5CCBA

Crystal structure of human m1a58 methyltransferase in a complex with trna3lys and sah
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
289
structure length
282
Chain Sequence
MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGDTSPFRSGTPMKEAVGHTGYLTFATKTPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit
total genus 71
structure length 282
sequence length 289
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5ccbA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ccbA02
5GIOE 3FZGA 1OR8A 2OZVA 3SVZA 3UJCA 4RTSA 1JSXA 2AOXA 2JHPA 2B2CA 5E1DA 2QE6A 2P35A 2GAFA 5GWXA 5E1MA 2ZZKA 3NVKI 1VL5A 1L9KA 4YMHA 3UJ6A 5K8VA 3GRYA 3IEIA 5FTWA 5GP1A 3UJAA 3OU2A 4C07A 1X1AA 1NW7A 3EVZA 3T7SA 4RTKA 1FJXA 2NXEA 1ZKDA 4FZVA 3CKKA 4AZTA 2C7PA 4ER7A 3KPYA 1G8SA 3ORHA 4KW7A 4LWPA 4NECA 4RTQA 4P58A 2IPXA 2NXCA 2O0LA 5B1SA 1XDZA 2Y1WA 4BLUA 1ZG3A 4HH4A 4EKIA 1NE2A 5E2AA 4PINA 3DXXA 1EG2A 2LD4A 2VZ9A 5JUWA 3HCFA 3R9XB 2QYOA 3KQWA 5EOVA 1FBNA 2BR5A 1PRYA 1SQFA 2K4MA 2EJUA 2YTZA 1BHJA 4XUCA 5HFJA 1NW3A 3I53A 1KYZA 2PX8A 2ZWAA 3EGVA 3LX6A 1TPYA 3OZTA 1YZHA 5DM0A 3I64A 2OBFA 1Y8CA 3FYDA 4GOOD 3VYWA 3G7UA 1BKYA 1SG9A 2KW5A 1M6YA 3EMBA 3LDFA 1HNNA 4FT4A 3SMQA 2UYHA 1ZQ9A 4PWYA 1QAQA 5K0FA 2YR0A 1N7JA 3TM5A 1L3BA 3I9FA 3KQYA 5CUQA 4RWZA 5G02A 1RI4A 2R6ZA 3M6WA 5K0EA 3M70A 2CMGA 3GRZA 4Z2YA 2Z6UA 1TW2A 4C05A 2BM8A 5FWAA 2AN3A 3K6RA 2A14A 2B9EA 2BR4A 2JHCA 2P3LA 3B3FA 1QAMA 3E23A 1X1DA 3MCTA 4PYQA 4R8RA 5FQNA 3THRA 5K0BA 5EHIA 3QV2A 3GU3A 4FGZA 3HP7A 1UWVA 2HTEA 1P91A 2NXJA 1N7IA 1KP9A 2B78A 3LBFA 2UYQA 3KQQA 4V0RA 1HMYA 1WG8A 1IXKA 1QAOA 3BWCA 3DXYA 3ELYA 3G2QA 3PX3A 4RSRA 2HMYB 1R18A 5HIJA 3PVCA 4CTKA 3C6MA 5K0LA 4DZRA 3B89A 2AN5A 1EJ6A 3HVHA 3KQPA 3RODA 1DUSA 2ONZA 4QPPA 5E8JA 5KS2A 3O7WA 1WXXA 1XJ5A 4KDRA 3F4KA 2P7IA 5LQNA 2C7QA 3KKZA 5BP7A 2FRXA 1VP9A 1XDSA 1YFJA 3QOWA 5F2KA 2FK8A 1V39A 5EEHA 2AVDA 5GM2A 3X0DA 4CTJA 4MHTA 3PT9A 4K6MA 1VP3A 4YV1A 1L3IA 1KPGA 2ZBPA 4KVZA 3EVGA 4C08A 3AY0A 5DTRA 3FRHA 3LCUA 3LCVB 4YUXA 4BY9E 1N2XA 3BKXA 4POOA 2FPOA 2ZBRA 3UJ8A 4C04A 4RTPA 2YVLA 1XDUA 2AOUB 2ZULA 3VC1A 3KQVA 1JG4A 3AXSA 1ORHA 1JR4A 4KDCA 3RIEA 3E05A 5EMLA 4DM3A 2JJQA 1F38A 2ZIEA 5IKMA 3G2PA 3GCZA 2IDKA 4RVHA 2G8NA 2ZIGA 2PY6A 1VBFA 5EKUA 4PYMA 3JWIA 5K01A 1VQ1A 3FUUA 5CVUA 5C0OE 4DCMA 3L8DA 4M37A 2Y1XA 3IYLW 2BZGA 3P9CA 4E30A 4PYKA 4EKGA 2UZ4A 1F3LA 4GF5A 5DT2A 1RI3A 3NWEA 5GOZA 3TKAA 5FQOA 3TLJA 1XCJA 4RVGA 4HRAA 1Q0TA 2ZCJA 3OCJA 5EIFA 4ER3A 4AZSA 2YXEA 2BM9A 3M4XA 3EVAA 3G89A 1RJDA 4BP3A 3C3YA 3NVMB 4P7JA 3IHTA 2AOWA 2IH4A 2ZZNA 2PXXA 4QQNA 5K0CA 3EGEA 2YX1A 3B7PA 3CCFA 4R8SA 3UWPA 3TQSA 2AOTA 3FYCA 3NTVA 2PX4A 4OQDA 5F2OA 2O05A 1G60A 4BLVA 2WA2A 4ER5A 5HIKA 5LQKA 1VPTA 1U2ZA 3IV6A 4IV8A 3HM2A 3D2LA 2P8JA 4QVKA 4BLWA 3EGIA 3BWYA 5DTMA 1DCTA 3FPGA 2GH1A 3RW9A 4ISCA 3NJRA 2ORED 3UZUA 4R6WA 5EVJA 2IP2A 3JWHA 4QTTB 2O57A 4M38A 4EQZA 2PV0A 2AOVA 3A25A 3JWJA 3OFKA 5DM4A 4QVGA 2CL5A 5CD1A 2VP3A 2AOUA 2JH9A 2NNWB 4GUAA 4IWNA 5FUBA 3SXJA 2PX2A 2AN4A 3GJYA 3G5LA 2ZVJA 1O9GA 3TM4A 4YUYA 5CVEA 4U7PB 5C1IA 3P8ZA 4GC9A 4PNEA 3SR4A 5LSAA 5E9QA 3GRUA 3M6XA 2PLWA 2XVAA 4AZVA 1VLMA 3LSTA 5F2NA 2IBSA 3HA3A 3CBGA 4RTRA 2YUIA 5DX1A 5DXAA 2FHPA 4M36A 3TR6A 2FYTA 5EPEA 4KIFA 3KQOA 3FUTA 3PS9A 3P9KA 5EMMA 5ICEA 3I5UA 2ZWVA 3KPWA 4WXHA 1BOOA 2HV9A 5FHQA 3MQ2A 1JQEA 3GXOA 3EVFA 3FPFA 3DLCA 1KPIA 5EZQA 1TW3A 3TPZA 2NP6A 4PYIA 5H02A 5DSXA 2IIPA 4OX9Y 2BH2A 1FPQA 2P3QA 2GPYA 3CGGA 5LQCA 4CKEA 2XYQA 1EQAA 3T7RA 7MHTA 3P2IA 5K0JA 4OBXA 2I7CA 3S68A 5CIYA 3FTEA 2QY6A 4RVFA 5KQSA 3H2BA 3WSTA 4HTFB 3FPHA 3LDGA 2C7OA 1INLA 3QOXA 2NP7A 4QDJA 3UA4A 3MTIA 1MHTA 4L7VA 5E9JA 2PWPA 2AS0A 3FRIA 3AWIA 2IH5A 3GNLA 2ZIFA 4IV0A 1QZZA 2PT6A 1SUIA 3BUSA 4CWAA 5HZMA 1X1BA 4RTNA 4X60A 5U4XA 3DOUA 5EHGA 5EMJA 1NT2A 2EG5A 1M6EX 2Z6AA 2VDVE 2EJTA 3JWGA 1AV6A 4O29A 1YZ3A 4A6DA 1I9GA 4OQEA 4ATNA 4EMSA 1XXLA 1G6Q1 3B3GA 4WVLA 2IBTA 5EQJB 2GB4A 2XVMA 3C0KA 3VSEA 3P9NA 2YQZA 3PLAE 1KYWA 5D1HA 1I4WA 2EFJA 2UYOA 4RVDA 4XUDA 3OZRA 5EG5A 4RYLA 3MB5A 2FCAA 3CVOA 4LG1A 1AF7A 4MWZA 4ER0A 3HCDA 5JR3A 2OB1A 4KWCA 5FADA 4DA4A 1JTEA 3I58A 1WZNA 5CVJA 4P7GA 5EIWA 2AVNA 3KR2A 5DTQA 3SGLA 4GEKA 4RTMA 1KPHA 4FS8A 4X61A 1JG3A 4MQ4A 4YUZA 1NV8A 2BR3A 1QYRA 3HVJA 2XYRA 4UOEA 3B3JA 5BW5A 5K09A 8MHTA 3OE4A 4AX8A 2JHAA 2ZZMA 9MHTA 2QRVA 1NBIA 5T64A 1X1CA 1ZGAA 3AJDA 1YF3A 1P1BA 3CJRA 3LDUA 5CCBA 2CMHA 5DX0A 3OU6A 5E8RA 2DULA 2ADMA 5E9WA 1FP2A 3CJQA 3GRVA 3OE5A 1M0EA 2PVCA 3E8SA 4FR0A 4M7RA 3UJBA 5FULA 1JQDA 3KPJA 3PB3A 5DRTA 4G56A 5LQUA 