 3OSSC 1WGSA 1Y71A 1K9MC 3FEOA 3FJPA 5HK3A 3QBYA 1M9SA 4FSXA 3O8VA 1BI1A 3META 4JUVA 1HK9A 3H6ZA 3TREA 3JCMf 3C95A 5LL6S 2X4WA 1VQOT 4M7AE 4JDSA 4M7DG 2E10A 4J6WA 5CKFA 1MGQA 3QUIA 3OYMA 3CEYA 4ZTFA 4XTYA 4C8QA 4J6YA 4ELYC 2YRVA 2L8DA 2QQ9A 1UGSB 2O4XB 3OYYA 3L1AA 4F7UB 2CZ6B 4FIBA 4A4EA 4M7AC 1YJNA 3FC3A 1X75C 2ZPEB 2ZCFB 4KBMB 4M78F 5GAN6 2RJDA 3OYLA 1OZ3A 2DO3A 2ZPFB 4TVRA 5GAN2 4CRIA 2CKKA 1M1GA 4CI0C 3CCLA 3VUBA 2KK4A 1KD1U 4IURA 1M1KC 3CCVA 5CCAA 1G3SA 3MP6A 1VQ7A 4JS4A 2GF7A 2NLUA 2RJFA 4E7IA 4O6JA 2ZPGB 2OTLA 5A0DA 3OA6A 1G3YA 2ZZDA 3QYHB 3RERA 2YLBA 5L8RE 3M4GA 3QXEB 5LJ3j 5GANd 2RI5A 4JS5A 3A8OB 1Q86U 4C0GA 4OB1B 4XU0A 3ZBDA 3G4SA 2K3XA 3TEEA 3UPUA 1VQ4A 2CYZB 2BIVA 1DJ7B 1SSFA 3DLLA 1K73U 3CC2A 5FU7B 5FRMA 2Y4YA 1Y7XA 2CZ0B 4B9XA 3CBOA 3VV0A 3BY7A 2JNGA 2ZPHB 4KUDK 1VQ6A 1OYXA 4QVDA 1KC8C 3JB9F 4XU2A 3M58A 4A4KA 3CCQA 3GLXA 4J7FA 3CCQT 3OSVA 1I5LA 4Y91A 2EFIA 3V7CA 2DIQA 1ZHIA 4N0AC 5J3BA 5GANg 2X4JA 3H8ZA 5J39A 2PVGB 4ZGEB 2FL7A 1XNIA 3CPWA 1KG1A 5D6XA 4LDUA 1NPPA 4PJOE 1K8AC 1QP3A 3INZA 4X34A 3E9GA 1V29B 1G3TA 2H3JA 3M9QA 4M75C 4UC4A 1Q81U 3EFSA 5C0MA 2JUFA 5GAN4 2DXTA 4M78A 4C0DB 5HKCA 4HA8A 2PQWA 2G3RA 2EIFA 4N4GA 2FB7A 2XKOC 3CD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKH A;  3G7Z A;  5DLO A;  1NE8 A;  5CQX A;  2MF2 A;  4HKE A;  5CR2 A;  3VUB A;  1VUB A;  3JRZ A;  4MZM A;  5CCA A;  5CKB A;  5HK3 A;  4MZT A;  3HPW A;  3TCJ A;  5CKE A;  4OF1 A;  5CKF A;  5CK9 A;  1M1F A;  1UB4 A;  5HK0 A;  5CQY A;  4ELY C;  3NFC A;  5CO7 A;  4ELZ C;  4MDX A;  2C06 A;  2KMT A;  2VUB A;  4ME7 A;  5CKD A;  5HKC A;  1X75 C;  4MZP A;  3JSC A;  4VUB A; 
#chains in the Genus database with same CATH topology
 3CCM A;  3EG0 A;  1VQM A;  1QQJ A;  1MMA A;  5GAO l;  2HD0 A;  4HT8 A;  1NM7 A;  1CKB A;  3LGL A;  1W2B A;  3VS5 A;  1M90 U;  5LJ5 f;  1VQ8 A;  4M77 A;  3ER0 A;  5GAN 7;  2PVD B;  3A8G B;  5A0G A;  2L3Q A;  2MMP A;  2KDS A;  1GCP A;  4DOW A;  1OI1 A;  4DQ2 A;  2EBP A;  3I55 T;  2GGR A;  4GY5 A;  3CMA A;  3X24 B;  1TOV A;  2M0Y A;  2PNI A;  4CC7 A;  4FU6 A;  1C0M A;  5KCH A;  1RLQ C;  2BE9 B;  3QPH A;  1U1T A;  4FL6 A;  3MKD A;  1J3T A;  1VQK A;  3I55 A;  1OX8 A;  2M9U A;  4MDW A;  3J80 E;  3CPW S;  4XTV A;  2BE7 D;  2X4Y A;  4M75 D;  1YIJ A;  1U06 A;  4NL3 A;  4XU1 A;  2EJ9 A;  5GMK m;  4F7U G;  3CC4 A;  1NBE B;  3GP8 A;  2VC8 A;  1IRX A;  5FU7 C;  4KGV B;  1VQO A;  1M5Q 1;  3OB9 A;  1N9R A;  4J7I A;  1WQW A;  4X9D A;  5LJ3 f;  3CCL T;  2ZPB B;  1MMD A;  4OMQ A;  4A63 B;  1ZUK A;  3C12 A;  1N6A A;  2HAX A;  2HKN A;  1Y07 A;  4HVU A;  4F04 B;  4ZN3 A;  1GFC A;  1RAI B;  4BI8 B;  2NUP B;  1VQ9 T;  1OQK A;  4M75 E;  5CR2 A;  2NUP A;  4HVV A;  2E65 A;  4J8O A;  4LD6 A;  5GAO m;  1XOV A;  3VS3 A;  2EQM A;  4HCK A;  1YHQ Q;  2RA2 A;  4BB7 A;  4RG8 A;  1YIJ T;  1BB9 A;  2FHD A;  4AFS C;  1VQ8 Q;  4DEX A;  3SHW A;  4FSS A;  4PFP A;  1QVF P;  4LN2 A;  4XK8 E;  5KCO A;  3M53 A;  2CH4 W;  1PKT A;  3L2Q A;  2R5A A;  2Y4X A;  4JZ3 A;  2A7Y A;  2CP2 A;  2XMF A;  1S72 Q;  3J7A F;  2DF6 A;  1PCX A;  2P0K A;  4M78 D;  2VXF A;  3S6W A;  2OTL T;  1Q7Y U;  1HYO A;  4O5V A;  1JO8 A;  1OEB A;  4C8Q G;  2P4T A;  1WJS A;  4C0Z A;  1VQL T;  4MMK A;  4X1V A;  3JCM W;  3JCM c;  4ESR A;  2LNV A;  2X51 A;  1F1B B;  1Y96 A;  3CCE T;  3T9N A;  3QG1 A;  2QTV A;  1VQ5 Q;  4M7D C;  1M3C A;  3VS2 A;  4JPB W;  1VQK Q;  1V1C A;  1MUZ A;  3JSC A;  1YJW T;  2DZ9 A;  4R0K A;  2FZK B;  2OJ2 A;  1EIF A;  3QZ5 B;  3JCM J;  4QVZ A;  3HFO A;  4PLI A;  2VVK A;  4Y28 E;  1OPL A;  1G2B A;  1JXM A;  3ZEH A;  3EFO A;  3NGP A;  2KY9 A;  1FXX A;  2EYQ A;  3CC7 T;  2HQE A;  4L5G A;  4M7A A;  3RR6 A;  1D1B A;  5AT1 B;  4M77 F;  1KD1 C;  2ED0 A;  2J05 A;  1KHI A;  1BIB A;  4XTW A;  4M7D D;  1NLP C;  2ECZ A;  4GLK A;  4OB3 B;  4RTT