5CCAA

Crystal structure of mtb toxin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
94
Chain Sequence
MRPIHIAARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNTQTIPVCDLGRQIGYLLASQEPALAEAIGNAFDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF3
publication title Crystal structure of Mtb toxin
rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 18
structure length 94
sequence length 98
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ccaA00
2C06A 4VUBA 4MZPA 5CKFA 3VUBA 5CKDA 4MDXA 4HKEA 5CK9A 5HK0A 4OF1A 5DLOA 1VUBA 4ELZC 1NE8A 3TCJA 3JRZA 1UB4A 5CO7A 4ME7A 5HKCA 5CKHA 2VUBA 5CQYA 1M1FA 2MF2A 5CR2A 5CQXA 3G7ZA 3NFCA 4MZTA 4MZMA 1X75C 4ELYC 2KMTA 3JSCA 5HK3A 5CKBA 5CKEA 3HPWA 5CCAA
chains in the Genus database with same CATH superfamily
2YXYA 4E6RA 2M0OA 1VQ8Q 1KG1A 1SKUB 5IAYA 3I55A 2L3PA 3CCST 1T0HA 2L5QA 3M58A 1OQKA 6AT1B 2K5FA 4AFQC 1SRLA 3CPWP 1WHHA 2VKNA 2QEXT 1KC8C 4JJDA 3OYNA 1X75C 4E7HA 2DKGA 4OMNA 3CC2A 4JRQA 5IHNA 4R56A 2ZAEA 1A0NB 4J9CA 1TXQA 4ELZC 2YUNA 3BFMA 4L6V5 3I56T 2AT1B 3JV3A 1VQLA 3OW2P 1SG5A 2RD1A 1UJ0A 2COWA 2QTXA 2XK0A 1M27C 4OP0A 4Z88A 4BE0A 4M78G 4MZMA 1PSEA 4LD6A 2KNBB 2OTJA 4B9XA 2DPPB 1JBMA 2DETA 5CKFA 4FIBA 4M7AE 3SHWA 3PIPA 2LX9A 4UC4A 3JCMb 2HSPA 2OI3A 2RQVA 4FL6A 1Q82U 1W70A 1UB4A 1Y07A 3BW1A 1VQ5Q 3AHUA 4M77B 1OX9A 1K76A 2LJ1A 2E3IA 3OMCA 3HL8A 1VQKQ 1S72T 5GAMh 3KXTA 2QA4T 2PVGB 2RA2A 4IIMA 2FZCB 2DF6A 4GLMA 4ZGEB 2CZ6B 1HSQA 2K79A 5L8RE 3KUFA 1M90R 4M78D 3OYHA 4ME7A 2PVDB 2HL3A 5FRMA 1YITT 3VUZA 4KULA 1VOMA 4ZN3A 4GLKA 4MZTA 3OS0A 1BU1A 3QZ5B 2D8HA 3OS2A 2RI3A 4M7AF 4KUIA 5DY9A 3PMIA 4NOYA 4Q5WA 2KEAA 2JUFA 1M30A 1UGRB 3L2VA 4C8QD 3M59A 2YSQA 3M0PA 1YI2Q 2J05A 1GBQA 1K0SA 3QSUA 1X2KA 2NYSA 4M7DC 3T9NA 5GJVB 3CC7Q 1BYMA 4RKUE 5CKBA 2PUKB 4XTUA 3I55T 4OB3B 4QQGA 4A4FA 2EQJA 1UGSB 3ZFJA 1QP3A 1BI2A 1YJWA 3DLLA 2DD5A 3SB2A 5HKCA 1E6GA 4OB1B 2K2VA 3CC2T 3A8LB 3M53A 1P92A 1N9RA 4PJNA 1KQSP 1YIJA 1FMKA 4O5VA 2JTEA 2JVVA 3OYFA 4FYYB 3REBB 4RMOA 1JO8A 1VQLT 1OX8A 5LJ5d 4M7AA 4PKCC 1NJIR 4HT9A 2GBQA 4IUVA 4JS4A 2OTJT 3PIOA 4ZN1A 2M1HA 3EGUA 2EQKA 2EQUA 1YWOA 3C12A 5D6WA 2J6OA 1K73R 1G2BA 5I2SA 2VXEA 2FRWA 4MDXA 2FL7A 1JEGA 1NPRA 3REAB 1UJYA 3EAEA 3M54A 5CAIA 1R0CB 1RLQC 3CCEA 4M75E 3HRTA 2BUDA 2KSSA 5GMKl 3G6EA 4PJOB 3WVEB 3L1AA 1KD1C 1RLPC 2GTOA 5IHKA 4BI3A 3JB9I 2DRMA 1M2OA 2M9UA 5I21A 3Q1JA 2EJ9A 1OI1A 1M9SA 5C6SA 2OTLA 2E6NA 1GRIA 2EYXA 2LCCA 1IZ6A 1M1KU 4M7AG 4FYVB 3TSWA 2MF2A 1QLYA 2YT6A 2KYBA 1YHQT 2LQ8A 2WSCE 2V1QA 3F70A 2JZ2A 1JB0E 2Y4XA 1UGQB 3VUBA 1PSFA 2HKQB 5GMKj 3J80E 3CCSQ 5FW9A 4ZGDB 3M0SA 5I11A 1N9SA 3QUIA 4WCIA 5I2MA 3LH5A 3RBBB 2QEXQ 2DXTA 1M4ZA 4PK4A 5KYWA 8AT1B 2A08A 2K7AA 3FJPA 2NWMA 1ZQ1A 2RHZA 2EYZA 4F7UF 4EMKB 5FROA 1WJQA 4KBMB 3FB9A 3PFSA 2JM9A 1VQ6A 4M7AD 4A4EA 1VQKA 1K0XA 3RDVA 3JB9F 1I0CA 2HKNA 1QVFA 3X26B 3GP8A 1OPLA 1KFZA 5LJ3d 1Q86R 1YIJT 3O5ZA 1XJWB 2PZ1A 2QYZA 2M16A 1NM7A 1YCSB 3P8BB 3OYAA 3CMEA 2KT1A 4FW1A 3ZBDA 1C0MA 4FYXB 1RAGB 1UHFA 3MCAB 3S3MA 2YWWA 3HRUA 1VQ9A 2VASA 3EGDB 2CS7A 2QA4Q 2DX1A 3VS7A 4M75A 3EHQA 3FLGA 4LDUA 4Y91A 1QVPA 4ZTFA 1G83A 2QQAA 2KRSA 2RJEA 1FX7A 1M1GA 7AT1B 5CKDA 4AG2C 1X01A 1YI2A 1YITQ 4B9WA 3G6ET 1LPLA 2VWFA 2EQMA 2GQIA 5AYFA 3OYLA 1IREB 3RNJA 5GAOl 2Y4YA 2AIRB 5GAOr 3VV0A 3JCMh 2G3RA 3JCMX 4N0AC 1QW1A 1W2BS 1KC8R 3I35A 1QVFS 4M7DF 2OTLT 2X3XD 3LYIA 1ACMB 1IHWA 2QDYB 2F2VA 1JJ2P 4OB2B 3TQ7P 1MNEA 1WJSA 3MKDA 3CCQA 1RAHB 2X4JA 4JPBW 4C92B 2LNVA 2RI5A 4X9CA 3OS1A 2FZGB 4M75G 3A5ZB 5GMKe 3VS4A 5LJ3f 4PJLA 1VQOQ 2ED1A 2J06A 5GAMd 1PC0A 2EFIA 3CC2Q 1K8AU 2DLPA 2GFAA 1KSWA 4F7UG 1AVZC 2DA9A 2LCSA 1M8MA 2XDPA 4J7IA 1YFNA 1BIAA 1K9AA 4E7LA 3JCMW 1YJNQ 1VQLQ 2K4YA 1VQ6T 2GTJA 4OMPA 3RUXA 3V7SA 2XD0A 3HTRA 2F5KA 1GCPA 3H41A 2CZ1B 4QT7A 3THKA 4X1VA 3OBWA 3PE0A 1LOJA 3UA6A 4C0GA 3CMET 1ZBXA 1VIFA 3CCUQ 1GXIE 2QK0A 2QQSA 5GAN4 1K73C 2QDLA 3JB9J 1I8FA 2EYQA 2IPOB 4RTUA 1KK7A 1QCOA 1VQ9T 3GPLA 1OZ2A 1N6AA 3L2QA 5A0LA 2P0KA 2QTVA 1RABB 3I9QA 3M57A 3D7SB 2HBWA 3MEAA 3JB9D 1M3CA 2X9HA 4FT4A 3A98A 3NPFA 4C0FA 1AWXA 4A63B 2CH4A 2CP7A 2LJ3A 2NUPB 2RJFA 1OU9A 3S3NA 2P0PA 5M9OA 2AHJB 1SHFA 1FWZA 2L3RA 2QGGA 4JRIA 1AWWA 4AFZC 3I5RA 3QJ6A 4WF2A 1ZUKA 2QEXA 3TU4K 3M0QA 3OYDA 1EIFA 4J6XA 2MMPA 1Q7YU 2D6FA 1PKSA 2HQHA 1LCKA 2QXFA 4F16A 2E5QA 1SSHA 4C8QE 1YHQQ 3LW5E 2ROTA 4XU0A 1KQ2A 5A2QE 4IIOA 4RTVA 2D8JA 2DEQA 2CDTA 2A7YA 5GAMf 4MMLA 2A0FB 3J81E 2RQRA 3GIBA 3CEYA 4CC4B 2EPDA 1BK2A 3CCQT 2QAZA 2FYKA 1GCQA 2EKHA 3TSZA 4HVVA 4E7KA 1AEYA 4BY6B 4E2FB 4JZ4A 3M9QA 2YUPA 1WJRA 1UDLA 5FWBA 2ESWA 2E65A 1SSFA 4DA4A 1NEGA 3SWNB 4Z89A 1WLPB 1X6OA 1VQ7Q 4M7DD 3TCJA 4ORZA 3OB9A 2LNHB 2ZPEB 2KVQG 4DBQA 4K11A 1TTHB 2J6FA 5GANf 2RMOA 1IB8A 1KD1R 2D0NA 5GAN8 2JS0A 2DILA 2RM4A 2CUDA 4RUGA 1GFDA 2YHTA 1OOTA 1F1BB 4ATOA 2A28A 2HMAA 1I5OB 2AZVA 2F69A 3QIIA 1G3SA 1ZUUA 2O01E 1AZGB 4C5EA 4LDVA 2O9SA 1CSKA 1JRIA 2RHYA 1AHJB 4FT2A 4A4GA 2M02A 3CCVQ 3G6EQ 1NBEB 4JJCA 3CCJA 1N8RU 2ENMA 2H3JA 3CBOA 4J9GA 4C8QA 4XTZA 4LD9K 2JW4A 2F5TX 4P5NA 3V7RA 3QDRB 4A4KA 2DVJA 2RK1A 1M5Q1 1VQOA 2LRQA 3EG3A 3EFOA 1X43A 2OTLQ 1PRLC 3NTIA 2DNUA 1I4K1 1VQNT 2DL4A 2EWNA 1LNXA 1EX4A 1FMVA 1YJNA 4XTWA 4LUDA 1T3SA 1VYUA 2DL3A 2VXFA 3V8KA 2ED0A 3EG9A 3EH2A 5KYUA 3JB9H 1RUWA 1AT1B 3QWYA 3FJ5A 2E41A 3PVQA 1GFCA 1Y96A 9ATCB 2CSIA 3CCUA 4AMCA 4R55A 2RH2A 1K9MC 4RTWA 2VUBA 1VQ6Q 1ZSZB 1G8XA 1WHLA 3BY7A 2BZ8A 4C8QG 1MHNA 1J3TA 1CKAA 4M77C 1M2VA 4A4HA 2O88A 1ZSZC 1ABOA 2OAWA 3CCMA 1D1BA 1Q81C 2DD4A 4J5YA 1JQQA 3JCMd 2JMAA 3CMEQ 3CC4A 2LT4A 1RAIB 2DE0X 2FZKB 4FW2A 1WXUA 4IUQA 2FG0A 3UATA 2YLCA 3INZA 4JZ3A 1M3BA 1VQ9Q 2ZGWA 2LQNA 2JJ9A 2AKKA 2HL5C 4KRTA 2DYBA 5KYXA 4JLIA 2DBMA 2DZCA 1YHQA 2D0QB 5FWCA 2YDLA 1WI7A 1N5ZA 1D0ZA 1WXBA 3OYMA 3CD6T 2KDSA 2NUTA 1NYGA 3M55A 3LWHA 1MMDA 4HCCA 5GANh 2NUZA 2R5MA 3VJPA 5LJ5g 2DTIA 4ANJA 2FRYA 5LJ5j 1TU0B 2C06A 3CCJT 2GGRA 2DRKA 5DLQE 4OGEA 4A53A 4EPCA 1NJIU 5CK9A 5HK0A 2A3LA 3LLRA 2RN8A 1FMWA 4OB0B 4TVRA 2CKKA 3FRNA 1WQ7A 1VQOT 5GJWB 3KBGA 2I2LA 1Y0MA 2DXBA 2MOXA 3DLMA 1VQ7A 2FVUA 4JS5A 1D1CA 3CXCA 3CCQQ 3QKJA 4AG1C 1UHCA 4BB7A 3UDCA 1JXMA 3IQLA 1FYNA 1YJNT 1G5VA 1TG0A 2F1LA 2K2MA 2J7IA 3OMGA 2RF0A 2BTTA 1ARKA 4X9DA 3QWXX 