5CCAA

Crystal structure of mtb toxin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
94
Chain Sequence
b'MRPIHIAARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNTQTIPVCDLGRQIGYLLASQEPALAEAIGNAFDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF3
molecule tags Hydrolase
source organism Mycobacterium tuberculosis
publication title Crystal structure of Mtb toxin
rcsb
total genus 18
structure length 94
sequence length 98
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ccaA00
5CKBA 2C06A 1X75C 2KMTA 1NE8A 5HK3A 4MDXA 3HPWA 4VUBA 5CQYA 3NFCA 4MZPA 5CO7A 5DLOA 5HK0A 1VUBA 4ELYC 4HKEA 3JSCA 4OF1A 3TCJA 5CR2A 5CKEA 5CCAA 4ME7A 5CKDA 5CKFA 4MZMA 1UB4A 5HKCA 2VUBA 5CK9A 4MZTA 5CQXA 1M1FA 5CKHA 2MF2A 3JRZA 4ELZC 3VUBA 3G7ZA
chains in the Genus database with same CATH superfamily
3EG0A 4IUVA 4M7AB 3REBB 3I56A 3X26B 4RG2A 1I5OB 1Q81U 3FB9A 2KYBA 2HCKA 4E6RA 1ZSZA 3EG9A 1M1KC 2K57A 2M0OA 3H0FA 1XQHA 1VQPT 1NM7A 5CAIA 4GY5A 3OW2P 1VQMQ 5GANj 3JCMQ 1WJSA 3CPFA 2DZ9A 3P8DA 1VQ7T 2KVQG 2ZPHB 1PSEA 3OMCA 3VJPA 1TSFA 2B86A 1VQPQ 4N4GA 1K4US 3LWHA 2XHCA 3WVEB 5DM7R 4PFOA 2GNCA 3CCVA 3CCQQ 4JRPA 3JCMb 3C95A 2OTJQ 3EGDB 3H8ZA 3OYDA 3G6EQ 3TSZA 2F5KA 1YITQ 1M90C 4C5HA 2W0ZA 1U06A 2DYBA 3G71A 3JRZA 1FYNA 1PM3A 3A1PA 3CPWS 2LDMA 2QDYB 3DLMA 3CXCS 4HVWA 3JCMc 1UGPB 1Y07A 4M7AG 2K3YA 1H3ZA 1VQOA 2W10A 1PKSA 4FW2A 2KROA 3U23A 4QVZA 1JBMA 3OYMA 4FYVB 5GAMh 3M0UA 5KYXA 2DNUA 1EIFA 2PZ1A 1JJ2A 5GMKj 5A0LA 2ZPBB 1MMDA 1PD0A 1UGVA 1X27A 2YUNA 2NUPB 3LLRA 2FRWA 4IKFA 3VS7A 3DLLA 2HL5C 1RAEB 3LX7A 1Q86C 4J9HA 1J3TA 3M0PA 4Z8AA 3M0QA 3L1AA 3M59A 1OZ3A 2GF7A 2JOYA 5EG2A 3UA7A 1XJWB 3M0TA 1NLOC 1VQLA 4E7HA 2D0NA 2FZCB 3CCVQ 1ABOA 4Z88A 2KEAA 1XTDA 1NYFA 2HMAA 2YRCA 8ATCB 1UECA 1WX6A 4D6WA 5GAOq 1M1KU 4LDVA 3X25B 2CZ1B 1EFNA 3J7AF 2EW3A 1IGQA 1QVPA 3IQLA 1GXIE 4KH0B 2ED0A 2P0QA 3FLGA 2A28A 1LOJA 2DLPA 4JPBW 5FU6C 1RACB 1M3AA 2DA9A 2QEXT 3CCRQ 5CKDA 1QVGS 3CMEQ 2EYWA 3MEWA 3JCMV 4PFPA 2K4YA 4LUDA 4OB2B 2QTVA 1YJWA 4M78G 1E6GA 3EH2A 3J81E 1H92A 2QEXQ 4DA4A 4M75E 1WHLA 4GLKA 2LCLA 1WQ7A 3QUIA 4LE9A 1VQ5T 2ESWA 4X1VA 1AOJA 3MEUA 4KT0E 1ZUUA 3ZEHA 1HYOA 1KHCA 3CCEA 1M30A 4LNPA 3MPUB 1QCOA 1QCNA 2FHDA 5IHNA 4FM4B 4AMCA 1Q7YR 3HL8A 2HEQA 2GTJA 1NYGA 2MI6A 3CBMA 4Y28E 1WYXA 4WF2A 1RAFB 2O9VA 1GBRA 4B6MA 5J3BA 3CC7Q 3A8OB 3A98A 5KYUB 3CCMA 1I8FA 3OYFA 2VVKA 1UEBA 2K79A 1K9MR 1VQ8T 1KIKA 2F1LA 1Y96A 4ZGEB 2H3JA 3UT1A 1LNXA 4BI4A 4DEYA 3EGUA 3QZ9B 4M77A 3OS0A 1H641 2JM8A 4CI0C 1RAGB 2FEIA 4OGEA 1CKAA 3CEYA 1VQ8Q 3FJPA 3JCMf 1N8RU 2E6ZA 3BY7A 3TCJA 5IAYA 1R0BG 3RDVA 2QYZA 4JRQA 2E70A 1ZSZC 3R6NA 2A36A 2D8HA 4M77G 2JTFA 3I55A 1AZGB 1BK2A 2J6KA 3VS6A 1X6OA 2BE7D 3E9GA 3PE0A 4FYWB 2H8HA 4FYYB 1QW1A 3MEVA 3VU3C 1NJIR 3KXTA 2K6DA 5GAOm 2KK4A 5ECAA 4C92A 4NL3A 2MPXC 1NLPC 1Q82R 1VQNQ 3S3OA 1VQ4T 2K7AA 2XIDA 3M54A 4QVCA 2YWWA 1JO8A 5LJ5h 4AT1B 1M90R 2JUFA 2PQWA 3RKXA 2XKOC 4JRKA 2QXFA 3VS1A 2RPNA 2EPDA 2IIMA 5AT1B 2RQRA 3BFMA 3EAEA 3DB3A 2J7IA 3HP9A 5CK9A 2SEMA 4F14A 2RK2A 4BACA 5KYYB 3FRNA 4II1A 4M78A 2YT6A 4M75B 3V7SA 2P4TA 3FJ5A 3OYEA 3LH5A 4QVDA 4LN2A 1G3SA 1UUEA 1VQ9A 3C94A 2HD0A 4WCIA 3I55T 3EFOA 1VYUA 1M4ZA 4JZ3A 4M75A 3META 4C0ZA 2MOXA 2JVVA 3OMGA 1TXQA 3G7ZA 3G1JA 2E10A 2YXYA 1MMNA 1VQMT 4FSXA 5GAOn 1MUZA 2O2OA 3UWNA 3SHWA 4PJNA 3MCAB 2WSFE 2ROTA 1M9SA 3CMAA 3QWXX 5IH2A 1V1CA 5GAMe 4RTTA 4DBQA 4DBHA 2YHTA 1M8MA 3UF4A 5J39A 3CCMT 3JCMW 2Z0WA 3NHNA 1OEBA 4RMOA 2OI3A 5LJ3f 2NWMA 4R0KA 3I5SA 1Y57A 2RM4A 4GLMA 2QA4T 2L0AA 2HQEA 4AFSC 1YIJA 3SWNB 1D1CA 4M7AF 4PLLA 1T3LA 1YWPA 4E7IA 3VS5A 2DVJA 3ZL7C 2EFIA 1OZ2A 2KAFA 4N0AA 3NFCA 2XI9A 1VQOQ 5GANe 1VQLQ 2D8JA 2B8AA 2NYSA 2L3PA 1GCQA 3TU4K 1VQ6T 4J6YA 2KR3A 2XDBA 1IRXA 4B9WA 1QLYA 4PL6A 2EQUA 2ENMA 2D1XA 3CCUQ 3VUBA 3H0IA 3NGPA 2DBKA 1VQ6Q 2AKLA 4RG8A 4A63B 2QTXA 4DBFA 1YI2A 4EDUA 5KE3A 3WXMB 2KE9A 3THKA 2RNAA 2O88A 1AHJB 1VUBA 5KE2A 2CSIA 1I5LA 4PJOF 4NL2A 1KK7A 3DKMA 4C92F 4E7JA 2QAZA 3CCVT 5LJ3j 3RKWA 1KC8U 2LJ3A 4KRTA 1SKUB 3OSSC 2KBTA 2CKKA 2QDLA 5KCOA 3OB9A 1KSWA 1G2BA 1T3SA 2Y90A 2MWOA 3E9FA 2ZPFB 2LNHB 4OMOA 3VRZA 2J6FA 1VQMA 4ELYC 4C92E 5AYFA 4IIMA 5GAN5 2VV5A 5CCAA 3SWNA 1N9RA 2FPEA 2EGAA 4P5NA 3CCEQ 4CRIA 4PKCC 2OAUA 4CC2A 4K11A 1GFCA 4GBQA 1WHGA 4XTWA 3SEMA 4M7DA 2KYMA 4XAXB 1G3WA 2BTTA 1RAIB 5HK0A 1HD3A 1Z9ZA 3HRUA 1UHFA 5FRNA 1GCQC 2LQ8A 2MYSA 1NPPA 4HCKA 1K76A 3FEOA 3SWNC 1LVKA 5FROA 1YHQA 2JNGA 2GQIA 4F7UA 2DERA 5C6SA 2FYKA 2V26A 3JCMJ 3M55A 4LDUA 4C5IA 2HQXA 1Q86R 1PCXA 2QASA 4OMMA 4CC7A 2X9HA 2LRQA 4KGZB 5CO7A 2OJ2A 3NPFA 3JB9J 2X4YA 4C5GA 1LCKA 2HL3A 5IT9E 2LQWA 1UJ0A 2PUKB 1QVFS 3A8HB 2L2PA 1U1SA 4J9EA 4KULA 3CC7T 3HTRA 2AZSA 3V7CA 3M58A 1YJWQ 1IXDA 5GAMf 4IIOA 4XTUA 1N8RR 3R6OA 3UATA 2DTIA 3GP8A 2EGCA 4CC4B 2K3BA 1IHWA 4JJCA 2KY9A 4OMNA 3OBWA 4FSSA 3RUXA 2X35A 5I21A 2JTMA 3VYGA 4KUIA 5CQXA 3CXCA 4UC4A 2VKNA 4L5GA 2DIGA 3OS5A 3LGFA 1Q86U 3JB9G 5CVIA 1VA7A 1WJRA 1WNLA 2CP2A 1D3BA 4E47A 2WSCE 2DJZA 2BZYA 2CUBA 2KRNA 1K0SA 2K3XA 4C0FA 1BU1A 4EPCA 2JZ2A 4XTVA 2KDSA 3VS3A 1YWOA 2EJGA 1BCOA 4J83A 1PHTA 2YRDA 1U3OA 2RO0A 1QP2A 5GAN6 1PC0A 5FRMA 4ZN1A 4C0GA 9ATCB 3AT1B 1TWBA 1GL5A 1M3CA 3RKYA 1M2VA 2A37A 1OX9A 2EIFA 3QJ6A 5L23A 2OTLQ 3ZBDA 1WI7A 1UDLA 2NUTA 2RHUA 2LCSA 2EVRA 2L8DA 4C0DB 4O6JA 1WGSA 3VUZA 4OGCA 2JXBA 1Y0MA 3OBYA 2CP0A 4AFQC 3HRTA 2COZA 4Y92A 2KSSA 4XTXA 3QZ5B 2F5TX 4F7UF 3G71T 3ASKA 2AIRB 1KC8R 4OMPA 1IREB 4RTYA 1KD1C 3WVDB 1JU5C 1BI3A 1QP3A 5GMKi 1JB0E 2GCXA 2DMOA 1LJOA 2G3RA 2RN8A 3O5ZA 3EG2A 3GPLA 1D09B 2RF0A 3X24B 1Q81R 2OTJA 1SF9A 5HCKA 4FW1A 3L2ZA 2RJDA 2JS0A 2LQKA 2CP7A 4RCCA 1YJNT 1YFNA 4C92G 2M9UA 1GCPA 4M75F 5D6WA 5LJ5j 2EGEA 1NPRA 3M9QA 1VQPA 1AEYA 3CC2A 1RLPC 1ZA2B 2XD0A 4MDXA 5EC7A 3X28B 3M0RA 5DLQE 5FLXE 5A0DA 2VGNA 2EQKA 4A4FA 3CMEA 2COYA 2IVWA 3ZFJA 4OMLA 4EMHA 4XU0A 2FB7A 1U8RA 3VS4A 2DL4A 2OTJT 1M5Q1 2K2VA 4C0DC 4LDXA 3EGXB 3LWIA 5GAMg 2QQRA 1W2BP 1FWZA 3HFNA 2X4JA 2RA2A 2QGFB 1QMCA 4A4KA 3KUFA 3G4ST 2ECZA 2EYXA 2RHXA 4DBRA 2DJQA 4IURA 4OMFB 4CC3A 3QDRB 3L2RA 1W2BS 3BW1A 1IGUA 4ANJA 2DRKA 2GFAA 1BI2A 1JJ2S 2NLUA 4KH1B 2QQ9A 1QVFP 3JCMg 5I2MA 4J6XA 1VQ7A 4L6V5 4QT7A 5KYYA 4JJDA 2V1QA 1Q82C 2DXBA 2CZ7B 3UDCA 2YLBA 4MMLA 2DEUA 