A;  3NTH A;  2J6O A;  3BDU A;  5LJ5 j;  2CH4 A;  1M1F A;  2YXY A;  4FT2 A;  5IHI A;  5DY9 A;  4ZTJ A;  1I4K 1;  2HBW A;  4QT7 A;  2FPD A;  4FCY A;  4DOV A;  5GAN 3;  2MWO A;  4LUE A;  2O88 A;  3WVE B;  3HFN A;  1YIJ Q;  2KQW A;  2YHT A;  3CD6 Q;  3HRU A;  7AT1 B;  3N5B B;  2AZV A;  3H0H A;  3VS4 A;  2QK0 A;  2RQT A;  5IN1 A;  3SD4 A;  5CO7 A;  2JT4 A;  2QI2 A;  2C06 A;  2C0I A;  4E7S A;  1QW1 A;  4AFU C;  1CSK A;  2EGC A;  4J9F A;  3JRZ A;  2HZY A;  3EH2 A;  3OBW A;  2VYT A;  1WXT A;  1Q86 C;  2IG0 A;  1HD3 A;  1PD0 A;  2DTI A;  2DZC A;  2QXF A;  1NPR A;  4CC4 B;  2EAY A;  2I0N A;  2K5F A;  1UB4 A;  1LOJ A;  3M54 A;  5GAM g;  4DBH A;  2E6Z A;  1VQ4 T;  9ATC B;  2KRS A;  2JZ2 A;  3H0I A;  2K4Y A;  1U8R A;  3UA6 A;  4BAC A;  3FB9 A;  3SB2 A;  1O9S A;  3PT9 A;  2KXC A;  2ESW A;  1TUD A;  1Q82 U;  1X6O A;  2YWW A;  5CAI A;  4QQ6 A;  4C92 B;  2RQW A;  1U1S A;  4RTY A;  2JOY A;  2OTJ A;  4OVA A;  1RAB B;  4Z88 A;  4N0A A;  3A98 A;  3UAT A;  4LXC A;  2VAS A;  4N4I A;  4C92 G;  3JAM E;  1Q82 R;  3UF4 A;  1M90 C;  5ECA A;  1TS9 A;  2K7A A;  1SF9 A;  4NS5 A;  3FRN A;  1NZ9 A;  3CXC A;  3OS2 A;  4PJO B;  4M7A D;  1SHF A;  1ZX6 A;  2YUQ A;  4M75 G;  3REA B;  4ANJ A;  4M77 G;  5LJ5 g;  2JMA A;  2LTO A;  2O01 E;  2QEX T;  1WIE A;  4M77 C;  1VQ6 T;  1AWJ A;  2EKH A;  4YTL A;  3KFV A;  5DLO A;  3JCM Q;  2B8A A;  4ORZ A;  3DB3 A;  1YHQ T;  3HL8 A;  2JS2 A;  2COZ A;  1C6V X;  4EDU A;  1UJY A;  5FRO A;  4JRK A;  1YP5 A;  3M0Q A;  4M77 D;  8ATC B;  4E7H A;  1WGS A;  1Y71 A;  2LCS A;  3VS0 A;  3QBY A;  4FSX A;  1SKU B;  2C0O A;  1YJN Q;  5LL6 S;  4JDS A;  1MGQ A;  3OYM A;  4Z89 A;  1YCS B;  1IGU A;  3D7S B;  2JS0 A;  2CZ6 B;  3CCE Q;  4M7A C;  2DIL A;  2ZCF B;  2ZPF B;  5GAN 2;  4B6M A;  2FZC B;  4O6J A;  4IIO A;  2OTL A;  5A0D A;  1G3Y A;  1YWO A;  4JS5 A;  1R0C B;  1WHJ A;  2RI5 A;  3A8O B;  1WHH A;  1Z9Q A;  3ZBD A;  2K3X A;  1VQ4 A;  1TTH B;  1YJ9 Q;  1AWW A;  2CZ0 B;  4KUD K;  2ZPH B;  1OYX A;  1KC8 C;  2BZ8 A;  3JB9 F;  3M58 A;  2KGT A;  2ABL A;  3CCQ T;  1UFF A;  3OSV A;  5J3B A;  1UE9 A;  2EGE A;  2DM1 A;  3CPW A;  1KG1 A;  1JJ2 P;  1NPP A;  4X34 A;  1UGV A;  3VS7 A;  3E9G A;  1NG2 A;  1G3T A;  2H3J A;  4UC4 A;  1K9M R;  5C0M A;  2JUF A;  4C0D B;  2FB7 A;  4PJO C;  1TH7 A;  4BI3 A;  1NE8 A;  4C8Q F;  2XG8 D;  4FYY B;  2DXU A;  4C8Q E;  4OGC A;  5KYN A;  1W2B S;  3OYD A;  4PJL A;  3URG A;  3E19 A;  1JEG A;  3CCR A;  2VXE A;  2AKK A;  5GAN h;  3SDZ A;  3CCU Q;  2FG0 A;  4OMF B;  2DTO A;  2LQ8 A;  1K9M U;  1K73 R;  4PJO F;  2YLC A;  5IXB A;  1QVP A;  3I5R A;  2EWN A;  2RI3 A;  4M7A F;  1B3Q A;  4QKU A;  1JJ2 A;  4A4F A;  1FWZ A;  1HSQ A;  4D8K A;  2H8H A;  4PKC C;  2RQR A;  3PVL A;  3CCS T;  1Q82 C;  3M0S A;  1QWE A;  2FRW A;  1M30 A;  4P5N A;  3JB9 J;  1IGQ A;  5HY6 A;  3TQ7 P;  3Q1J A;  2CT3 A;  3CC7 A;  5I22 A;  3P8D A;  3QDF A;  1RAE B;  4C0F A;  2F69 A;  2LT4 A;  1PRM C;  2F1L A;  3VJP A;  3CCR T;  3V8K A;  4LDY A;  5LJ5 h;  1WZO A;  2HNI A;  1IRE B;  1VQ6 Q;  2AT1 B;  1TG0 A;  4X9C A;  3I56 Q;  2P0Q A;  2QGF B;  1YWP A;  4M7D A;  2MCN A;  2RHU A;  4HCZ A;  4FT4 A;  1VQL Q;  4IUU A;  3CCS Q;  2EPD A;  3NMZ C;  3QKJ A;  2L3S A;  4KUL A;  1QVF A;  3JB9 I;  5I21 A;  2YT6 A;  2OI3 A;  4JLG A;  4C92 F;  2JXB A;  3ZFJ A;  1RI0 A;  4F7U E;  2E70 A;  5IT9 E;  1ZSZ B;  3C0C A;  1ZQ1 A;  1VQM T;  3PNW C;  3CCM T;  1Y0M A;  2EYY A;  3OYB A;  2R5M A;  1D09 B;  1X27 A;  4HCB A;  2BZX A;  1B34 B;  2RK2 A;  1I81 A;  2GTO A;  1GCQ C;  4WTO B;  2DFU A;  1K1Z A;  2KYM A;  1R77 A;  1K76 A;  2B86 A;  2PZ1 A;  2RQU A;  1KHC A;  1I07 A;  4EMG A;  4RMO A;  3UWN A;  3L42 A;  3HKS A;  2F5T X;  1D3B A;  1K8A U;  4FYV B;  3OW2 A;  3FDR A;  1FMW A;  1VQK T;  2PUK B;  3OYN A;  2CZ1 B;  1KD1 R;  2LMJ A;  3A8H B;  2A08 