4L5GA 3QXEB 1MV3A 4Z02A 4JJBA 1I81A 5C0MA 3UPUA 3JCMf 3CCUT 2K57A 1D3BB 1MMNA 1MUZA 4IUPA 3URGA 1QCFA 1VUBA 4HCKA 4J9DA 2FPFA 4OMFB 3X25B 3C0CA 1AZEA 2HBPA 4BD3A 2QI2A 3CCVA 2GFUA 3SEMA 3VKIA 5FU6B 2HSEB 3CCMT 4IKFA 2QGFB 1YP5A 1Z9QA 1M3AA 2QQBA 2KAFA 1SEMA 4PJOC 5GMKm 1QKXA 1UFFA 2BZYA 1QMCA 4F7UE 3G4SA 3CC4T 4BI8B 1RAEB 1V29B 4IURA 3ZEHA 3QYHB 3BE3A 2L89A 3CPFA 3M0TA 5GAN6 2CT3A 3DB3A 2C0TA 3CXCS 4DEXA 3CQTA 4KGVB 4QKUA 5LJ3g 5FRNA 3GLXA 3OBYA 1X27A 5LJ3j 1OZ3A 2ZZDA 5CVIA 3P8DA 4HVUA 4E7JA 2HD0A 1Q86U 1ZUYA 2VV5A 3NHNA 2F2XA 2KBTA 1WHJA 1RAAB 1FXXA 3EGXA 3V7CA 5LJ5e 2GCXA 1VQNQ 4HVWA 4O6JA 2DL5A 3G71T 1JU5C 2LQWA 1W2BA 1TUGB 2YRCA 4XU2A 5HCKA 2CUBA 5FLXE 4EMKC 1B34A 2JTMA 4M78B 1KJWA 1E6HA 2YUQA 1VQ7T 2E3HA 3A1PA 2EKOA 3QPHA 3RMQA 2W0ZA 1MGQA 3TVTA 1CKBA 3OA6A 3G1JA 4M77F 4LDYA 4J9IA 4BUGA 4M7DE 3ULRB 5A0GA 4C8QB 4JLGA 4KGXB 5KYNA 4J6WA 1SHGA 2LTOA 2CGHA 2F2WA 2O31A 3H6ZA 1QVGA 2DM1A 3H0HA 2ZCFB 1WDXA 1RADB 1R8OB 5KCOA 4JRKA 1KHCA 3OYBA 3EG1A 3X20B 4DBRA 4BE1A 1QVFP 3MP1A 1QP2A 4PLLA 2EAYA 4V2SA 4F7UA 3VYHB 4KH0B 4RTZA 2VB6A 2DERA 3CCVT 1ZBJA 2P4TA 2M51A 3L2RA 2B86A 3OYGA 1HYOA 2L2PA 5ECAA 1V76A 5GAMg 3EG9B 5KYUB 1Z9ZA 3G4ST 3C95A 5GAN2 5GAMj 3C4SA 2R57A 3UA7A 5FU7B 3X24B 5GAOm 3CD6Q 4F17A 1Q82C 1Y96B 2WACA 3LGLA 4ZGJB 1NG2A 5FU7C 5KYYA 3CCRA 1WFWA 2ECZA 3PVLA 3HSBA 4LDXA 3FC3A 3CCJQ 2RQTA 4RTXA 4N4GA 3VS3A 4KT0E 3CBPA 2GF7A 2DJQA 1M2VB 2H3EB 5LJ3e 2E64A 4C92C 1VIEA 3META 3A8MB 4FSXA 5DLOA 2XKOC 3DKMA 3RKYA 1IO6A 2JM8A 1QVGS 1PCXA 1X6GA 4BE2A 3WXMB 4OMMA 1K9MR 4OMOA 1ZA1B 2DIGA 3JB9G 1B3QA 2MAMA 5KYXB 4VUBA 2K3YA 2LJ0A 1TH7A 1PG5B 1R77A 3ZL7C 4AFUC 4BACA 1EZZB 4HXJA 4M7DA 3L2WA 5GAOn 1Q81R 3GNFB 1WYXA 1T0JA 2VYTA 1NEBA 3LWIA 4OVAA 2JN0A 3MEWA 4CRIA 5CCAA 1VYTA 2OX7A 5GAN3 1HK9A 5GANd 2P84A 2LC4A 2MWOA 2HQEA 2VVKA 4PJOF 4C0DB 3L2UA 1D0XA 3FDRA 2V8JA 3EG2A 3CCMQ 1K8AR 4NL3A 3PTAA 2JS2A 2KRMA 5CQXA 3OYYA 4C0DC 2YLBA 2VGMA 2W10A 2CP0A 2D1XA 4BDYA 3CC4Q 2QQRA 1NLOC 2JT4A 2O2OA 4NL2A 4PFZA 4EMHA 1OU8A 1NE8A 2EJFA 4Y92A 2K6DA 2MCNA 4M77D 4M7AB 4QVDA 1ABQA 1VQNA 4QVZA 3M4GA 2K5IA 5CQYA 1M1FA 4FCYA 4M7AC 4M7DG 1BI1A 5GAMe 4XU3A 4EMGA 4N4IA 2X4WA 1B07A 2EYYA 4XAXB 1PWTA 2B8AA 3CCRT 2CREA 3HP9A 1WZOA 3H9NA 1TSFA 1JXOA 1K4US 2KXDA 2DVEA 1AOJA 4M4ZA 3NTHA 4E7ZA 1KD1U 3L2ZA 5KH6A 3G71Q 2KYMA 1ZSGA 2EVRA 4BY6C 4LXCA 1YJ9A 2LCLA 5GAOp 1V1CA 4JUVA 2RQWA 3CCLA 1Q7YR 2RK2A 2DBKA 4DOWA 1M1KC 2RI2A 3SWNC 1W6XA 4C5GA 4J83A 2E12A 4QQ6A 2ATCB 3OQ5A 5LL6S 3MEUA 3I5SA 1RI0A 3JCMJ 5IH2A 2ZPBB 4AT1B 3HFOA 4LE9A 1YNZA 3EFSA 4ZNXA 4YTLA 4C92E 1ZLMA 2G6FX 4J9FA 1YBYA 5KYWB 1W1FA 4QVCA 3VS6A 3CD6A 5KE3A 2AKLA 2MYSA 3OSSC 5IXBA 4EMKA 5GMKh 2CT4A 3CPWA 3HRSA 1MMAA 5J39A 3E19A 2QQ9A 2RHXA 1QWFA 3HHTB 2JMCA 2HCKA 4HCBA 1B34B 2JXBA 5IHIA 3G4SQ 2DTHA 4N4HA 2DO3A 3OW2A 1RL2A 2E4HA 3OSVA 3M5AA 3QHSA 1D0YA 1QCNA 2DZ9A 2KROA 2DEUA 2V1RA 1VQPA 2RNAA 2YUOA 2O4XA 1BIBA 1WXTA 2IVWA 3X28B 4C5IA 4PJJA 2LDMA 3RR6A 2EJGA 3EGDA 4J9HA 2BE9B 1YWPA 4C92F 1U1SA 1KHIA 4PJOD 2FEIA 2IIMA 2RJDA 3PT9A 2XDDA 4ZTJA 4M75B 3JCMg 1Y71A 2LX7A 2COYA 3VRYA 1G3YA 4M75C 4D8DA 2GNCA 4R0KA 4HKEA 1SF9A 1QQJA 2V8KA 2E10A 1M90U 4F7UB 4Y28E 2GQVA 4Z8AA 4N0AA 3JAME 3TREA 2XG8D 5GAOq 1TUDA 1N8RR 2YRDA 1BKBA 1MV0B 4LN2A 4D6WA 3L42A 3CPWS 1HXDA 1PD0A 1U1TA 1YJ9T 1VQMQ 3MHXA 2PQWA 2HZYA 1VQ4T 3VRZA 2PU9B 2LP5A 2LQKA 3CCLT 1DJ7B 3QO3A 3RESA 2AZSA 3JCMV 1AWOA 2RPNA 5KYYB 3OW2S 1UE9A 1G3WA 8ATCB 1ZHIA 1BI3A 1GL5A 1HJDA 4C92A 2X35A 1ZX6A 4DBFA 2XI9A 1GBRA 3OYJA 3FEOA 2PUOB 2KRNA 2BE7D 5DM7R 2EBPA 2ROLA 2L0AA 3J7AF 1WIEA 5KCHA 1K8AC 1U5SA 1H8KA 1Q82R 3VYGA 2BKDN 4PFPA 2CZ7B 2P0QA 3JCMc 1T3LA 3BDUA 4DEYA 1WHMA 4PFOA 3R6NA 1XOVA 1KQSA 4F04B 1XNIA 2COZA 4XU1A 2PTKA 2X4YA 4L59A 4RTYA 3GOXA 4J6YA 5EC7A 4E7SA 3RKWA 2CSQA 1M8VA 4M7DB 2L3SA 3G71A 2DIQA 2XU8A 3CMAQ 3MP6A 2R58A 3VS1A 2OJ2A 2FPDA 3OYIA 1K1ZA 4QQDA 1VQPT 3CBMA 1NLPC 3G7ZA 3RIRA 3VS2A 3NMZC 1X2QA 3CCRQ 1TOVA 3KFVA 1UGVA 2EGCA 2JNGA 3PGGA 1K73U 4C92G 4DOVA 2E6ZA 1H3ZA 3M4YA 3PMTA 5GAN7 3JRZA 4GBQA 1IGUA 1BI0A 2DK3A 3MJXA 2Y90A 1OEBA 2EGEA 3E2UA 4CC3A 3NTKA 4KGZB 2NUPA 4WTOB 3NFCA 2Z0WA 4AFSC 1B7TA 1UEBA 2EIFA 3MEVA 2KMTA 3JSCA 3JCMe 4PJMA 1QKWA 1OPKA 5D7UA 3OY9A 2CZ0B 1E7OA 2HNIA 3QG1A 1Q7YC 3QYGB 1BBZA 2KY9A 3VS0A 4OMLA 3E9GA 2DAQA 2VGNA 4LNPA 1XQHA 4XTYA 5A0DA 5CO7A 4RG8A 2IG0A 4J9EA 4C92D 1X69A 3UWNA 5IXFA 4J9BA 2J6KA 2XHCA 3CXCP 4PLIA 1KQSS 2DXCA 3H0IA 1OV3A 1PM3A 1AD5A 1LVKA 3V8JA 3HPWA 2E70A 5FU6C 4OF1A 2KXCA 2ZPIB 2SEMA 2ZPGB 1WHKA 5CKHA 4LDWA 2CP3A 1D1AA 1VQ8A 2DFUA 1X6BA 1RAFB 1GCQC 1OULA 5HK3A 5CKEA 2HAXA 1TWBA 3TEEA 3OYCA 1U3OA 3SWNA 3JCMQ 3V8LA 4M77E 3H0FA 1NPPA 1Q95G 1HD3A 3N5BB 2E1HA 3LGFA 1UECA 3GBQA 2ABLA 3LX7A 4XQ3A 1UUEA 3S3OA 1I1JA 3P8HA 4M75F 1VQMA 3GNGA 1UG1A 2EQIA 2FB7A 1G3TA 1Y7XA 2PNIA 2A37A 1TS9A 2RHIA 1M1KR 4RG2A 2EYWA 4ELYC 5LJ5f 3AT1B 3ER0A 1WX6A 4M78C 1PKTA 4J8OA 3I56Q 4E7IA 1VQ5A 2I0NA 1YJWT 4OMQA 1W4SA 1N8RC 4HCZA 2WSFE 1Y57A 1YJ9Q 1C6VX 4FYWB 1VQ4Q 4GY5A 2PVOB 3CCLQ 1KC8U 1PHTA 3VU3C 4C8QC 1WQWA 3EFOB 4DBHA 1W2BP 2O4XB 2BZXA 3RMSA 4MDWA 3A8OB 3QJYA 1S72Q 1JJ2A 2K9GA 3NGPA 4XTXA 1UTIA 2NLUA 4E47A 2OAUA 2HDAA 4PL6A 1KQ1A 2XIDA 2D9TA 1SPKA 2DYIA 1M90C 4DQ2A 3CMAA 5J26A 1U06A 4C0ZA 3CCET 1WGSA 1R0BG 1VQ8T 2C0OA 3CC7A 4M77A 4PNOA 3DB4A 2EW3A 1QVGP 1WPYA 1C1AA 3EFRA 1K9MU 2LMJA 1ZSZA 1D09B 2K3BA 2K5LA 2V8IA 4RTTA 4KH1B 5I22A 2QG9B 1H641 4XTVA 1PNJA 2RQUA 1EFNA 3M56A 2FPEA 4F14A 1Q81U 3ASKA 1VQPQ 3S6WA 4PJOE 3A8GB 2CP5A 1MNDA 5KE2A 3PNWC 5GANg 5CR2A 5GANj 2K3XA 3I55Q 2HQXA 2X51A 4X34A 3M0RA 5D6XA 3GF5A 2KE9A 1H92A 2VC8A 2KGTA 2LVMA 1WHGA 4CC7A 2RO0A 3E1SA 1VQMT 3O8VA 5HY6A 4OGCA 5IN1A 2RJCA 1BB9A 1IHVA 5AT1B 3MPUB 3VS5A 2JTFA 1JJ2S 1AWJA 1VYVA 1H3HA 4MMKA 2NUTB 1SRMA 1BCMA 1VQ5T 2MI6A 5EG2A 2AK5A 4BI4A 5IT9E 4M77G 2XICA 2CH4W 3H8ZA 2KQWA 1VQKT 4II1A 3C94A 1NJIC 2A36A 4MZPA 2WSEE 1LJOA 2OTJQ 1RI9A 3EG0A 3QDFA 4JDSA 2C0IA 2HEQA 2MPXC 2X3WD 4M75D 3MO8A 5J3BA 2KI7A 5LJ5h 4FM4B 4FU6A 4BDZA 2DL8A 3WVDB 4HA8A 2XMFA 1WNLA 4EIKA 2KK4A 1I07A 1NYFA 1QWEA 2DJZA 2X4XA 4M78E 1IRXA 4JJNK 2CYZB 2JOYA 2L3QA 4RCBA 1O9SA 3CCSA 3E9FA 2DXUA 3CMAT 1YI2T 5CIUA 1D3BA 3FIFA 2H8HA 2DMOA 4XK8E 1RACB 3CC7T 2CP6A 4HT8A 2XDBA 1TUCA 3R6OA 2QASA 4RCCA 2M0YA 3JCMP 4CI0C 4NS5A 2E5KA 1KIKA 3I56A 2SRCA 4LUEA 4PJOA 3LH0A 3QZ9B 5L23A 2ZPHB 1S1NA 2ZPFB 2MK5A 1PD1A 2R5AA 3QBYA 2CP2A 4B6MA 2KT8A 3M0UA 1VQ4A 1ZA2B 4M78F 3OYEA 1U8RA 2MWPA 3ME9A 2YRVA 4C5HA 2O9VA 5D6YA 5GAN5 5GANe 4IUUA 3HFNA 3U23A 1YJWQ 1N27A 4EDUA 1UGPB 1IXDA 2LZ6B 3OYKA 1S72A 3EHRA 2QA4A 2EGAA 3BDLA 1MMGA 1YCYA 3EH1A 4KUDK 2LT1A 4CC2A 1YIJQ 3RKXA 1Q86C 4C8QF 2FO0A 1XTDA 5GMKi 3OS5A 1PRMC 1OYXA 2RHUA 3MP8A 3HKSA 1IGQA 2DTOA 3SD4A 2V26A 4A54A 2KR3A 3UF4A 1BCOA 2DL7A 4QW2A 1YITA 3SDZA 3EGXB 2P4RA 5LJ3h 4PJOG 3RERA 1YN8A 2RB6A 1I5LA 4IUTA 4FSSA 4JRPA 3UT1A 2BIVA 2L8DA 2FHDA 2MIOA 1VA7A 1NZ9A 4ESRA 4M78A 1WA7A 4J7FA 4D8KA 3A8HB 3SFMA 1O75A 3CCEQ