3PFGA 4EVIA 3HCBA 3BGIA 3V8VA 5P8WA 1NV9A 2PT9A 3EPPA 3GWZA 1P1CA 5FA8A 3HVKA 3UJ7A 4BP1A 4C06A 2ZFUA 5ICGA 2PWYA 3FPEA 3KQTA 1O54A 2H11A 5GINE 3AXTA 3KQSA 3P97A 5DPMA 5ICCA 2XBMA 1H1DA 1X19A 2VDUE 4OA8A 3C3PA 1IY9A 2H1RA 3OU7A 2OB2A 4GC5A 3B5IA 5DSTA 2VS1A 3R6TA 2HR1A 5KVAA 1P39A 5C9ZA 4OBWA 4YV0A 4QQKA 3V97A 1NW8A 2G71A 3DMFA 5DM2A 2PXAA 4HC4A 4P7KA 3PFHA 4X63A 2OXTA 3GDHA 5FCDA 5HIMA 2V74B 1XTPA 2G70A 5FHRA 3ER8A 3DLIA 3CJTA 4V0QA 1NW6A 2PKWA 3U81A 3KR9A 2OPBA 3UBTA 2I6GA 3A26A 1KIAA 4E33A 4CKCA 2VDWA 4EK9A 5ICFA 5BXYA 5K0GA 3OPNA 3KR0A 4RTOA 4KIGA 3EVBA 4DCGA 4B17A 1NKVA 2PSSA 1EIZA 2WA1A 2GLUA 2DPMA 1AQIA 3HNRA 1R74A 3EMDA 1JG2A 4QTUB 3UA3A 1G38A 2B3TA 2CKDA 2P40A 1SKMA 3BWBA 4PONA 1RJFA 4DMGA 3G8BA 5DM1A 4C03A 3KHKA 1UIRA 2V7EA 4MIKA 3HCEA 4FSDA 4DF3A 4AUKA 1VIDA 3TMAA 2O06A 3LL7A 3R24A 2QRVB 4GOMD 4CKBA 4RTJA 2OYRA 4DKJA 2OY0A 4PIPA 2ONYA 1EJ0A 3G5TA 3MGGA 2ERCA 2CWWA 2ZLBA 3BWMA 3BKWA 3GGDA 4E31A 3EVDA 4FP9A 3T7TA 5GIPE 3HEMA 5M5BA 3ELUA 3LBYA 4E2YA 3BT7A 5LQJA 3DR5A 2AOTB 2IDJA 3GIWA 3LKZA 4A6EA 4F85A 3KPVA 5DLYA 4JXJA 3G2MA 3FUXA 2GA9A 3GO4A 3PX2A 4LWOA 2AR0A 4OA5A 5EKXA 4PYJA 3PTAA 2B25A 3EEYA 1WY7A 1MJFA 3DXZA 3ERCA 1DL5A 3LGAA 1Q0SA 1R6AA 2I9KA 1D2HA 3ME5A 2UYCA 1Z3CA 1EAMA 2HWKA 3EVCA 3G8AA 3K0BA 1JTFA 3TRKA 4CXMA 3DTNA 1NW5A 1BC5A 2O07A 2ZBQA 4HTFA 5EC8A 3KPUA 4LECA 2ZTHA 2P1DA 2NYUA 4HSGA 2QM3A 3M6UA 3A27A 2R3SA 4DQ0A 4PGHA 2JG3A 3M33A 4R05A 4Y2HA 5HOQA 3MHTA 4RX1A 10MHA 2PJDA 2WK1A 5E1BA 3BXOA 5EEGA 5T6BA 1R8XA 2EX4A 3HCAA 3MCZA 5DXJA 2ZW9A 2PBFA 1YUBA 4PGGA 1JQ3A 1PJZA 3HVIA 3FUVA 3T0IA 3OZSA 3A7DA 3TOSA 3A7EA 3MERA 5HILA 4XCXA 3TFWA 4F84A 4YMGA 5LR6A 3FTFA 2PXCA 4YUWA 1WS6A 3REOA 1YFLA 5LQAA 2PGXA 3Q87B 4GOLD 1B42A 3BGDA 2H00A 5FA5A 3ELWA 2AZTA 3CC8A 3DMGA 3LCCA 3O4FA 4RTLA 1XCLA 4YUVA 4X41A 1FP1D 5GM1A 4PYLA 3UJDA 2GS9A 3P2EA 5DX8A 3EEOA 1RI5A 3P71T 1R00A 3FTCA 3HA5A 5BW4A 4P7FA 1T43A 4PIMA 2YXDA 5MHTA 4C4AA 3G2OA 3FTDA 3DMHA 1ORIA 4RV9A 2P7HA 1RJEA 3A4TA 4GOND 1RI1A 1NBHA 4E2ZA 5E1OA 3DH0A 3SM3A 3EVEA 4QPNA 2P41A 4YV2A 4H0NA 2NXNA 5EGSA 3SSMA 5EZSA 1O9HA 1R8YA 1ZHFA 1G55A 5IH3A 1ZGJA 2Q41A 1SQGA 5KYGA 3M6VA 1L1EA 3C6KA 1I1NA 2N47A 3NW9A 4HG2A 4HGYA 3BGVA 3UJ9A 5KQRA 1VE3A 3ID6C 3ER9A 3G88A 1D2CA 1QANA 2G72A 3ELDA 3R0QA 2FK7A 5CVDA 4E2XA 3P2KA 3P9IA 5LQRA 2XYVA 1JSZA 2F8LA 1JG1A 2Z6QA 4KRGA 5CVVA 3KR1A 3LPMA 4ER6A 1AQJA 5D1NA 5K0NA 3SSOA 2ESRA 4IKPA 1IM8A 3KU1A 2IFTA 5EMKA 2PX5A 3THSA 2G1PA 1RJGA 1L3CA 4PYOA 3GRRA 4PYNA 1YB2A 3DUWA 5HIIA 1UFKA 1G8AA 2JH8A 2I62A 4QDKA 4U7TB 4Y30A 2ZSUA 3MTEA 5FWDA 3ANXA 4MTLA 2E5WA 4GBED 5ERGB 3LECA 3FUWA 4E2WA 3DP7A 4E70A 3MAGA 5DRYA 1KR5A 1WXWA 3NDIA 3SX0A 3LHDA 4E32A 2YXLA 4FSXA 5CM2Z 4R6XA 3O31A 1SUSA 5K05A 1KXZA 4HGZA 2HNKA 3TKYA 5K03A 4ZTBA 3HTXA 5DWQA 2P3OA 3E7PA 5HEKA 1XVAA 5CCXA 5E2BA 3OFJA 2C7RA 3NMUF 3NWBA 1SVUA 2IGTA 3Q7EA 4PCLA 4XUEA 3NDJA 3KQMA 1KHHA 3VC2A 4F86A 3BZBA 1D2GA 2OKCA 4FT2A 3R3HA 3UFBA 3HA7A 3SSNA 4GQBA 5T67A 4AZWA 2IH2A 4X1OA 1RI2A 3HCCA 3DULA 2OO3A 3LKDA 4PCAA 3FPJA
chains in the Genus database with same CATH superfamily
3I4FA 4QYWA 4TUYB 4TTRA 5JXWA 3H83A 2RK4A 1J8VA 2A5JA 2B2CA 1DBPA 4ZI7A 1ST3A 2OD7A 1Q20A 4I55A 1EGHA 5DYGA 2CYBA 5K8VA 1A9PA 1CB7A 3QOFA 3AL2A 4BV3A 3EZ7A 4HDNA 4OXRA 4PLFA 2NPOA 4RMGA 1NW7A 2Y66A 2CUTA 2HYIC 3DMRA 4JP5A 3PTLA 4EB6B 1ZKDA 1HTTA 2K5UA 3QELA 1CUJA 2AI2A 1HEYA 5FPHA 5JXGA 1SJ9A 2A9PA 2SKCA 5IKPA 1IN8A 4OUKX 5G1PA 2J33A 5GQSA 2HHJA 2N42A 4BLUA 3RFTA 2R7NA 5KMGA 5KYKA 2G5GX 5IJ9B 3OT5A 4ENTA 1PX0A 1XRJA 3H19A 4GMXA 3VSCA 5HA5A 2XYGA 1H2XA 3LT5A 3KQHA 1CYEA 3V80A 4BCBA 1VA4A 4FX5A 3MRXA 2O2IA 1BKYA 4PX5A 1AV6A 3KOWA 1V4BA 4N0DA 2FE4A 5AVJA 3CUEF 3WYGA 5A02A 3MGBA 4J03A 1RQLA 1M8KA 2J5XA 5AKJA 4DDMA 4RWZA 1WSDA 2XMQA 2VZLA 1T6NA 3OC0A 1LPBB 2VO1A 1NQXA 3W7BA 1L8XA 4C7MA 4ARAA 2R9VA 1SCQA 5ALFA 4M0CA 1MU0A 3ADCA 2A14A 2NV6A 4OOFA 4EY7A 2GD6A 5CT9A 5E6SA 3UK6A 1F60A 1T1IA 3CEMA 4G1UC 4FGZA 4AWBA 2CFOA 2QTVA 1Y1LA 5AM4A 4NCXA 3U6KA 2M6RA 3PIRA 1N7IA 1Y7TA 4H6XA 1DAHA 4RENA 2H1IA 4Y2JA 1KH3A 1LSOA 3DZFA 1XZFA 4BECA 1KZYC 1UKEA 3BDVA 3MWEA 3WRVA 5JZOA 1IE3A 4F60A 1HZZA 1UJ4A 3UC9A 4G5RA 5DW0A 3EPRA 2WNIA 2UU9B 4NU6A 5CMLA 5AXAA 4N5DA 1BOFA 1IBSA 3JPWA 4OKNA 2FQXA 1JTVA 1YVUA 3IA2A 4DWJA 1DWOA 3KYCB 3I39X 4RIHA 1K4MA 1UM9A 4U2FA 3ROZA 3BWEA 2FOLA 3EEFA 5IAGA 2GCNA 1J70A 1CYDA 4K6KA 4LDNA 2DFNA 1JU4A 3WHKA 3EAGA 1W5FA 2Y1DA 1EPUA 1N57A 1P72A 4YV1A 5TPZD 4C08A 2IXGA 2B83A 1NUTA 3NPAA 3CIFA 2D1YA 3MLAA 3QI2A 4N54A 1W93A 1Z62A 3DBRA 2NU6B 3D7KA 1B1CA 5TQ2A 3U7QA 