A;  3LH5 A;  4PJO G;  4ATO A;  5KE3 A;  1BBZ A;  4HCC A;  1LJO A;  4F17 A;  1LNX A;  2G6F X;  2RNA A;  1KQ2 A;  2HQX A;  1N9S A;  1WNL A;  5GMK l;  1K0S A;  4XTU A;  3M4Y A;  2LJ1 A;  3HP9 A;  2QA4 A;  2MPX C;  1ZSG A;  4KT0 E;  4M77 E;  2AZS A;  3DB4 A;  3VYH B;  4BY6 C;  3EG9 B;  3FIF A;  1VQO Q;  2NYS A;  5GAM d;  1WHG A;  2RK1 A;  4NOY A;  3SWN C;  1LPL A;  2KEA A;  4OML A;  5GJW B;  2DET A;  2HL3 A;  4J6X A;  2KXD A;  4DBR A;  3G6E A;  5A0L A;  1QWF A;  2MIO A;  2P84 A;  4B9W A;  2D8J A;  1BK2 A;  4JZ4 A;  3G71 T;  2EQI A;  2HCK A;  4PLL A;  4ELZ C;  1X6B A;  3I55 Q;  1M3B A;  1KC8 U;  4IUT A;  4E7K A;  4PJO A;  1I1J A;  1D3B B;  3A8M B;  4Q5W A;  3ASK A;  3HTR A;  1VQM Q;  2D8H A;  4OMN A;  2EVR A;  2MWP A;  2VGN A;  2LX9 A;  1KQS P;  3EG3 A;  3UDC A;  1FX7 A;  3X28 B;  4OMO A;  2ROL A;  1GFD A;  3R6N A;  2D6F A;  5D6W A;  1IXD A;  3CCU A;  3AHU A;  5IH2 A;  4BI4 A;  2L89 A;  4QW2 A;  4J9H A;  5DLQ E;  1M1K R;  2LQW A;  5GMK e;  5GAN f;  4LDX A;  2O9S A;  1PC0 A;  2COY A;  2EQU A;  1FMV A;  2KRO A;  4AT1 B;  1UEC A;  5KYW A;  4M4Z A;  4WCI A;  1UTI A;  3JB9 G;  1FYN A;  3MEV A;  1QKX A;  3L2R A;  3EG9 A;  3CME Q;  2QEX A;  2FVU A;  1IO6 A;  3QYG B;  2CRE A;  2IIM A;  3LGF A;  1QVG S;  4DA4 A;  2JTF A;  3CCL Q;  3MP8 A;  1BYM A;  1YNZ A;  4M7D E;  1H8K A;  2A3L A;  5KE2 A;  1PSE A;  1VQ4 Q;  5GAO n;  3HSB A;  2PU9 B;  4IIM A;  3RKX A;  5IXF A;  4AMC A;  3PTA A;  2FPF A;  3OYJ A;  4A4G A;  2KT8 A;  2DA9 A;  1W4S A;  3JCM b;  1X69 A;  2A0F B;  1CKA A;  2EGA A;  3A5Z B;  1SPK A;  3BDL A;  1A0N B;  2MYS A;  1VQP A;  2KNB B;  1D1A A;  2WSC E;  5CKB A;  1D0Y A;  2AHJ B;  3PFS A;  4ZGJ B;  3UT1 A;  4PJN A;  4XTX A;  1PM3 A;  1I0C A;  3LWH A;  1S1N A;  4OB0 B;  3V8L A;  4IUQ A;  5GMK j;  2QQB A;  1UEB A;  4F7U A;  3V7R A;  1M2O A;  2HQH A;  2L2P A;  1WI7 A;  3ZL7 C;  1WHK A;  3MHX A;  3OYF A;  1QP2 A;  1VQ7 T;  3MP1 A;  4XTZ A;  4XAX B;  2X3X D;  4M7D F;  1RLP C;  2YUP A;  4M77 B;  1U3O A;  2GQV A;  1N8R U;  4M78 E;  1SRL A;  4RTZ A;  2PUO B;  3S3M A;  1GXI E;  4PJM A;  3I9Q A;  4C92 C;  1JQQ A;  4VUB A;  2QQR A;  4II1 A;  3CC4 Q;  1K0X A;  2BZY A;  4RCC A;  5HCK A;  3CMA Q;  2JM9 A;  3HPW A;  3QJY A;  3CC7 Q;  3I5S A;  2CUD A;  2V1Q A;  4F7U F;  3M5A A;  1Z9Z A;  5KYX A;  5LJ5 e;  2LNH B;  3MO8 A;  5I2M A;  4LDV A;  3CPW P;  4PJO D;  2DMO A;  1AHJ B;  4EMK A;  3SEM A;  2Y90 A;  2V8K A;  1K9M C;  2MF2 A;  1VIF A;  2NUZ A;  4JUV A;  3TRE A;  3JCM f;  2X4W A;  4M7A E;  3M0P A;  1HJD A;  4C8Q A;  2L8D A;  2QQ9 A;  3L1A A;  4FIB A;  1YFN A;  2GQI A;  1AEY A;  4M78 F;  2H3E B;  3A1P A;  3OYL A;  1PWT A;  2CKK A;  4JJC A;  4IUR A;  1AZG B;  1X43 A;  1M1K C;  3CCV A;  5CCA A;  1M2V A;  4JS4 A;  1M2V B;  5FWB A;  3RER A;  2YLB A;  5L8R E;  5GAN d;  4C0G A;  3OW2 P;  4XU0 A;  3G4S A;  1GRI A;  5KYU A;  3TEE A;  2BIV A;  3EGU A;  5KYW B;  1XJW B;  4B9X A;  2AKL A;  1VQ6 A;  3CCQ A;  3GLX A;  1SSH A;  3V7C A;  1TUC A;  3H8Z A;  2FL7 A;  5D6X A;  2C0T A;  2V1R A;  3VS6 A;  4LDU A;  3G4S Q;  4PJO E;  1K8A C;  1V29 B;  2CP5 A;  3EFS A;  2DBM A;  2X3W D;  4M78 A;  1Q95 G;  5KYX B;  2G3R A;  2EIF A;  4OMM A;  2QAS A;  2XKO C;  2GBQ A;  1VQ7 Q;  3CD6 A;  2OX7 A;  2RHI A;  2DJZ A;  1N5Z A;  1AD5 A;  4E7J A;  3WVD B;  1Q7Y C;  1OU8 A;  1BI0 A;  2DPP B;  3QZ9 B;  4AFQ C;  1AT1 B;  3TVT A;  1ABQ A;  5LJ3 d;  5A2Q E;  3C4S A;  2E3I A;  4GBQ A;  2DNU A;  1V76 A;  1QKW A;  2CP0 A;  3M57 A;  3LWI A;  3WXM B;  4GLM A;  1H3Z A;  1UHC A;  1MMG A;  2JN0 A;  5GAM f;  3TU4 K;  4LD9 K;  3NTK A;  1X2K A;  2ENM A;  3RKY A;  2ZAE A;  1N27 A;  1EFN A;  1YN8 A;  3I35 A;  1RAF B;  2DL8 A;  1BIA A;  1VQ9 A;  5CQY A;  1NLO C;  3NFC A;  1W6X A;  2RJC A;  3PE0 A;  2F5K A;  3BFM A;  1XQH A;  2NUT A;  4HKE A;  2K9G A;  1O75 A;  