chains in the Genus database with same CATH topology
4C92G 4DOVA 2E6ZA 3OA6A 1VQ9T 2M0OA 1H3ZA 3GPLA 3M4YA 3PMTA 1KG1A 4M77F 1OZ2A 4LDYA 4BUGA 1N6AA 4M7DE 3L2QA 5A0LA 2P0KA 5GAN7 3JRZA 5IAYA 3I55A 1BI0A 2DK3A 3CCST 2Y90A 2L5QA 3M58A 3M57A 5A0GA 3MEAA 3JB9D 4FT4A 4C8QB 4JLGA 3NTKA 4J6WA 2K5FA 4C0FA 2LTOA 2CGHA 3NFCA 2QEXT 2RJFA 3H6ZA 3S3NA 1QVGA 2P0PA 1KC8C 2ZCFB 3OYNA 1UEBA 1X75C 2EIFA 2AHJB 2KMTA 3JSCA 1R8OB 2DKGA 1FWZA 3MEVA 5KCOA 3JCMe 2L3RA 4JRKA 4JRIA 3CC2A 4JRQA 4R56A 1KHCA 3OYBA 3OY9A 3QJ6A 4WF2A 2CZ0B 2QEXA 3X20B 4BE1A 3TU4K 3MP1A 2HNIA 3QG1A 1QP2A 3OYDA 1Q7YC 1EIFA 3QYGB 4J6XA 4PLLA 2EAYA 2KY9A 2MMPA 3BFMA 4ELZC 4F7UA 3E9GA 4L6V5 3VYHB 2DAQA 2VGNA 3I56T 1Q7YU 2D6FA 2QXFA 1XQHA 2E5QA 4XTYA 4V2SA 4C8QE 5A0DA 3CCVT 1VQLA 5CO7A 4RG8A 2RD1A 3LW5E 2IG0A 2QTXA 2XK0A 4XU0A 4OP0A 2P4TA 4C92D 3L2RA 3UWNA 4BE0A 1KQ2A 5A2QE 3OYGA 2XHCA 4M78G 4MZMA 4PLIA 5GAMg 2DXCA 1PSEA 1KQSS 4LD6A 3G4ST 3C95A 5GAN2 5GAMj 2OTJA 2DEQA 3C4SA 3V8JA 4B9XA 2DPPB 2R57A 2A7YA 3HPWA 5GAMf 4MMLA 5FU7B 2E70A 3X24B 1JBMA 5GAOm 3J81E 5CKFA 4FIBA 3GIBA 3CEYA 4M7AE 5FU6C 4OF1A 3PIPA 2LX9A 1Y96B 4UC4A 1Q82C 3JCMb 2WACA 3LGLA 4FL6A 4ZGJB 3CCQT 1Q82U 2ZPIB 1UB4A 2FYKA 2ZPGB 1Y07A 5FU7C 3CCRA 3BW1A 3AHUA 4M77B 5CKHA 4LDWA 4E7KA 3HSBA 4BY6B 3OMCA 3HL8A 4LDXA 1VQ8A 3M9QA 3FC3A 1S72T 5GAMh 3KXTA 2QA4T 2PVGB 4N4GA 1WJRA 2RA2A 5HK3A 4KT0E 3CBPA 5CKEA 2GF7A 3OYCA 3TEEA 2HAXA 5FRNA 5LJ3e 4ZGEB 2CZ6B 2E64A 2E65A 3SWNA 4C92C 1VIEA 3META 3JCMQ 1SSFA 4DA4A 3A8MB 4FSXA 5DLOA 3SWNB 2XKOC 3V8LA 1X6OA 3DKMA 5L8RE 3RKYA 3KUFA 4M77E 3TCJA 4M7DD 4M78D 3OYHA 3OB9A 2PVDB 4ME7A 5FRMA 1QVGS 1YITT 1NPPA 3VUZA 4KULA 4BE2A 3WXMB 2ZPEB 3N5BB 2KVQG 4ZN3A 4GLKA 2E1HA 3LGFA 4MZTA 5GANf 3OS0A 3QZ5B 2DIGA 3JB9G 2MAMA 3LX7A 4XQ3A 3OS2A 2RI3A 4VUBA 5GAN8 2K3YA 4M7AF 1TH7A 4KUIA 5DY9A 2RM4A 3PMIA 3S3OA 4BACA 4NOYA 4Q5WA 2JUFA 2YHTA 1UGRB 3P8HA 4ATOA 3L2VA 4M7DA 3L2WA 5GAOn 4M75F 4C8QD 3GNFB 3GNGA 3M59A 1VQMA 2FB7A 2VYTA 2F69A 3QIIA 1G3TA 1G3SA 3LWIA 1Y7XA 4OVAA 2JN0A 3MEWA 3QSUA 2O01E 4CRIA 2RHIA 4M7DC 4RG2A 3T9NA 4ELYC 5LJ5f 3ER0A 4C5EA 4LDVA 4RKUE 4M78C 5CKBA 1BYMA 2PUKB 4J8OA 4XTUA 5CCAA 4E7IA 1VQ5A 1JRIA 2RHYA 1AHJB 4FT2A 4A4GA 1YJWT 3I55T 5GAN3 4OB3B 1HK9A 4QQGA 4A4FA 5GANd 1W4SA 2LC4A 2EQJA 2MWOA 3CCJA 1N8RC 1UGSB 3ZFJA 2HQEA 1QP3A 4PJOF 1BI2A 4HCZA 4C0DB 1YJWA 1N8RU 3L2UA 3DLLA 2DD5A 2H3JA 2WSFE 3CBOA 2V8JA 3FDRA 3SB2A 4C8QA 5HKCA 4OB1B 4NL3A 4XTZA 3PTAA 2K2VA 4LD9K 2F5TX 3CC2T 4P5NA 3V7RA 3A8LB 5CQXA 3M53A 3OYYA 3QDRB 4C0DC 1P92A 1N9RA 2VGMA 2RK1A 2YLBA 4GY5A 4A4KA 1YIJA 1M5Q1 1VQOA 2LRQA 4BDYA 2PVOB 1KC8U 4O5VA 2QQRA 3VU3C 4C8QC 1WQWA 2JVVA 3NTIA 3OYFA 2O4XB 4RMOA 4NL2A 4EMHA 1VQLT 3RMSA 1I4K1 4MDWA 1VQNT 3A8OB 2EWNA 1NE8A 2EJFA 5LJ5d 4M7AA 4PKCC 3QJYA 4HT9A 4M7AB 4M77D 1LNXA 4QVDA 1YJNA 4XTWA 1VQNA 4QVZA 3M4GA 2K5IA 4IUVA 2VXFA 5CQYA 1M1FA 4JS4A 2OTJT 1JJ2A 3PIOA 3V8KA 4XTXA 4M7AC 4ZN1A 4M7DG 2NLUA 4E47A 2M1HA 1BI1A 2OAUA 3JB9H 2EQKA 5GAMe 2C06A 4XU3A 4PL6A 4EMGA 2EQUA 3C12A 4N4IA 5D6WA 1KQ1A 2X4WA 2XIDA 2D9TA 4XAXB 4DQ2A 2E41A 5J26A 2B8AA 2VXEA 5I2SA 3CMAA 2FL7A 3CCRT 4MDXA 3HP9A 4C0ZA 1NPRA 1Y96A 3CCET 3CCUA 1WGSA 4R55A 2RH2A 3EAEA 3M54A 5CAIA 1K9MC 3CC7A 1VQ8T 4M77A 4PNOA 3DB4A 1WPYA 3EFRA 1K9MU 3CCEA 4M75E 3HRTA 2VUBA 2BUDA 2DVEA 2KSSA 5GMKl 3G6EA 3NTHA 4PJOB 3WVEB 3L1AA 1KD1C 2K5LA 2V8IA 3BY7A 1KD1U 3L2ZA 1H641 4XTVA 5KH6A 4BI3A 1MHNA 4C8QG 4M77C 3JB9I 2M9UA 5I21A 4A4HA 4BY6C 3M56A 1YJ9A 3CCMA 3Q1JA 1Q81C 2DD4A 4J5YA 2LCLA 5GAOp 2EJ9A 1Q81U 1OI1A 1M9SA 3ASKA 4JUVA 5C6SA 3JCMd 3S6WA 3CCLA 2RK2A 2LT4A 3CC4A 2OTLA 2E6NA 3A8GB 4DOWA 4PJOE 1M1KC 4IUQA 2RI2A 2LCCA 1IZ6A 3SWNC 5KE2A 1M1KU 3PNWC 4M7AG 5GANg 2YLCA 3INZA 2MF2A 5CR2A 5GANj 2K3XA 1YHQT 2ZGWA 2HQXA 2LQ8A 2WSCE 2E12A 4J83A 4C5GA 3F70A 4QQ6A 2JZ2A 1JB0E 4X34A 3OQ5A 2Y4XA 3GF5A 5D6XA 5LL6S 1UGQB 3VUBA 1PSFA 3MEUA 1RI0A 2VC8A 3JCMJ 2LVMA 2ZPBB 4JLIA 5GMKj 3HFOA 2DZCA 2RO0A 3J80E 1YHQA 3E1SA 2D0QB 1VQMT 3O8VA 5HY6A 4OGCA 5IN1A 2RJCA 4ZGDB 3EFSA 1N9SA 3QUIA 5I2MA 2JTFA 1JJ2S 3OYMA 3CD6T 2DXTA 4YTLA 1M4ZA 2KDSA 4C92E 4HCCA 3M55A 3LWHA 4MMKA 3FJPA 5GANh 1YBYA 2R5MA 3VJPA 5LJ5g 4QVCA 2DTIA 2MI6A 5EG2A 4BI4A 5IT9E 1VQ5T 1ZQ1A 3CD6A 4M77G 5KE3A 5LJ5j 3OSSC 2XICA 2RHZA 3H8ZA 4EMKA 5GMKh 2KQWA 3CPWA 1VQKT 4II1A 3C94A 4F7UF 3HRSA 5J39A 4EMKB 3CCJT 5DLQE 3E19A 1NJIC 5FROA 1WJQA 4OGEA 4MZPA 4A53A 4EPCA 4KBMB 2QQ9A 1NJIU 3FB9A 3PFSA 5CK9A 5HK0A 2RHXA 2WSEE 1VQ6A 3HHTB 4M7AD 1LJOA 2A3LA 4A4EA 3LLRA 1VQKA 4OB0B 3JB9F 4JDSA 4TVRA 1QVFA 2CKKA 3X26B 4HCBA 3GP8A 3FRNA 5LJ3d 1B34B 1YIJT 1WQ7A 1VQOT 2DTHA 4M75D 3MO8A 4N4HA 5J3BA 3KBGA 2DO3A 2I2LA 2M16A 5LJ5h 3OW2A 4FM4B 2DXBA 1RL2A 3OSVA 4FU6A 4BDZA 3DLMA 3M5AA 3P8BB 3QHSA 3OYAA 1VQ7A 2DZ9A 2FVUA 4HA8A 3WVDB 3CMEA 4JS5A 1VQPA 3ZBDA 3CXCA 2O4XA 1BIBA 1WNLA 3QKJA 2IVWA 3X28B 4C5IA 4BB7A 3UDCA 2LDMA 2KK4A 3MCAB 1YJNT 3S3MA 2EJGA 3HRUA 2X4XA 2DJZA 4M78E 1VQ9A 1G5VA 4JJNK 2CYZB 2JOYA 2CS7A 1U1SA 1KHIA 4C92F 3OMGA 4RCBA 4PJOD 1O9SA 2RJDA 3PT9A 2XDDA 3CCSA 4M75A 3E9FA 4X9DA 4ZTJA 4M75B 4L5GA 3QXEB 1Y71A 3FLGA 3JCMg 2DXUA 4LDUA 3CMAT 4Y91A 4Z02A 1YI2T 1QVPA 1I81A 5CIUA 5C0MA 3UPUA 4ZTFA 1D3BA 2QQAA 3FIFA 3JCMf 3CCUT 2K57A 1D3BB 2RJEA 1FX7A 1M1GA 4XK8E 1G3YA 4IUPA 4M75C 3URGA 5CKDA 4HKEA 3CC7T 1X01A 1YI2A 1VUBA 2V8KA 4B9WA 2E10A 1M90U 4HT8A 4F7UB 4OMFB 4Y28E 2GQVA 3R6OA 2XDBA 3G6ET 3X25B 4RCCA 4N0AA 3JAME 3JCMP 2EQMA 2XG8D 3TREA 4CI0C 5GAOq 5AYFA 2HBPA 4NS5A 1BKBA 4BD3A 3OYLA 3I56A 