3VFDA 5FP0A 1CY2A 1RYHA 2XVZA 1KA9H 3BXGA 4YP9A 2PH7A 5IUKC 1UJBA 3SY8A 1UBNA 2JJQA 1IJEA 4Z0PA 1L5GB 2B69A 2Q8NA 4IPTA 2W6MA 5IC6A 4DCUA 2O8BB 4Y2VA 4NICA 3QJYA 5TF4A 5CVUA 3I6BA 1RCUA 4O5OA 3UGQA 1KWGA 1EFRD 1N2JA 1XZ8A 3G6WA 4KH0A 1J2EA 2HIMA 4LI3X 2EWWA 1P0FA 1BJTA 3ZUPA 2ZI3A 3D54D 3TLJA 5AJZA 1HV8A 4TMXA 3V48A 2DR2A 3OH8A 1SC4A 4KQJA 5BYBA 2YJTD 2B8TA 2FMHA 4CMIA 2X0RA 2C5BA 1A9TA 1ZU5A 2HHCA 3AUSA 3L84A 2EDCA 1ZI6A 3OLCX 3FSJX 3PUYA 4KMOA 5BYJA 4EG4A 5IHPA 5IZCC 3NVMB 2WJGA 3H9EO 4MRPA 1R27A 2WSMA 3MEQA 4MRRA 2ZUCA 3ZZUA 1K08A 4A5OA 2ZROA 2ZYAA 2P9GA 3KO8A 1ORDA 1XQXA 2C5EA 3OX2A 3KZXA 4J2HA 3ZDXB 4BQQA 1MJHA 3B85A 3OQJA 3UWPA 3FYCA 4KWHA 1QHHA 1MVOA 2AJLI 1ZEMA 2AG8A 2Z3ZA 5I9SA 3C3JA 3QELB 3ZE2B 4LVOA 4C2BA 2EKDA 3OIDA 1H22A 3JYPA 4OCZA 1Z83A 3QIVA 5CW1A 5AXBA 3RC3A 1DNPA 4AWAA 2PVPA 4PNZA 5CX1A 4EI8A 3FPTA 1CQIB 2JARA 2XDAA 1QVVA 5GY7A 4LY3A 3LSYA 2RGNA 4AY4A 2PSEA 5LBTA 1G42A 1CBUA 1UBSB 2GWRA 4G09A 4LBYA 4MW7A 1IY1A 4Q48A 4BKPA 4CFZA 4H1WA 3DP9A 3IMKA 4CM5A 1YVRA 2AN4A 4YMLA 4HRYA 2ZYWX 3F3YA 1E1RA 2HF8A 3EJWA 5FWXA 5C1IA 3R5XA 4PNEA 3IQGX 1IXZA 1N6LA 3SJ7A 5B6IA 3A2LA 3SG0A 5L95A 1E0AA 1RW4A 5HQ3B 3HABA 3P19A 2ZUWA 3HA3A 1GZ6A 2Q1CX 1K8QA 2XNCA 2EGGA 1SQ6A 2GSWA 3T52A 3TR6A 4D4JA 1HWYA 3MYRA 2DUNA 2P69A 3CA8A 2XBUA 3I45A 4KE9A 3U4QA 1FK8A 1CEQA 4K40A 1FRFS 4AK9A 5KTPA 3QEJA 1N2SA 4AJHA 1NVVR 3DLCA 1X42A 2LDBA 1TW3A 4ACAA 1UBMS 3TZBA 4DSNA 5TDHA 2Q18X 3FIJA 3B6IA 4YGXB 1RCFA 5CFRA 5AW7A 1E2KA 3NC1C 4GWKA 5JMTA 2QY6A 1TKBA 2BI7A 1ZGGA 5IKEA 1YIDA 3SC6A 1AK1A 5DBIA 3MFQA 4L7VA 2PWPA 2AS0A 4RZUA 1O2DA 1IHYA 3T7AA 1OI2A 2A59A 2ZIFA 3TQFA 4XIFA 2ZYTX 3NXSA 1QIHA 1TF2A 3NC4A 4WGFA 5DHTA 1JHQA 2ZXEA 1DRWA 4B5LA 5HS6A 1QK5A 1T0PA 1NT2A 4MCHA 5GGXA 1XOIA 4C1NA 2FP4A 2HQOA 5DV9A 4B6EA 2IV2X 4R5MA 3ZHSA 2DY0A 3HWSA 2XGJA 2WNSA 3DAHA 2CXOA 1V7PC 2XVMA 4XWAA 1UXGA 4LJYA 2E7ZA 1GNVA 1MJ5A 4LXGA 4OQDA 1XA0A 1M8PA 1QOZA 4L51A 4X0EA 3ENQA 5BNZA 2G76A 2ZSDA 4OV6B 4UTOA 4B3RB 4WGGA 4U3JB 4MW4A 3PWZA 3HCDA 1TM7E 2W8ZA 4KIUA 3OJLA 3IO5A 4JNKA 2O23A 5K6TA 5A9RA 1EFRA 3TSCA 1PZGA 1N9GB 2DGDA 1H66A 2JAQA 1JG3A 3MM4A 4B32A 5I3ZA 3I9KA 5ED4A 1XZEA 2AXNA 4KIJA 2BR3A 3BWXA 5HYVA 1AKEA 1HE8B 3RTGA 4JP3A 1NRWA 3A1SA 4BMOB 3L4EA 2CLHB 4D80A 5K09A 4PQGA 1TECE 3OF5A 1QGYA 1C0PA 1FVOA 1REQB 3USCS 3W90A 1D09A 1XKXA 2QTLA 4JU9A 3ZZTA 2C3YA 3OU6A 1J00A 4MQMA 1KDVA 5E9WA 5ECGC 1GQYA 3GFTA 5U1PA 1QJCA 3OJXA 4BMZA 1C30B 4TS9A 2XMPA 1X13A 1GT6A 1WCWA 1GDHA 4D99A 2YXNA 3EQ6A 3GG9A 4LRYA 4Q16A 3QXXA 5JI2E 4G36A 4Z6KA 1Z2DA 1EFTA 2QTAA 3FHCB 4XQGA 4LSGA 2H1WA 4Q82A 1DKPA 1HXHA 3FAKA 3NHUA 4HAWA 1ZJZA 4TTIA 5DZSA 4RK1A 3ZE1B 4CMGA 5KWEA 4JKIA 1WW2A 2PSFA 3OZCA 4EITA 3AUYA 3K8ZA 3FPEA 5H5JA 3CURA 4RHXA 4MKFA 1KE2A 5KKNB 3LQFA 1XZJA 1QYWA 2P4SA 3MT0A 1PE0A 1NJFA 2VDUE 4R84A 1P74A 2DAPA 4JBIA 5KC9A 3QSYA 1STOA 1V16A 3L7IA 4KEAA 4JUBA 4H2DA 5FLKA 3AEYA 4I5GA 2CNWD 4EJ2A 1VLZA 5K4GA 5EFOA 3AEUA 4HC4A 3D7RA 3M2PA 5JS2A 4UMDA 5M29A 2MR5A 3D02A 4J9UE 3NYIA 4H18A 4ZV9A 4AS2A 3QMWA 3TL6A 1FRZA 5CGZA 2PGDA 3DLAA 1MAWA 2RK6A 5TMBA 2YFYA 4BTVA 4QHSA 2CNOA 3A26A 1E6WA 2HY7A 3EF3A 4CKCA 3BH7A 1Q50A 2PYZA 1AKVA 1XHEA 3HNOA 3M5WA 3ZLUA 2PSSA 1S3SA 4QODA 2OORA 2X5NA 1MJNA 1T13A 3MELA 4BFUA 1Y1KE 1SXJE 4XQCA 2BTEA 1Q1ZA 4D6PA 2DHEA 5LDGA 4G8JA 2XB9A 3RYFB 5DSZA 1WPGA 3L6BA 3C43A 1K5DA 2XE8A 4AIRA 4RFVA 4EPTA 1Z56C 4D9HA 2FQYA 4AQYB 2OFPA 4RKYA 1QZTA 1FDTA 2MYTA 2XDYA 4O4LF 2CY0A 2XMSA 4OREX 4W1RA 5ESRA 2AFVA 4KXUA 1J5XA 2JGDB 2WEKA 2XVXA 5A5EA 1Z6QA 1QIJA 3R3UA 2IGBA 3BDAA 4KKVA 1XWFA 4U7HA 5B36A 2PJZA 4E31A 1OXSC 3QWBA 1EFDN 1VJCA 3DMDA 1ORTA 5A4MS 2R1TA 1GVNB 2EZ4A 4G1FA 4A23A 5JCZA 4JT8A 3J81A 3KEOA 1GNSA 4UUPA 1PR2A 4G8CA 2VHQA 4BX3A 3BT7A 3H6GA 1II0A 1AF4A 4JI2B 3QHQA 1Q22A 2VF2A 2VHYA 3HACA 4ZVOA 4JXJA 3GD5A 2FRVA 1QFSA 1YZNA 1GSHA 2AFIE 3FUXA 3JXEA 1E2LA 5F4BA 4C4RA 5KOJA 4FNMA 5CCEA 1OH7A 2VAVA 2RAVA 2PR2A 2QTFA 2ZYVX 4RELA 5F1KA 3FPSA 1W87A 4GNKA 3QWZA 1Q0SA 4GPEA 1YT5A 3MS4A 1U11A 4LQ4A 2BGJA 2XMRA 3K0BA 5EJIA 1CVLA 1JVSA 1UMKA 1WXFA 2C9BA 2XOKD 4LJAA 5EGNA 1ZL0A 3EXIB 3STVA 4BNIA 2P30A 3NYQA 3NDBB 2B5VA 2ON6A 1N2BA 3NBZC 3E7DA 2F9LA 3U09A 4HPWA 5K8IA 1AS3A 1KI6B 2Q9CA 5JU6A 4Y2HA 1UM8A 2QLNA 3UT5B 1W85B 2BGTA 3O74A 2WK1A 5EWJB 2PZBA 4ZOLF 5J5VA 3WB1A 1AQUA 1DPFA 4O5AA 5CT8A 2C98A 3DE1X 1ECFA 4QOJA 5I5EA 1J0AA 1KYVA 4PPNA 1O1YA 1UP6A 3IILA 4W5WA 2BFFA 2FWNA 1RKVA 2P11A 4BGUA 5IWCA 4Y9TA 1H4QA 1JIKA 3WHIA 1F9AA 1KDPA 4BDTA 1TFUA 2ZYRA 3WLFA 3CC8A 3UF0A 1XTRA 1CUZA 5JBQA 2QGNA 4NDNE 5KHAA 3ZGZA 5LD2B 