4J9GA 2PNIA 1YBYA 3CCJT 2O01E 2K9GA 3CPWP 4F17A 4PJOD 1M2VB 4XTZA 2EYZA 3EFOB 4KGVB 2VWFA 3TSWA 3CC4A 3CC2Q 3EG3A 3CCST 2F2XA 3JB9I 1WQWA 2O9SA 4J9IA 1ACMB 3P8BB 1N6AA 2K5IA 3AHUA 2DRMA 2F69A 4E7SA 1FMWA 2RJEA 4MZTA 1BCMA 1QVFA 1UE9A 5GAN2 1RL2A 1VIFA 1RI0A 1U5SA 2DD5A 2RQVA 2BIVA 2LC4A 1Q82U 2JTEA 1PD1A 3M57A 4IUQA 3NTIA 5IHIA 4OP0A 5C0MA 1TOVA 4A4GA 2LP5A 4BE1A 4J9CA 1VQ5A 1TUGB 1FX7A 3X20B 3ME9A 2RI2A 4C8QG 1CSKA 2DEQA 4M7AC 5I2SA 4M7DB 2KI7A 1K73U 1M3BA 4PNOA 3CCRT 2EJ9A 2E12A 1YCYA 4KBMB 1ZSGA 1NJIC 2EJFA 2HSEB 3CC7A 2LNVA 1VQ7Q 2LT4A 4BY6B 4PJOE 2AT1B 4FIBA 3RMQA 2L5QA 4N4HA 4OF1A 4RUGA 3OS1A 1WPYA 8AT1B 1MV3A 2MCNA 3QXEB 1AD5A 3HKSA 2RD1A 3CCQT 5CKHA 2PVDB 3EFRA 2DVEA 1HJDA 4HT8A 1NEBA 4M7AD 3QG1A 4ZNXA 2QGGA 5GAOp 3VRYA 2L3RA 2QI2A 6AT1B 3H9NA 3C0CA 1W4SA 2M16A 4J9DA 5LJ3g 2HBPA 1K8AR 1RAHB 2JMCA 4AG1C 3J80E 2KMTA 4EMKC 3S3MA 4J7IA 1YI2T 5LJ3e 2F2WA 1KG1A 1KQ2A 3L42A 4JLGA 2E6NA 5GANh 3PT9A 3BDLA 1PNJA 5LL6S 2CZ0B 1YNZA 2BZXA 4OB0B 3TEEA 1R0CB 5GJVB 2DYIA 5GANf 3PFSA 5FWCA 5LJ5f 2KRSA 2DFUA 5FU7B 3QSUA 1PWTA 3RMSA 2V8JA 2DXUA 1P92A 4RKUE 2O4XA 2OX7A 3VS0A 4JS5A 3PMIA 1K9MC 3OYYA 3SB2A 3MHXA 2X51A 1IHVA 2VASA 1SPKA 2E64A 4Y91A 2CP6A 1C0MA 3MKDA 3REAB 4C8QC 1G83A 1B34A 2MK5A 1VQNT 3QBYA 4F04B 2A7YA 1AT1B 3L2VA 1C1AA 2E1HA 1ARKA 1X43A 3OA6A 2DBMA 1YHQQ 2IPOB 2LQNA 1K9AA 4RTZA 1S72A 1JRIA 2YLCA 2COWA 4QW2A 4JZ4A 3CMET 2XK0A 3NMZC 3E2UA 4PJOB 3VKIA 4ESRA 2KQWA 2OTLA 3JSCA 2DK3A 2DILA 4F7UE 1PG5B 3KFVA 1KJWA 2QK0A 2QQAA 2HDAA 3OYLA 3CCLA 3QDFA 1V29B 1QWEA 2R58A 4LXCA 1VQKQ 4M78B 2DL7A 3SFMA 1QVGP 1KD1R 1WHMA 2DX1A 3M4GA 4XU2A 4M4ZA 1OPKA 3BDUA 2P84A 3OS2A 2RHYA 1RI9A 3RBBB 5CR2A 1BI1A 3M0SA 2LX7A 2JMAA 4M7DD 2J6OA 2ZPIB 2QG9B 4QQGA 3FDRA 3M53A 4C8QE 3M56A 2CREA 4HVVA 2FPFA 2RHZA 3VV0A 1YJ9T 2DO3A 4J9BA 2RQUA 1ZUKA 7AT1B 1QWFA 3V8LA 1TG0A 2VXEA 3JCMe 2YUPA 1GRIA 2O31A 3RR6A 3CCMQ 2L3QA 2CS7A 2G6FX 3I9QA 4XU3A 1UTIA 4HT9A 3LH0A 1LPLA 4AFZC 2X4WA 5LJ5g 5CKBA 3RERA 3A8LB 5KH6A 3FIFA 1W2BA 1TUCA 2E3IA 2MWPA 2M51A 3PIOA 1M27C 1M8VA 3JB9F 3UPUA 4C8QF 2DTOA 5FW9A 2D9TA 4AFUC 3Q1JA 2GBQA 2EKHA 3PNWC 1D1AA 1VYVA 2YSQA 1YJNA 2HZYA 3QYGB 2C0TA 3I56Q 4PFZA 4LD6A 4M77B 1QQJA 3HPWA 3HSBA 4MZPA 1OQKA 4LD9K 2L89A 1TU0B 2ZCFB 3CC2T 4BD3A 3I56T 3CCSQ 1WXUA 4HVUA 4YTLA 5I22A 4JUVA 5GAN4 4NS5A 2DD4A 4DEXA 3A8MB 4F16A 2CUDA 1UGRB 3HHTB 5KCHA 3JCMd 1I4K1 2EQJA 3HRSA 1N9SA 2JN0A 1C6VX 2R5MA 4JLIA 4XQ3A 1VIEA 2SRCA 4HCBA 3C4SA 5KYWB 4ZN3A 1JEGA 1RUWA 4PJLA 1UB4A 5M9OA 3UA6A 1V76A 4C8QA 1B3QA 2VGMA 1OU8A 1WHKA 4FYXB 1M2OA 2M0YA 3A5ZB 1M1GA 1OU9A 2EKOA 1K0XA 1GFDA 5HY6A 1WHJA 3MP1A 1K9MU 3CCET 4Z89A 4QQ6A 2A3LA 4E7LA 1T0HA 2GGRA 2NUTB 2XDPA 4QKUA 1JJ2P 3OYGA 2ZZDA 2JM9A 4E7ZA 1Q7YU 1MMGA 2V1RA 1B07A 3V8JA 1KQSP 1D0YA 3V7RA 2K5LA 5FU6B 2PVGB 1Z9QA 4IUUA 1SHFA 2VXFA 2GTOA 4EMKA 4WTOB 1VQ5Q 4M78D 1WXBA 4F7UB 3G6ET 1YITT 1Y7XA 5D6XA 3JB9H 5HK3A 2WACA 4LDYA 5KYWA 1ABQA 5GMKh 4M7AA 1MV0B 1DJ7B 1R8OB 2J05A 5KYXB 1WXTA 2DXTA 2DL8A 4ZTFA 1YN8A 3TQ7P 2WSEE 1Y71A 4O5VA 2E65A 5L8RE 4JJBA 2JT4A 5GAOr 4JJNK 4ZGDB 3PIPA 3PMTA 4D8KA 4D8DA 1KHIA 3MP8A 1XOVA 2LT1A 2I0NA 1I0CA 3URGA 3CCRA 2E3HA 1BKBA 1S72T 2KGTA 5FU7C 5LJ3d 3L2QA 1VQ4A 4IUPA 4RCBA 4BUGA 1E7OA 2EYYA 1PSFA 2RB6A 3JCMX 2MAMA 1S72Q 4M7DF 5IXFA 4M7DC 2DAQA 2LMJA 2HKNA 4Q5WA 3L2WA 1E6HA 2A08A 2XMFA 4ME7A 2YDLA 2R57A 1AVZC 5GAOl 1FXXA 4FT2A 2ZPEB 1JXOA 2EBPA 4EMKB 3JAME 4M77D 2LJ1A 3CMAT 2C0IA 3CD6A 1ZA1B 2RK1A 2GFUA 2YUOA 1EZZB 4A54A 1IB8A 3JV3A 2DE0X 3OYAA 5GAN8 1X2QA 1SHGA 2EWNA 2MMPA 3QHSA 4JDSA 2KXDA 1Q7YC 5IN1A 5GAMj 4NOYA 1KQ1A 2AHJB 3G71Q 4M75G 2AKKA 2BUDA 3CCQA 1G8XA 4C5EA 2C06A 3OYCA 1WFWA 1VQ8A 5GAN3 3QIIA 3EGXA 1WLPB 4QQDA 2RJFA 1B34B 3LW5E 4X34A 1VQKT 1D0XA 1UG1A 1KD1U 2P4RA 3A8GB 3I55Q 1WA7A 2QQBA 1X2KA 2EQMA 1AWJA 5A2QE 3I5RA 1MMAA 4ZTJA 4DQ2A 1NJIU 1BIAA 3CD6T 1JQQA 3QYHB 1YJWT 5KYUA 1YJ9Q 1G3TA 3G4SA 3OW2S 2ROLA 3QKJA 1M1FA 3CCLQ 2QQSA 3CD6Q 1SG5A 4BE2A 1MHNA 2EYQA 1Y96B 5GANg 1WZOA 1RAAB 3CCLT 1K73C 1HSQA 1H8KA 1K73R 5CKEA 2CDTA 1ZX6A 2HAXA 3O8VA 2J06A 4IUTA 3CCSA 2EQIA 4JS4A 4R55A 3M4YA 4J5YA 2CT3A 1UHCA 3QPHA 1ZSZB 3EG9B 2V8KA 2M02A 2IG0A 5GMKe 1N5ZA 3OQ5A 2QA4Q 1X75C 4N0AC 2NUPA 1AWWA 2AZVA 2XICA 1OI1A 2DKGA 1I1JA 2DPPB 3I35A 2Y4YA 3OYJA 3OYHA 1VQLT 2DZCA 3ULRB 3QWYA 1EX4A 2RI5A 2CT4A 3TVTA 2OTLT 3GBQA 2CH4A 1SSFA 2CP5A 2FL7A 2RH2A 5CIUA 2PU9B 1HK9A 2YUQA 4BI3A 2KT1A 4PK4A 4J8OA 1S1NA 1TUDA 4XTYA 4M78C 2CSQA 2R5AA 1N8RC 1MGQA 4BI8B 4X9CA 4E7KA 2RHIA 1AWXA 1K8AC 1R77A 4C92C 4M7AE 3SD4A 1QKWA 1CKBA 4M77E 2ZGWA 4FL6A 1NE8A 3OYIA 3C12A 3M5AA 2CYZB 2P0PA 3NTHA 2DF6A 4LUEA 4PJMA 2HBWA 2CH4W 1B7TA 1UGSB 5J26A 5CKFA 3BE3A 2FO0A 1PRLC 3H41A 3N5BB 2DXCA 1ZBJA 4KGXB 1YCSB 1WDXA 1K1ZA 1VQ9Q 5GJWB 4LDWA 4L59A 4RTUA 2D6FA 2EAYA 1ZQ1A 2DTHA 1UGQB 3CPWA 2E4HA 4ATOA 4MMKA 2HNIA 2LVMA 4X9DA 4BDYA 1X01A 1W6XA 2PVOB 2HKQB 5IXBA 4BY6C 1X6GA 2FRYA 2KNBB 1GBQA 4DOWA 4J6WA 4M77F 4M77C 3V8KA 3RNJA 1YP5A 1YITA 1QCFA 3OSVA 4BDZA 2KXCA 3VS2A 2LZ6B 2VUBA 3EGDA 2PTKA 1SRLA 1Q95G 1KQSS 2CP3A 3D7SB 2D0QB 2HSPA 1BI0A 2O4XB 2RQTA 4TVRA 4V2SA 4DOVA 1BYMA 3GNFB 4M78E 2GQVA 1G5VA 4VUBA 4R56A 3T9NA 1BBZA 3CBOA 4Z02A 1NBEB 4PJJA 4KUDK 3EFSA 1O75A 1G3YA 4FT4A 3MO8A 1VQOT 1UFFA 5FWBA 4C92B 5LJ5d 2JJ9A 1QKXA 2KT8A 3F70A 3E1SA 2YRVA 5CQYA 4OB1B 3MJXA 5DLOA 3HFOA 4RTWA 4OVAA 1AZEA 2FVUA 1TTHB 3CCUT 1MNEA 4ZGJB 2LTOA 3GIBA 2L3SA 2LJ0A 2CZ6B 3VYHB 3QO3A 5HKCA 3ER0A 4PLIA 1FMKA 2K2MA 5GAN7 2I2LA 3TREA 4BE0A 1VYTA 3JB9D 1OPLA 4ORZA 4E2FB 3CCJA 5D6YA 1X69A 3CQTA 3FC3A 2FG0A 5LJ3h 4M78F 3CMAQ 3LYIA 3PVLA 5GMKl 1TH7A 4MZMA 2ABLA 2DETA 3S6WA 2XU8A 3GF5A 4C8QD 1OV3A 4N4IA 2MF2A 1VQKA 1VOMA 4AG2C 2BE9B 2CGHA 3OW2A 2A0FB 5GAMd 3EG1A 5DY9A 4EIKA 1NZ9A 1BIBA 4HA8A 1RABB 1KC8C 1M90U 1M1KR 1PKTA 1YHQT 2DIQA 3JCMP 1A0NB 4PJOC 1WHHA 4A4HA 3EHQA 4M75D 1YJ9A 3OYNA 2C0OA 1D1BA 2JW4A 3S3NA 1QVGA 4A4EA 4PJOA 1T0JA 4OB3B 4HXJA 2X4XA 2VC8A 1SRMA 4XK8E 1SSHA 1RLQC 1OYXA 2JS2A 3H6ZA 3PTAA 2RQWA 2XDDA 5D7UA 4B9XA 2RI3A 2ED1A 2E5QA 4C8QB 4RTXA 1YIJQ 3H0HA 4ELZC 4EMGA 5GANd 1KQSA 3E19A 1VQ6A 4M75C 2XG8D 3OY9A 3DB4A 1YIJT 2E41A 3OYKA 1ZUYA 3G6EA 4C92D 4A53A 2KRMA 2LCCA 2ZPGB 3RIRA 2H3EB 3L2UA 1F1BB 4HCZA 4MDWA 2DL5A 3INZA 2AK5A 3GOXA 1YI2Q 3EH1A 2ATCB 1D3BB 4F7UG 3GLXA 2HQHA 2F2VA 1OOTA 2V8IA 1ZLMA 5LJ5e 4FCYA 4M7DE 2VB6A 1WJQA 1OX8A 1W70A 1I81A 1K8AU 1OULA 1TS9A 1IO6A 3GNGA 1D0ZA 5GMKm 5I11A 3G4SQ 1NEGA 5A0GA 5IHKA 2QEXA 2RJCA 3CXCP 2PUOB 3OYBA 4XU1A 2LX9A 3RESA 1VQNA 3JCMh 3CBPA 3SDZA 2FPDA 4BB7A 3CC4T 1AWOA 4FU6A 1O9SA 4RTVA 4OMQA 2Y4XA 3NTKA 3P8HA 2BKDN 2E5KA 3MP6A 2QA4A 1XNIA 3CC4Q 1BB9A 3PGGA 2X3XD 4HCCA 1X6BA 5KYNA 1W1FA 3CCJQ 1FMVA 3MEAA 2DL3A 1UJYA 1U1TA 3QJYA 2K5FA 2OAWA 2ZAEA 1VQ4Q 1Q81C 2BZ8A 1HXDA 2M1HA 4JRIA 4PJOG 2DM1A 1NG2A 3KBGA 1IZ6A 1ZBXA 1I07A 1SEMA 2P0KA 2FZKB 3CCUA 1KFZA 2VYTA 3PVQA 4J9FA 2RMOA 4HKEA 1ZHIA 1N27A 1MNDA 4J7FA 1JXMA 1WIEA 1H3HA 4M7DG 3EHRA 3LGLA 2NUZA 2FZGB 2X3WD 1PRMC 1VQ9T 2MIOA 1YJNQ 1RADB