4PJOA 1IREB 3LH0A 2QI2A 5GAOl 3QZ9B 4D6WA 3CCVA 2GFUA 2Y4YA 2ZPHB 3L42A 3CPWS 1HXDA 3VKIA 3VV0A 5GAOr 3JCMh 2ZPFB 5FU6B 1U1TA 1YJ9T 3CCMT 2G3RA 3JCMX 3MHXA 4N0AC 1QW1A 2PQWA 1VQ4T 4IKFA 2R5AA 1W2BS 3QBYA 2QQBA 2KAFA 2PU9B 4PJOC 5GMKm 3G4SA 1QVFS 2LQKA 4F7UE 3CCLT 3CC4T 4M7DF 2OTLT 1DJ7B 1VQ4A 3LYIA 3QO3A 3RESA 4M78F 3JCMV 4BI8B 3OYEA 2QDYB 1V29B 1U8RA 4IURA 3ZEHA 3OW2S 2MWPA 1G3WA 3ME9A 3QYHB 4OB2B 2YRVA 2L89A 3CPFA 1ZHIA 4C5HA 1WJSA 1BI3A 5GAN6 3CCQA 4C92A 2X4JA 2X35A 3DB3A 5D6YA 5GAN5 5GANe 4C92B 4IUUA 3CXCS 2LNVA 3HFNA 1N27A 2XI9A 4EDUA 2RI5A 1UGPB 3OYKA 4X9CA 3OYJA 3OS1A 5LJ3g 3FEOA 1S72A 3GLXA 3OBYA 2PUOB 3A5ZB 4M75G 5GMKe 3BDLA 5LJ3j 2QA4A 1OZ3A 1YCYA 2ZZDA 5LJ3f 4KUDK 2LT1A 4E7HA 5DM7R 5CVIA 3P8DA 3RKXA 1Q86C 4C8QF 3J7AF 5GMKi 1XTDA 1K8AC 5KCHA 5GAMd 4E7JA 2HD0A 1Q86U 3OS5A 2EFIA 1OYXA 1K8AU 2RHUA 2GFAA 3MP8A 3HKSA 2DTOA 2VV5A 3SD4A 3VYGA 4F7UG 1M90C 4A54A 2BKDN 2XDPA 1FXXA 5M9OA 2CZ7B 4J7IA 3V7CA 2P0QA 4QW2A 3JCMc 5LJ5e 3SDZA 1YITA 4E7LA 1BIAA 3BDUA 2GCXA 3JCMW 5LJ3h 2K4YA 4PJOG 3RERA 1VQ6T 2RB6A 1XOVA 3RUXA 1KQSA 1I5LA 4IUTA 1XNIA 4O6JA 3V7SA 3G71T 4XU1A 2F5KA 2XD0A 4JRPA 3UT1A 2X4YA 4L59A 2BIVA 2CZ1B 3GOXA 1W2BA 2L8DA 2FHDA 4J6YA 4XU2A 1NZ9A 3RKWA 3OBWA 1M8VA 4M7DB 4M78A 5FLXE 4EMKC 3G71A 2DIQA 2XU8A 1B34A 2JTMA 3MP6A 4M78B 2R58A 1LOJA 4J7FA 3OYIA 1VQ7T 4C0GA 4QQDA 3CMET 1VQPT 1ZBXA 1VIFA 3A8HB 3CBMA 2EKOA 3G7ZA 3QPHA 1GXIE 3RIRA 3RMQA 3SFMA 2QQSA 5GAN4 1K73C 3JB9J 1MGQA 1I8FA 1O75A 2EYQA 2JNGA 3PGGA 1K73U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C06 A;  4VUB A;  4MZP A;  5CKF A;  3VUB A;  5CKD A;  4MDX A;  4HKE A;  5CK9 A;  5HK0 A;  4OF1 A;  5DLO A;  1VUB A;  4ELZ C;  1NE8 A;  3TCJ A;  3JRZ A;  1UB4 A;  5CO7 A;  4ME7 A;  5HKC A;  5CKH A;  2VUB A;  5CQY A;  1M1F A;  2MF2 A;  5CR2 A;  5CQX A;  3G7Z A;  3NFC A;  4MZT A;  4MZM A;  1X75 C;  4ELY C;  2KMT A;  3JSC A;  5HK3 A;  5CKB A;  5CKE A;  3HPW A;  5CCA A; 
#chains in the Genus database with same CATH topology
 2YXY A;  4E6R A;  2M0O A;  1VQ8 Q;  1KG1 A;  1SKU B;  5IAY A;  3I55 A;  2L3P A;  3CCS T;  1T0H A;  2L5Q A;  3M58 A;  1OQK A;  6AT1 B;  2K5F A;  4AFQ C;  1SRL A;  3CPW P;  1WHH A;  2VKN A;  2QEX T;  1KC8 C;  4JJD A;  3OYN A;  1X75 C;  4E7H A;  2DKG A;  4OMN A;  3CC2 A;  4JRQ A;  5IHN A;  4R56 A;  2ZAE A;  1A0N B;  4J9C A;  1TXQ A;  4ELZ C;  2YUN A;  3BFM A;  4L6V 5;  3I56 T;  2AT1 B;  3JV3 A;  1VQL A;  3OW2 P;  1SG5 A;  2RD1 A;  1UJ0 A;  2COW A;  2QTX A;  2XK0 A;  1M27 C;  4OP0 A;  4Z88 A;  4BE0 A;  4M78 G;  4MZM A;  1PSE A;  4LD6 A;  2KNB B;  2OTJ A;  4B9X A;  2DPP B;  1JBM A;  2DET A;  5CKF A;  4FIB A;  4M7A E;  3SHW A;  3PIP A;  2LX9 A;  4UC4 A;  3JCM b;  2HSP A;  2OI3 A;  2RQV A;  4FL6 A;  1Q82 U;  1W70 A;  1UB4 A;  1Y07 A;  3BW1 A;  1VQ5 Q;  3AHU A;  4M77 B;  1OX9 A;  1K76 A;  2LJ1 A;  2E3I A;  3OMC A;  3HL8 A;  1VQK Q;  1S72 T;  5GAM h;  3KXT A;  2QA4 T;  2PVG B;  2RA2 A;  4IIM A;  2FZC B;  2DF6 A;  4GLM A;  4ZGE B;  2CZ6 B;  1HSQ A;  2K79 A;  5L8R E;  3KUF A;  1M90 R;  4M78 D;  3OYH A;  4ME7 A;  2PVD B;  2HL3 A;  5FRM A;  1YIT T;  3VUZ A;  4KUL A;  1VOM A;  4ZN3 A;  4GLK A;  4MZT A;  3OS0 A;  1BU1 A;  3QZ5 B;  2D8H A;  3OS2 A;  2RI3 A;  4M7A F;  4KUI A;  5DY9 A;  3PMI A;  4NOY A;  4Q5W A;  2KEA A;  2JUF A;  1M30 A;  1UGR B;  3L2V A;  4C8Q D;  3M59 A;  2YSQ A;  3M0P A;  1YI2 Q;  2J05 A;  1GBQ A;  1K0S A;  3QSU A;  1X2K A;  2NYS A;  4M7D C;  3T9N A;  5GJV B;  3CC7 Q;  1BYM A;  4RKU E;  5CKB A;  2PUK B;  4XTU A;  3I55 T;  4OB3 B;  4QQG A;  4A4F A;  2EQJ A;  1UGS B;  3ZFJ A;  1QP3 A;  1BI2 A;  1YJW A;  3DLL A;  2DD5 A;  3SB2 A;  5HKC A;  1E6G A;  4OB1 B;  2K2V A;  3CC2 T;  3A8L B;  3M53 A;  1P92 A;  1N9R A;  4PJN A;  1KQS P;  1YIJ A;  1FMK A;  4O5V A;  2JTE A;  2JVV A;  3OYF A;  4FYY B;  3REB B;  4RMO A;  1JO8 A;  1VQL T;  1OX8 A;  5LJ5 d;  4M7A A;  4PKC C;  1NJI R;  4HT9 A;  2GBQ A;  4IUV A;  4JS4 A;  2OTJ T;  3PIO A;  4ZN1 A;  2M1H A;  3EGU A;  2EQK A;  2EQU A;  1YWO A;  3C12 A;  5D6W A;  2J6O A;  1K73 R;  1G2B A;  5I2S A;  2VXE A;  2FRW A;  4MDX A;  2FL7 A;  1JEG A;  1NPR A;  3REA B;  1UJY A;  3EAE A;  3M54 A;  5CAI A;  1R0C B;  1RLQ C;  3CCE A;  4M75 E;  3HRT A;  2BUD A;  2KSS A;  5GMK l;  3G6E A;  4PJO B;  3WVE B;  3L1A A;  1KD1 C;  1RLP C;  2GTO A;  5IHK A;  4BI3 A;  3JB9 I;  2DRM A;  1M2O A;  2M9U A;  5I21 A;  3Q1J A;  2EJ9 A;  1OI1 A;  1M9S A;  5C6S A;  2OTL A;  2E6N A;  1GRI A;  2EYX A;  2LCC A;  1IZ6 A;  1M1K U;  4M7A G;  4FYV B;  3TSW A;  2MF2 A;  1QLY A;  2YT6 A;  2KYB A;  1YHQ T;  2LQ8 A;  2WSC E;  2V1Q A;  3F70 A;  2JZ2 A;  1JB0 E;  2Y4X A;  1UGQ B;  3VUB A;  1PSF A;  2HKQ B;  5GMK j;  3J80 E;  3CCS Q;  5FW9 A;  4ZGD B;  3M0S A;  5I11 A;  1N9S A;  3QUI A;  4WCI A;  5I2M A;  3LH5 A;  3RBB B;  2QEX Q;  2DXT A;  1M4Z A;  4PK4 A;  5KYW A;  8AT1 B;  2A08 A;  2K7A A;  3FJP A;  2NWM A;  1ZQ1 A;  2RHZ A;  2EYZ A;  4F7U F;  4EMK B;  5FRO A;  1WJQ A;  4KBM B;  3FB9 A;  3PFS A;  2JM9 A;  1VQ6 A;  4M7A D;  4A4E A;  1VQK A;  1K0X A;  3RDV A;  3JB9 F;  1I0C A;  2HKN A;  1QVF A;  3X26 B;  3GP8 A;  1OPL A;  1KFZ A;  5LJ3 d;  1Q86 R;  1YIJ T;  3O5Z A;  1XJW B;  2PZ1 A;  2QYZ A;  2M16 A;  1NM7 A;  1YCS B;  3P8B B;  3OYA A;  3CME A;  2KT1 A;  4FW1 A;  3ZBD A;  1C0M A;  4FYX B;  1RAG B;  1UHF A;  3MCA B;  3S3M A;  2YWW A;  3HRU A;  1VQ9 A;  2VAS A;  3EGD B;  2CS7 A;  2QA4 Q;  2DX1 A;  3VS7 A;  4M75 A;  3EHQ A;  3FLG A;  4LDU A;  4Y91 A;  1QVP A;  4ZTF A;  1G83 A;  2QQA A;  2KRS A;  2RJE A;  1FX7 A;  1M1G A;  7AT1 B;  5CKD A;  4AG2 C;  1X01 A;  1YI2 A;  1YIT Q;  4B9W A;  3G6E T;  1LPL A;  2VWF A;  2EQM A;  2GQI A;  5AYF A;  3OYL A;  1IRE B;  3RNJ A;  5GAO l;  2Y4Y A;  2AIR B;  5GAO r;  3VV0 A;  3JCM h;  2G3R A;  3JCM X;  4N0A C;  1QW1 A;  1W2B S;  1KC8 R;  3I35 A;  1QVF S;  4M7D F;  2OTL T;  2X3X D;  3LYI A;  1ACM B;  1IHW A;  2QDY B;  2F2V A;  1JJ2 P;  4OB2 B;  3TQ7 P;  1MNE A;  1WJS A;  3MKD A;  3CCQ A;  1RAH B;  2X4J A;  4JPB W;  4C92 B;  2LNV A;  2RI5 A;  4X9C A;  3OS1 A;  2FZG B;  4M75 G;  3A5Z B;  5GMK e;  3VS4 A;  5LJ3 f;  4PJL A;  1VQO Q;  2ED1 A;  2J06 A;  5GAM d;  1PC0 A;  2EFI A;  3CC2 Q;  1K8A U;  