3GOHA 4WH0A 4LNUA 1IJKA 4W7HA 2H7XA 2AGVA 2IA5A 2WYUA 3H7IA 1YTLA 5DX8A 5B1HA 3UATA 4KSBA 2XHZA 2QD1A 1FVHA 4G23A 1BD4A 3SIWA 4KPFC 1XN4A 3U7JA 1KFJB 2IYPA 2V1XA 1BGWA 2WWFA 3OCZA 1CDEA 3U62A 1MIHA 2WINI 5SYMA 1Z38A 1TYAE 4NHOA 1TO6A 2P7HA 3L0IB 4JJ8A 4PLCA 5AM1A 1E77A 2VNHA 3U80A 4L5CA 2CDAA 4M9CA 1LDGA 1DMSA 4CV3A 4S12A 1GRNA 4FZJA 4HQ6A 5D3ZA 3AJEA 3MWYW 4H3HB 1O9HA 2ZSAA 2ZIVB 3DGEC 4URFA 4DA0A 4Q3OA 3EGCA 1U3WA 1RZVA 2QZZA 1AB6A 2H0RA 1CUGA 5JEEA 4TTPA 5H81A 2G72A 1FFEA 2O0KA 3G79A 3HSYA 3IELA 3NHFA 3R0QA 2MMGA 1QRAA 1JX6A 4IYRA 5B1IA 3KQLA 4GP7A 1JG1A 3U4CA 3HJFA 5T3YA 2XJ9A 4Q39A 3VBEA 3OZIA 1Q92A 2IHKA 1E0DA 3BF7A 1H2ZA 4ER6A 3KZ1E 1F2UA 2H1OA 1BRTA 3OURA 4RMJA 3KU1A 4K9NA 2F55A 3EWNA 3ETDA 1SVLA 4FFSA 3HUUA 1I1OA 2PZLA 4LX0A 4PYOA 1ZMBA 3UPTA 4YX9A 4CCYB 3DZDA 4S1NA 4YJFB 2NW6A 2DKFA 5DHPA 3GY0A 4NYMR 2Z4RA 4X95A 5F76A 4LY0A 4G3XA 4PO3X 3UYKA 1TK2A 3VTZA 2A86A 4ABYA 1A8UA 3O5AA 1D4OA 4Y67A 2C3MA 3RUPA 2VT2A 4OB7A 3AF6A 4ZTUB 1WXWA 1Q7RA 2Q5OA 3I2YX 3SHVA 1SHTX 2GPSA 2IWHA 1NUSA 3NRJA 2WJ4A 2HWWA 5KBYA 1V5WA 1N7GA 3IE1A 3KQUA 3PFNA 2HNKA 2BSQA 2O8DB 3QENA 3LCRA 4ZTBA 1ZGHA 1C7JA 4O4HF 1X9GA 2P3OA 2RBKA 3EOAI 3M5CA 4J0DA 3DV0B 1GZ3A 1XK7A 4L2IB 3NMUF 2PUEA 5AW1A 4KTVE 4XQ9A 1X1QA 5SZIA 3TZ6A 2C4VA 2PRSA 4MS1B 2NTEA 1RJ9A 3PC3A 1ODTC 2W9XA 2GKOA 3OQPA 2B5OA 3AB7A 3D7SA 1FNMA 3II6X 5JATA 3VH3A 5GIOE 1BXRA 3DB1A 3JD2A 3MLBA 2Q2OA 3ZIDA 4BOYA 5ITSA 2FDRA 3G2KA 4BRWA 2B36A 4N8EA 2W7TA 2XNHA 5DBGA 2ZPAA 1KH1A 2NVWA 3HRHA 5DOZA 5GP1A 4BAZA 5H0IA 3SQNA 3ZW7A 3BBLA 5A5VA 3BTOA 4NEHB 1PQYA 5E3JA 5EMHA 5AVYA 4JMLA 1MOZA 4NG4A 1U8CB 2GN6A 4IIEA 2GESA 2FKNA 3F6RA 2WE8A 1QO9A 1FMTA 4OP3A 1M73E 4JCOA 3ETNA 5EJ7A 2R8PA 2WP0A 2XCIA 3IAS6 3LXMA 4DJ5X 1LLUA 2O0LA 1WMEA 4IIYA 4HK4A 4FMCF 3P2YA 3BICA 3EWAA 5A4KA 2B1RA 3DXXA 5FBKA 5JUWA 2GPBA 5LLSA 4BC1A 2QYOA 1M6NA 3D1JA 3TPCA 4HZIA 2LKCA 4EA8A 2WU3A 3LOPA 5FOWA 4D7AA 2DECA 3CMMA 1KAEA 4BX2A 1W59A 2YH2A 4EHIA 5C3UA 1UBKS 2I4LA 2ZWAA 5D87A 3VKWA 3ESAA 3BMNB 4COKA 2V0NA 1PR4A 4MYUA 2OBNA 1VJTA 2DRIA 3EMBA 3LDFA 4F56A 1FX1A 2UYHA 3DZKA 1R6XA 4UNRA 4P0PB 1CNMA 3IT0A 1HF3A 3EIXA 1DRVA 1XAGA 3NJ8A 3ODPA 1O58A 3EXG1 3ND9A 3IR5A 4WL0A 3D64A 4YRTA 1M34A 2Z5FA 4H7IA 4EUSA 2P27A 4C2AA 2XVYA 1D8AA 4ZXFA 2B9EA 4ALKA 1G4HA 5C8VA 1I3NA 4FFNA 2JBWA 1XJWA 4BN5A 2H52A 5EIAA 4F4CA 5LMUB 1EP1B 1YI8A 2HMSA 4BGVA 3IIIA 1R4NA 2C07A 3PD0A 1NVXQ 1WB6A 3DE0X 1O0SA 2ODQA 3GQVA 1CY6A 1VIYA 5EJ5A 1MB3A 4NNPA 1P1IA 4RSRA 5FUXA 1N5KA 4M9UA 4N7JA 4HXFB 2OORC 2C1XA 1M2OB 3D5QA 2HMAA 3NNNA 4CTKA 5BYAA 1E20A 4NE9A 3V8RA 1C4KA 1Z63A 1VPWA 2NVUA 3Q72A 2J30A 2H9IA 5AOCA 3R5JA 3NM5A 4MR9B 2VDWB 2QMHA 4IIFA 5BOSA 2PBRA 1YMQA 3P0JA 3L79A 5LQNA 1T34A 3TEMA 5J1SB 5I7SA 5B7GA 3CB4A 2W71A 4KVZA 2RI1A 4PSAA 4WADA 1T3SA 1WIWA 3LCVB 1W1UA 2C2BA 4LTNA 2FB9A 4RDIA 4A0SA 4BY9E 1GA4A 1ZC4A 3I1FA 4RF4A 3ZI4A 4O4HA 1UXKA 2RGBA 4PGFA 5HGXA 1LZLA 1W36D 2DTXA 4A8JB 2RB5A 1N34B 2QRNA 3AHDA 3VHXB 1BMQA 3CCBA 1UFQA 2QMYA 1D9XA 3DDHA 4RSHA 5LBUA 2ZIEA 2AWNA 4KNVA 4B09A 4HNSA 4X7RA 2IDKA 4CG0A 4OY3A 3BMQA 3W7AA 2SHKA 1NUPA 2R6R1 3QI7A 1T2AA 3OF3A 3U7FB 2H7VA 1QCCA 3WRWA 1ZDMA 5ALNA 3OMLA 3WWCA 3IRUA 2BZGA 4KX5A 1ZINA 4G1EB 4GF5A 2GEVA 3FKSA 1S5PA 1TQ2A 4HRAA 2ZIXB 4TL9A 1EP2B 2WD7B 1TAGA 5KDLA 3ZWVA 5AKHA 3GJ7A 2OUKA 2ANBA 5FBLB 3OEED 5BR7A 2QMUA 1HQKA 5GONA 2Z08A 4DL9A 3O38A 1X7HA 3TX6A 3OLQA 4MSUA 3JW8A 2BFCB 4KQ9A 3KZVA 4ZHQB 1X3SA 2O9JA 2WVGA 4AUNA 1AOXA 3HRKA 4MW5A 3K92A 1VI6A 4JYMA 2R48A 4H4DA 2FPKA 1CJTC 1M0SA 1VKZA 3WGKA 1KJ9A 4MI1A 5IJXA 1NC3A 2FF5A 4I99A 1V8DA 3FOWA 1QH8A 1GN9A 5AOAA 2VUUA 4MUMA 4YJGB 2IZ6A 1O6FA 5EJFA 4CTNA 3ZPXA 3BSFA 1EQ2A 1T36B 3EA4A 4BC0A 1SHKA 5EZ5A 4ND5A 2Z8YM 4UD2A 1I6MA 4IRMA 4WI1A 4YJHA 5DTMA 4BLWA 2EKLA 3ZI0A 5A5GA 1J1UA 1YKSA 3E35A 4A0QA 3UZUA 4GMFA 4HXGA 2OLJA 2FSUA 4B0OA 3ANSA 3QNMA 1FPMA 3ZHYA 3WNDA 1OXUA 4IAOA 4YPVA 3GPCA 4F1KA 2G9QA 3L04A 2JIDA 5T5QA 2JH9A 1WHTA 2GXUA 4W9MC 3GJYA 4XR4A 1EVLA 2QZ9A 4HNRA 2OAQ1 1JMYA 5J9FA 2Q6IA 5JAOA 1A69A 3FPKA 3O91A 1X8XA 5EPUA 3DBOB 4RD6A 1J8DA 1JXOA 1DIHA 3M2TA 1JLLB 1N0WA 3FROA 4GR4A 4WN3A 3IKJA 4ZCLA 3WLLA 1YRHA 1OWOA 3JR3A 1E92A 2D2XA 2LIPA 3K0CA 4N1AA 5DGHA 1RWNA 1AS2A 5EWJA 1IN5A 3FPFA 1QTQA 4IOMA 1KY4A 4Q18A 2QN2A 1HRKA 3N1UA 4RPGA 4OX9Y 5SZJA 1RWMA 2EKQA 2GPYA 2NUBA 2ES4A 1T9GR 1WVIA 3LPCA 4FDVA 4R68A 1RTTA 4XD2A 1A8HA 1ECJA 1OW3B 2D5BA 3A4VA 5DN9A 5GJWC 4TOIA 5FPYA 4WLFA 5CB0A 2G83A 5K0JA 3PVZA 4RNDB 2VOEA 3ZY2A 3BIXA 3T3MB 3WSTA 4ARZB 3I9V6 3EC7A 3QOXA 1EDBA 4KVGA 3INTA 2J09A 3VNRA 2PMBA 1ODKA 