chains in the Genus database with same CATH topology
1Y96B 3OB9A 4IUVA 4M7AB 5GANg 5GANf 3I56A 3X26B 4RG2A 3PFSA 1Q81U 3FB9A 2Y90A 2MWOA 3E9FA 2ZPFB 1M1KC 5LJ5f 1VQMA 4ELYC 3CCLT 2K57A 2M0OA 4C92E 1K73C 1XQHA 5FU7B 5AYFA 3QSUA 5GAN5 1VQPT 2VV5A 3RMSA 2V8JA 5CAIA 2DXUA 4GY5A 1P92A 5CKEA 5CCAA 5GANj 2HAXA 3JCMQ 1WJSA 3O8VA 4RKUE 3CPFA 2DZ9A 2O4XA 3SWNA 1N9RA 3P8DA 1VQ7T 2KVQG 4JS5A 3PMIA 4IUTA 4P5NA 2ZPHB 3CCSA 4R55A 1PSEA 3OMCA 3OYYA 3M4YA 4J5YA 3VJPA 1K9MC 3QPHA 3SB2A 2V8KA 4CRIA 2IG0A 4N4GA 4PKCC 2OAUA 5GMKe 3MHXA 3LWHA 2XHCA 3OQ5A 3WVEB 5DM7R 4XTWA 1X75C 4N0AC 4M7DA 4XAXB 2E64A 1G3WA 4Y91A 3CCVA 4JRPA 4C8QC 3JCMb 5HK0A 3C95A 2XICA 3HRUA 1B34A 5FRNA 3H8ZA 3OYDA 2F5KA 2LQ8A 1OI1A 1M90C 2DKGA 1VQNT 1NPPA 4C5HA 3QBYA 3FEOA 3SWNC 2A7YA 3L2VA 2DPPB 1YHQA 5FROA 2E1HA 2JNGA 2Y4YA 3OYJA 4F7UA 3OYHA 3G71A 3OA6A 1VQLT 2DZCA 3JRZA 5C6SA 1S72A 3CPWS 2FYKA 3JCMJ 3M55A 1JRIA 2LDMA 4LDUA 2QDYB 2YLCA 2RI5A 3DLMA 3CXCS 4QW2A 2HQXA 3JCMc 4C5IA 2OTLT 1UGPB 2RH2A 1Y07A 1SSFA 2FL7A 5CIUA 3CMET 2XK0A 2PU9B 4M7AG 1HK9A 2K3YA 4PJOB 2LRQA 3VKIA 5CO7A 4BI3A 1H3ZA 1VQOA 2KQWA 4J8OA 2OTLA 4XTYA 3JSCA 4M78C 2DK3A 3JB9J 4F7UE 2R5AA 2X4YA 4C5GA 1N8RC 1MGQA 4QVZA 4BI8B 1JBMA 3OYMA 5IT9E 2QQAA 3OYLA 4X9CA 3CCLA 5GAMh 4E7KA 1V29B 1EIFA 2PUKB 1QVFS 2RHIA 1JJ2A 5GMKj 3A8HB 1K8AC 5A0LA 2ZPBB 1U1SA 4KULA 2R58A 3CC7T 3V7CA 3M58A 4C92C 4M7AE 3SD4A 4M78B 5GAMf 4M77E 2ZGWA 4FL6A 3SFMA 1NE8A 3OYIA 3LLRA 3C12A 3M4GA 4XU2A 4XTUA 4IKFA 3R6OA 2DTIA 3BDUA 3M5AA 3GP8A 2CYZB 2P0PA 3NTHA 3DLLA 3OS2A 2RHYA 3LX7A 5CR2A 1Q86C 2KY9A 1BI1A 5J26A 1UGSB 5CKFA 3OBWA 3RUXA 2X35A 5I21A 4M7DD 3L1AA 3M59A 2JTMA 3VYGA 2ZPIB 1OZ3A 4QQGA 3N5BB 4KUIA 5CQXA 4UC4A 3FDRA 3CXCA 2GF7A 3M53A 4L5GA 4C8QE 2JOYA 3M56A 5EG2A 2DXCA 2DIGA 3OS5A 2RHZA 3LGFA 3VV0A 3JB9G 5CVIA 1Q86U 1WJRA 1WNLA 1YJ9T 2DO3A 1VQLA 4E7HA 1D3BA 4E47A 2WSCE 2DJZA 4LDWA 3V8LA 2VXEA 4L59A 3JCMe 2D6FA 2EAYA 1XTDA 2K3XA 1ZQ1A 4C0FA 4EPCA 2CS7A 2DTHA 2JZ2A 4XTVA 1UGQB 3CPWA 2KDSA 4XU3A 4D6WA 4ATOA 4HT9A 2EJGA 4MMKA 2HNIA 3LH0A 5GAOq 1M1KU 4LDVA 3X25B 4J83A 2CZ1B 2LVMA 3J7AF 4X9DA 4BDYA 2X4WA 2RO0A 1QP2A 5GAN6 5LJ5g 1X01A 5CKBA 2PVOB 3RERA 3A8LB 5KH6A 1QVPA 3FIFA 5FRMA 4BY6C 4ZN1A 1GXIE 4C0GA 2P0QA 3FLGA 1W2BA 1LOJA 2MWPA 5FU6C 4DOWA 3PIOA 3RKYA 4J6WA 4M77F 4M77C 3V8KA 2QEXT 1M8VA 1YITA 3JB9F 3UPUA 2EIFA 3OSVA 3QJ6A 4BDZA 4C8QF 5CKDA 2DTOA 3ZBDA 1QVGS 2D9TA 2VUBA 3Q1JA 2RHUA 3MEWA 3PNWC 3JCMV 2L8DA 2K4YA 4C0DB 4O6JA 1WGSA 4OB2B 3VUZA 4OGCA 1KQSS 1YJWA 4M78G 1YJNA 3J81E 2D0QB 3QYGB 3OBYA 1BI0A 2O4XB 4DA4A 4M75E 4TVRA 4LD6A 4DOVA 4V2SA 4M77B 1BYMA 3GNFB 4M78E 2GQVA 3HRTA 1G5VA 3HPWA 4VUBA 3HSBA 2KSSA 4GLKA 3QZ5B 4MZPA 4XTXA 4R56A 2F5TX 4F7UF 3G71T 2LCLA 3T9NA 1WQ7A 3ASKA 3QUIA 1VQ5T 4LD9K 3CBOA 3MEUA 2L89A 4KT0E 1IREB 2ZCFB 1KD1C 4Z02A 3WVDB 3ZEHA 3CC2T 4BD3A 1KHCA 3I56T 4KUDK 3CCEA 4YTLA 1BI3A 1QP3A 3EFSA 1O75A 4JUVA 5GAN4 4NS5A 2DD4A 1G3YA 1JB0E 2FHDA 2GCXA 3A8MB 4FT4A 3MO8A 5GMKi 1VQOT 1UGRB 3HHTB 1LJOA 5KCHA 2G3RA 1I4K1 4FM4B 3JCMd 4C92B 5LJ5d 2EQJA 3HL8A 3GPLA 3HRSA 3E1SA 3CBMA 3F70A 2MI6A 4Y28E 1N9SA 2JN0A 2R5MA 3X24B 2YRVA 2OTJA 4JLIA 4WF2A 4XQ3A 5CQYA 1VIEA 4OB1B 4HCBA 5DLOA 3HFOA 3C4SA 3L2ZA 2RJDA 4OVAA 5J3BA 2LQKA 3A8OB 4ZN3A 2FVUA 4RCCA 1YJNT 3CCUT 4ZGJB 3CCMA 2LTOA 4C92G 2M9UA 1I8FA 3GIBA 2CZ6B 3OYFA 3VYHB 3QO3A 1UB4A 5HKCA 3ER0A 5M9OA 4PLIA 4M75F 1UEBA 5D6WA 1VQ8T 5LJ5j 4C8QA 5GAN7 2VGMA 2I2LA 1NPRA 1Y96A 2H3JA 3TREA 3UT1A 1LNXA 4BI4A 4ZGEB 3QZ9B 4M77A 3M9QA 3OS0A 1VQPA 4BE0A 3CC2A 1H641 3A5ZB 4CI0C 1M1GA 2EKOA 3JB9D 2XD0A 4MDXA 5HY6A 3MP1A 4OGEA 3CEYA 3X28B 3CCJA 5D6YA 5FLXE 5DLQE 1K9MU 5A0DA 2VGNA 3CCET 3FJPA 3JCMf 2EQKA 4QQ6A 2E6ZA 4A4FA 3FC3A 2A3LA 3BY7A 5LJ3h 4M78F 3CMEA 3TCJA 5IAYA 3LYIA 5GMKl 2IVWA 3ZFJA 1TH7A 4MZMA 4E7LA 4EMHA 4XU0A 2FB7A 2XDPA 3S6WA 4JRQA 2XU8A 3GF5A 4C8QD 4N4IA 1U8RA 2E70A 2OTJT 3OYGA 2MF2A 1VQKA 4M77G 2ZZDA 1M5Q1 2JTFA 2K2VA 4C0DC 4LDXA 3LWIA 5GAMg 3I55A 1Q7YU 2CGHA 2QQRA 3OW2A 1FWZA 1X6OA 3HFNA 5GAMd 5DY9A 2X4JA 2RA2A 3V8JA 1NZ9A 1BIBA 4HA8A 1KC8C 3E9GA 3V7RA 2K5LA 4A4KA 1M90U 3KUFA 3G4ST 5FU6B 1YHQT 2DIQA 2RHXA 3JCMP 4PJOC 4IURA 2PVGB 4OMFB 3QDRB 3L2RA 1W2BS 4IUUA 4A4HA 3BW1A 1QW1A 2VXFA 3MEVA 3VU3C 4EMKA 3KXTA 2GFAA 1BI2A 4M75D 2NLUA 1YJ9A 1JJ2S 3OYNA 4M78D 2QQ9A 5GAOm 4F7UB 2KK4A 3JCMg 4C92A 3G6ET 3S3NA 1YITT 1QVGA 1Y7XA 4A4EA 4NL3A 5I2MA 5D6XA 4OB3B 4PJOA 3S3OA 2X4XA 4J6XA 1VQ4T 3JB9H 2VC8A 2XIDA 3M54A 4QVCA 5HK3A 1VQ7A 2WACA 4L6V5 4LDYA 4XK8E 5LJ5h 2JUFA 5GMKh 2PQWA 3RKXA 4M7AA 2XKOC 1DJ7B 4JRKA 2QXFA 1OYXA 1Q82C 2DXBA 3H6ZA 1R8OB 3PTAA 2DXTA 2CZ7B 4ZTFA 2XDDA 3UDCA 2YLBA 4MMLA 4B9XA 2RI3A 3BFMA 3EAEA 1YBYA 3CCJT 3DB3A 2O01E 3HP9A 2WSEE 5CK9A 4PJOD 1Y71A 2E5QA 2E65A 4O5VA 5L8RE 4XTZA 4C8QB 2RK2A 4BACA 3FRNA 4II1A 4EMGA 4M78A 4ELZC 5GANd 3CC4A 5GAOr 1KQSA 3E19A 4M75B 4JJNK 4ZGDB 3PIPA 3PMTA 3CCST 1VQ6A 3JB9I 1WQWA 4M75C 3V7SA 2P4TA 3OYEA 4QVDA 3P8BB 1KHIA 1N6AA 3MP8A 2XG8D 1XOVA 1G3SA 2K5IA 3OY9A 3C94A 1VQ9A 3DB4A 2HD0A 2LT1A 4JS4A 1YIJT 3AHUA 2E41A 3OYKA 3URGA 3CCRA 3I55T 3G6EA 4C92D 4A53A 1BKBA 2F69A 2LCCA 1M4ZA 2ZPGB 4M75A 3RIRA 3META 4C0ZA 1S72T 3L2UA 5FU7C 4HCZA 5LJ3d 2RJEA 4MDWA 4MZTA 2JVVA 3L2QA 3INZA 1VQ4A 3OMGA 3GOXA 4IUPA 1QVFA 4RCBA 5GAN2 1RL2A 4BUGA 2E10A 3G7ZA 1D3BB 1VIFA 1RI0A 2DD5A 4F7UG 1VQMT 2BIVA 3GLXA 2LC4A 1PSFA 2RB6A 4FSXA 3JCMX 2MAMA 5GAOn 1Q82U 4M7DF 4M7DC 3UWNA 2DAQA 2V8IA 3MCAB 2WSFE 3M57A 5LJ5e 4IUQA 3NTIA 4M7DE 4Q5WA 