2DLP A;  2GFA A;  1KSW A;  4F7U G;  1AVZ C;  2DA9 A;  2LCS A;  1M8M A;  2XDP A;  4J7I A;  1YFN A;  1BIA A;  1K9A A;  4E7L A;  3JCM W;  1YJN Q;  1VQL Q;  2K4Y A;  1VQ6 T;  2GTJ A;  4OMP A;  3RUX A;  3V7S A;  2XD0 A;  3HTR A;  2F5K A;  1GCP A;  3H41 A;  2CZ1 B;  4QT7 A;  3THK A;  4X1V A;  3OBW A;  3PE0 A;  1LOJ A;  3UA6 A;  4C0G A;  3CME T;  1ZBX A;  1VIF A;  3CCU Q;  1GXI E;  2QK0 A;  2QQS A;  5GAN 4;  1K73 C;  2QDL A;  3JB9 J;  1I8F A;  2EYQ A;  2IPO B;  4RTU A;  1KK7 A;  1QCO A;  1VQ9 T;  3GPL A;  1OZ2 A;  1N6A A;  3L2Q A;  5A0L A;  2P0K A;  2QTV A;  1RAB B;  3I9Q A;  3M57 A;  3D7S B;  2HBW A;  3MEA A;  3JB9 D;  1M3C A;  2X9H A;  4FT4 A;  3A98 A;  3NPF A;  4C0F A;  1AWX A;  4A63 B;  2CH4 A;  2CP7 A;  2LJ3 A;  2NUP B;  2RJF A;  1OU9 A;  3S3N A;  2P0P A;  5M9O A;  2AHJ B;  1SHF A;  1FWZ A;  2L3R A;  2QGG A;  4JRI A;  1AWW A;  4AFZ C;  3I5R A;  3QJ6 A;  4WF2 A;  1ZUK A;  2QEX A;  3TU4 K;  3M0Q A;  3OYD A;  1EIF A;  4J6X A;  2MMP A;  1Q7Y U;  2D6F A;  1PKS A;  2HQH A;  1LCK A;  2QXF A;  4F16 A;  2E5Q A;  1SSH A;  4C8Q E;  1YHQ Q;  3LW5 E;  2ROT A;  4XU0 A;  1KQ2 A;  5A2Q E;  4IIO A;  4RTV A;  2D8J A;  2DEQ A;  2CDT A;  2A7Y A;  5GAM f;  4MML A;  2A0F B;  3J81 E;  2RQR A;  3GIB A;  3CEY A;  4CC4 B;  2EPD A;  1BK2 A;  3CCQ T;  2QAZ A;  2FYK A;  1GCQ A;  2EKH A;  3TSZ A;  4HVV A;  4E7K A;  1AEY A;  4BY6 B;  4E2F B;  4JZ4 A;  3M9Q A;  2YUP A;  1WJR A;  1UDL A;  5FWB A;  2ESW A;  2E65 A;  1SSF A;  4DA4 A;  1NEG A;  3SWN B;  4Z89 A;  1WLP B;  1X6O A;  1VQ7 Q;  4M7D D;  3TCJ A;  4ORZ A;  3OB9 A;  2LNH B;  2ZPE B;  2KVQ G;  4DBQ A;  4K11 A;  1TTH B;  2J6F A;  5GAN f;  2RMO A;  1IB8 A;  1KD1 R;  2D0N A;  5GAN 8;  2JS0 A;  2DIL A;  2RM4 A;  2CUD A;  4RUG A;  1GFD A;  2YHT A;  1OOT A;  1F1B B;  4ATO A;  2A28 A;  2HMA A;  1I5O B;  2AZV A;  2F69 A;  3QII A;  1G3S A;  1ZUU A;  2O01 E;  1AZG B;  4C5E A;  4LDV A;  2O9S A;  1CSK A;  1JRI A;  2RHY A;  1AHJ B;  4FT2 A;  4A4G A;  2M02 A;  3CCV Q;  3G6E Q;  1NBE B;  4JJC A;  3CCJ A;  1N8R U;  2ENM A;  2H3J A;  3CBO A;  4J9G A;  4C8Q A;  4XTZ A;  4LD9 K;  2JW4 A;  2F5T X;  4P5N A;  3V7R A;  3QDR B;  4A4K A;  2DVJ A;  2RK1 A;  1M5Q 1;  1VQO A;  2LRQ A;  3EG3 A;  3EFO A;  1X43 A;  2OTL Q;  1PRL C;  3NTI A;  2DNU A;  1I4K 1;  1VQN T;  2DL4 A;  2EWN A;  1LNX A;  1EX4 A;  1FMV A;  1YJN A;  4XTW A;  4LUD A;  1T3S A;  1VYU A;  2DL3 A;  2VXF A;  3V8K A;  2ED0 A;  3EG9 A;  3EH2 A;  5KYU A;  3JB9 H;  1RUW A;  1AT1 B;  3QWY A;  3FJ5 A;  2E41 A;  3PVQ A;  1GFC A;  1Y96 A;  9ATC B;  2CSI A;  3CCU A;  4AMC A;  4R55 A;  2RH2 A;  1K9M C;  4RTW A;  2VUB A;  1VQ6 Q;  1ZSZ B;  1G8X A;  1WHL A;  3BY7 A;  2BZ8 A;  4C8Q G;  1MHN A;  1J3T A;  1CKA A;  4M77 C;  1M2V A;  4A4H A;  2O88 A;  1ZSZ C;  1ABO A;  2OAW A;  3CCM A;  1D1B A;  1Q81 C;  2DD4 A;  4J5Y A;  1JQQ A;  3JCM d;  2JMA A;  3CME Q;  3CC4 A;  2LT4 A;  1RAI B;  2DE0 X;  2FZK B;  4FW2 A;  1WXU A;  4IUQ A;  2FG0 A;  3UAT A;  2YLC A;  3INZ A;  4JZ3 A;  1M3B A;  1VQ9 Q;  2ZGW A;  2LQN A;  2JJ9 A;  2AKK A;  2HL5 C;  4KRT A;  2DYB A;  5KYX A;  4JLI A;  2DBM A;  2DZC A;  1YHQ A;  2D0Q B;  5FWC A;  2YDL A;  1WI7 A;  1N5Z A;  1D0Z A;  1WXB A;  3OYM A;  3CD6 T;  2KDS A;  2NUT A;  1NYG A;  3M55 A;  3LWH A;  1MMD A;  4HCC A;  5GAN h;  2NUZ A;  2R5M A;  3VJP A;  5LJ5 g;  2DTI A;  4ANJ A;  2FRY A;  5LJ5 j;  1TU0 B;  2C06 A;  3CCJ T;  2GGR A;  2DRK A;  5DLQ E;  4OGE A;  4A53 A;  4EPC A;  1NJI U;  5CK9 A;  5HK0 A;  2A3L A;  3LLR A;  2RN8 A;  1FMW A;  4OB0 B;  4TVR A;  2CKK A;  3FRN A;  1WQ7 A;  1VQO T;  5GJW B;  3KBG A;  2I2L A;  1Y0M A;  2DXB A;  2MOX A;  3DLM A;  1VQ7 A;  2FVU A;  4JS5 A;  1D1C A;  3CXC A;  3CCQ Q;  3QKJ A;  4AG1 C;  1UHC A;  4BB7 A;  3UDC A;  1JXM A;  3IQL A;  1FYN A;  1YJN T;  1G5V A;  1TG0 A;  2F1L A;  2K2M A;  2J7I A;  3OMG A;  2RF0 A;  2BTT A;  1ARK A;  4X9D A;  3QWX X;  4L5G A;  3QXE B;  1MV3 A;  4Z02 A;  4JJB A;  1I81 A;  5C0M A;  3UPU A;  3JCM f;  3CCU T;  2K57 A;  1D3B B;  1MMN A;  1MUZ A;  4IUP A;  3URG A;  1QCF A;  1VUB A;  4HCK A;  4J9D A;  2FPF A;  4OMF B;  3X25 B;  3C0C A;  1AZE A;  2HBP A;  4BD3 A;  2QI2 A;  3CCV A;  2GFU A;  3SEM A;  3VKI A;  5FU6 B;  2HSE B;  3CCM T;  4IKF A;  2QGF B;  1YP5 A;  1Z9Q A;  1M3A A;  2QQB A;  2KAF A;  1SEM A;  4PJO C;  5GMK m;  1QKX A;  1UFF A;  2BZY A;  1QMC A;  4F7U E;  3G4S A;  3CC4 T;  4BI8 B;  1RAE B;  1V29 B;  4IUR A;  3ZEH A;  3QYH B;  3BE3 A;  2L89 A;  3CPF A;  3M0T A;  5GAN 6;  2CT3 A;  3DB3 A;  2C0T A;  3CXC S;  4DEX A;  3CQT A;  4KGV B;  4QKU A;  5LJ3 g;  5FRN A;  3GLX A;  3OBY A;  1X27 A;  5LJ3 j;  1OZ3 A;  2ZZD A;  5CVI A;  3P8D A;  4HVU A;  4E7J A;  2HD0 A;  1Q86 U;  1ZUY A;  2VV5 A;  3NHN A;  2F2X A;  2KBT A;  1WHJ A;  1RAA B;  1FXX A;  3EGX A;  3V7C A;  5LJ5 e;  2GCX A;  1VQN Q;  4HVW A;  4O6J A;  2DL5 A;  3G71 T;  1JU5 C;  2LQW A;  1W2B A;  1TUG B;  2YRC A;  4XU2 A;  5HCK A;  2CUB A;  5FLX E;  4EMK C;  1B34 A;  2JTM A;  4M78 B;  1KJW A;  1E6H A;  2YUQ A;  1VQ7 T;  2E3H A;  3A1P A;  2EKO A;  3QPH A;  3RMQ A;  2W0Z A;  1MGQ A;  3TVT A;  1CKB A;  3OA6 A;  3G1J A;  4M77 F;  4LDY A;  4J9I A;  4BUG A;  4M7D E;  3ULR B;  5A0G A;  4C8Q B;  4JLG A;  4KGX B;  5KYN A;  4J6W A;  1SHG A;  2LTO A;  2CGH A;  2F2W A;  2O31 A;  3H6Z A;  1QVG A;  2DM1 A;  3H0H A;  2ZCF B;  1WDX A;  1RAD B;  1R8O B;  5KCO A;  4JRK A;  1KHC A;  3OYB A;  3EG1 A;  3X20 B;  4DBR A;  4BE1 A;  1QVF P;  3MP1 A;  1QP2 A;  4PLL A;  2EAY A;  4V2S A;  4F7U A;  3VYH B;  4KH0 B;  4RTZ A;  2VB6 A;  2DER A;  3CCV T;  1ZBJ A;  2P4T A;  2M51 A;  3L2R A;  2B86 A;  3OYG A;  1HYO A;  2L2P A;  5ECA A;  1V76 A;  5GAM g;  3EG9 B;  5KYU B;  1Z9Z A;  3G4S T;  3C95 A;  5GAN 2;  5GAM j;  3C4S A;  2R57 A;  3UA7 A;  5FU7 B;  3X24 B;  5GAO m;  3CD6 Q;  4F17 A;  1Q82 C;  1Y96 B;  2WAC A;  3LGL A;  4ZGJ B;  1NG2 A;  5FU7 C;  5KYY A;  3CCR A;  1WFW A;  2ECZ A;  3PVL A;  3HSB A;  4LDX A;  3FC3 A;  3CCJ Q;  2RQT A;  4RTX A;  4N4G A;  3VS3 A;  4KT0 E;  3CBP A;  2GF7 A;  2DJQ A;  1M2V B;  2H3E B;  5LJ3 e;  2E64 A;  4C92 C;  1VIE A;  3MET A;  3A8M B;  4FSX A;  5DLO A;  2XKO C;  3DKM A;  3RKY A;  1IO6 A;  2JM8 A;  1QVG S;  1PCX