4KQGA 1FFAA 3C74A 3ZWMA 2CLCX 1KMHA 3KJIA 5E7QA 2IK8A 3IE0A 4TVKA 2IZOA 4D02A 1LDYA 3MQFA 1AK9A 3IDOA 1MB4A 2FN8A 4EZBA 3EXEA 1UKZA 3OOWA 3W5DA 3VO1A 2ZT5A 3LXRA 3PPVA 5MFZA 1X0VA 4LXQA 4KMSA 1D2RA 1Z47A 4WXEA 3EZGA 2EQ5A 5F64A 4AB1A 3HR8A 4K05A 2RMKA 4B3DA 2Q49A 5JJBA 2VPXA 2WT8A 3CTPA 4I1YA 3O95A 3BMCB 4K1XA 3SI7A 3U9TA 1PUXA 5D85A 4IMJB 4PTYA 2RAFA 3B12A 4DCSA 4P53A 3FMFA 4MV4A 4UE3S 5AOVA 2EZUA 2IS6A 1FP4B 1I4WA 1XG5A 1BDBA 1DBVO 1NP6A 1XZPA 3IERA 1FEZA 4ME6A 1HE5A 3H9JA 2GK4A 4ID3A 5KYWA 1DC6A 5K8TA 1DJMA 2EEZA 1A5SB 2JGFA 3BMOB 3U13A 1CV2A 4L4XA 1JYFA 4FS8A 5ALZA 2NU9B 1B7GO 2ANCA 1TMKA 1NV8A 2CLIB 2WIKA 3B36A 3FSRA 3HVJA 4HFMA 2Z58A 4UOEA 4ZRMA 2DUWA 1J5PA 4JIMA 3OE1A 4HDAA 4CV0A 4F12A 4N5LA 2NUPB 3RNOA 1CRQA 3I6IA 4DJAA 1SXGA 4PAOA 1UDWA 2O19A 4MQ5A 2YVKA 3ACCA 4RABA 3JRXA 4TX1A 4DWWA 2CCJA 2XNSA 5H7XA 2VHCA 1AZLA 4KCGA 4D0RA 3QEAZ 1O7JA 4AT1A 4C6TB 1T26A 2IDZA 2FZCA 3BBPA 1S6YA 2AMJA 2BDUA 3ZBQA 4F2PA 1Z22A 2CVFA 3T1NA 4TL8A 3TQRA 1EFLA 2IUEA 2QMQA 1TQ6A 3A1WA 5E0OA 4R1MA 2JLQA 2Q6TA 2XZOA 3AXTA 1CQPA 3I73A 3ZY5A 3W3AA 1NFFA 1IY9A 1T6BY 3FWYA 2PKEA 1JEYA 1G8FA 1W76A 1UZNA 5KNBA 1NLYA 2VYVD 1BH6A 5IK2A 2OR3A 2YRFA 1XF9A 3K8QA 4OBWA 4L3VA 2O59A 1SG0A 4YR9A 1E3EA 4MXDA 4KQHA 4GH5A 4QEDA 2Q9UA 4P7KA 3RUAA 4NYJQ 4EAQA 4HAZA 3DCYA 4M8LA 4DAEA 1ZJJA 2QVGA 1GPAA 5HKKA 1AJEA 3WICA 4MJXA 2WJAA 4FNOA 5KEIA 3A14A 1SD5A 1IJBA 2W2KA 1MPTA 3H4MA 2WU4A 4H60A 4HT3B 2AKYA 4KIGA 5IN5A 1MRSA 5J2TF 1XKLA 3ZJYA 2VT7A 1Z0AA 3OECA 2HRZA 3RTEA 5KOJB 5KU1A 3JR7A 2G0AA 2KMLA 1D2AA 5LNK1 4HNQA 3G1UA 2GJKA 4YO7A 2XNKA 4E6PA 2EJVA 3DLHA 2VCYA 4PW0A 4PONA 3KLNA 2GVZC 4LVUA 3BOSA 4MVYA 3WTCA 4EFDA 3H1TA 1UDRA 5B58T 3BYZA 1TVKA 1DFGA 1JBKA 1Z36A 4MVJH 4D44A 1PJCA 3IGFA 2ST1A 1II9A 3P96A 1EVQA 4LZZA 1W5EA 4XM2A 4OFBA 1XLWA 3GGDA 5H4HA 2IXDA 4FP9A 2JAWA 2VA9A 1TVEA 4C4TA 3Q2OA 1IXRC 1NATA 3VZRA 1TT7A 4AXBA 1KEEB 1H1TA 2G0TA 4P86A 1L5KA 1LPNA 4NMXB 3IP9A 3AT1A 1QH8B 3DR5A 3GIWA 3TFOA 3OZAA 3WYNA 2B2NA 3FBWA 3MUOA 1U5AA 2JVJA 2F4NA 5FOUA 1FP4A 2AZDA 1E32A 3KG2A 4C0XA 3HADA 3ZJVA 5CIWA 1FSZA 1I1HA 4QFDA 3RVRA 4XWTA 1OUMA 1WY7A 3HZHA 1IY8A 5J58A 3DHWC 1IOZA 2NLOA 3IUMA 5KOHB 3T1HB 3ERCA 3UY4A 5LB4A 3U17A 4W5JA 2AMYA 3LO8A 1QHYA 4XDHA 2UZ1B 5L3QA 2C61A 3HKCA 3UGKA 1ISSA 1FFWA 1RVDA 1NBAA 2ZTVA 3CH6A 3KPUA 1V45E 1ZMXA 4H7JA 1NQTA 4LECA 3WK7A 1WLSA 3WIUA 4TTQA 3KCQA 4JEMA 3JZIA 3ORRA 2JLBA 2BEVB 1A2OA 4L8WB 4TZ0A 5KWJA 1E3WA 2GEJA 2DQSA 5AHKA 3T0GA 3W34A 4HXEB 5LNK6 5H3CA 3TB4A 2DCMA 3QUCA 3U5TA 2FTKE 1ZNYA 2DPXA 2NYRA 3LC1O 5JCOC 1U31A 3A6HA 3IP6A 2YNMD 5DXJA 2P2CA 5HGJA 4F3TA 2GXAA 4YMUA 2JGIA 2XSZD 3C48A 4YT8A 2QNRA 1M1XB 3R6GA 1WP9A 1H4VB 4NCNA 3HWWA 3CSDA 2UYGA 2ZYGA 4F4FA 5TR9A 5L3VA 1XX6A 3HR4A 4YAUA 2O2SA 1B3RA 3KL4A 1XVUA 1NY5A 5L51A 1NURA 4NPCA 1YB7A 4OQ4A 4JAVC 3EEOA 3JSAA 5ABPA 4JSTA 3RWMB 2XQFA 3WGIA 2P4HX 1RLTA 3WBBA 3ZNQA 4AJ4A 4D8WA 4M1ZA 3G2OA 3FTDA 1LCIA 2ATIA 4B2LA 2C99A 3E5RA 3HCPA 4FYXA 1Q16A 4TGLA 3V1YA 1EBFA 1RI1A 3A37A 3QQ5A 1K8ZB 1KJWA 1KO4A 1EFKA 1UT6A 1CD5A 1N0UA 4DR5B 2B82A 1LA2A 2PU7A 3WGJA 3HFSA 4L50A 3KXPA 1G20A 3AOGA 4RZ2A 2FPIA 3LQ1A 1U90A 4QHYA 3LO5A 1GITA 3DMTA 4A8PA 3PC2A 3C6KA 1MV5A 2HX1A 4MCAA 5B4TA 1OT5A 2QSJA 3ISTA 5CVCA 5JS6A 3MT8A 4M8KA 3CISA 4KSYA 2VNAA 3M3HA 4KKXB 4A15A 2JLRA 1I36A 1ECGA 2J32A 4ERNA 4OHBA 2X4GA 2J9FB 1ZXXA 4KXLA 4U2BA 3VPBA 3GP3A 4A0RA 5MDHA 1IN6A 3QVGB 1C0EA 2ESRA 3GVPA 4QU5A 3ZQUA 2A0KA 2ACKA 1Y8RB 5JV5A 1ZD8A 4PC3A 1G3MA 4MIOA 4NQRA 4CUZA 1L3CA 3AOEA 4XEUA 4ND8B 3A3OA 3HWX1 1DX6A 3TLGA 5JPCA 1UFKA 2WU0A 1AE1A 2CC2A 3S5JA 4DLYA 2J0SA 2XY4A 3HYCA 1GYQA 1HE4A 3CZQA 2XQJA 3R3XA 1M1YE 2Q1DX 1V48A 3BIJA 3JWEA 5EJ9A 4FFPA 5JO9A 1XTIA 1MO2A 2HA0A 1VDZA 3MS2A 4M87A 3NDIA 2J7PD 2PL3A 4G0XA 3ZCUA 5ESXA 4W9RA 4FX2A 1NXTA 3K05A 3WQSB 4I14A 3KJFA 2A1IA 3HPRA 4QDXA 1HLDA 4U63A 4CI0B 3WE7A 5JTUA 3T5CA 3KV1A 2XDPA 4CIDA 1UMBB 2GVDC 3RASA 2AFHE 4PZ0A 3F47A 5HEKA 4AECA 1WMBA 2ZOSA 1XNQB 2TS1A 2X7HA 4YT5A 3CG0A 3WGYA 2WLSA 3UEOA 3NWBA 1ML4A 1SVUA 5BW6B 3T3GA 1Y4DE 3ZZNA 4CEHA 4BYGA 1I4LD 3L1VA 3T06B 6CHYA 1KI9A 1KBQA 4B3TB 1XZIA 4TKVB 4XH9B 5E38A 5H8WA 1L5ZA 1CUSA 3A3YA 2SECE 4K7JA 1P60A 1Z8DA 2ZUDA 4IDHA 4IV5A 5LZ4A 2JZCA 2WTAA 4XIYA 3OX4A 3VPSA 1MX9A 2OO3A 2Z2XA 1N2CA 1JAHA 3C8HA 3PXEA 2H5EA 2C5HA 4JROA 4X84A 3RIXA 4IFTA 3SVZA 2QE7A 3ZOKA 2D5CA 1UOEA 1L7XA 4ZQCB 3QVKA 4IEFB 3IPCA 3VKUA 3GOQA 3AHJA 4G0MA 4EPWA 1NF9A 3ILYA 3CCCA 3M1IA 2OG1A 2DKNA 3QX8A 4OP2A 1A7KA 2PA3A 3DKVA 3RBAA 1ESEA 2O1WA 5DNVA 1ONBA 3UJAA 1FU8A 3RE1A 3EVZA 2QBYA 2H2DA 