2WSE E;  1R0B G;  1P92 A;  2DTH A;  2A28 A;  2DRK A;  1M4Z A;  2LCL A;  1Y57 A;  3U23 A;  5LJ5 d;  2XD0 A;  5FW9 A;  3R6O A;  4LUD A;  1VQN T;  1M3A A;  3NTI A;  4BE1 A;  2DL5 A;  2CSI A;  4EMK B;  3CQT A;  3G7Z A;  3O5Z A;  4R56 A;  1S72 T;  2VWF A;  2DLP A;  1AZE A;  1I5O B;  3EGX A;  4QVC A;  1U5S A;  2KRN A;  3VUZ A;  2E3H A;  1OV3 A;  4EIK A;  2M0O A;  1H92 A;  1EZZ B;  1TWB A;  5IAY A;  1HXD A;  2FYK A;  3M59 A;  2VUB A;  3RUX A;  1ABO A;  3JCM X;  1RAD B;  4J9D A;  2NUT B;  4E2F B;  2PVO B;  4JRQ A;  2LJ3 A;  4C0D C;  1ZA2 B;  2XIC A;  2LQN A;  1VQ5 T;  2HL5 C;  1OZ2 A;  1YJN T;  4OF1 A;  1JB0 E;  3OBY A;  1SHG A;  4QQD A;  3OYH A;  3OS1 A;  4IUP A;  4BE2 A;  2RHX A;  1PKS A;  3JCM g;  3CBP A;  2YRC A;  2DK3 A;  5LJ3 h;  4J9E A;  3MCA B;  2J6K A;  3OYA A;  1PRL C;  2A37 A;  2LDM A;  1NEB A;  2EJG A;  4D6W A;  2DXC A;  3HRT A;  3JV3 A;  4J83 A;  2HMA A;  4FYW B;  1UGQ B;  4D8D A;  3CME A;  3QO3 A;  3CCU T;  5HK0 A;  2LJ0 A;  2XK0 A;  2E5Q A;  1G83 A;  2HSE B;  3LH0 A;  2RI2 A;  4OP0 A;  2PTK A;  5FLX E;  1PNJ A;  3EGX B;  2GFA A;  5LJ3 e;  3JCM V;  1MND A;  1SRM A;  1GBQ A;  1RAA B;  4M78 B;  4DBF A;  4V2S A;  4AFZ C;  1AWO A;  3H9N A;  3VKI A;  5GAN j;  1ACM B;  5CK9 A;  2DD5 A;  2KSS A;  3M0U A;  1E7O A;  2GNC A;  4DEY A;  1AVZ C;  2HDA A;  2EJF A;  2P0P A;  3OQ5 A;  2KE9 A;  2RO0 A;  2O2O A;  1JJ2 S;  3RMQ A;  1R8O B;  3JB9 D;  4E7L A;  2ATC B;  1T0H A;  1UUE A;  3CXC P;  2F2W A;  1YJW A;  3FJ5 A;  4L6V 5;  1OU9 A;  1BU1 A;  1D1C A;  1D0X A;  1KQS A;  1I8F A;  2CUB A;  1NJI R;  3RES A;  2I2L A;  4AG2 C;  3HHT B;  3OW2 S;  2SRC A;  4BY6 B;  1X01 A;  4IUV A;  3RKW A;  2KBT A;  2O9V A;  1YJ9 A;  4EMK C;  2CS7 A;  5GMK h;  4PFO A;  1IB8 A;  3A8L B;  2DL4 A;  3V7S A;  4LDW A;  1YIT A;  2JM8 A;  1QLY A;  2K6D A;  5EG2 A;  3BE3 A;  3I56 A;  3S3O A;  2EKO A;  3LW5 E;  2DXB A;  1WDX A;  3JB9 H;  5FWC A;  1T3S A;  3P8B B;  4OMP A;  2O4X A;  4PNO A;  4M7A G;  1UGP B;  4MZM A;  5FU6 B;  3L2V A;  1RAH B;  2CP7 A;  2DRM A;  3FLG A;  3OYI A;  2MK5 A;  2DER A;  3CD6 T;  1GL5 A;  1M1K U;  2J6F A;  3OMC A;  1IHV A;  5CIU A;  2LC4 A;  3QDR B;  2QTX A;  3KBG A;  2BKD N;  4ZN1 A;  2DVE A;  4M7A B;  1RL2 A;  1B34 A;  1WJR A;  1VQ8 T;  1M90 R;  2OTJ T;  3LX7 A;  3NPF A;  1VQN A;  2XDP A;  3BW1 A;  1YI2 T;  3KXT A;  2BTT A;  1M27 C;  3HRS A;  3P8H A;  4FW1 A;  3CCE A;  1MNE A;  3AT1 B;  1TXQ A;  1E6H A;  2E41 A;  4RTW A;  4HXJ A;  1KJW A;  5GAO p;  4XU3 A;  4JJB A;  3GNF B;  1YHQ A;  1H64 1;  4IKF A;  3QWY A;  2SEM A;  2E6N A;  4M78 G;  1MHN A;  2RPN A;  4PJJ A;  3JCM h;  4A54 A;  1MMN A;  3CCV T;  2DX1 A;  2DVJ A;  4RUG A;  3JCM P;  4M78 C;  3E2U A;  1N8R C;  1QCN A;  2E12 A;  4HVW A;  5CKE A;  3GNG A;  4BE0 A;  1RI9 A;  1G3W A;  4RG2 A;  3OS0 A;  2X9H A;  1VQL A;  1XTD A;  3X25 B;  1KQ1 A;  3X20 B;  2E64 A;  3CCJ A;  4JRP A;  2R57 A;  3NHN A;  2XU8 A;  1OX9 A;  2RQV A;  2HSP A;  2P4R A;  4XQ3 A;  2FPE A;  1S72 A;  2QDL A;  5D6Y A;  4OB2 B;  3GIB A;  2RH2 A;  1YCY A;  2EYW A;  2KMT A;  2XID A;  1EX4 A;  3JCM d;  3GPL A;  2RD1 A;  1B07 A;  1VQP T;  1RAG B;  2F2X A;  5DM7 R;  3FJP A;  5HK3 A;  1M9S A;  2IPO B;  1BI1 A;  3MET A;  3TSZ A;  3C95 A;  4M7D G;  1Q7Y R;  2E10 A;  5CKF A;  3QUI A;  4ZTF A;  2GTJ A;  4XTY A;  4J6Y A;  4ELY C;  1UGS B;  1ARK A;  3OYY A;  1QVG P;  4A4E A;  1X75 C;  3EG1 A;  5GAN 6;  3G6E Q;  2L3P A;  1OPK A;  4TVR A;  1M1G A;  1KC8 R;  2DL7 A;  4CI0 C;  2KK4 A;  1VQ7 A;  1G3S A;  3MP6 A;  2NLU A;  3M0T A;  2ZPG B;  4CC2 A;  3OA6 A;  2ZZD A;  3QXE B;  3REB B;  1IHW A;  4FYX B;  3UPU A;  2CYZ B;  2LX7 A;  2OTL Q;  5FU7 B;  1NYG A;  1UG1 A;  1Y7X A;  2Y4Y A;  3CBO A;  3RDV A;  2VKN A;  2FEI A;  4PK4 A;  4XU2 A;  4A4K A;  1ZA1 B;  3CCJ Q;  2EFI A;  2DIQ A;  5GAN g;  2MOX A;  3CC2 