A;  1X6G A;  4BE2 A;  3WXM B;  4OMM A;  1K9M R;  4OMO A;  1ZA1 B;  2DIG A;  3JB9 G;  1B3Q A;  2MAM A;  5KYX B;  4VUB A;  2K3Y A;  2LJ0 A;  1TH7 A;  1PG5 B;  1R77 A;  3ZL7 C;  4AFU C;  4BAC A;  1EZZ B;  4HXJ A;  4M7D A;  3L2W A;  5GAO n;  1Q81 R;  3GNF B;  1WYX A;  1T0J A;  2VYT A;  1NEB A;  3LWI A;  4OVA A;  2JN0 A;  3MEW A;  4CRI A;  5CCA A;  1VYT A;  2OX7 A;  5GAN 3;  1HK9 A;  5GAN d;  2P84 A;  2LC4 A;  2MWO A;  2HQE A;  2VVK A;  4PJO F;  4C0D B;  3L2U A;  1D0X A;  3FDR A;  2V8J A;  3EG2 A;  3CCM Q;  1K8A R;  4NL3 A;  3PTA A;  2JS2 A;  2KRM A;  5CQX A;  3OYY A;  4C0D C;  2YLB A;  2VGM A;  2W10 A;  2CP0 A;  2D1X A;  4BDY A;  3CC4 Q;  2QQR A;  1NLO C;  2JT4 A;  2O2O A;  4NL2 A;  4PFZ A;  4EMH A;  1OU8 A;  1NE8 A;  2EJF A;  4Y92 A;  2K6D A;  2MCN A;  4M77 D;  4M7A B;  4QVD A;  1ABQ A;  1VQN A;  4QVZ A;  3M4G A;  2K5I A;  5CQY A;  1M1F A;  4FCY A;  4M7A C;  4M7D G;  1BI1 A;  5GAM e;  4XU3 A;  4EMG A;  4N4I A;  2X4W A;  1B07 A;  2EYY A;  4XAX B;  1PWT A;  2B8A A;  3CCR T;  2CRE A;  3HP9 A;  1WZO A;  3H9N A;  1TSF A;  1JXO A;  1K4U S;  2KXD A;  2DVE A;  1AOJ A;  4M4Z A;  3NTH A;  4E7Z A;  1KD1 U;  3L2Z A;  5KH6 A;  3G71 Q;  2KYM A;  1ZSG A;  2EVR A;  4BY6 C;  4LXC A;  1YJ9 A;  2LCL A;  5GAO p;  1V1C A;  4JUV A;  2RQW A;  3CCL A;  1Q7Y R;  2RK2 A;  2DBK A;  4DOW A;  1M1K C;  2RI2 A;  3SWN C;  1W6X A;  4C5G A;  4J83 A;  2E12 A;  4QQ6 A;  2ATC B;  3OQ5 A;  5LL6 S;  3MEU A;  3I5S A;  1RI0 A;  3JCM J;  5IH2 A;  2ZPB B;  4AT1 B;  3HFO A;  4LE9 A;  1YNZ A;  3EFS A;  4ZNX A;  4YTL A;  4C92 E;  1ZLM A;  2G6F X;  4J9F A;  1YBY A;  5KYW B;  1W1F A;  4QVC A;  3VS6 A;  3CD6 A;  5KE3 A;  2AKL A;  2MYS A;  3OSS C;  5IXB A;  4EMK A;  5GMK h;  2CT4 A;  3CPW A;  3HRS A;  1MMA A;  5J39 A;  3E19 A;  2QQ9 A;  2RHX A;  1QWF A;  3HHT B;  2JMC A;  2HCK A;  4HCB A;  1B34 B;  2JXB A;  5IHI A;  3G4S Q;  2DTH A;  4N4H A;  2DO3 A;  3OW2 A;  1RL2 A;  2E4H A;  3OSV A;  3M5A A;  3QHS A;  1D0Y A;  1QCN A;  2DZ9 A;  2KRO A;  2DEU A;  2V1R A;  1VQP A;  2RNA A;  2YUO A;  2O4X A;  1BIB A;  1WXT A;  2IVW A;  3X28 B;  4C5I A;  4PJJ A;  2LDM A;  3RR6 A;  2EJG A;  3EGD A;  4J9H A;  2BE9 B;  1YWP A;  4C92 F;  1U1S A;  1KHI A;  4PJO D;  2FEI A;  2IIM A;  2RJD A;  3PT9 A;  2XDD A;  4ZTJ A;  4M75 B;  3JCM g;  1Y71 A;  2LX7 A;  2COY A;  3VRY A;  1G3Y A;  4M75 C;  4D8D A;  2GNC A;  4R0K A;  4HKE A;  1SF9 A;  1QQJ A;  2V8K A;  2E10 A;  1M90 U;  4F7U B;  4Y28 E;  2GQV A;  4Z8A A;  4N0A A;  3JAM E;  3TRE A;  2XG8 D;  5GAO q;  1TUD A;  1N8R R;  2YRD A;  1BKB A;  1MV0 B;  4LN2 A;  4D6W A;  3L42 A;  3CPW S;  1HXD A;  1PD0 A;  1U1T A;  1YJ9 T;  1VQM Q;  3MHX A;  2PQW A;  2HZY A;  1VQ4 T;  3VRZ A;  2PU9 B;  2LP5 A;  2LQK A;  3CCL T;  1DJ7 B;  3QO3 A;  3RES A;  2AZS A;  3JCM V;  1AWO A;  2RPN A;  5KYY B;  3OW2 S;  1UE9 A;  1G3W A;  8ATC B;  1ZHI A;  1BI3 A;  1GL5 A;  1HJD A;  4C92 A;  2X35 A;  1ZX6 A;  4DBF A;  2XI9 A;  1GBR A;  3OYJ A;  3FEO A;  2PUO B;  2KRN A;  2BE7 D;  5DM7 R;  2EBP A;  2ROL A;  2L0A A;  3J7A F;  1WIE A;  5KCH A;  1K8A C;  1U5S A;  1H8K A;  1Q82 R;  3VYG A;  2BKD N;  4PFP A;  2CZ7 B;  2P0Q A;  3JCM c;  1T3L A;  3BDU A;  4DEY A;  1WHM A;  4PFO A;  3R6N A;  1XOV A;  1KQS A;  4F04 B;  1XNI A;  2COZ A;  4XU1 A;  2PTK A;  2X4Y A;  4L59 A;  4RTY A;  3GOX A;  4J6Y A;  5EC7 A;  4E7S A;  3RKW A;  2CSQ A;  1M8V A;  4M7D B;  2L3S A;  3G71 A;  2DIQ A;  2XU8 A;  3CMA Q;  3MP6 A;  2R58 A;  3VS1 A;  2OJ2 A;  2FPD A;  3OYI A;  1K1Z A;  4QQD A;  1VQP T;  3CBM A;  1NLP C;  3G7Z A;  3RIR A;  3VS2 A;  3NMZ C;  1X2Q A;  3CCR Q;  1TOV A;  3KFV A;  1UGV A;  2EGC A;  2JNG A;  3PGG A;  1K73 U;  4C92 G;  4DOV A;  2E6Z A;  1H3Z A;  3M4Y A;  3PMT A;  5GAN 7;  3JRZ A;  4GBQ A;  1IGU A;  1BI0 A;  2DK3 A;  3MJX A;  2Y90 A;  1OEB A;  2EGE A;  3E2U A;  4CC3 A;  3NTK A;  4KGZ B;  2NUP A;  4WTO B;  3NFC A;  2Z0W A;  4AFS C;  1B7T A;  1UEB A;  2EIF A;  3MEV A;  2KMT A;  3JSC A;  3JCM e;  4PJM A;  1QKW A;  1OPK A;  5D7U A;  3OY9 A;  2CZ0 B;  1E7O A;  2HNI A;  3QG1 A;  1Q7Y C;  3QYG B;  1BBZ A;  2KY9 A;  3VS0 A;  4OML A;  3E9G A;  2DAQ A;  2VGN A;  4LNP A;  1XQH A;  4XTY A;  5A0D A;  5CO7 A;  4RG8 A;  2IG0 A;  4J9E A;  4C92 D;  1X69 A;  3UWN A;  5IXF A;  4J9B A;  2J6K A;  2XHC A;  3CXC P;  4PLI A;  1KQS S;  2DXC A;  3H0I A;  1OV3 A;  1PM3 A;  1AD5 A;  1LVK A;  3V8J A;  3HPW A;  2E70 A;  5FU6 C;  4OF1 A;  2KXC A;  2ZPI B;  2SEM A;  2ZPG B;  1WHK A;  5CKH A;  4LDW A;  2CP3 A;  1D1A A;  1VQ8 A;  2DFU A;  1X6B A;  1RAF B;  1GCQ C;  1OUL A;  5HK3 A;  5CKE A;  2HAX A;  1TWB A;  3TEE A;  3OYC A;  1U3O A;  3SWN A;  3JCM Q;  3V8L A;  4M77 E;  3H0F A;  1NPP A;  1Q95 G;  1HD3 A;  3N5B B;  2E1H A;  3LGF A;  1UEC A;  3GBQ A;  2ABL A;  3LX7 A;  4XQ3 A;  1UUE A;  3S3O A;  1I1J A;  3P8H A;  4M75 F;  1VQM A;  3GNG A;  1UG1 A;  2EQI A;  2FB7 A;  1G3T A;  1Y7X A;  2PNI A;  2A37 A;  1TS9 A;  2RHI A;  1M1K R;  4RG2 A;  2EYW A;  4ELY C;  5LJ5 f;  3AT1 B;  3ER0 A;  1WX6 A;  4M78 C;  1PKT A;  4J8O A;  3I56 Q;  4E7I A;  1VQ5 A;  2I0N A;  1YJW T;  4OMQ A;  1W4S A;  1N8R C;  4HCZ A;  2WSF E;  1Y57 A;  1YJ9 Q;  1C6V X;  4FYW B;  1VQ4 Q;  4GY5 A;  2PVO B;  3CCL Q;  1KC8 U;  1PHT A;  3VU3 C;  4C8Q C;  1WQW A;  3EFO B;  4DBH A;  1W2B P;  2O4X B;  2BZX A;  3RMS A;  4MDW A;  3A8O B;  3QJY A;  1S72 Q;  1JJ2 A;  2K9G A;  3NGP A;  4XTX A;  1UTI A;  2NLU A;  4E47 A;  2OAU A;  2HDA A;  4PL6 A;  1KQ1 A;  2XID A;  2D9T A;  1SPK A;  2DYI A;  1M90 C;  4DQ2 A;  3CMA A;  5J26 A;  1U06 A;  4C0Z A;  3CCE T;  1WGS A;  1R0B G;  1VQ8 T;  2C0O A;  3CC7 A;  4M77 A;  4PNO A;  3DB4 A;  2EW3 A;  1QVG P;  1WPY A;  1C1A A;  3EFR A;  1K9M U;  2LMJ A;  1ZSZ A;  1D09 B;  2K3B A;  2K5L A;  2V8I A;  4RTT A;  4KH1 B;  5I22 A;  2QG9 B;  1H64 1;  4XTV A;  1PNJ A;  2RQU A;  1EFN A;  3M56 A;  2FPE A;  4F14 A;  1Q81 U;  3ASK A;  1VQP Q;  3S6W A;  4PJO E;  3A8G B;  2CP5 A;  1MND A;  5KE2 A;  3PNW C;  5GAN g;  5CR2 A;  5GAN j;  2K3X A;  3I55 Q;  2HQX A;  2X51 A;  4X34 A;  3M0R A;  5D6X A;  3GF5 A;  2KE9 A;  1H92 A;  2VC8 A;  2KGT A;  2LVM A;  1WHG A;  4CC7 A;  2RO0 A;  3E1S A;  1VQM T;  3O8V A;  5HY6 A;  4OGC A;  5IN1 A;  2RJC