3L2WA 1M9SA 4OP0A 5C0MA 3CMAA 4A4GA 1WJQA 4ME7A 1I81A 2R57A 5GAMe 4BE1A 1K8AU 1VQ5A 5GAOl 1FX7A 1FXXA 3X20B 3GNGA 3ME9A 2RI2A 2ZPEB 4FT2A 4C8QG 2DEQA 5GMKm 4M7AC 2YHTA 4EMKB 5I2SA 3JAME 4M77D 4M7DB 3CMAT 1K73U 3CD6A 4PNOA 5A0GA 3CCRT 5J39A 2QEXA 3CCMT 2RK1A 2EJ9A 2E12A 1YCYA 2GFUA 4KBMB 2RJCA 3JCMW 1NJIC 4A54A 2EJFA 2PUOB 3CC7A 3OYBA 2LNVA 2LT4A 4RMOA 4BY6B 4XU1A 3OYAA 4PJOE 2LX9A 5LJ3f 3RESA 5GAN8 1VQNA 3JCMh 4FIBA 3CBPA 3RMQA 2L5QA 4N4HA 2EWNA 3SDZA 4BB7A 4OF1A 3CC4T 3OS1A 1WPYA 2MMPA 3QHSA 4FU6A 4JDSA 1O9SA 2RM4A 3QXEB 1Q7YC 5IN1A 2Y4XA 5GAMj 2QA4T 3HKSA 4NOYA 2HQEA 3NTKA 3P8HA 1YIJA 2RD1A 2BKDN 3SWNB 4M7AF 1KQ1A 2AHJB 4PLLA 3CCQT 3MP6A 4M75G 5CKHA 2QA4A 2PVDB 1XNIA 3EFRA 2DVEA 4E7IA 1N8RU 2BUDA 4HT8A 3PGGA 3CCQA 4HCCA 2EFIA 1OZ2A 2KAFA 4C5EA 2C06A 4N0AA 3OYCA 3QG1A 4M7AD 5GAOp 3NFCA 1VQ8A 2XI9A 5GAN3 5GANe 3QIIA 2L3RA 3MEAA 4QQDA 2B8AA 1U1TA 2QI2A 2RJFA 5KCOA 1B34B 3LW5E 3QJYA 2K5FA 4X34A 3TU4K 1VQ6T 4J6YA 1VQKT 2XDBA 1KD1U 1Q81C 1HXDA 2M1HA 4B9WA 4JRIA 4PL6A 4PJOG 1W4SA 2M16A 2EQUA 3A8GB 5LJ3g 3KBGA 2HBPA 1IZ6A 3VUBA 1ZBXA 2QQBA 2EQMA 4RG8A 2QTXA 1YI2A 3J80E 2P0KA 4EDUA 2KMTA 5KE3A 5A2QE 3CCUA 3WXMB 4ZTJA 4DQ2A 2VYTA 1NJIU 4EMKC 3S3MA 1AHJB 1VUBA 4J7IA 5KE2A 1BIAA 4HKEA 1ZHIA 1YI2T 3CD6T 1N27A 5LJ3e 1I5LA 1KG1A 4PJOF 3QYHB 3L42A 4JLGA 1KQ2A 4NL2A 4J7FA 1YJWT 4E7JA 2E6NA 3DKMA 4C92F 5GANh 3PT9A 1G3TA 3BDLA 3G4SA 4M7DG 3LGLA 3CCVT 5LL6S 5LJ3j 3RKWA 3OW2S 1VQ9T 2CZ0B 3QKJA 1KC8U 1M1FA 2QQSA 4OB0B 3OSSC 3TEEA 2CKKA 4BE2A 1MHNA 2EYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKB A;  2C06 A;  1X75 C;  2KMT A;  1NE8 A;  5HK3 A;  4MDX A;  3HPW A;  4VUB A;  5CQY A;  3NFC A;  4MZP A;  5CO7 A;  5DLO A;  5HK0 A;  1VUB A;  4ELY C;  4HKE A;  3JSC A;  4OF1 A;  3TCJ A;  5CR2 A;  5CKE A;  5CCA A;  4ME7 A;  5CKD A;  5CKF A;  4MZM A;  1UB4 A;  5HKC A;  2VUB A;  5CK9 A;  4MZT A;  5CQX A;  1M1F A;  5CKH A;  2MF2 A;  3JRZ A;  4ELZ C;  3VUB A;  3G7Z A; 
#chains in the Genus database with same CATH topology
 3EG0 A;  4IUV A;  4M7A B;  3REB B;  3I56 A;  3X26 B;  4RG2 A;  1I5O B;  1Q81 U;  3FB9 A;  2KYB A;  2HCK A;  4E6R A;  1ZSZ A;  3EG9 A;  1M1K C;  2K57 A;  2M0O A;  3H0F A;  1XQH A;  1VQP T;  1NM7 A;  5CAI A;  4GY5 A;  3OW2 P;  1VQM Q;  5GAN j;  3JCM Q;  1WJS A;  3CPF A;  2DZ9 A;  3P8D A;  1VQ7 T;  2KVQ G;  2ZPH B;  1PSE A;  3OMC A;  3VJP A;  1TSF A;  2B86 A;  1VQP Q;  4N4G A;  1K4U S;  3LWH A;  2XHC A;  3WVE B;  5DM7 R;  4PFO A;  2GNC A;  3CCV A;  3CCQ Q;  4JRP A;  3JCM b;  3C95 A;  2OTJ Q;  3EGD B;  3H8Z A;  3OYD A;  3G6E Q;  3TSZ A;  2F5K A;  1YIT Q;  1M90 C;  4C5H A;  2W0Z A;  1U06 A;  2DYB A;  3G71 A;  3JRZ A;  1FYN A;  1PM3 A;  3A1P A;  3CPW S;  2LDM A;  2QDY B;  3DLM A;  3CXC S;  4HVW A;  3JCM c;  1UGP B;  1Y07 A;  4M7A G;  2K3Y A;  1H3Z A;  1VQO A;  2W10 A;  1PKS A;  4FW2 A;  2KRO A;  3U23 A;  4QVZ A;  1JBM A;  3OYM A;  4FYV B;  5GAM h;  3M0U A;  5KYX A;  2DNU A;  1EIF A;  2PZ1 A;  1JJ2 A;  5GMK j;  5A0L A;  2ZPB B;  1MMD A;  1PD0 A;  1UGV A;  1X27 A;  2YUN A;  2NUP B;  3LLR A;  2FRW A;  4IKF A;  3VS7 A;  3DLL A;  2HL5 C;  1RAE B;  3LX7 A;  1Q86 C;  4J9H A;  1J3T A;  3M0P A;  4Z8A A;  3M0Q A;  3L1A A;  3M59 A;  1OZ3 A;  2GF7 A;  2JOY A;  5EG2 A;  3UA7 A;  1XJW B;  3M0T A;  1NLO C;  1VQL A;  4E7H A;  2D0N A;  2FZC B;  3CCV Q;  1ABO A;  4Z88 A;  2KEA A;  1XTD A;  1NYF A;  2HMA A;  2YRC A;  8ATC B;  1UEC A;  1WX6 A;  4D6W A;  5GAO q;  1M1K U;  4LDV A;  3X25 B;  2CZ1 B;  1EFN A;  3J7A F;  2EW3 A;  1IGQ A;  1QVP A;  3IQL A;  1GXI E;  4KH0 B;  2ED0 A;  2P0Q A;  3FLG A;  2A28 A;  1LOJ A;  2DLP A;  4JPB W;  5FU6 C;  1RAC B;  1M3A A;  2DA9 A;  2QEX T;  3CCR Q;  5CKD A;  1QVG S;  3CME Q;  2EYW A;  3MEW A;  3JCM V;  4PFP A;  2K4Y A;  4LUD A;  4OB2 B;  2QTV A;  1YJW A;  4M78 G;  1E6G A;  3EH2 A;  3J81 E;  1H92 A;  2QEX Q;  4DA4 A;  4M75 E;  1WHL A;  4GLK A;  2LCL A;  1WQ7 A;  3QUI A;  4LE9 A;  1VQ5 T;  2ESW A;  4X1V A;  1AOJ A;  3MEU A;  4KT0 E;  1ZUU A;  3ZEH A;  1HYO A;  1KHC A;  3CCE A;  1M30 A;  4LNP A;  3MPU B;  1QCO A;  1QCN A;  2FHD A;  5IHN A;  4FM4 B;  4AMC A;  1Q7Y R;  3HL8 A;  2HEQ A;  2GTJ A;  1NYG A;  2MI6 A;  3CBM A;  4Y28 E;  1WYX A;  4WF2 A;  1RAF B;  2O9V A;  1GBR A;  4B6M A;  5J3B A;  3CC7 Q;  3A8O B;  3A98 A;  5KYU B;  3CCM A;  1I8F A;  3OYF A;  2VVK A;  1UEB A;  2K79 A;  1K9M R;  1VQ8 T;  1KIK A;  2F1L A;  1Y96 A;  4ZGE B;  2H3J A;  3UT1 A;  1LNX A;  4BI4 A;  4DEY A;  3EGU A;  3QZ9 B;  4M77 A;  3OS0 A;  1H64 1;  2JM8 A;  4CI0 C;  1RAG B;  2FEI A;  4OGE A;  1CKA A;  3CEY A;  1VQ8 Q;  3FJP A;  3JCM f;  1N8R U;  2E6Z A;  3BY7 A;  3TCJ A;  5IAY A;  1R0B G;  3RDV A;  2QYZ A;  4JRQ A;  2E70 A;  1ZSZ C;  3R6N A;  2A36 A;  2D8H A;  4M77 G;  2JTF A;  3I55 A;  1AZG B;  1BK2 A;  2J6K A;  3VS6 A;  1X6O A;  2BE7 D;  3E9G A;  3PE0 A;  4FYW B;  2H8H A;  4FYY B;  1QW1 A;  3MEV A;  3VU3 C;  1NJI R;  3KXT A;  2K6D A;  5GAO m;  2KK4 A;  5ECA A;  4C92 A;  4NL3 A;  2MPX C;  1NLP C;  1Q82 R;  1VQN Q;  3S3O A;  1VQ4 T;  2K7A A;  2XID A;  3M54 A;  4QVC A;  2YWW A;  1JO8 A;  5LJ5 h;  4AT1 B;  1M90 R;  2JUF A;  2PQW A;  3RKX A;  2XKO C;  4JRK A;  2QXF A;  3VS1 A;  2RPN A;  2EPD A;  2IIM A;  5AT1 B;  2RQR A;  3BFM A;  3EAE A;  3DB3 A;  2J7I A;  3HP9 A;  5CK9 A;  2SEM A;  4F14 A;  2RK2 A;  4BAC A;  5KYY B;  3FRN A;  4II1 A;  4M78 A;  2YT6 A;  4M75 B;  3V7S A;  2P4T A;  3FJ5 A;  3OYE A;  3LH5 A;  4QVD A;  4LN2 A;  1G3S A;  1UUE A;  1VQ9 A;  3C94 A;  2HD0 A;  4WCI A;  3I55 T;  3EFO A;  1VYU A;  1M4Z A;  4JZ3 A;  4M75 A;  3MET A;  4C0Z A;  2MOX A;  2JVV A;  3OMG A;  1TXQ A;  3G7Z A;  3G1J A;  2E10 A;  2YXY A;  1MMN A;  1VQM T;  4FSX A;  5GAO n;  1MUZ A;  2O2O A;  3UWN A;  3SHW A;  4PJN A;  3MCA B;  2WSF E;  2ROT A;  1M9S A;  3CMA A;  3QWX X;  5IH2 A;  1V1C A;  5GAM e;  4RTT A;  4DBQ A;  4DBH A;  2YHT A;  1M8M A;  3UF4 A;  5J39 A;  3CCM T;  3JCM W;  2Z0W A;  3NHN A;  1OEB A;  4RMO A;  2OI3 A;  5LJ3 f;  2NWM A;  4R0K A;  3I5S A;  1Y57 A;  2RM4 A;  4GLM A;  2QA4 T;  2L0A A;  2HQE A;  4AFS C;  1YIJ A;  3SWN B;  1D1C A;  4M7A F;  4PLL A;  1T3L A;  1YWP A;  4E7I A;  3VS5 A;  2DVJ A;  3ZL7 C;  2EFI A;  1OZ2 A;  2KAF