Q;  2PVG B;  1X2Q A;  4F14 A;  1UJ0 A;  1QP3 A;  1ZUY A;  4J9I A;  3M9Q A;  4M75 C;  1KFZ A;  1ZSZ A;  2YUO A;  1H3H A;  3EHR A;  2X4X A;  2CP6 A;  3RMS A;  1MV3 A;  3OYG A;  2QYZ A;  2QAZ A;  2D9T A;  2E5K A;  3SFM A;  1UDL A;  2O31 A;  3EGD B;  3G1J A;  4RCB A;  4JLI A;  3EFR A;  1G8X A;  1KK7 A;  1QMC A;  1T0J A;  1QCF A;  1Y96 B;  4CC3 A;  2GFU A;  1NJI C;  2KI7 A;  2XDB A;  1VQP Q;  2RB6 A;  5GAO r;  4HT9 A;  4NL2 A;  3VU3 C;  2M1H A;  4C8Q B;  3DKM A;  2DYB A;  2DL3 A;  1M8V A;  5GAN 8;  1C1A A;  3L2U A;  3MEW A;  1K73 C;  5D7U A;  2E1H A;  2LP5 A;  1BKB A;  4J9B A;  3KUF A;  2LVM A;  2DYI A;  4MZP A;  1NEG A;  2OAU A;  5C6S A;  2RMO A;  4PL6 A;  1WYX A;  5EC7 A;  2QQS A;  2R58 A;  3E1S A;  2KVQ G;  1TU0 B;  1FMK A;  4J9G A;  5GAM h;  3CCJ T;  3LYI A;  4KRT A;  1JBM A;  2DAQ A;  2JMC A;  2VV5 A;  2K2V A;  3L2W A;  1B7T A;  2K3Y A;  1QVF S;  4C5G A;  4ME7 A;  3CBM A;  2W10 A;  1ZBJ A;  1VQN Q;  2XI9 A;  3V8J A;  3QHS A;  3C94 A;  3VRY A;  3E9F A;  3GF5 A;  2YDL A;  5FRN A;  2K3B A;  1YJ9 T;  4J5Y A;  5AYF A;  2BUD A;  3OS5 A;  4RTX A;  2QGG A;  3PMI A;  1NJI U;  4RTU A;  3G4S T;  1YJW Q;  2RM4 A;  2KAF A;  3SWN B;  2LRQ A;  2MAM A;  3CCM Q;  3EG2 A;  2DE0 X;  1AOJ A;  2EYX A;  5CVI A;  1GCQ A;  2YSQ A;  4Y92 A;  2MI6 A;  1YIT Q;  1D0Z A;  1PG5 B;  2JTE A;  1WQ7 A;  5GMK i;  1K9A A;  1QVG A;  1WA7 A;  2D0Q B;  2QA4 Q;  3G71 Q;  5CKH A;  2DD4 A;  1WXU A;  3OMG A;  4KH0 B;  4N4H A;  3G71 A;  2DKG A;  4C92 E;  4KH1 B;  4A4H A;  1M8M A;  3CME T;  5IHN A;  1YIT T;  1UHF A;  3G6E T;  2E4H A;  4EPC A;  5FU6 C;  2WSF E;  2RHY A;  2L0A A;  5GAM j;  5GAN 5;  1MV0 B;  2QG9 B;  4C92 D;  1YBY A;  5J26 A;  2FZG B;  3EFO B;  2HBP A;  2WAC A;  2KT1 A;  4A53 A;  4BD3 A;  2DEU A;  1W70 A;  2CDT A;  3F70 A;  2JVV A;  4M75 B;  2DIG A;  3VS1 A;  4M75 A;  4Z02 A;  4WF2 A;  5IHK A;  3SWN A;  2AK5 A;  1ZSZ C;  1SG5 A;  4FW2 A;  4JJN K;  5M9O A;  4M75 F;  3RBB B;  5KH6 A;  3OY9 A;  4LNP A;  2XDD A;  2V8J A;  2ZGW A;  2QDY B;  4LE9 A;  3JCM e;  4MZT A;  4C5I A;  5LJ3 g;  3CXC S;  3CC4 T;  2VB6 A;  4BDY A;  2J06 A;  1NYF A;  1VQ5 A;  5GAO q;  1KQS S;  4K11 A;  2LZ6 B;  4FM4 B;  4C5E A;  3CPF A;  1WJQ A;  1KIK A;  2RHZ A;  3VRZ A;  4PFZ A;  2RJE A;  3QJ6 A;  2EQJ A;  3CCR Q;  5CKD A;  1PSF A;  1WHM A;  3CCQ Q;  3LLR A;  4MML A;  1BCM A;  3IQL A;  5I2S A;  2K2M A;  3UA7 A;  1VUB A;  2X35 A;  4ZNX A;  3CC2 T;  4Z8A A;  1ZLM A;  2K79 A;  5KYY B;  2L3R A;  2CSQ A;  3PVQ A;  1BI3 A;  3S3N A;  3MJX A;  3RIR A;  2CZ7 B;  5GAM e;  4DBQ A;  3L2Z A;  3OYK A;  1Q81 C;  1UGR B;  3RNJ A;  2QA4 T;  6AT1 B;  3VYG A;  2M16 A;  3PIO A;  1WX6 A;  1Q81 R;  5CQX A;  1RAC B;  4KUI A;  2K57 A;  1JRI A;  4E7Z A;  2OAW A;  1LVK A;  3TCJ A;  3OYC A;  3QSU A;  3PMT A;  3CMA T;  2KRM A;  4OGE A;  5GJV B;  2W0Z A;  2LT1 A;  2K5L A;  1QCO A;  1T3L A;  1ZBX A;  4KGZ B;  2XHC A;  2CP3 A;  2ROT A;  2D0N A;  4E47 A;  5L23 A;  4QQG A;  2EQK A;  3M55 A;  2LCC A;  2KR3 A;  3QII A;  1YI2 A;  5I11 A;  3X26 B;  4R55 A;  1VIE A;  4KGX B;  4ZGD B;  1JXO A;  2M51 A;  4AG1 C;  3CCS A;  2KYB A;  3TSW A;  3EAE A;  1ZUU A;  1LCK A;  2JW4 A;  1VYV A;  3ULR B;  4C92 A;  3PGG A;  2IVW A;  1E6G A;  1G5V A;  3ME9 A;  3J81 E;  3MEU A;  2JTM A;  1GBR A;  3OYE A;  1TUG B;  3PIP A;  1IZ6 A;  2DBK A;  3M56 A;  4BDZ A;  1WXB A;  2QEX Q;  2QQA A;  5KYU B;  5KYY A;  2F2V A;  3GBQ A;  2RN8 A;  1BCO A;  1OOT A;  2LQK A;  3H0F A;  5GAN e;  2V26 A;  3DLM A;  4M7D B;  3I56 T;  1BI2 A;  2JJ9 A;  2V8I A;  1WPY A;  1OUL A;  1VA7 A;  2ZPI B;  3EGD A;  4L59 A;  3M0R A;  2YUN A;  2VGM A;  4BUG A;  4C5H A;  2K5I A;  3MEA A;  2L5Q A;  2DEQ A;  2EW3 A;  1VQ9 Q;  4J9C A;  4RKU E;  4C8Q D;  1K4U S;  2GCX A;  3GOX A;  1SEM A;  2CGH A;  4C8Q C;  8AT1 B;  1PD1 A;  4MDX A;  2HKQ B;  3H41 A;  1K8A R;  1WFW A;  4JRI A;  4EMH A;  1WLP B;  2EYZ A;  2AIR B;  3OSS C;  3FEO A;  2NWM A;  3O8V A;  2COW A;  1RUW A;  1HK9 A;  3H6Z A;  1W1F A;  2M02 A;  1VQO T;  1VOM A;  2OTJ Q;  4J6W A;  3CEY A;  4JJD A;  2D1X A;  1PHT A;  2ED1 A;  2YRV A;  1AWX A;  2A36 A;  2O4X B;  4F7U B;  1YJN A;  3FC3 A;  2ZPE B;  4KBM B;  2RJD A;  2J7I A;  1OZ3 A;  2DO3 A;  2FRY A;  4CRI A;  3CCL A;  3VUB A;  1KD1 U;  2RF0 A;  2YRD A;  2Z0W A;  2GF7 A;  2RJF A;  4E7I A;  1X6G A;  3QYH B;  1W2B P;  3M4G A;  5LJ3 j;  3EH1 A;  1Q86 U;  4OB1 B;  2FO0 A;  1DJ7 B;  1SSF A;  3DLL A;  1K73 U;  3CC2 A;  4RTV A;  5FRM A;  3VV0 A;  3BY7 A;  2JNG A;  3CCV Q;  4QVD A;  4E6R A;  1WHL A;  3QWX X;  4J7F A;  1I5L A;  2HEQ A;  3MPU B;  4Y91 A;  1Q86 R;  1ZHI A;  4N0A C;  1N8R R;  2X4J A;  1JU5 C;  5J39 A;  4ZGE B;  1KSW A;  1XNI A;  1TSF A;  2DJQ A;  1VYU A;  2CT4 A;  3INZ A;  3THK A;  1Q81 U;  5GAN 4;  2DXT A;  5HKC A;  4HA8 A;  2PQW A;  4F16 A;  1YI2 Q;  4N4G A;  1VYT A;  3EHQ A; 
#chains in the Genus database with same CATH homology
 1TH7 A;  2RHI A;  2DJZ A;  2X4X A;  4BI3 A;  1NE8 A;  4C8Q F;  3CCM A;  2XG8 D;  1VQM A;  2DXU A;  3RMS A;  4OGC A;  4C8Q E;  3OYG A;  4E7J A;  3WVD B;  1W2B S;  5GAO l;  1Q7Y C;  3OYD A;  2HD0 A;  4HT8 A;  1BI0 A;  2DPP B;  3QZ9 B;  3E19 A;  2D9T A;  3LGL A;  3URG A;  3CCR A;  1W2B A;  1M90 U;  2VXE A;  5GAN h;  3SDZ A;  5LJ3 d;  5LJ5 f;  1VQ8 A;  3SFM A;  5A2Q E;  4OMF B;  1K9M U;  2DTO A;  2LQ8 A;  4M77 A;  3ER0 A;  3C4S A;  2PVD B;  4RCB A;  5GAN 7;  4JLI A;  2YLC A;  3EFR A;  4PJO F;  1QVP A;  3A8G B;  5A0G A;  2MMP A;  2EWN A;  2KDS A;  4DOW A;  2RI3 A;  1OI1 A;  4DQ2 A;  4M7A F;  1Y96 B;  3M57 A;  3LWI A;  3I55 T;  3WXM B;  1H3Z A;  1JJ2 A;  4A4F A;  1FWZ A;  2JN0 A;  4GY5 A;  5GAM f;  2GFU A;  3CMA A;  1NJI C;  3X24 B;  3TU4 K;  2XDB A;  4PKC C;  4LD9 K;  3NTK A;  4FU6 A;  5KCH A;  2RB6 A;  3CCS T;  5GAO r;  4HT9 A;  4NL2 A;  3RKY A;  2M1H A;  3VU3 C;  3QPH A;  4C8Q B;  1U1T A;  3DKM A;  1Q82 C;  1N27 A;  4FL6 A;  1M8V A;  1VQK A;  3I55 A;  5GAN 8;  3L2U A;  3MEW A;  1K73 C;  4P5N A;  2E1H A;  3JB9 J;  1BIA A;  2M9U A;  1BKB A;  4MDW A;  5HY6 A;  1VQ9 A;  3J80 E;  3Q1J A;  3CC7 A;  3KUF A;  5CQY A;  2LVM A;  3P8D A;  3CPW S;  3NFC A;  4C0F A;  2RJC A;  2F69 A;  4XTV A;  2LT4 A;  4MZP A;  2OAU A;  3VJP A;  3CCR T;  5C6S A;  3V8K A;  2F5K A;  4LDY A;  5LJ5 h;  3BFM A;  2X4Y A;  4M75 D;  1YIJ A;  1XQH A;  4PL6 A;  4XU1 A;  4NL3 A;  2EJ9 A;  4HKE A;  1O75 A;  2HNI A;  5GMK m;  1IRE B;  2QQS A;  2WSE E;  4F7U G;  1P92 A;  3CC4 A;  2R58 A;  4X9C A;  2DTH A;  2P0Q A;  3E1S A;  2KVQ G;  3GP8 A;  2VC8 A;  4M7D A;  1M4Z A;  2LCL A;  5FU7 C;  1VQO A;  1M5Q 1;  3OB9 A;  1N9R A;  2RHU A;  4HCZ A;  4J7I A;  4C92 C;  4FT4 A;  5GAM h;  4IUU A;  1WQW A;  3CCJ T;  4X9D A;  5LJ3 f;  5LJ5 d;  2XD0 A;  3LYI A;  3QKJ A;  3CCL T;  2ZPB B;  3R6O A;  1JBM A;  4KUL A;  1QVF A;  2DAQ A;  3C12 A;  3JB9 I;  2VV5 A;  1VQN T;  2K2V A;  5I21 A;  3L2W A;  1N6A A;  2K3Y A;  1QVF S;  4C5G A;  2HAX A;  4JLG A;  4C92 F;  3NTI A;  4BE1 A;  4ME7 A;  1Y07 A;  3ZFJ A;  3CBM A;  1RI0 A;  4F7U E;  4EMK B;  2E70 A;  5IT9 E;  4ZN3 A;  4BI8 B;  2XI9 A;  1ZQ1 A;  3G7Z A;  1VQM T;  3V8J A;  3QHS A;  3PNW C;  1VQ9 T;  4M75 E;  3CCM T;  3C94 A;  5CR2 A;  4R56 A;  1S72 T;  3E9F A;  3GF5 A;  2E65 A;  4J8O A;  4LD6 A;  5GAO m;  3OYB A;  1XOV A;  2R5M A;  2EQM A;  4QVC A;  5FRN A;  2RA2 A;  1YJ9 T;  4HCB A;  2RK2 A;  1B34 B;  4J5Y A;  1I81 A;  3VUZ A;  4BB7 A;  4RG8 A;  5AYF A;  2BUD A;  1YIJ T;  3OS5 A;  3PMI A;  2FHD A;  2M0O A;  1NJI U;  3G4S T;  5IAY A;  1HXD A;  1KHC A;  2FYK A;  2VUB A;  3M59 A;  2RM4 A;  3RUX A;  4EMG A;  4XK8 E;  5KCO A;  2KAF A;  4RMO A;  3UWN A;  3M53 A;  3SWN B;  3L42 A;  2LRQ A;  2MAM A;  3JCM X;  