A;  1BB9 A;  1IHV A;  5AT1 B;  3MPU B;  3VS5 A;  2JTF A;  1JJ2 S;  1AWJ A;  1VYV A;  1H3H A;  4MMK A;  2NUT B;  1SRM A;  1BCM A;  1VQ5 T;  2MI6 A;  5EG2 A;  2AK5 A;  4BI4 A;  5IT9 E;  4M77 G;  2XIC A;  2CH4 W;  3H8Z A;  2KQW A;  1VQK T;  4II1 A;  3C94 A;  1NJI C;  2A36 A;  4MZP A;  2WSE E;  1LJO A;  2OTJ Q;  1RI9 A;  3EG0 A;  3QDF A;  4JDS A;  2C0I A;  2HEQ A;  2MPX C;  2X3W D;  4M75 D;  3MO8 A;  5J3B A;  2KI7 A;  5LJ5 h;  4FM4 B;  4FU6 A;  4BDZ A;  2DL8 A;  3WVD B;  4HA8 A;  2XMF A;  1WNL A;  4EIK A;  2KK4 A;  1I07 A;  1NYF A;  1QWE A;  2DJZ A;  2X4X A;  4M78 E;  1IRX A;  4JJN K;  2CYZ B;  2JOY A;  2L3Q A;  4RCB A;  1O9S A;  3CCS A;  3E9F A;  2DXU A;  3CMA T;  1YI2 T;  5CIU A;  1D3B A;  3FIF A;  2H8H A;  2DMO A;  4XK8 E;  1RAC B;  3CC7 T;  2CP6 A;  4HT8 A;  2XDB A;  1TUC A;  3R6O A;  2QAS A;  4RCC A;  2M0Y A;  3JCM P;  4CI0 C;  4NS5 A;  2E5K A;  1KIK A;  3I56 A;  2SRC A;  4LUE A;  4PJO A;  3LH0 A;  3QZ9 B;  5L23 A;  2ZPH B;  1S1N A;  2ZPF B;  2MK5 A;  1PD1 A;  2R5A A;  3QBY A;  2CP2 A;  4B6M A;  2KT8 A;  3M0U A;  1VQ4 A;  1ZA2 B;  4M78 F;  3OYE A;  1U8R A;  2MWP A;  3ME9 A;  2YRV A;  4C5H A;  2O9V A;  5D6Y A;  5GAN 5;  5GAN e;  4IUU A;  3HFN A;  3U23 A;  1YJW Q;  1N27 A;  4EDU A;  1UGP B;  1IXD A;  2LZ6 B;  3OYK A;  1S72 A;  3EHR A;  2QA4 A;  2EGA A;  3BDL A;  1MMG A;  1YCY A;  3EH1 A;  4KUD K;  2LT1 A;  4CC2 A;  1YIJ Q;  3RKX A;  1Q86 C;  4C8Q F;  2FO0 A;  1XTD A;  5GMK i;  3OS5 A;  1PRM C;  1OYX A;  2RHU A;  3MP8 A;  3HKS A;  1IGQ A;  2DTO A;  3SD4 A;  2V26 A;  4A54 A;  2KR3 A;  3UF4 A;  1BCO A;  2DL7 A;  4QW2 A;  1YIT A;  3SDZ A;  3EGX B;  2P4R A;  5LJ3 h;  4PJO G;  3RER A;  1YN8 A;  2RB6 A;  1I5L A;  4IUT A;  4FSS A;  4JRP A;  3UT1 A;  2BIV A;  2L8D A;  2FHD A;  2MIO A;  1VA7 A;  1NZ9 A;  4ESR A;  4M78 A;  1WA7 A;  4J7F A;  4D8K A;  3A8H B;  3SFM A;  1O75 A;  3CCE Q; 
#chains in the Genus database with same CATH homology
 4C92 G;  4DOV A;  2E6Z A;  3OA6 A;  1VQ9 T;  2M0O A;  1H3Z A;  3GPL A;  3M4Y A;  3PMT A;  1KG1 A;  4M77 F;  1OZ2 A;  4LDY A;  4BUG A;  1N6A A;  4M7D E;  3L2Q A;  5A0L A;  2P0K A;  5GAN 7;  3JRZ A;  5IAY A;  3I55 A;  1BI0 A;  2DK3 A;  3CCS T;  2Y90 A;  2L5Q A;  3M58 A;  3M57 A;  5A0G A;  3MEA A;  3JB9 D;  4FT4 A;  4C8Q B;  4JLG A;  3NTK A;  4J6W A;  2K5F A;  4C0F A;  2LTO A;  2CGH A;  3NFC A;  2QEX T;  2RJF A;  3H6Z A;  3S3N A;  1QVG A;  2P0P A;  1KC8 C;  2ZCF B;  3OYN A;  1UEB A;  1X75 C;  2EIF A;  2AHJ B;  2KMT A;  3JSC A;  1R8O B;  2DKG A;  1FWZ A;  3MEV A;  5KCO A;  3JCM e;  2L3R A;  4JRK A;  4JRI A;  3CC2 A;  4JRQ A;  4R56 A;  1KHC A;  3OYB A;  3OY9 A;  3QJ6 A;  4WF2 A;  2CZ0 B;  2QEX A;  3X20 B;  4BE1 A;  3TU4 K;  3MP1 A;  2HNI A;  3QG1 A;  1QP2 A;  3OYD A;  1Q7Y C;  1EIF A;  3QYG B;  4J6X A;  4PLL A;  2EAY A;  2KY9 A;  2MMP A;  3BFM A;  4ELZ C;  4F7U A;  3E9G A;  4L6V 5;  3VYH B;  2DAQ A;  2VGN A;  3I56 T;  1Q7Y U;  2D6F A;  2QXF A;  1XQH A;  2E5Q A;  4XTY A;  4V2S A;  4C8Q E;  5A0D A;  3CCV T;  1VQL A;  5CO7 A;  4RG8 A;  2RD1 A;  3LW5 E;  2IG0 A;  2QTX A;  2XK0 A;  4XU0 A;  4OP0 A;  2P4T A;  4C92 D;  3L2R A;  3UWN A;  4BE0 A;  1KQ2 A;  5A2Q E;  3OYG A;  2XHC A;  4M78 G;  4MZM A;  4PLI A;  5GAM g;  2DXC A;  1PSE A;  1KQS S;  4LD6 A;  3G4S T;  3C95 A;  5GAN 2;  5GAM j;  2OTJ A;  2DEQ A;  3C4S A;  3V8J A;  4B9X A;  2DPP B;  2R57 A;  2A7Y A;  3HPW A;  5GAM f;  4MML A;  5FU7 B;  2E70 A;  3X24 B;  1JBM A;  5GAO m;  3J81 E;  5CKF A;  4FIB A;  3GIB A;  3CEY A;  4M7A E;  5FU6 C;  4OF1 A;  3PIP A;  2LX9 A;  1Y96 B;  4UC4 A;  1Q82 C;  3JCM b;  2WAC A;  3LGL A;  4FL6 A;  4ZGJ B;  3CCQ T;  1Q82 U;  2ZPI B;  1UB4 A;  2FYK A;  2ZPG B;  1Y07 A;  5FU7 C;  3CCR A;  3BW1 A;  3AHU A;  4M77 B;  5CKH A;  4LDW A;  4E7K A;  3HSB A;  4BY6 B;  3OMC A;  3HL8 A;  4LDX A;  1VQ8 A;  3M9Q A;  3FC3 A;  1S72 T;  5GAM h;  3KXT A;  2QA4 T;  2PVG B;  4N4G A;  1WJR A;  2RA2 A;  5HK3 A;  4KT0 E;  3CBP A;  5CKE A;  2GF7 A;  3OYC A;  3TEE A;  2HAX A;  5FRN A;  5LJ3 e;  4ZGE B;  2CZ6 B;  2E64 A;  2E65 A;  3SWN A;  4C92 C;  1VIE A;  3MET A;  3JCM Q;  1SSF A;  4DA4 A;  3A8M B;  4FSX A;  5DLO A;  3SWN B;  2XKO C;  3V8L A;  1X6O A;  3DKM A;  5L8R E;  3RKY A;  3KUF A;  4M77 E;  3TCJ A;  4M7D D;  4M78 D;  3OYH A;  3OB9 A;  2PVD B;  4ME7 A;  5FRM A;  1QVG S;  1YIT T;  1NPP A;  3VUZ A;  4KUL A;  4BE2 A;  3WXM B;  2ZPE B;  3N5B B;  2KVQ G;  4ZN3 A;  4GLK A;  2E1H A;  3LGF A;  4MZT A;  5GAN f;  3OS0 A;  3QZ5 B;  2DIG A;  3JB9 G;  2MAM A;  3LX7 A;  4XQ3 A;  3OS2 A;  2RI3 A;  4VUB A;  5GAN 8;  2K3Y A;  4M7A F;  1TH7 A;  4KUI A;  5DY9 A;  2RM4 A;  3PMI A;  3S3O A;  4BAC A;  4NOY A;  4Q5W A;  2JUF A;  2YHT A;  1UGR B;  3P8H A;  4ATO A;  3L2V A;  4M7D A;  3L2W A;  5GAO n;  4M75 F;  4C8Q D;  3GNF B;  3GNG A;  3M59 A;  1VQM A;  2FB7 A;  2VYT A;  2F69 A;  3QII A;  1G3T A;  1G3S A;  3LWI A;  1Y7X A;  4OVA A;  2JN0 A;  3MEW A;  3QSU A;  2O01 E;  4CRI A;  2RHI A;  4M7D C;  4RG2 A;  3T9N A;  4ELY C;  5LJ5 f;  3ER0 A;  4C5E A;  4LDV A;  4RKU E;  4M78 C;  5CKB A;  1BYM A;  2PUK B;  4J8O A;  4XTU A;  5CCA A;  4E7I A;  1VQ5 A;  1JRI A;  2RHY A;  1AHJ B;  4FT2 A;  4A4G A;  1YJW T;  3I55 T;  5GAN 3;  4OB3 B;  1HK9 A;  4QQG A;  4A4F A;  5GAN d;  1W4S A;  2LC4 A;  2EQJ A;  2MWO A;  3CCJ A;  1N8R C;  1UGS B;  3ZFJ A;  2HQE A;  1QP3 A;  4PJO F;  1BI2 A;  4HCZ A;  4C0D B;  1YJW A;  1N8R U;  3L2U A;  3DLL A;  2DD5 A;  2H3J A;  2WSF E;  3CBO A;  2V8J A;  3FDR A;  3SB2 A;  4C8Q A;  5HKC A;  4OB1 B;  4NL3 A;  4XTZ A;  3PTA A;  2K2V A;  4LD9 K;  2F5T X;  3CC2 T;  4P5N A;  3V7R A;  3A8L B;  5CQX A;  3M53 A;  3OYY A;  3QDR B;  4C0D C;  1P92 A;  1N9R A;  2VGM A;  2RK1 A;  2YLB A;  4GY5 A;  4A4K A;  1YIJ A;  1M5Q 1;  1VQO A;  2LRQ A;  4BDY A;  2PVO B;  1KC8 U;  4O5V A;  2QQR A;  3VU3 C;  4C8Q C;  1WQW A;  2JVV A;  3NTI A;  3OYF A;  2O4X B;  4RMO A;  4NL2 A;  4EMH A;  1VQL T;  3RMS A;  1I4K 1;  4MDW A;  1VQN T;  3A8O B;  2EWN A;  1NE8 A;  2EJF A;  5LJ5 d;  4M7A A;  4PKC C;  3QJY A;  4HT9 A;  4M7A B;  4M77 D;  1LNX A;  4QVD A;  1YJN A;  4XTW A;  1VQN A;  4QVZ A;  3M4G A;  2K5I A;  4IUV A;  2VXF A;  5CQY A;  1M1F A;  4JS4 A;  2OTJ T;  