4YRPA 1P19A 3NT5A 3N86A 1T8WA 2Q4OA 3G23A 3VVLA 4BS9A 4TVSA 1E61A 2CV1A 2FX2A 4PE5B 4GYWA 1HETA 4P58A 2WTXA 3UMFA 3V8QA 4IQ4A 1F2TB 3ZJTA 1PT7A 1XA3A 3JARB 3JQFC 3MJDA 3HI4A 3O90A 2VTBB 2ZYDA 1T2VA 2GEUA 1FP7A 1MT3A 1X77A 3IUEA 2VZ9A 2B6HA 1W581 2OHIA 4S0XA 3N2KB 3OQVA 3KUKA 3WGVA 1N6PA 4MYHA 4YVFA 3THYB 3TVDA 2HBQA 3KXIA 2EJUA 2GO1A 3I53A 2MR6A 1WA5A 2PX8A 4R1NA 4XAQA 2F9FA 4HLCA 1YJ8A 3CUTA 3IP8A 3FCCA 5BNIA 4ZI3A 4BXOB 1H3EA 3BE8A 2Z3VA 3CONA 3PPIA 1X0XA 1NXVA 2EL7A 3QSGA 4EJFA 2IPAB 5D3MA 2R6ZA 4JC0A 4B6QA 1GNTA 1SXQA 3GYGA 2I2DA 3MQ4A 1PTKA 4Z2YA 2CFRA 1ZH4A 4P54A 1IRIA 1PBTA 1XDBA 1JHAA 4DRXB 1CJVC 1ZIDA 2ZRDA 4KGZA 4CU2A 3GFFA 3THRA 1Z39A 1MD9A 3MCTA 5HW0A 2J41A 1VGVA 4BNTA 1Q3KA 1U1GA 4GZMA 4JL6A 4PZ9A 4QXAA 4JLAA 3ND7A 4UATA 1JFRA 3ILSA 1RAHA 1ZJ6A 4IVPA 1YGPA 4IUCS 1BQ4A 2GJSA 2DHQA 2ZAIA 2J6HA 1U0SY 4X1KB 4K6CA 3LBFA 3X1XA 1ZAKA 4TLEA 2XCQA 1W48A 2JEOA 4FIDA 1QAOA 2ZBVA 3M4YA 3QWFA 4UM9D 1UFOA 3TQTA 2HMUA 4PG8A 3LHFA 1RBYA 1OC2A 2BYTA 2D2VA 1KI3A 3KQPA 5F2EA 1ZRHA 5J59A 5CLQA 5LKAA 1Y42X 1U94A 5DU2A 1U9IA 3KJNA 2JJ8A 1VJ5A 4FYVA 4QASA 4RY8A 1DTEA 2C9YA 1ABEA 2A1TR 2WHEA 3EC1A 2PDAA 3H2KA 4J43A 2XNJA 4L9AA 5AK5A 4R1PA 4N47A 5JDIA 4CG2A 1IJFA 4K6MA 4LBVA 4JHLA 4NJOA 4INOA 2P2ZA 1CJSA 4IJ6A 2VKTA 4PC7A 3ZWQA 4HVTA 4YUXA 3EODA 2WUGA 3N59A 4LXYA 3AVWA 1BA2A 2OG2A 1VLLA 1GADO 3VDMA 1GY8A 2QTVB 3KDAA 1VXOA 2BFFB 1MGPA 1QCZA 1EDEA 1ORHA 1VSUA 2DLDA 2JKVA 3E05A 3EUEA 3D59A 3LWNA 3RIEA 3QGMA 1F38A 3OD5A 4N9QA 1Z2PX 2F3RA 5JCPA 3HYRA 3G2PA 1XTZA 3ENWA 3SFZA 2ZIGA 5FI3A 1TM5E 1RAIA 4TKMA 3WX0A 1AX9A 3QE4A 4IXWA 3A0RB 4PZDA 3D6AA 4KLRA 2P3SA 3RKRA 1YDMA 4MITA 4ZALA 2PH1A 4YP5A 3EZLA 1Y9DA 1NVTA 1W4AA 2H1LA 3CUWA 5JZ9A 3GBPA 4L9RA 2HF7A 1EXDA 1RP1A 3SXUA 4JYCA 2QRMA 3CRVA 1Q6ZA 3OCJA 4XCQA 5FPSA 3WYDA 4AQDA 4A10A 3V32A 3WLTA 2E5LB 5EXTA 1N5RA 4D6XA 1DSSG 2PGNA 3MMZA 3QXSA 2EYQA 2RGCA 1K98A 3TBHA 2J3LA 4JXZA 4DGQA 2X7JA 3C3YA 3P9QA 1ONOA 4QKQA 3R5TA 4IDBA 1GCOA 2AEEA 2H57A 2H9YA 4B8WA 4AXXA 5TT1A 5BQPA 1J8MF 3MJHA 4YRRA 3RUEA 3WHPA 4M1WA 4G24A 5G41A 4NV1A 4J76A 3FPBA 1M3SA 2H07A 4AULA 3AHEA 4BMPB 4C78A 4ER5A 1YHNA 4UCFA 5HJ2A 1YSCA 3S27A 5JWOA 4FJ1A 2P8JA 2HJSA 3O2QB 4HTAA 5HCUA 3SF0A 1C3LA 2GJ9A 1VE7A 3G8YA 4KFCA 2R47A 3BB3A 2R8XA 3KAKA 3MTGA 2RAUA 3NS7A 4IG4A 4ZA2A 2AXEA 4D2IA 3AIMA 4ML3A 1RE0A 2NG1A 1TGYA 4HSEA 2VJKA 2HU7A 3JWJA 4FE7A 3T95A 3PJRA 1V8OA 3A11A 1M2JA 4QUDA 2CL5A 5CD1A 1S7GA 2O4UX 2QMEA 2UUOA 2WVAA 4IWNA 1COWA 1JHYA 4ZI2A 1U7DA 2DEUA 2VL7A 5IFKA 4FI3F 3KOMA 2IY9A 1OWMA 4ZCRA 2Z5GA 3M6XA 2PLWA 5EE9A 1YBMA 2G17A 3X1DA 1ILEA 1WCIB 1JE1A 4LXUA 5DI3B 1DC8A 2F17A 3PQ6A 4ZPXA 4I66A 5KKAA 2X0FA 4PAQA 3U7HB 1ORVA 2VAWA 3H86A 2ZU0C 2CBZA 2ZSIA 4QARA 1PEKE 2ZWVA 1KZ6A 1BOOA 2J07A 3BD8A 3HBJA 1Z34A 2DQZA 5T57A 1E7MA 1WHSB 2BEWA 2WZDA 4CMJA 3EVFA 1QS0A 2PZEA 4PZAA 4ZODA 4DA9A 1KPIA 4J29A 5ICFA 2WU8A 3GGPA 1ZKMA 2B0JA 1PT8A 2H48A 4ZPJA 2JKYA 2ZIWB 3SAJA 3TVYA 4ZCQA 1U2QA 3TFQA 1Q7CA 3BK1A 3M83A 4A6PA 2QDXA 5FNVA 3RB8A 4Z1MD 4Z4CA 5JSQA 1WDTA 5CFOA 3GP8A 3PBKA 1BYUA 3EIHA 3PDHA 1FTQA 2WJYA 1AD2A 1CX9B 4JL5A 4OEHA 3GLIB 5CLIA 4BEWA 2DWOA 2IX9A 4XTRA 1NKSA 4OK6A 1OBCA 5H9WA 4J2TA 5MFPA 1CU1A 1DB3A 3OLYA 4E3ZA 1KE1A 4B4WA 4XLLA 4BQEA 5ES4B 1KWKA 2V97A 4GQAA 1KYIA 4QTZA 5E4FA 1X1BA 2VLBA 3NEYA 4X60A 3NORA 1EK5A 3EVTA 1IUNA 1G1MA 4K46A 2BE7A 4RH0A 4UKDA 1YQDA 3HUTA 4DR1B 3I9LA 1MQ9A 2EG5A 4G8DA 4L07A 3ZIUA 4J4TA 4CIVA 5C7LO 4O29A 3O8OB 1J8QA 1N4AA 3P9PA 2EFDB 3VDRA 3VMFA 3WLOA 3ZV6A 2YVAA 1WD7A 3AJ9A 4X3CA 3UW1A 4ZYXA 1AZWA 2BSXA 2PANA 5ALJA 1IHPA 1PV4A 5C7IO 2V3CC 3I8SA 1POWA 4KDFA 4J4BA 4LJKA 3WYBA 3ICWA 3JQRA 3TIXB 3RC8A 2UXDB 1HRDA 1W2GA 2E4ZA 4QGAA 3RIYA 1Z73A 4YCBA 3E4DA 2V65A 1U5BA 2GWHA 2JJ2D 2XTMA 2C96A 3ND6A 4HLUA 1IVNA 1E8DA 2JIZA 4C7BA 2DHDA 4KXFB 1EE9A 1E66A 5H80A 1YJCA 2VF5X 3D3QA 1KPHA 1EUYA 2XQIA 2V3WA 1J4AA 2FSGA 1KIMA 4FI3C 4FXOA 5AI0A 2H0QA 1X7DA 2OGZA 4CDNA 1WXEA 5CCBA 3D2AA 2R8OA 1TI7A 2H2HA 4YHBA 4DSZA 1E3QA 1QLWA 5GVRA 2V98A 1HDIA 3DYIA 5LL6P 3WGOA 3PX7A 3B1XA 3ZU2A 4FYPA 1IY0A 1S1MA 1ZOPA 5REQB 2QI9F 3F7TA 4PSVA 4DE5A 1GTRA 3AUJB 1GSIA 4TZ6A 4NTZA 1Z75A 1XMVA 4XCVA 4NOKA 1AGXA 4FMBB 4Y1GA 4EO4A 3UJ7A 2AV6A 2JFZA 1D7AA 2V7BA 5BXQC 2PWYA 2QZSA 4CKWA 1SXJD 3B3AA 1SUCA 3PFFA 3D0QA 3ZDCA 1YTUA 3FHTA 4MZXA 2IL1A 4EHBA 3P97A 2F48A 2FN4A 3IDSA 1DX9A 1UL1X 2F3SA 5L3SB 5LM3A 2V6GA 1L4LA 1Y63A 4KHZA 5G3YA 3ZYZA 3AONB 4L3OA 2W4IA 4RZXA 2H5IA 4DIBA 2C9ZA 3C4JA 3PGVA 5I4CA 4TMTA 4YK7A 4DUPA 1PJ2A 1RQNA 1XZLA 3OFSA 2WMNB 1V8ZA 4BCDA 1KZGB 8ABPA 1WMAA 1XRMA 