3HKS A;  2F5T X;  1D3B A;  2PVO B;  3L2Q A;  1K8A U;  2R5A A;  3OW2 A;  4JRQ A;  3FDR A;  2Y4X A;  1VQK T;  4C0D C;  2XIC A;  5CVI A;  2PUK B;  2A7Y A;  1VQ5 T;  3OYN A;  1OZ2 A;  2CZ1 B;  1YJN T;  4OF1 A;  1JB0 E;  3A8H B;  3J7A F;  2MI6 A;  3OBY A;  4QQD A;  3OYH A;  3OS1 A;  4IUP A;  4BE2 A;  4PJO G;  2RHX A;  3JCM g;  1WQ7 A;  3CBP A;  5GMK i;  4ATO A;  1QVG A;  2P0K A;  4M78 D;  5KE3 A;  2VXF A;  3S6W A;  2OTL T;  1Q7Y U;  2DK3 A;  2D0Q B;  5LJ3 h;  4O5V A;  4HCC A;  1LJO A;  3MCA B;  1LNX A;  3OYA A;  1KQ2 A;  5CKH A;  2HQX A;  4C8Q G;  1N9S A;  2DD4 A;  2LDM A;  2P4T A;  3OMG A;  1WNL A;  1WJS A;  2EJG A;  4N4H A;  4D6W A;  4C0Z A;  5GMK l;  1VQL T;  4MMK A;  3JCM W;  3G71 A;  4XTU A;  2DXC A;  3M4Y A;  3JCM c;  3HP9 A;  2DKG A;  3HRT A;  4C92 E;  2LNV A;  2QA4 A;  4J83 A;  4A4H A;  1Y96 A;  3CCE T;  3CME T;  1UGQ B;  4KT0 E;  3CME A;  4M77 E;  3QO3 A;  3T9N A;  1YIT T;  3QG1 A;  3G6E T;  3DB4 A;  3CCU T;  3VYH B;  5HK0 A;  4BY6 C;  4EPC A;  5FU6 C;  4M7D C;  2WSF E;  2XK0 A;  2E5Q A;  2RHY A;  3FIF A;  5GAM j;  5GAN 5;  4C92 D;  1YBY A;  5GAM d;  3LH0 A;  3JSC A;  5J26 A;  2RK1 A;  4NOY A;  3SWN C;  2RI2 A;  1YJW T;  4OP0 A;  2DZ9 A;  2HBP A;  5FLX E;  1EIF A;  3QZ5 B;  3JCM J;  4J6X A;  2GFA A;  5LJ3 e;  2WAC A;  3G6E A;  4QVZ A;  3HFO A;  3JCM V;  5A0L A;  4PLI A;  4Y28 E;  4A53 A;  4M78 B;  4BD3 A;  4V2S A;  3F70 A;  3VKI A;  3ZEH A;  5GAN j;  2JVV A;  4B9W A;  5CK9 A;  2DD5 A;  2KSS A;  2KY9 A;  4M75 B;  3G71 T;  2DIG A;  4M75 A;  1FXX A;  4PLL A;  2EYQ A;  4ELZ C;  2HQE A;  3CC7 T;  4L5G A;  4M7A A;  1KC8 U;  4IUT A;  4WF2 A;  2EJF A;  4Z02 A;  4E7K A;  3SWN A;  4JJN K;  5M9O A;  4PJO A;  4M75 F;  1D3B B;  3A8M B;  2P0P A;  3ASK A;  4Q5W A;  5KH6 A;  3OQ5 A;  4M77 F;  3OY9 A;  2XDD A;  2RO0 A;  1KD1 C;  2MWP A;  1KHI A;  2VGN A;  2LX9 A;  2V8J A;  2QDY B;  2ZGW A;  1BIB A;  4XTW A;  1R8O B;  3RMQ A;  3JB9 D;  1JJ2 S;  4M7D D;  3JCM e;  4MZT A;  4C5I A;  4GLK A;  5LJ3 g;  3CXC S;  3CC4 T;  4BDY A;  3UDC A;  4E7L A;  4OB3 B;  1YJW A;  3NTH A;  5GAO q;  1VQ5 A;  1KQS S;  1FX7 A;  3X28 B;  4L6V 5;  3BDU A;  4FM4 B;  4C5E A;  5LJ5 j;  3CPF A;  2D6F A;  5D6W A;  1KQS A;  1WJQ A;  2RHZ A;  1M1F A;  2RJE A;  3QJ6 A;  4FT2 A;  3CCU A;  1U8R A;  3AHU A;  4BI4 A;  1I8F A;  2EQJ A;  2L89 A;  4QW2 A;  5DY9 A;  1I4K 1;  4ZTJ A;  5DLQ E;  5CKD A;  4DOV A;  5GAN 3;  3RES A;  1PSF A;  2MWO A;  2I2L A;  5GMK e;  3HHT B;  3OW2 S;  3LLR A;  3WVE B;  5GAN f;  3HFN A;  4MML A;  4LDX A;  2KQW A;  2YHT A;  5I2S A;  1VUB A;  3HRU A;  2X35 A;  3CC2 T;  4BY6 B;  2EQU A;  1X01 A;  4IUV A;  3N5B B;  3RKW A;  1YJ9 A;  2L3R A;  4EMK C;  2CS7 A;  1BI3 A;  5GMK h;  3JB9 G;  3S3N A;  3A8L B;  2CZ7 B;  3RIR A;  4LDW A;  3V7S A;  3MEV A;  5GAM e;  3L2R A;  3L2Z A;  5IN1 A;  3OYK A;  1YIT A;  3SD4 A;  2QEX A;  2FVU A;  1Q81 C;  3QYG B;  1UGR B;  5CO7 A;  5EG2 A;  2QI2 A;  3LGF A;  2C06 A;  1QVG S;  2QA4 T;  4DA4 A;  3VYG A;  3I56 A;  3S3O A;  2JTF A;  2EKO A;  1QW1 A;  3LW5 E;  2DXB A;  2M16 A;  3PIO A;  3JB9 H;  3MP8 A;  5CQX A;  3P8B B;  1BYM A;  2O4X A;  4PNO A;  4M7D E;  4M7A G;  3JRZ A;  1UGP B;  3OBW A;  4KUI A;  2VYT A;  4MZM A;  1Q86 C;  2IG0 A;  5FU6 B;  3L2V A;  2DTI A;  2K57 A;  1JRI A;  2A3L A;  2DZC A;  2QXF A;  1NPR A;  1PSE A;  3TCJ A;  5KE2 A;  3OYC A;  3QSU A;  3PMT A;  3FLG A;  5GAO n;  3OYI A;  3CMA T;  3HSB A;  2PU9 B;  4OGE A;  3RKX A;  3CD6 T;  3PTA A;  1M1K U;  2EAY A;  3OMC A;  2K5F A;  3OYJ A;  1UB4 A;  1LOJ A;  3M54 A;  5CIU A;  5GAM g;  2E6Z A;  2LC4 A;  4A4G A;  3QDR B;  1VQ4 T;  2LT1 A;  2JZ2 A;  2K5L A;  2QTX A;  3KBG A;  1W4S A;  2BKD N;  2DVE A;  2K4Y A;  4ZN1 A;  1ZBX A;  4M7A B;  3JCM b;  1RL2 A;  1B34 A;  4BAC A;  1WJR A;  3A5Z B;  1VQ8 T;  2XHC A;  3BDL A;  3FB9 A;  