1JJ2 A;  3PIO A;  3V8K A;  4XTX A;  4M7A C;  4ZN1 A;  4M7D G;  2NLU A;  4E47 A;  2M1H A;  1BI1 A;  2OAU A;  3JB9 H;  2EQK A;  5GAM e;  2C06 A;  4XU3 A;  4PL6 A;  4EMG A;  2EQU A;  3C12 A;  4N4I A;  5D6W A;  1KQ1 A;  2X4W A;  2XID A;  2D9T A;  4XAX B;  4DQ2 A;  2E41 A;  5J26 A;  2B8A A;  2VXE A;  5I2S A;  3CMA A;  2FL7 A;  3CCR T;  4MDX A;  3HP9 A;  4C0Z A;  1NPR A;  1Y96 A;  3CCE T;  3CCU A;  1WGS A;  4R55 A;  2RH2 A;  3EAE A;  3M54 A;  5CAI A;  1K9M C;  3CC7 A;  1VQ8 T;  4M77 A;  4PNO A;  3DB4 A;  1WPY A;  3EFR A;  1K9M U;  3CCE A;  4M75 E;  3HRT A;  2VUB A;  2BUD A;  2DVE A;  2KSS A;  5GMK l;  3G6E A;  3NTH A;  4PJO B;  3WVE B;  3L1A A;  1KD1 C;  2K5L A;  2V8I A;  3BY7 A;  1KD1 U;  3L2Z A;  1H64 1;  4XTV A;  5KH6 A;  4BI3 A;  1MHN A;  4C8Q G;  4M77 C;  3JB9 I;  2M9U A;  5I21 A;  4A4H A;  4BY6 C;  3M56 A;  1YJ9 A;  3CCM A;  3Q1J A;  1Q81 C;  2DD4 A;  4J5Y A;  2LCL A;  5GAO p;  2EJ9 A;  1Q81 U;  1OI1 A;  1M9S A;  3ASK A;  4JUV A;  5C6S A;  3JCM d;  3S6W A;  3CCL A;  2RK2 A;  2LT4 A;  3CC4 A;  2OTL A;  2E6N A;  3A8G B;  4DOW A;  4PJO E;  1M1K C;  4IUQ A;  2RI2 A;  2LCC A;  1IZ6 A;  3SWN C;  5KE2 A;  1M1K U;  3PNW C;  4M7A G;  5GAN g;  2YLC A;  3INZ A;  2MF2 A;  5CR2 A;  5GAN j;  2K3X A;  1YHQ T;  2ZGW A;  2HQX A;  2LQ8 A;  2WSC E;  2E12 A;  4J83 A;  4C5G A;  3F70 A;  4QQ6 A;  2JZ2 A;  1JB0 E;  4X34 A;  3OQ5 A;  2Y4X A;  3GF5 A;  5D6X A;  5LL6 S;  1UGQ B;  3VUB A;  1PSF A;  3MEU A;  1RI0 A;  2VC8 A;  3JCM J;  2LVM A;  2ZPB B;  4JLI A;  5GMK j;  3HFO A;  2DZC A;  2RO0 A;  3J80 E;  1YHQ A;  3E1S A;  2D0Q B;  1VQM T;  3O8V A;  5HY6 A;  4OGC A;  5IN1 A;  2RJC A;  4ZGD B;  3EFS A;  1N9S A;  3QUI A;  5I2M A;  2JTF A;  1JJ2 S;  3OYM A;  3CD6 T;  2DXT A;  4YTL A;  1M4Z A;  2KDS A;  4C92 E;  4HCC A;  3M55 A;  3LWH A;  4MMK A;  3FJP A;  5GAN h;  1YBY A;  2R5M A;  3VJP A;  5LJ5 g;  4QVC A;  2DTI A;  2MI6 A;  5EG2 A;  4BI4 A;  5IT9 E;  1VQ5 T;  1ZQ1 A;  3CD6 A;  4M77 G;  5KE3 A;  5LJ5 j;  3OSS C;  2XIC A;  2RHZ A;  3H8Z A;  4EMK A;  5GMK h;  2KQW A;  3CPW A;  1VQK T;  4II1 A;  3C94 A;  4F7U F;  3HRS A;  5J39 A;  4EMK B;  3CCJ T;  5DLQ E;  3E19 A;  1NJI C;  5FRO A;  1WJQ A;  4OGE A;  4MZP A;  4A53 A;  4EPC A;  4KBM B;  2QQ9 A;  1NJI U;  3FB9 A;  3PFS A;  5CK9 A;  5HK0 A;  2RHX A;  2WSE E;  1VQ6 A;  3HHT B;  4M7A D;  1LJO A;  2A3L A;  4A4E A;  3LLR A;  1VQK A;  4OB0 B;  3JB9 F;  4JDS A;  4TVR A;  1QVF A;  2CKK A;  3X26 B;  4HCB A;  3GP8 A;  3FRN A;  5LJ3 d;  1B34 B;  1YIJ T;  1WQ7 A;  1VQO T;  2DTH A;  4M75 D;  3MO8 A;  4N4H A;  5J3B A;  3KBG A;  2DO3 A;  2I2L A;  2M16 A;  5LJ5 h;  3OW2 A;  4FM4 B;  2DXB A;  1RL2 A;  3OSV A;  4FU6 A;  4BDZ A;  3DLM A;  3M5A A;  3P8B B;  3QHS A;  3OYA A;  1VQ7 A;  2DZ9 A;  2FVU A;  4HA8 A;  3WVD B;  3CME A;  4JS5 A;  1VQP A;  3ZBD A;  3CXC A;  2O4X A;  1BIB A;  1WNL A;  3QKJ A;  2IVW A;  3X28 B;  4C5I A;  4BB7 A;  3UDC A;  2LDM A;  2KK4 A;  3MCA B;  1YJN T;  3S3M A;  2EJG A;  3HRU A;  2X4X A;  2DJZ A;  4M78 E;  1VQ9 A;  1G5V A;  4JJN K;  2CYZ B;  2JOY A;  2CS7 A;  1U1S A;  1KHI A;  4C92 F;  3OMG A;  4RCB A;  4PJO D;  1O9S A;  2RJD A;  3PT9 A;  2XDD A;  3CCS A;  4M75 A;  3E9F A;  4X9D A;  4ZTJ A;  4M75 B;  4L5G A;  3QXE B;  1Y71 A;  3FLG A;  3JCM g;  2DXU A;  4LDU A;  3CMA T;  4Y91 A;  4Z02 A;  1YI2 T;  1QVP A;  1I81 A;  5CIU A;  5C0M A;  3UPU A;  4ZTF A;  1D3B A;  2QQA A;  3FIF A;  3JCM f;  3CCU T;  2K57 A;  1D3B B;  2RJE A;  1FX7 A;  1M1G A;  4XK8 E;  1G3Y A;  4IUP A;  4M75 C;  3URG A;  5CKD A;  4HKE A;  3CC7 T;  1X01 A;  1YI2 A;  1VUB A;  2V8K A;  4B9W A;  2E10 A;  1M90 U;  4HT8 A;  4F7U B;  4OMF B;  4Y28 E;  2GQV A;  3R6O A;  2XDB A;  3G6E T;  3X25 B;  4RCC A;  4N0A A;  3JAM E;  3JCM P;  2EQM A;  2XG8 D;  3TRE A;  4CI0 C;  5GAO q;  5AYF A;  2HBP A;  4NS5 A;  1BKB A;  4BD3 A;  3OYL A;  3I56 A;  4PJO A;  1IRE B;  3LH0 A;  2QI2 A;  5GAO l;  3QZ9 B;  4D6W A;  3CCV A;  2GFU A;  2Y4Y A;  2ZPH B;  3L42 A;  3CPW S;  1HXD A;  3VKI A;  3VV0 A;  5GAO r;  3JCM h;  2ZPF B;  5FU6 B;  1U1T A;  1YJ9 T;  3CCM T;  2G3R A;  3JCM X;  3MHX A;  4N0A C;  1QW1 A;  2PQW A;  1VQ4 T;  4IKF A;  2R5A A;  1W2B S;  3QBY A;  2QQB A;  2KAF A;  2PU9 B;  4PJO C;  5GMK m;  3G4S A;  1QVF S;  2LQK A;  4F7U E;  3CCL T;  3CC4 T;  4M7D F;  2OTL T;  1DJ7 B;  1VQ4 A;  3LYI A;  3QO3 A;  3RES A;  4M78 F;  3JCM V;  4BI8 B;  3OYE A;  2QDY B;  1V29 B;  1U8R A;  4IUR A;  3ZEH A;  3OW2 S;  2MWP A;  1G3W A;  3ME9 A;  3QYH B;  4OB2 B;  2YRV A;  2L89 A;  3CPF A;  1ZHI A;  4C5H A;  1WJS A;  1BI3 A;  5GAN 6;  3CCQ A;  4C92 A;  2X4J A;  2X35 A;  3DB3 A;  5D6Y A;  5GAN 5;  5GAN e;  4C92 B;  4IUU A;  3CXC S;  2LNV A;  3HFN A;  1N27 A;  2XI9 A;  4EDU A;  2RI5 A;  1UGP B;  3OYK A;  4X9C A;  3OYJ A;  3OS1 A;  5LJ3 g;  3FEO A;  1S72 A;  3GLX A;  3OBY A;  2PUO B;  3A5Z B;  4M75 G;  5GMK e;  3BDL A;  5LJ3 j;  2QA4 A;  1OZ3 A;  1YCY A;  2ZZD A;  5LJ3 f;  4KUD K;  2LT1 A;  4E7H A;  5DM7 R;  5CVI A;  3P8D A;  3RKX A;  1Q86 C;  4C8Q F;  3J7A F;  5GMK i;  1XTD A;  1K8A C;  5KCH A;  5GAM d;  4E7J A;  2HD0 A;  1Q86 U;  3OS5 A;  2EFI A;  1OYX A;  1K8A U;  2RHU A;  2GFA A;  3MP8 A;  3HKS A;  2DTO A;  2VV5 A;  3SD4 A;  3VYG A;  4F7U G;  1M90 C;  4A54 A;  2BKD N;  2XDP A;  1FXX A;  5M9O A;  2CZ7 B;  4J7I A;  3V7C A;  2P0Q A;  4QW2 A;  3JCM c;  5LJ5 e;  3SDZ A;  1YIT A;  4E7L A;  1BIA A;  3BDU A;  2GCX A;  3JCM W;  5LJ3 h;  2K4Y A;  4PJO G;  3RER A;  1VQ6 T;  2RB6 A;  1XOV A;  3RUX A;  1KQS A;  1I5L A;  4IUT A;  1XNI A;  4O6J A;  3V7S A;  3G71 T;  4XU1 A;  2F5K A;  2XD0 A;  4JRP A;  3UT1 A;  2X4Y A;  4L59 A;  2BIV A;  2CZ1 B;  3GOX A;  1W2B A;  2L8D A;  2FHD A;  4J6Y A;  4XU2 A;  1NZ9 A;  3RKW A;  3OBW A;  1M8V A;  4M7D B;  4M78 A;  5FLX E;  4EMK C;  3G71 A;  2DIQ A;  2XU8 A;  1B34 A;  2JTM A;  3MP6 A;  4M78 B;  2R58 A;  1LOJ A;  4J7F A;  3OYI A;  1VQ7 T;  4C0G A;  4QQD A;  3CME T;  1VQP T;  1ZBX A;  1VIF A;  3A8H B;  3CBM A;  2EKO A;  3G7Z A;  3QPH A;  1GXI E;  3RIR A;  3RMQ A;  3SFM A;  2QQS A;  5GAN 4;  1K73 C;  3JB9 J;  1MGQ A;  1I8F A;  1O75 A;  2EYQ A;  2JNG A;  3PGG A;  1K73 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...