A;  4N0A A;  3NFC A;  2XI9 A;  1VQO Q;  5GAN e;  1VQL Q;  2D8J A;  2B8A A;  2NYS A;  2L3P A;  1GCQ A;  3TU4 K;  1VQ6 T;  4J6Y A;  2KR3 A;  2XDB A;  1IRX A;  4B9W A;  1QLY A;  4PL6 A;  2EQU A;  2ENM A;  2D1X A;  3CCU Q;  3VUB A;  3H0I A;  3NGP A;  2DBK A;  1VQ6 Q;  2AKL A;  4RG8 A;  4A63 B;  2QTX A;  4DBF A;  1YI2 A;  4EDU A;  5KE3 A;  3WXM B;  2KE9 A;  3THK A;  2RNA A;  2O88 A;  1AHJ B;  1VUB A;  5KE2 A;  2CSI A;  1I5L A;  4PJO F;  4NL2 A;  1KK7 A;  3DKM A;  4C92 F;  4E7J A;  2QAZ A;  3CCV T;  5LJ3 j;  3RKW A;  1KC8 U;  2LJ3 A;  4KRT A;  1SKU B;  3OSS C;  2KBT A;  2CKK A;  2QDL A;  5KCO A;  3OB9 A;  1KSW A;  1G2B A;  1T3S A;  2Y90 A;  2MWO A;  3E9F A;  2ZPF B;  2LNH B;  4OMO A;  3VRZ A;  2J6F A;  1VQM A;  4ELY C;  4C92 E;  5AYF A;  4IIM A;  5GAN 5;  2VV5 A;  5CCA A;  3SWN A;  1N9R A;  2FPE A;  2EGA A;  4P5N A;  3CCE Q;  4CRI A;  4PKC C;  2OAU A;  4CC2 A;  4K11 A;  1GFC A;  4GBQ A;  1WHG A;  4XTW A;  3SEM A;  4M7D A;  2KYM A;  4XAX B;  1G3W A;  2BTT A;  1RAI B;  5HK0 A;  1HD3 A;  1Z9Z A;  3HRU A;  1UHF A;  5FRN A;  1GCQ C;  2LQ8 A;  2MYS A;  1NPP A;  4HCK A;  1K76 A;  3FEO A;  3SWN C;  1LVK A;  5FRO A;  1YHQ A;  2JNG A;  2GQI A;  4F7U A;  2DER A;  5C6S A;  2FYK A;  2V26 A;  3JCM J;  3M55 A;  4LDU A;  4C5I A;  2HQX A;  1Q86 R;  1PCX A;  2QAS A;  4OMM A;  4CC7 A;  2X9H A;  2LRQ A;  4KGZ B;  5CO7 A;  2OJ2 A;  3NPF A;  3JB9 J;  2X4Y A;  4C5G A;  1LCK A;  2HL3 A;  5IT9 E;  2LQW A;  1UJ0 A;  2PUK B;  1QVF S;  3A8H B;  2L2P A;  1U1S A;  4J9E A;  4KUL A;  3CC7 T;  3HTR A;  2AZS A;  3V7C A;  3M58 A;  1YJW Q;  1IXD A;  5GAM f;  4IIO A;  4XTU A;  1N8R R;  3R6O A;  3UAT A;  2DTI A;  3GP8 A;  2EGC A;  4CC4 B;  2K3B A;  1IHW A;  4JJC A;  2KY9 A;  4OMN A;  3OBW A;  4FSS A;  3RUX A;  2X35 A;  5I21 A;  2JTM A;  3VYG A;  4KUI A;  5CQX A;  3CXC A;  4UC4 A;  2VKN A;  4L5G A;  2DIG A;  3OS5 A;  3LGF A;  1Q86 U;  3JB9 G;  5CVI A;  1VA7 A;  1WJR A;  1WNL A;  2CP2 A;  1D3B A;  4E47 A;  2WSC E;  2DJZ A;  2BZY A;  2CUB A;  2KRN A;  1K0S A;  2K3X A;  4C0F A;  1BU1 A;  4EPC A;  2JZ2 A;  4XTV A;  2KDS A;  3VS3 A;  1YWO A;  2EJG A;  1BCO A;  4J83 A;  1PHT A;  2YRD A;  1U3O A;  2RO0 A;  1QP2 A;  5GAN 6;  1PC0 A;  5FRM A;  4ZN1 A;  4C0G A;  9ATC B;  3AT1 B;  1TWB A;  1GL5 A;  1M3C A;  3RKY A;  1M2V A;  2A37 A;  1OX9 A;  2EIF A;  3QJ6 A;  5L23 A;  2OTL Q;  3ZBD A;  1WI7 A;  1UDL A;  2NUT A;  2RHU A;  2LCS A;  2EVR A;  2L8D A;  4C0D B;  4O6J A;  1WGS A;  3VUZ A;  4OGC A;  2JXB A;  1Y0M A;  3OBY A;  2CP0 A;  4AFQ C;  3HRT A;  2COZ A;  4Y92 A;  2KSS A;  4XTX A;  3QZ5 B;  2F5T X;  4F7U F;  3G71 T;  3ASK A;  2AIR B;  1KC8 R;  4OMP A;  1IRE B;  4RTY A;  1KD1 C;  3WVD B;  1JU5 C;  1BI3 A;  1QP3 A;  5GMK i;  1JB0 E;  2GCX A;  2DMO A;  1LJO A;  2G3R A;  2RN8 A;  3O5Z A;  3EG2 A;  3GPL A;  1D09 B;  2RF0 A;  3X24 B;  1Q81 R;  2OTJ A;  1SF9 A;  5HCK A;  4FW1 A;  3L2Z A;  2RJD A;  2JS0 A;  2LQK A;  2CP7 A;  4RCC A;  1YJN T;  1YFN A;  4C92 G;  2M9U A;  1GCP A;  4M75 F;  5D6W A;  5LJ5 j;  2EGE A;  1NPR A;  3M9Q A;  1VQP A;  1AEY A;  3CC2 A;  1RLP C;  1ZA2 B;  2XD0 A;  4MDX A;  5EC7 A;  3X28 B;  3M0R A;  5DLQ E;  5FLX E;  5A0D A;  2VGN A;  2EQK A;  4A4F A;  3CME A;  2COY A;  2IVW A;  3ZFJ A;  4OML A;  4EMH A;  4XU0 A;  2FB7 A;  1U8R A;  3VS4 A;  2DL4 A;  2OTJ T;  1M5Q 1;  2K2V A;  4C0D C;  4LDX A;  3EGX B;  3LWI A;  5GAM g;  2QQR A;  1W2B P;  1FWZ A;  3HFN A;  2X4J A;  2RA2 A;  2QGF B;  1QMC A;  4A4K A;  3KUF A;  3G4S T;  2ECZ A;  2EYX A;  2RHX A;  4DBR A;  2DJQ A;  4IUR A;  4OMF B;  4CC3 A;  3QDR B;  3L2R A;  1W2B S;  3BW1 A;  1IGU A;  4ANJ A;  2DRK A;  2GFA A;  1BI2 A;  1JJ2 S;  2NLU A;  4KH1 B;  2QQ9 A;  1QVF P;  3JCM g;  5I2M A;  4J6X A;  1VQ7 A;  4L6V 5;  4QT7 A;  5KYY A;  4JJD A;  2V1Q A;  1Q82 C;  2DXB A;  2CZ7 B;  3UDC A;  2YLB A;  4MML A;  2DEU A;  4J9G A;  2PNI A;  1YBY A;  3CCJ T;  2O01 E;  2K9G A;  3CPW P;  4F17 A;  4PJO D;  1M2V B;  4XTZ A;  2EYZ A;  3EFO B;  4KGV B;  2VWF A;  3TSW A;  3CC4 A;  3CC2 Q;  3EG3 A;  3CCS T;  2F2X A;  3JB9 I;  1WQW A;  2O9S A;  4J9I A;  1ACM B;  3P8B B;  1N6A A;  2K5I A;  3AHU A;  2DRM A;  2F69 A;  4E7S A;  1FMW A;  2RJE A;  4MZT A;  1BCM A;  1QVF A;  1UE9 A;  5GAN 2;  1RL2 A;  1VIF A;  1RI0 A;  1U5S A;  2DD5 A;  2RQV A;  2BIV A;  2LC4 A;  1Q82 U;  2JTE A;  1PD1 A;  3M57 A;  4IUQ A;  3NTI A;  5IHI A;  4OP0 A;  5C0M A;  1TOV A;  4A4G A;  2LP5 A;  4BE1 A;  4J9C A;  1VQ5 A;  1TUG B;  1FX7 A;  3X20 B;  3ME9 A;  2RI2 A;  4C8Q G;  1CSK A;  2DEQ A;  4M7A C;  5I2S A;  4M7D B;  2KI7 A;  1K73 U;  1M3B A;  4PNO A;  3CCR T;  2EJ9 A;  2E12 A;  1YCY A;  4KBM B;  1ZSG A;  1NJI C;  2EJF A;  2HSE B;  3CC7 A;  2LNV A;  1VQ7 Q;  2LT4 A;  4BY6 B;  4PJO E;  2AT1 B;  4FIB A;  3RMQ A;  2L5Q A;  4N4H A;  4OF1 A;  4RUG A;  3OS1 A;  1WPY A;  8AT1 B;  1MV3 A;  2MCN A;  3QXE B;  1AD5 A;  3HKS A;  2RD1 A;  3CCQ T;  5CKH A;  2PVD B;  3EFR A;  2DVE A;  1HJD A;  4HT8 A;  1NEB A;  4M7A D;  3QG1 A;  4ZNX A;  2QGG A;  5GAO p;  3VRY A;  2L3R A;  2QI2 A;  6AT1 B;  3H9N A;  3C0C A;  1W4S A;  2M16 A;  4J9D A;  5LJ3 g;  2HBP A;  1K8A R;  1RAH B;  2JMC A;  4AG1 C;  3J80 E;  2KMT A;  4EMK C;  3S3M A;  4J7I A;  1YI2 T;  5LJ3 e;  2F2W A;  1KG1 A;  1KQ2 A;  3L42 A;  4JLG A;  2E6N A;  5GAN h;  3PT9 A;  3BDL A;  1PNJ A;  5LL6 S;  2CZ0 B;  1YNZ A;  2BZX A;  4OB0 B;  3TEE A;  1R0C B;  5GJV B;  2DYI A;  5GAN f;  3PFS A;  5FWC A;  5LJ5 f;  2KRS A;  2DFU A;  5FU7 B;  3QSU A;  1PWT A;  3RMS A;  2V8J A;  2DXU A;  1P92 A;  4RKU E;  2O4X A;  2OX7 A;  3VS0 A;  4JS5 A;  3PMI A;  1K9M C;  3OYY A;  3SB2 A;  3MHX A;  2X51 A;  1IHV A;  2VAS A;  1SPK A;  2E64 A;  4Y91 A;  2CP6 A;  1C0M A;  3MKD A;  3REA B;  4C8Q C;  1G83 A;  1B34 A;  2MK5 A;  1VQN T;  3QBY A;  4F04 B;  2A7Y A;  1AT1 B;  3L2V A;  1C1A A;  2E1H A;  1ARK A;  1X43 A;  3OA6 A;  2DBM A;  1YHQ Q;  2IPO B;  2LQN A;  1K9A A;  4RTZ A;  1S72 A;  1JRI A;  2YLC A;  2COW A;  4QW2 A;  4JZ4 A;  3CME T;  2XK0 A;  3NMZ C;  3E2U A;  4PJO B;  3VKI A;  4ESR A;  2KQW A;  2OTL A;  3JSC A;  2DK3 A;  2DIL A;  4F7U E;  1PG5 B;  3KFV A;  1KJW A;  2QK0 A;  2QQA A;  2HDA A;  3OYL A;  3CCL A;  3QDF A;  1V29 B;  1QWE