3SB2 A;  1O9S A;  2OTJ T;  1VQP A;  3LX7 A;  4E47 A;  3PT9 A;  1VQN A;  2XDP A;  3BW1 A;  2WSC E;  2EQK A;  3M55 A;  2LCC A;  4QQG A;  3QII A;  5CKB A;  3KXT A;  1YI2 T;  1YI2 A;  1Q82 U;  1X6O A;  3HRS A;  3P8H A;  2AHJ B;  5CAI A;  3CCE A;  3PFS A;  4ZGJ B;  4QQ6 A;  3UT1 A;  2E41 A;  3X26 B;  4C92 B;  4R55 A;  4PJO C;  1VIE A;  1U1S A;  4XTX A;  4ZGD B;  2JOY A;  5GAO p;  2OTJ A;  4OVA A;  4XU3 A;  3LWH A;  3CCS A;  4N0A A;  3GNF B;  4OB0 B;  3V8L A;  1YHQ A;  4IUQ A;  5GMK j;  1H64 1;  1UEB A;  2QQB A;  3EAE A;  4IKF A;  4N4I A;  4C92 G;  4F7U A;  3V7R A;  3JAM E;  4C92 A;  2E6N A;  2IVW A;  3PGG A;  4M78 G;  1M90 C;  1MHN A;  1G5V A;  3ME9 A;  3JCM h;  4A54 A;  3J81 E;  3CCV T;  3MHX A;  3MEU A;  3OYF A;  2JTM A;  3OYE A;  3JCM P;  1QP2 A;  4M78 C;  3PIP A;  3MP1 A;  1VQ7 T;  4XTZ A;  4XAX B;  1IZ6 A;  1N8R C;  3FRN A;  4NS5 A;  1NZ9 A;  2E12 A;  3M56 A;  5CKE A;  3OS2 A;  3CXC A;  4BDZ A;  4M7D F;  4PJO B;  4M77 B;  2QQA A;  3GNG A;  4M7A D;  4BE0 A;  2GQV A;  4M75 G;  1N8R U;  1G3W A;  4M77 G;  4M78 E;  4RG2 A;  5LJ5 g;  2LQK A;  3OS0 A;  2LTO A;  1VQL A;  1XTD A;  5GAN e;  2O01 E;  2QEX T;  2PUO B;  3DLM A;  4M7D B;  3I56 T;  1BI2 A;  3X25 B;  3S3M A;  1GXI E;  1KQ1 A;  4M77 C;  3X20 B;  2E64 A;  2V8I A;  4VUB A;  2QQR A;  1WPY A;  4II1 A;  2R57 A;  3CCJ A;  4JRP A;  1VQ6 T;  4YTL A;  5DLO A;  3JCM Q;  2ZPI B;  2XU8 A;  4RCC A;  4L59 A;  2B8A A;  3DB3 A;  2VGM A;  4BUG A;  1YHQ T;  3HL8 A;  3HPW A;  4C5H A;  2K5I A;  3MEA A;  2L5Q A;  3QJY A;  2DEQ A;  4XQ3 A;  4RKU E;  4C8Q D;  4EDU A;  5FRO A;  2GCX A;  4F7U F;  3GOX A;  1S72 A;  2CGH A;  3M5A A;  4C8Q C;  5D6Y A;  5LJ5 e;  4OB2 B;  3GIB A;  4MDX A;  2RH2 A;  4JRK A;  1YCY A;  2KMT A;  3MO8 A;  5I2M A;  2XID A;  4LDV A;  4JRI A;  3JCM d;  4PJO D;  3GPL A;  2RD1 A;  1AHJ B;  4EMH A;  2Y90 A;  4EMK A;  2V8K A;  4M77 D;  1VQP T;  4E7H A;  5DM7 R;  2MF2 A;  1VIF A;  3OSS C;  1WGS A;  1Y71 A;  1K9M C;  3FEO A;  3FJP A;  5HK3 A;  3QBY A;  1M9S A;  4FSX A;  3O8V A;  1BI1 A;  3MET A;  4JUV A;  1HK9 A;  3H6Z A;  3TRE A;  3JCM f;  3C95 A;  5LL6 S;  2X4W A;  1VQO T;  4M7A E;  4JDS A;  4M7D G;  2E10 A;  4J6W A;  5CKF A;  1MGQ A;  3QUI A;  3OYM A;  3CEY A;  4ZTF A;  4XTY A;  4C8Q A;  4J6Y A;  4ELY C;  2YRV A;  2L8D A;  2QQ9 A;  1UGS B;  2O4X B;  3OYY A;  3L1A A;  4F7U B;  2CZ6 B;  4FIB A;  4A4E A;  4M7A C;  1YJN A;  3FC3 A;  1X75 C;  2ZPE B;  2ZCF B;  4KBM B;  4M78 F;  5GAN 6;  2RJD A;  3OYL A;  1OZ3 A;  2DO3 A;  2ZPF B;  4TVR A;  5GAN 2;  4CRI A;  2CKK A;  1M1G A;  4CI0 C;  3CCL A;  3VUB A;  2KK4 A;  1KD1 U;  4IUR A;  1M1K C;  3CCV A;  5CCA A;  1G3S A;  3MP6 A;  1VQ7 A;  4JS4 A;  2GF7 A;  2NLU A;  2RJF A;  4E7I A;  4O6J A;  2ZPG B;  2OTL A;  5A0D A;  3OA6 A;  1G3Y A;  2ZZD A;  3QYH B;  3RER A;  2YLB A;  5L8R E;  3M4G A;  3QXE B;  5LJ3 j;  5GAN d;  2RI5 A;  4JS5 A;  3A8O B;  1Q86 U;  4C0G A;  4OB1 B;  4XU0 A;  3ZBD A;  3G4S A;  2K3X A;  3TEE A;  3UPU A;  1VQ4 A;  2CYZ B;  2BIV A;  1DJ7 B;  1SSF A;  3DLL A;  1K73 U;  3CC2 A;  5FU7 B;  5FRM A;  2Y4Y A;  1Y7X A;  2CZ0 B;  4B9X A;  3CBO A;  3VV0 A;  3BY7 A;  2JNG A;  2ZPH B;  4KUD K;  1VQ6 A;  1OYX A;  4QVD A;  1KC8 C;  3JB9 F;  4XU2 A;  3M58 A;  4A4K A;  3CCQ A;  3GLX A;  4J7F A;  3CCQ T;  3OSV A;  1I5L A;  4Y91 A;  2EFI A;  3V7C A;  2DIQ A;  1ZHI A;  4N0A C;  5J3B A;  5GAN g;  2X4J A;  3H8Z A;  5J39 A;  2PVG B;  4ZGE B;  2FL7 A;  1XNI A;  3CPW A;  1KG1 A;  5D6X A;  4LDU A;  1NPP A;  4PJO E;  1K8A C;  1QP3 A;  3INZ A;  4X34 A;  3E9G A;  1V29 B;  1G3T A;  2H3J A;  3M9Q A;  4M75 C;  4UC4 A;  1Q81 U;  3EFS A;  5C0M A;  2JUF A;  5GAN 4;  2DXT A;  4M78 A;  4C0D B;  5HKC A;  4HA8 A;  2PQW A;  2G3R A;  2EIF A;  4N4G A;  2FB7 A;  2XKO C;  3CD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...