2IQIA 3AETB 1RXVA 2JI7A 4HPJB 3IXMA 2JB9A 2BMEA 4P9NA 2Z95A 2QQSA 3CEHA 4CQMB 2RFLA 1SHJA 1NBWB 2X1MA 2VWPA 3B7WA 1CQZA 3P0FA 5TQ0A 5C4GB 2MSNA 1DCMA 5JSZB 4EHKA 4YONB 2CKDA 1GCGA 4EJSA 2YVUA 1VYHA 1HPLA 1NQWA 3AGPA 3JAKB 4XGQA 1EEXB 5AW4A 1NBMA 2H16A 5ALQA 2ZKIA 2JCYA 4H4CA 4G63A 4S3MA 1TLLA 1B8NA 4H3VA 3V2UA 3KB6A 4LN1A 1R8QA 4NU0A 3CH7A 4MTCA 1JEQA 3H65A 3Q3GE 4OAPA 5BSGA 4D0LB 1L5NA 3LLVA 1E4OA 1K5HA 2AW3A 5EE5B 3CNHA 3WL8A 4RU1A 4JP2A 1UBTS 1RHMA 2QLLA 1XRSB 5DK6A 3I30X 5ES3A 1BCRB 2JLSA 2BJWA 2GCPA 2R5WA 4PBTA 5HE9A 1SKAA 3RT7A 3LQYA 3O8OA 1BMFA 1SOMA 2BTQA 2PGJA 3CRNA 5GJBA 3K7EA 1S2GA 1Z4JA 4BU0A 2WG1A 16PKA 2DB3A 4IIJF 3RI3A 4AO8A 5CFQA 4DB4A 1OAAA 1XRLA 1U63A 3HMQA 3AB3A 2IHJA 3EEYA 5CNKA 4MHOA 2ZG6A 4MDFA 3L46A 4WKCA 3U7EB 1KMHB 4NH0A 4RL6A 4CLXA 5CLFA 2XR1A 4EGSA 3GBSA 1W25A 4QFBA 2X40A 2P9FA 1ZIXA 1QGZA 2PKXA 2RC5A 3GLUA 3WZMA 2NYUA 1OA1A 1THMA 4B3HA 1F2TA 2E3JA 1IZ9A 3NJ4A 1Z6GA 4CQMD 1YBVA 3GCDA 5CLGA 2CKMA 2HW8A 1AU9A 3UAVA 3GBVA 2PJDA 3UWDA 1YKGA 1S8NA 1Y8QB 3Q0TA 3UAWA 3FUCA 3N3AC 2EX4A 5EEGA 3MCZA 1AGYA 3S1AA 3MXTA 2PBFA 3TCNA 4M8IA 2QD4A 5BR1A 4ZO6A 3H5OA 4B6JA 3I0NA 4L78A 2JNWA 1P9NA 1YE5A 2QD2A 1N7HA 1R6TA 2WVHA 3WQQA 3S7ZA 5LQAA 1IPFA 3C98A 3DBLA 4ZOCA 3A2MA 3L7AA 2A5DA 4QD3A 4D9MA 1MX5A 4N12A 1QFJA 5EFZA 4Z0NA 4NOLA 4F6LA 2DXIA 4BVLA 3PUXA 5ETJA 3GL9A 4B3XA 3EULA 4FONA 2QLJA 1NRXA 1RABA 1N5MA 1JIIA 1MMFB 2GLXA 4E1AA 4LQDA 3ZGYA 2IRWA 4PIMA 4QJBA 4DYHA 3I92A 5BUQA 4MRSA 3DMHA 4MUHA 1XJ0A 1QG2A 1TIKA 1EFCA 2BDEA 4GOND 3FJYA 4E2ZA 1CB0A 1OC4A 5FEMA 3RFCA 1GUDA 4YCAA 1UAGA 1A8IA 3MCVA 4QPDA 4TUYF 1ZMRA 4JYBA 4AICA 1VI2A 1CR6A 3IMFA 4IZHA 5B3JA 4NCBA 4YRCA 1XMOB 3PDCA 4MVJI 4DNPA 2FZKA 1ZHFA 1G55A 4NFYA 2ZUTA 1P7ZA 1BDIA 1USIA 4EYSA 2FSHA 1QHHB 3E5MA 3KK0A 2P0EA 1K7SN 3G9UA 4WZAB 3ZBTA 4E2XA 4F21A 2KB0A 1WNFA 2QY9A 3JAKA 1M74A 2PKQP 5D84A 2G4LA 3SSOA 1U1FA 2HCBA 2CVHA 2OVFA 3NU1A 1IM8A 5EYPB 5ADWA 3LH5A 4LDZA 5E0KB 4MB2A 2F8TA 1RJGA 4Y2QA 4R01A 4LRQA 3ZDDA 3FVVA 2VJAA 3RHSA 2TMKA 1IK4A 1PV2A 2UV8A 4AZ0B 3JZAA 4ZGGA 1GZ4A 5FDFA 4BKOA 1ZD9A 2HA7A 3N7AA 4KU4A 3TDKA 2Y9MB 3WXMA 5MN4A 3V4RA 5FI1B 1LGYA 1SH7A 1G64A 1U28C 2A4KA 2R5FA 4TVOA 4E2WA 5CAEA 5BWLA 1RZRA 4Z4EA 3MF4A 3GEHA 4HLNA 2AI1A 1Z68A 2RARA 3N2ZB 1FNCA 3HDHA 4GXRA 4A8JA 2IEGA 3OD1A 3U3RA 4DTIA 4Q1VA 4HGZA 1RWKA 1GL9B 1YDHA 2BMAA 2NUAA 4XGKA 1GAXA 5ALXA 5I9LA 2EBWA 3FMGA 3K4QA 3HTXA 4F6RA 1P2SA 4EB6A 2GZ3A 4DQKA 1DKNA 2QMOA 2X2FA 3HY3A 4H1UA 4RD0A 3O8RA 1KHHA 3KM0A 3M4JA 2EW2A 1T9DA 4NYIR 2ZYIA 3BG5A 1V1RA 5CX4A 2W90A 1F20A 4EGAA 4CMHA 3NBAA 3Q41A 2CK3D 4IL5A 4DVJA 2D13A 1LH0A 4ZZ2A 1QKKA 1LI7A 3K2QA 2BN4A 3P2JA 3EF0A 2H3EA 4O33A 4DPLA 1U7PA 3R4CA 3X1MA 1RFLA 4NI5A 3KSZO 4B5KA 5DW3A 4JODA 3CW9A 3ZCRA 5AKEA 1Z6TA 3W8RA 4QM6A 4C07A 3P9RA 4Y0NA 3JV7A 2A5LA 1X1AA 5HZGA 5JRJA 3FF4A 4GBJA 3D8SA 3GK3A 2JLUA 2HK8A 1NXSA 4P84A 1GG2A 1IMJA 4ZO9A 3VJLA 2RKWA 2JCSA 5B1SA 4INJA 1OXTA 1CRZA 1YQ9A 3LXXA 3KS9A 1IB6A 4BLQA 1G7CA 4GHWA 3LQKA 4IQGA 3TZLA 3T5DA 3VTAA 3WGQA 1RIIA 3D6VA 5EOVA 4DSOA 1DT5A 2EV9A 1S02A 1U3VA 2BR5A 2XA9A 4K1LA 4WZBA 3AF4A 4E13A 3CLTD 5E4JA 1A27A 1FE8A 4WRRA 3C4QA 4LYFA 2IX3A 5TVGA 1OU4A 2ZSHA 3TXXA 2B1QA 3KKMA 1YAJA 2XTNA 2QTHA 3VDNB 1GTVA 1XN1A 1ORWA 1ETUA 1M6YA 4J8PA 4DCVA 1NXXA 4DG8A 2DHCA 1ZQ9A 4XA8A 1A5AB 3HYLA 2DFLA 3R44A 3LY5A 2Q21A 2JV2A 3KTAA 3WVNA 3ZWXA 2R6JA 4CQLA 4ES6A 3RFXA 1S01A 2CXUA 4W8HA 3O94A 3LQ2A 4Y2TA 3WLKX 4FEEA 1RRGA 2P3LA 3GMDA 4UJ3A 1QXSA 2E9SA 2Q1XA 3PR3A 3HV0A 4B31A 4CM4B 1VHQA 4UVHA 3RHTA 4G41A 1W73A 3BXHA 3FNIA 3PICA 3PKZA 4GVPA 3UN1A 1YZUA 1CTQA 1NC1A 2I1LA 2HTEA 2MOKA 3HHPA 2ID7A 4Q1EA 1N5IA 4MWTA 1JG6A 1M10A 1YVEI 2YJNA 3S2SA 5I7FA 2XB8A 3PYXA 2HM7A 2Y6VA 1KSHA 2HYDA 5F78A 1YBFA 1GCAA 3WLAA 4ZCPA 3MYYA 3LW8A 5AH0A 1FTNA 4ALNA 3FDJA 3NANA 4D45A 2IOHA 1V5FA 3MCWA 3L0ZA 4X66B 1WSBA 1DBRA 3O82A 3ZDZB 1KEUA 2AHOA 3H4VA 3W3AD 1XEWX 3JYHA 5EJEA 4MPDA 1EFUA 2Y1FA 3USZA 2C4HA 5KS2A 5KVSA 4N3GA 3T6KA 1JHVA 1LLQA 4ZEOA 2RB4A 3FVQA 4EENA 2C4KA 2AVDA 2QJRA 3HRIA 4IDDA 1UPCA 3LUBA 4LRSB 5FD8A 1S9DA 3MWEB 2ENUA 1PWXA 1W4LA 1U8UA 2JFUA 1O94D 5I01A 2ZBRA 2WIAA 4C6HA 2WYIA 3K4HA 4ZN6A 1PFUA 3QPBA 1VLVA 1GWNA 2JFOA 2QX6A 2DBVO 3GFPA 5LWHA 4MHSA 5BVGA 1IZZA 4ONEA 4CYMA 4LF6B 5JWRA 2ZUFA 5CT4A 2KYRA 3GCZA 3H2YA 4XEHA 2WT9A 5K51A 4MCIA 5KYVA 1RWVA 3WK4A 4H3KB 1YZFA 4ZU3A 5B1EA 3GV0A 1O9BA 3ZH2A 4V2IA 3N2EA 4ETNA 4FDTA 2G08A 3UCEA 2NO6A 1HSZA 2BEUA 2VXCA 4FHCA 3ILHA 1UC9A 1YRLA 4YI3A 5REQA 6REQB 4HHEA 2ZTLA 4Q93A 5FOVA 1PNVA 1ULZA 2VN8A 4AZSA 4M3NA 1NNSA 5IBCA 1SOUA 