A;  2R58 A;  4LXC A;  1VQK Q;  4M78 B;  2DL7 A;  3SFM A;  1QVG P;  1KD1 R;  1WHM A;  2DX1 A;  3M4G A;  4XU2 A;  4M4Z A;  1OPK A;  3BDU A;  2P84 A;  3OS2 A;  2RHY A;  1RI9 A;  3RBB B;  5CR2 A;  1BI1 A;  3M0S A;  2LX7 A;  2JMA A;  4M7D D;  2J6O A;  2ZPI B;  2QG9 B;  4QQG A;  3FDR A;  3M53 A;  4C8Q E;  3M56 A;  2CRE A;  4HVV A;  2FPF A;  2RHZ A;  3VV0 A;  1YJ9 T;  2DO3 A;  4J9B A;  2RQU A;  1ZUK A;  7AT1 B;  1QWF A;  3V8L A;  1TG0 A;  2VXE A;  3JCM e;  2YUP A;  1GRI A;  2O31 A;  3RR6 A;  3CCM Q;  2L3Q A;  2CS7 A;  2G6F X;  3I9Q A;  4XU3 A;  1UTI A;  4HT9 A;  3LH0 A;  1LPL A;  4AFZ C;  2X4W A;  5LJ5 g;  5CKB A;  3RER A;  3A8L B;  5KH6 A;  3FIF A;  1W2B A;  1TUC A;  2E3I A;  2MWP A;  2M51 A;  3PIO A;  1M27 C;  1M8V A;  3JB9 F;  3UPU A;  4C8Q F;  2DTO A;  5FW9 A;  2D9T A;  4AFU C;  3Q1J A;  2GBQ A;  2EKH A;  3PNW C;  1D1A A;  1VYV A;  2YSQ A;  1YJN A;  2HZY A;  3QYG B;  2C0T A;  3I56 Q;  4PFZ A;  4LD6 A;  4M77 B;  1QQJ A;  3HPW A;  3HSB A;  4MZP A;  1OQK A;  4LD9 K;  2L89 A;  1TU0 B;  2ZCF B;  3CC2 T;  4BD3 A;  3I56 T;  3CCS Q;  1WXU A;  4HVU A;  4YTL A;  5I22 A;  4JUV A;  5GAN 4;  4NS5 A;  2DD4 A;  4DEX A;  3A8M B;  4F16 A;  2CUD A;  1UGR B;  3HHT B;  5KCH A;  3JCM d;  1I4K 1;  2EQJ A;  3HRS A;  1N9S A;  2JN0 A;  1C6V X;  2R5M A;  4JLI A;  4XQ3 A;  1VIE A;  2SRC A;  4HCB A;  3C4S A;  5KYW B;  4ZN3 A;  1JEG A;  1RUW A;  4PJL A;  1UB4 A;  5M9O A;  3UA6 A;  1V76 A;  4C8Q A;  1B3Q A;  2VGM A;  1OU8 A;  1WHK A;  4FYX B;  1M2O A;  2M0Y A;  3A5Z B;  1M1G A;  1OU9 A;  2EKO A;  1K0X A;  1GFD A;  5HY6 A;  1WHJ A;  3MP1 A;  1K9M U;  3CCE T;  4Z89 A;  4QQ6 A;  2A3L A;  4E7L A;  1T0H A;  2GGR A;  2NUT B;  2XDP A;  4QKU A;  1JJ2 P;  3OYG A;  2ZZD A;  2JM9 A;  4E7Z A;  1Q7Y U;  1MMG A;  2V1R A;  1B07 A;  3V8J A;  1KQS P;  1D0Y A;  3V7R A;  2K5L A;  5FU6 B;  2PVG B;  1Z9Q A;  4IUU A;  1SHF A;  2VXF A;  2GTO A;  4EMK A;  4WTO B;  1VQ5 Q;  4M78 D;  1WXB A;  4F7U B;  3G6E T;  1YIT T;  1Y7X A;  5D6X A;  3JB9 H;  5HK3 A;  2WAC A;  4LDY A;  5KYW A;  1ABQ A;  5GMK h;  4M7A A;  1MV0 B;  1DJ7 B;  1R8O B;  2J05 A;  5KYX B;  1WXT A;  2DXT A;  2DL8 A;  4ZTF A;  1YN8 A;  3TQ7 P;  2WSE E;  1Y71 A;  4O5V A;  2E65 A;  5L8R E;  4JJB A;  2JT4 A;  5GAO r;  4JJN K;  4ZGD B;  3PIP A;  3PMT A;  4D8K A;  4D8D A;  1KHI A;  3MP8 A;  1XOV A;  2LT1 A;  2I0N A;  1I0C A;  3URG A;  3CCR A;  2E3H A;  1BKB A;  1S72 T;  2KGT A;  5FU7 C;  5LJ3 d;  3L2Q A;  1VQ4 A;  4IUP A;  4RCB A;  4BUG A;  1E7O A;  2EYY A;  1PSF A;  2RB6 A;  3JCM X;  2MAM A;  1S72 Q;  4M7D F;  5IXF A;  4M7D C;  2DAQ A;  2LMJ A;  2HKN A;  4Q5W A;  3L2W A;  1E6H A;  2A08 A;  2XMF A;  4ME7 A;  2YDL A;  2R57 A;  1AVZ C;  5GAO l;  1FXX A;  4FT2 A;  2ZPE B;  1JXO A;  2EBP A;  4EMK B;  3JAM E;  4M77 D;  2LJ1 A;  3CMA T;  2C0I A;  3CD6 A;  1ZA1 B;  2RK1 A;  2GFU A;  2YUO A;  1EZZ B;  4A54 A;  1IB8 A;  3JV3 A;  2DE0 X;  3OYA A;  5GAN 8;  1X2Q A;  1SHG A;  2EWN A;  2MMP A;  3QHS A;  4JDS A;  2KXD A;  1Q7Y C;  5IN1 A;  5GAM j;  4NOY A;  1KQ1 A;  2AHJ B;  3G71 Q;  4M75 G;  2AKK A;  2BUD A;  3CCQ A;  1G8X A;  4C5E A;  2C06 A;  3OYC A;  1WFW A;  1VQ8 A;  5GAN 3;  3QII A;  3EGX A;  1WLP B;  4QQD A;  2RJF A;  1B34 B;  3LW5 E;  4X34 A;  1VQK T;  1D0X A;  1UG1 A;  1KD1 U;  2P4R A;  3A8G B;  3I55 Q;  1WA7 A;  2QQB A;  1X2K A;  2EQM A;  1AWJ A;  5A2Q E;  3I5R A;  1MMA A;  4ZTJ A;  4DQ2 A;  1NJI U;  1BIA A;  3CD6 T;  1JQQ A;  3QYH B;  1YJW T;  5KYU A;  1YJ9 Q;  1G3T A;  3G4S A;  3OW2 S;  2ROL A;  3QKJ A;  1M1F A;  3CCL Q;  2QQS A;  3CD6 Q;  1SG5 A;  4BE2 A;  1MHN A;  2EYQ A;  1Y96 B;  5GAN g;  1WZO A;  1RAA B;  3CCL T;  1K73 C;  1HSQ A;  1H8K A;  1K73 R;  5CKE A;  2CDT A;  1ZX6 A;  2HAX A;  3O8V A;  2J06 A;  4IUT A;  3CCS A;  2EQI A;  4JS4 A;  4R55 A;  3M4Y A;  4J5Y A;  2CT3 A;  1UHC A;  3QPH A;  1ZSZ B;  3EG9 B;  2V8K A;  2M02 A;  2IG0 A;  5GMK e;  1N5Z A;  3OQ5 A;  2QA4 Q;  1X75 C;  4N0A C;  2NUP A;  1AWW A;  2AZV A;  2XIC A;  1OI1 A;  2DKG A;  1I1J A;  2DPP B;  3I35 A;  2Y4Y A;  3OYJ A;  3OYH A;  1VQL T;  2DZC A;  3ULR B;  3QWY A;  1EX4 A;  2RI5 A;  2CT4 A;  3TVT A;  2OTL T;  3GBQ A;  2CH4 A;  1SSF A;  2CP5 A;  2FL7 A;  2RH2 A;  5CIU A;  2PU9 B;  1HK9 A;  2YUQ A;  4BI3 A;  2KT1 A;  4PK4 A;  4J8O A;  1S1N A;  1TUD A;  4XTY A;  4M78 C;  2CSQ A;  2R5A A;  1N8R C;  1MGQ A;  4BI8 B;  4X9C A;  4E7K A;  2RHI A;  1AWX A;  1K8A C;  1R77 A;  4C92 C;  4M7A E;  3SD4 A;  1QKW A;  1CKB A;  4M77 E;  2ZGW A;  4FL6 A;  1NE8 A;  3OYI A;  3C12 A;  3M5A A;  2CYZ B;  2P0P A;  3NTH A;  2DF6 A;  4LUE A;  4PJM A;  2HBW A;  2CH4 W;  1B7T A;  1UGS B;  5J26 A;  5CKF A;  3BE3 A;  2FO0 A;  1PRL C;  3H41 A;  3N5B B;  2DXC A;  1ZBJ A;  4KGX B;  1YCS B;  1WDX A;  1K1Z A;  1VQ9 Q;  5GJW B;  4LDW A;  4L59 A;  4RTU A;  2D6F A;  2EAY A;  1ZQ1 A;  2DTH A;  1UGQ B;  3CPW A;  2E4H A;  4ATO A;  4MMK A;  2HNI A;  2LVM A;  4X9D A;  4BDY A;  1X01 A;  1W6X A;  2PVO B;  2HKQ B;  5IXB A;  4BY6 C;  1X6G A;  2FRY A;  2KNB B;  1GBQ A;  4DOW A;  4J6W A;  4M77 F;  4M77 C;  3V8K A;  3RNJ A;  1YP5 A;  1YIT A;  1QCF A;  3OSV A;  4BDZ A;  2KXC A;  3VS2 A;  2LZ6 B;  2VUB A;  3EGD A;  2PTK A;  1SRL A;  1Q95 G;  1KQS S;  2CP3 A;  3D7S B;  2D0Q B;  2HSP A;  1BI0 A;  2O4X B;  2RQT A;  4TVR A;  4V2S A;  4DOV A;  1BYM A;  3GNF B;  4M78 E;  2GQV A;  1G5V A;  4VUB A;  4R56 A;  3T9N A;  1BBZ A;  3CBO A;  4Z02 A;  1NBE B;  4PJJ A;  4KUD K;  3EFS A;  1O75 A;  1G3Y A;  4FT4 A;  3MO8 A;  1VQO T;  1UFF A;  5FWB A;  4C92 B;  5LJ5 d;  2JJ9 A;  1QKX A;  2KT8 A;  3F70 A;  3E1S A;  2YRV A;  5CQY A;  4OB1 B;  3MJX A;  5DLO A;  3HFO A;  4RTW A;  4OVA A;  1AZE A;  2FVU A;  1TTH B;  3CCU T;  1MNE A;  4ZGJ B;  2LTO A;  3GIB A;  2L3S A;  2LJ0 A;  2CZ6 B;  3VYH B;  3QO3 A;  5HKC A;  3ER0 A;  4PLI A;  1FMK A;  2K2M A;  5GAN 7;  2I2L A;  3TRE A;  4BE0 A;  1VYT A;  3JB9 D;  1OPL A;  4ORZ A;  4E2F B;  3CCJ A;  5D6Y A;  1X69 A;  3CQT A;  3FC3 A;  2FG0 A;  5LJ3 h;  4M78 F;  3CMA Q;  3LYI A;  3PVL A;  5GMK l;  1TH7 A;  4MZM A;  2ABL A;  2DET A;  3S6W A;  2XU8 A;  3GF5 A;  4C8Q D;  1OV3 A;  4N4I A;  2MF2 A;  1VQK A;  1VOM A;  4AG2 C;  2BE9 B;  2CGH A;  3OW2 A;  2A0F B;  5GAM d;  3EG1 A;  5DY9 A;  4EIK A;  1NZ9 A;  1BIB A;  4HA8 A;  1RAB B;  1KC8 C;  1M90 U;  1M1K R;  1PKT A;  1YHQ T;  2DIQ A;  3JCM P;  1A0N B;  4PJO C;  1WHH A;  4A4H A;  3EHQ A;  4M75 D;  1YJ9 A;  3OYN A;  2C0O A;  1D1B A;  2JW4 A;  3S3N A;  1QVG A;  4A4E A;  4PJO A;  1T0J A;  4OB3 B;  4HXJ A;  2X4X A;  2VC8 A;  1SRM A;  4XK8 E;  1SSH A;  1RLQ C;  1OYX A;  2JS2 A;  3H6Z A;  3PTA A;  2RQW A;  2XDD A;  5D7U A;  4B9X A;  2RI3 A;  2ED1 A;  2E5Q A;  4C8Q B;  4RTX A;  1YIJ Q;  3H0H A;  4ELZ C;  4EMG A;  5GAN d;  1KQS A;  3E19 A;  1VQ6 A;  4M75 C;  2XG8 D;  3OY9 A;  3DB4 A;  1YIJ T;  2E41 A;  3OYK A;  1ZUY A;  3G6E A;  4C92 D;  4A53 A;  2KRM A;  2LCC A;  2ZPG B;  3RIR A;  2H3E B;  3L2U A;  1F1B B;  4HCZ A;  4MDW A;  2DL5 A;  3INZ A;  2AK5 A;  3GOX A;  1YI2 Q;  3EH1 A;  2ATC B;  1D3B B;  4F7U G;  3GLX A;  2HQH A;  2F2V A;  1OOT A;  2V8I A;  1ZLM A;  5LJ5 e;  4FCY A;  4M7D E;  2VB6 A;  1WJQ A;  1OX8 A;  1W70 A;  1I81 A;  1K8A U;  1OUL A;  1TS9 A;  1IO6 A;  3GNG A;  1D0Z A;  5GMK m;  5I11 A;  3G4S Q;  1NEG A;  5A0G A;  5IHK A;  2QEX A;  2RJC A;  3CXC P;  2PUO B;  3OYB A;  4XU1 A;  2LX9 A;  3RES A;  1VQN A;  3JCM h;  3CBP A;  3SDZ A;  2FPD A;  4BB7 A;  3CC4 T;  1AWO A;  4FU6 A;  1O9S A;  4RTV A;  4OMQ A;  2Y4X A;  3NTK A;  3P8H A;  2BKD N;  2E5K A;  3MP6 A;  2QA4 A;  1XNI A;  3CC4 Q;  1BB9 A;  3PGG A;  2X3X D;  4HCC A;  1X6B A;  5KYN A;  1W1F A;  3CCJ Q;  1FMV A;  3MEA A;  2DL3 A;  1UJY A;  1U1T A;  3QJY A;  2K5F A;  2OAW A;  2ZAE A;  1VQ4 Q;  1Q81 C;  2BZ8 A;  1HXD A;  2M1H A;  4JRI A;  4PJO G;  2DM1 A;  1NG2 A;  3KBG A;  1IZ6 A;  1ZBX A;  1I07 A;  1SEM A;  2P0K A;  2FZK B;  3CCU A;  1KFZ A;  2VYT A;  3PVQ A;  4J9F A;  2RMO A;  4HKE A;  1ZHI A;  1N27 A;  1MND A;  4J7F A;  1JXM A;  1WIE A;  1H3H A;  4M7D G;  3EHR A;  3LGL A;  2NUZ A;  2FZG B;  2X3W D;  1PRM C;  1VQ9 T;  2MIO A;  1YJN Q;  1RAD B; 
#chains in the Genus database with same CATH homology
 1Y96 B;  3OB9 A;  4IUV A;  4M7A B;  5GAN g;  5GAN f;  3I56 A;  3X26 B;  4RG2 A;  3PFS A;  1Q81 U;  3FB9 A;  2Y90 A;  2MWO A;  3E9F A;  2ZPF B;  1M1K C;  5LJ5 f;  1VQM A;  4ELY C;  3CCL T;  2K57 A;  2M0O A;  4C92 E;  1K73 C;  1XQH A;  5FU7 B;  5AYF A;  3QSU A;  5GAN 5;  1VQP T;  2VV5 A;  3RMS A;  2V8J A;  5CAI A;  2DXU A;  4GY5 A;  1P92 A;  5CKE A;  5CCA A;  5GAN j;  2HAX A;  3JCM Q;  1WJS A;  3O8V A;  4RKU E;  3CPF A;  2DZ9 A;  2O4X A;  3SWN A;  1N9R A;  3P8D A;  1VQ7 T;  2KVQ G;  4JS5 A;  3PMI A;  4IUT A;  4P5N A;  2ZPH B;  3CCS A;  4R55 A;  1PSE A;  3OMC A;  3OYY A;  3M4Y A;  4J5Y A;  3VJP A;  1K9M C;  3QPH A;  3SB2 A;  2V8K A;  4CRI A;  2IG0 A;  4N4G A;  4PKC C;  2OAU A;  5GMK e;  3MHX A;  3LWH A;  2XHC A;  3OQ5 A;  3WVE B;  5DM7 R;  4XTW A;  1X75 C;  4N0A C;  4M7D A;  4XAX B;  2E64 A;  1G3W A;  4Y91 A;  3CCV A;  4JRP A;  4C8Q C;  3JCM b;  5HK0 A;  3C95 A;  2XIC A;  3HRU A;  1B34 A;  5FRN A;  3H8Z A;  3OYD A;  2F5K A;  2LQ8 A;  1OI1 A;  1M90 C;  2DKG A;  1VQN T;  1NPP A;  4C5H A;  3QBY A;  3FEO A;  3SWN C;  2A7Y A;  3L2V A;  2DPP B;  1YHQ A;  5FRO A;  2E1H A;  2JNG A;  2Y4Y A;  3OYJ A;  4F7U A;  3OYH A;  3G71 A;  3OA6 A;  1VQL T;  2DZC A;  3JRZ A;  5C6S A;  1S72 A;  3CPW S;  2FYK A;  3JCM J;  3M55 A;  1JRI A;  2LDM A;  4LDU A;  2QDY B;  2YLC A;  2RI5 A;  3DLM A;  3CXC S;  4QW2 A;  2HQX A;  3JCM c;  4C5I A;  2OTL T;  1UGP B;  2RH2 A;  1Y07 A;  1SSF A;  2FL7 A;  5CIU A;  3CME T;  2XK0 A;  2PU9 B;  4M7A G;  1HK9 A;  2K3Y A;  4PJO B;  2LRQ A;  3VKI A;  5CO7 A;  4BI3 A;  1H3Z A;  1VQO A;  2KQW A;  4J8O A;  2OTL A;  4XTY A;  3JSC A;  4M78 C;  2DK3 A;  3JB9 J;  4F7U E;  2R5A A;  2X4Y A;  4C5G A;  1N8R C;  1MGQ A;  4QVZ A;  4BI8 B;  1JBM A;  3OYM A;  5IT9 E;  2QQA A;  3OYL A;  4X9C A;  3CCL A;  5GAM h;  4E7K A;  1V29 B;  1EIF A;  2PUK B;  1QVF S;  2RHI A;  1JJ2 A;  5GMK j;  3A8H B;  1K8A C;  5A0L A;  2ZPB B;  1U1S A;  4KUL A;  2R58 A;  3CC7 T;  3V7C A;  3M58 A;  4C92 C;  4M7A E;  3SD4 A;  4M78 B;  5GAM f;  4M77 E;  2ZGW A;  4FL6 A;  3SFM A;  1NE8 A;  3OYI A;  3LLR A;  3C12 A;  3M4G A;  4XU2 A;  4XTU A;  4IKF A;  3R6O A;  2DTI A;  3BDU A;  3M5A A;  3GP8 A;  2CYZ B;  2P0P A;  3NTH A;  3DLL A;  3OS2 A;  2RHY A;  3LX7 A;  5CR2 A;  1Q86 C;  2KY9 A;  1BI1 A;  5J26 A;  1UGS B;  5CKF A;  3OBW A;  3RUX A;  2X35 A;  5I21 A;  4M7D D;  3L1A A;  3M59 A;  2JTM A;  3VYG A;  2ZPI B;  1OZ3 A;  4QQG A;  3N5B B;  4KUI A;  5CQX A;  4UC4 A;  3FDR A;  3CXC A;  2GF7 A;  3M53 A;  4L5G A;  4C8Q E;  2JOY A;  3M56 A;  5EG2 A;  2DXC A;  2DIG A;  3OS5 A;  2RHZ A;  3LGF A;  3VV0 A;  3JB9 G;  5CVI A;  1Q86 U;  1WJR A;  1WNL A;  1YJ9 T;  2DO3 A;  1VQL A;  4E7H A;  1D3B A;  4E47 A;  2WSC E;  2DJZ A;  4LDW A;  3V8L A;  2VXE A;  4L59 A;  3JCM e;  2D6F A;  2EAY A;  1XTD A;  2K3X A;  1ZQ1 A;  4C0F A;  4EPC A;  2CS7 A;  2DTH A;  2JZ2 A;  4XTV A;  1UGQ B;  3CPW A;  2KDS A;  4XU3 A;  4D6W A;  4ATO A;  4HT9 A;  2EJG A;  4MMK A;  2HNI A;  3LH0 A;  5GAO q;  1M1K U;  4LDV A;  3X25 B;  4J83 A;  2CZ1 B;  2LVM A;  3J7A F;  4X9D A;  4BDY A;  2X4W A;  2RO0 A;  1QP2 A;  5GAN 6;  5LJ5 g;  1X01 A;  5CKB A;  2PVO B;  3RER A;  3A8L B;  5KH6 A;  1QVP A;  3FIF A;  5FRM A;  4BY6 C;  4ZN1 A;  1GXI E;  4C0G A;  2P0Q A;  3FLG A;  1W2B A;  1LOJ A;  2MWP A;  5FU6 C;  4DOW A;  3PIO A;  3RKY A;  4J6W A;  4M77 F;  4M77 C;  3V8K A;  2QEX T;  1M8V A;  1YIT A;  3JB9 F;  3UPU A;  2EIF A;  3OSV A;  3QJ6 A;  4BDZ A;  4C8Q F;  5CKD A;  2DTO A;  3ZBD A;  1QVG S;  2D9T A;  2VUB A;  3Q1J A;  2RHU A;  3MEW A;  3PNW C;  3JCM V;  2L8D A;  2K4Y A;  4C0D B;  4O6J A;  1WGS A;  4OB2 B;  3VUZ A;  4OGC A;  1KQS S;  1YJW A;  4M78 G;  1YJN A;  3J81 E;  2D0Q B;  3QYG B;  3OBY A;  1BI0 A;  2O4X B;  4DA4 A;  4M75 E;  4TVR A;  4LD6 A;  4DOV A;  4V2S A;  4M77 B;  1BYM A;  3GNF B;  4M78 E;  2GQV A;  3HRT A;  1G5V A;  3HPW A;  4VUB A;  3HSB A;  2KSS A;  4GLK A;  3QZ5 B;  4MZP A;  4XTX A;  4R56 A;  2F5T X;  4F7U F;  3G71 T;  2LCL A;  3T9N A;  1WQ7 A;  3ASK A;  3QUI A;  1VQ5 T;  4LD9 K;  3CBO A;  3MEU A;  2L89 A;  4KT0 E;  1IRE B;  2ZCF B;  1KD1 C;  4Z02 A;  3WVD B;  3ZEH A;  3CC2 T;  4BD3 A;  1KHC A;  3I56 T;  4KUD K;  3CCE A;  4YTL A;  1BI3 A;  1QP3 A;  3EFS A;  1O75 A;  4JUV A;  5GAN 4;  4NS5 A;  2DD4 A;  1G3Y A;  1JB0 E;  2FHD A;  2GCX A;  3A8M B;  4FT4 A;  3MO8 A;  5GMK i;  1VQO T;  1UGR B;  3HHT B;  1LJO A;  5KCH A;  2G3R A;  1I4K 1;  4FM4 B;  3JCM d;  4C92 B;  5LJ5 d;  2EQJ A;  3HL8 A;  3GPL A;  3HRS A;  3E1S A;  3CBM A;  3F70 A;  2MI6 A;  4Y28 E;  1N9S A;  2JN0 A;  2R5M A;  3X24 B;  2YRV A;  2OTJ A;  4JLI A;  4WF2 A;  4XQ3 A;  5CQY A;  1VIE A;  4OB1 B;  4HCB A;  5DLO A;  3HFO A;  3C4S A;  3L2Z A;  2RJD A;  4OVA A;  5J3B A;  2LQK A;  3A8O B;  4ZN3 A;  2FVU A;  4RCC A;  1YJN T;  3CCU T;  4ZGJ B;  3CCM A;  2LTO A;  4C92 G;  2M9U A;  1I8F A;  3GIB A;  2CZ6 B;  3OYF A;  3VYH B;  3QO3 A;  1UB4 A;  5HKC A;  3ER0 A;  5M9O A;  4PLI A;  4M75 F;  1UEB A;  5D6W A;  1VQ8 T;  5LJ5 j;  4C8Q A;  5GAN 7;  2VGM A;  2I2L A;  1NPR A;  1Y96 A;  2H3J A;  3TRE A;  3UT1 A;  1LNX A;  4BI4 A;  4ZGE B;  3QZ9 B;  4M77 A;  3M9Q A;  3OS0 A;  1VQP A;  4BE0 A;  3CC2 A;  1H64 1;  3A5Z B;  4CI0 C;  1M1G A;  2EKO A;  3JB9 D;  2XD0 A;  4MDX A;  5HY6 A;  3MP1 A;  4OGE A;  3CEY A;  3X28 B;  3CCJ A;  5D6Y A;  5FLX E;  5DLQ E;  1K9M U;  5A0D A;  2VGN A;  3CCE T;  3FJP A;  3JCM f;  2EQK A;  4QQ6 A;  2E6Z A;  4A4F A;  3FC3 A;  2A3L A;  3BY7 A;  5LJ3 h;  4M78 F;  3CME A;  3TCJ A;  5IAY A;  3LYI A;  5GMK l;  2IVW A;  3ZFJ A;  1TH7 A;  4MZM A;  4E7L A;  4EMH A;  4XU0 A;  2FB7 A;  2XDP A;  3S6W A;  4JRQ A;  2XU8 A;  3GF5 A;  4C8Q D;  4N4I A;  1U8R A;  2E70 A;  2OTJ T;  3OYG A;  2MF2 A;  1VQK A;  4M77 G;  2ZZD A;  1M5Q 1;  2JTF A;  2K2V A;  4C0D C;  4LDX A;  3LWI A;  5GAM g;  3I55 A;  1Q7Y U;  2CGH A;  2QQR A;  3OW2 A;  1FWZ A;  1X6O A;  3HFN A;  5GAM d;  5DY9 A;  2X4J A;  2RA2 A;  3V8J A;  1NZ9 A;  1BIB A;  4HA8 A;  1KC8 C;  3E9G A;  3V7R A;  2K5L A;  4A4K A;  1M90 U;  3KUF A;  3G4S T;  5FU6 B;  1YHQ T;  2DIQ A;  2RHX A;  3JCM P;  4PJO C;  4IUR A;  2PVG B;  4OMF B;  3QDR B;  3L2R A;  1W2B S;  4IUU A;  4A4H A;  3BW1 A;  1QW1 A;  2VXF A;  3MEV A;  3VU3 C;  4EMK A;  3KXT A;  2GFA A;  1BI2 A;  4M75 D;  2NLU A;  1YJ9 A;  1JJ2 S;  3OYN A;  4M78 D;  2QQ9 A;  5GAO m;  4F7U B;  2KK4 A;  3JCM g;  4C92 A;  3G6E T;  3S3N A;  1YIT T;  1QVG A;  1Y7X A;  4A4E A;  4NL3 A;  5I2M A;  5D6X A;  4OB3 B;  4PJO A;  3S3O A;  2X4X A;  4J6X A;  1VQ4 T;  3JB9 H;  2VC8 A;  2XID A;  3M54 A;  4QVC A;  5HK3 A;  1VQ7 A;  2WAC A;  4L6V 5;  4LDY A;  4XK8 E;  5LJ5 h;  2JUF A;  5GMK h;  2PQW A;  3RKX A;  4M7A A;  2XKO C;  1DJ7 B;  4JRK A;  2QXF A;  1OYX A;  1Q82 C;  2DXB A;  3H6Z A;  1R8O B;  3PTA A;  2DXT A;  2CZ7 B;  4ZTF A;  2XDD A;  3UDC A;  2YLB A;  4MML A;  4B9X A;  2RI3 A;  3BFM A;  3EAE A;  1YBY A;  3CCJ T;  3DB3 A;  2O01 E;  3HP9 A;  2WSE E;  5CK9 A;  4PJO D;  1Y71 A;  2E5Q A;  2E65 A;  4O5V A;  5L8R E;  4XTZ A;  4C8Q B;  2RK2 A;  4BAC A;  3FRN A;  4II1 A;  4EMG A;  4M78 A;  4ELZ C;  5GAN d;  3CC4 A;  5GAO r;  1KQS A;  3E19 A;  4M75 B;  4JJN K;  4ZGD B;  3PIP A;  3PMT A;  3CCS T;  1VQ6 A;  3JB9 I;  1WQW A;  4M75 C;  3V7S A;  2P4T A;  3OYE A;  4QVD A;  3P8B B;  1KHI A;  1N6A A;  3MP8 A;  2XG8 D;  1XOV A;  1G3S A;  2K5I A;  3OY9 A;  3C94 A;  1VQ9 A;  3DB4 A;  2HD0 A;  2LT1 A;  4JS4 A;  1YIJ T;  3AHU A;  2E41 A;  3OYK A;  3URG A;  3CCR A;  3I55 T;  3G6E A;  4C92 D;  4A53 A;  1BKB A;  2F69 A;  2LCC A;  1M4Z A;  2ZPG B;  4M75 A;  3RIR A;  3MET A;  4C0Z A;  1S72 T;  3L2U A;  5FU7 C;  4HCZ A;  5LJ3 d;  2RJE A;  4MDW A;  4MZT A;  2JVV A;  3L2Q A;  3INZ A;  1VQ4 A;  3OMG A;  3GOX A;  4IUP A;  1QVF A;  4RCB A;  5GAN 2;  1RL2 A;  4BUG A;  2E10 A;  3G7Z A;  1D3B B;  1VIF A;  1RI0 A;  2DD5 A;  4F7U G;  1VQM T;  2BIV A;  3GLX A;  2LC4 A;  1PSF A;  2RB6 A;  4FSX A;  3JCM X;  2MAM A;  5GAO n;  1Q82 U;  4M7D F;  4M7D C;  3UWN A;  2DAQ A;  2V8I A;  3MCA B;  2WSF E;  3M57 A;  5LJ5 e;  4IUQ A;  3NTI A;  4M7D E;  4Q5W A;  3L2W A;  1M9S A;  4OP0 A;  5C0M A;  3CMA A;  4A4G A;  1WJQ A;  4ME7 A;  1I81 A;  2R57 A;  5GAM e;  4BE1 A;  1K8A U;  1VQ5 A;  5GAO l;  1FX7 A;  1FXX A;  3X20 B;  3GNG A;  3ME9 A;  2RI2 A;  2ZPE B;  4FT2 A;  4C8Q G;  2DEQ A;  5GMK m;  4M7A C;  2YHT A;  4EMK B;  5I2S A;  3JAM E;  4M77 D;  4M7D B;  3CMA T;  1K73 U;  3CD6 A;  4PNO A;  5A0G A;  3CCR T;  5J39 A;  2QEX A;  3CCM T;  2RK1 A;  2EJ9 A;  2E12 A;  1YCY A;  2GFU A;  4KBM B;  2RJC A;  3JCM W;  1NJI C;  4A54 A;  2EJF A;  2PUO B;  3CC7 A;  3OYB A;  2LNV A;  2LT4 A;  4RMO A;  4BY6 B;  4XU1 A;  3OYA A;  4PJO E;  2LX9 A;  5LJ3 f;  3RES A;  5GAN 8;  1VQN A;  3JCM h;  4FIB A;  3CBP A;  3RMQ A;  2L5Q A;  4N4H A;  2EWN A;  3SDZ A;  4BB7 A;  4OF1 A;  3CC4 T;  3OS1 A;  1WPY A;  2MMP A;  3QHS A;  4FU6 A;  4JDS A;  1O9S A;  2RM4 A;  3QXE B;  1Q7Y C;  5IN1 A;  2Y4X A;  5GAM j;  2QA4 T;  3HKS A;  4NOY A;  2HQE A;  3NTK A;  3P8H A;  1YIJ A;  2RD1 A;  2BKD N;  3SWN B;  4M7A F;  1KQ1 A;  2AHJ B;  4PLL A;  3CCQ T;  3MP6 A;  4M75 G;  5CKH A;  2QA4 A;  2PVD B;  1XNI A;  3EFR A;  2DVE A;  4E7I A;  1N8R U;  2BUD A;  4HT8 A;  3PGG A;  3CCQ A;  4HCC A;  2EFI A;  1OZ2 A;  2KAF A;  4C5E A;  2C06 A;  4N0A A;  3OYC A;  3QG1 A;  4M7A D;  5GAO p;  3NFC A;  1VQ8 A;  2XI9 A;  5GAN 3;  5GAN e;  3QII A;  2L3R A;  3MEA A;  4QQD A;  2B8A A;  1U1T A;  2QI2 A;  2RJF A;  5KCO A;  1B34 B;  3LW5 E;  3QJY A;  2K5F A;  4X34 A;  3TU4 K;  1VQ6 T;  4J6Y A;  1VQK T;  2XDB A;  1KD1 U;  1Q81 C;  1HXD A;  2M1H A;  4B9W A;  4JRI A;  4PL6 A;  4PJO G;  1W4S A;  2M16 A;  2EQU A;  3A8G B;  5LJ3 g;  3KBG A;  2HBP A;  1IZ6 A;  3VUB A;  1ZBX A;  2QQB A;  2EQM A;  4RG8 A;  2QTX A;  1YI2 A;  3J80 E;  2P0K A;  4EDU A;  2KMT A;  5KE3 A;  5A2Q E;  3CCU A;  3WXM B;  4ZTJ A;  4DQ2 A;  2VYT A;  1NJI U;  4EMK C;  3S3M A;  1AHJ B;  1VUB A;  4J7I A;  5KE2 A;  1BIA A;  4HKE A;  1ZHI A;  1YI2 T;  3CD6 T;  1N27 A;  5LJ3 e;  1I5L A;  1KG1 A;  4PJO F;  3QYH B;  3L42 A;  4JLG A;  1KQ2 A;  4NL2 A;  4J7F A;  1YJW T;  4E7J A;  2E6N A;  3DKM A;  4C92 F;  5GAN h;  3PT9 A;  1G3T A;  3BDL A;  3G4S A;  4M7D G;  3LGL A;  3CCV T;  5LL6 S;  5LJ3 j;  3RKW A;  3OW2 S;  1VQ9 T;  2CZ0 B;  3QKJ A;  1KC8 U;  1M1F A;  2QQS A;  4OB0 B;  3OSS C;  3TEE A;  2CKK A;  4BE2 A;  1MHN A;  2EYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...