2QUJA 2BM9A 4JQCA 4KN5A 5FORA 3C1AA 3EVAA 3KEQA 5JIBA 5BPFA 3LI2A 3M81A 3KVOA 2NUPA 2IYQA 2ATCA 3E2MA 3SIRA 3DPUA 4EUFA 2HO4A 4EUEA 3BIOA 1SCNE 1JR3E 1Z4OA 1TA9A 4CTOA 3N2IA 3N0RA 1JFLA 3L92A 1EDDA 1ZUNA 2AOWA 4IYJA 3FCXA 4X5OA 4BNVA 3P45A 1OH6A 3H3XA 4X94A 2GK7A 1WU7A 4GGPA 3PKJA 3NTVA 5HJ7A 5JECA 1HNXB 2VIIA 1EUQA 1MGOA 2I6UA 4S35A 1Z8HA 4DHEA 1Y6RA 2NIPA 2AFHB 1L7QA 2R00A 1GL6A 1YA6A 3UANA 4B4VA 3DQZA 5D86A 2XCRB 1WP4A 1RCTE 2RI6A 1YQXA 4ZTZB 1MJGM 2BIFA 5EE1A 1H2BA 3IH5A 4WUTA 5FUBA 4LA4A 4ZOEA 1QIDA 4EBBA 3G85A 3VVMA 5KNCD 3U3JA 1M8FA 1JIXA 3OLXA 5L9AA 1OI3A 1MLDA 3B48A 1TMYA 1TCCA 4MW1A 3RK4A 5I9NA 3VR5H 1KK2A 2XUFA 3EARA 3K2EA 4JC8A 2PT5A 2JASA 4J49A 1ZK4A 1EVKA 4GI2A 5C1PA 2H63A 1OBFO 1SRRA 2VTVA 1G2QA 4M36A 5DN6D 5EPEA 5LLDA 5FAKA 3KQOA 3CEJA 5ICEA 3HVRA 1DKLA 3OZEA 2PUWA 4NBVA 2RIRA 2WIGA 5FA6A 1ZUHA 4YJ3F 5LZ7A 3RAJA 3U4DA 5KYTA 4QDUA 4F72A 4V3CA 4BLTA 1QZUA 4KQFA 4LUCA 4RNCA 3ESXA 3F0TA 3ZVLA 1MOPA 4GLLA 3V33A 2AK3A 4TV8A 2O8FA 4BPRA 3KWJA 5HIAA 3R5KA 4BEVA 4C4ZA 1JL3A 1CUDA 5L45A 2WM9B 3KT8A 4KWEA 5A6VA 5MGNA 4RVFA 5KQSA 1DTSA 1ZMOA 5IRCD 2BAGA 2B7LA 1T2FA 2DKOA 1V41E 2P78A 2MSWA 1CUBA 2YWEA 3IEMA 5TSDA 3AKYA 3MTIA 5DTJA 1RHQA 5KB3A 1UQUA 1B8PA 3FRIA 4OP1A 3RVPA 1R0BA 2FMUA 4I3GA 7YASA 4Q4AB 4ESVA 1ZIPA 5CK4A 4EPYA 2FR1A 4Y8VA 2H5LA 1WTAA 4M1TA 5EMJA 1UFVA 2SKEA 2A0FA 1IIRA 2ZVDA 2EJTA 5HBGA 4EOGA 4EYGA 1DT3A 1QPGA 3L07A 1HE2A 1I9GA 4K6GA 5HHTA 1JAZA 2NZUG 2FSPA 4TRJA 2QVXX 3S44A 3B3GA 5EQJB 4UNQA 4DV4B 2BEKA 5J2UB 3ZXUB 3EFEA 4BMDA 4JK3A 1GNRA 2F1OA 2GQ0A 3ES9A 3MINA 3RJTA 1ZLYA 4HMPA 4JLNA 4TKUB 3THXB 3KSUA 4X24A 4Z4GA 4IDQA 1Y3FE 3HJHA 1PW7A 3I0MA 1YZYA 5JR3A 3EG9A 4NABA 1ZJ4A 1EDZA 2I8CA 1FMFA 4RD2A 2OZKA 3HB9A 1E79D 4TYYA 2H7CA 4D4KA 1TEZA 5F9FA 1OHHA 3I9NA 4TXMA 4AY2A 4MGHA 4HWSA 4RTMA 3HI6A 4JLBA 4Z8XA 1SB8A 1BGXT 1RRCA 4GR5A 1DUIA 1ZD1A 4E7OA 2C7VA 2P9ZA 1NBIA 3K2IA 4WFIA 5F98A 1FUIA 4XVRA 1QX3A 1N2CE 2CE2X 3L8HA 3V55A 2CDBA 1LRJA 3JVIA 2QUZA 4JD5A 3O4IA 3CMCO 1NPDA 1HTBA 5SY4A 3QFSA 1XXHE 3KDPA 4MX8A 4ISBA 4QUBA 4XLTA 1UK8A 2FUEA 3JVEA 4R2HA 4MI3A 5AI4A 3PFGA 4DANA 4EVIA 4FINA 4LVCA 2SCUA 4TTVA 4DG9A 3QMVA 4KPGA 2WWRA 4LYDA 2PPVA 2OGTA 3GZNB 1OFVA 2B7BA 1H5UA 3DJFA 4RGBA 3GGCA 3RYCA 1NNI1 3HLKA 1YFZA 4F2DA 2D59A 5KJCA 2VT6A 4ZQIA 2J3EA 2Q46A 5ICCA 3IV7A 3RBVA 2ODEA 3C3PA 3BZWA 3PNMA 3UT6A 4EJ6A 2DZDA 3ZGOA 2OB2A 4KXYA 1R5BA 2RCYA 4JR0A 4F71A 2QWXA 3M7IA 5C9ZA 4A6XA 1XDWA 2Y1OA 1L4BA 3CVYA 4WLUA 2W8BA 2KS6A 1OASA 3Q6IA 2ZVPX 3TJRA 1C0IA 4S05A 3I37X 4OLHA 1RC1A 1H85A 2HRCA 2NTYC 3JQDA 1RAAA 4M46A 2CWDA 5KOHA 3SVTA 4B76A 2PKYX 1A7JA 5BR4A 3ZCTA 3P0RA 1J06A 2JIBA 3D6NB 3WB9A 4DLAA 1ZP6A 3DFKA 3O4VA 1R74A 2HK6A 1JDZA 1D3AA 3AG6A 4KL8S 1MENA 3TLBA 2XD4A 1XNHA 2B1IA 4M9ZA 2OQVA 1OV4A 4G0VA 3PIDA 3JQAD 1JMKC 4J0JA 4B3IA 2P62A 4DXDA 1T15A 1OXVA 4RJKA 3KSAC 3R9XA 1OA0A 4PIPA 1J0XO 1N3YA 2FUCA 1I7LA 2P2SA 4RLQA 3UAYA 4JI8B 3EVDA 4PBRA 4ZMRA 3PDIB 3KVNA 4W7SA 1G5FA 2CLKB 5IAAA 3RYIB 1BU8A 4ZQHA 2BC9A 4GLFA 4UXIA 3ZTTA 5IDVA 1FDOA 2XX3A 3BMCA 3OM1A 4M1KA 4ZVVA 1MXHA 3S2ZA 1RD4A 3AHFA 1CUCA 5A7FA 2BCJQ 3EISA 4RQAA 1VKRA 3KPVA 1L4EA 2PIAA 3KJEA 4OQPA 2IYLD 3AHIA 3GDWA 1GRCA 3LA8A 1WAMA 2WHXA 3PX2A 3FMVA 3R5HA 5SYAA 4A16A 1P17A 3BB4A 4CLDA 1U0JA 4MS3A 3SS7X 2QX4A 2O2EA 3MRTA 4FHZA 3W77A 1QP4A 2BFCA 1UK6A 4ZQEA 2GYWA 3M0EA 1BCSA 3DC7A 4I9UA 4YFYA 2P8SA 1JFFA 4NBKA 1P0MA 5ILOA 4S04A 3GLKA 1RWWA 1VRCA 1IM2A 2HD4A 3FHLA 5TLSA 4KXWA 1CUVA 4YN3A 4BQFA 2IE8A 2YOHA 2V4UA 4MI9A 1BG6A 4MJ3A 4DQ0A 1KEPA 2AA3A 4R2LA 3MSXA 2V0GA 1P44A 2D00A 4WN9A 10MHA 1RWPA 1KJZA 5A4JA 2HBRA 4Q9LA 2F4VB 1BDMA 2X4DA 5BSVA 4D3YA 5CTJA 3LK7A 5AK3A 5F3WB 5D6NA 3RUIA 3B38A 2ZW9A 2ZB4A 4QUGA 5JAUA 2ZVQX 4JENA 2RBGA 3BRWA 4L6AA 1JQ3A 2OAP1 2A5GA 1V1MA 2XUZA 4L85A 5JLJA 3JQGB 4YMGA 2ZJ2A 3TIWA 2L82A 5IG2A 1EXMA 3I6ZA 1Z08A 3W1EA 2VSNA 2OK7A 1OROA 4GLBA 1NVUQ 3BGDA 4NJEB 4C21A 3O4FA 1ZUIA 5JYCA 3H8WA 2M98A 1G9TA 1FP1D 1U1EA 1IN1A 1EUZA 3N2GB 2IU4A 3ED5A 3ZHXA 1UWCA 2C0QA 3IT1A 1S2MA 4HWKA 1SKYE 2Z2YA 3OKCA 5DNUA 2XJ4A 3R6DA 4J0IA 5LMZA 3IDQA 1S4MA 3LIPA 1ORIA 2BUAA 5JY1A 5DK4A 4ZYVA 4F9EA 5E3HA 3H2GA 3P4YA 2KE5A 2C5SA 2CJWB 4WNYA 2PM8A 2J31A 2C84A 3ZD7A 3IHLA 1L4MA 3EDYA 4AN4A 1T4DA 3D3JA 2ECFA 4YV2A 1M2HA 1KAQA 5A3VA 3E48A 1PS0A 4IIVA 1Q12A 1Y5RA 3R3SA 4ND4A 2PMWB 3M4NA 2EJWA 1J9EA 1ZH6A 3RIMA 2ID4A 3TG2A 1WUKS 4L4ZA 4TTTS 2FWPA 4AMGA 1IK6A 5EWMB 4BQNA 2IPMA 1T5BA 4HDKA 4QGGA 5HZHA 4Z2AA 4MYDA 1Z4KA 3CNBA 4DIMA 3P2KA 5J1TB 1L1FA 1A8QA 3HB7A 4I6EA 1AKUA 3KZOA 4BO5A 1DUVG 3H9GA 3JY6A 4N6NA 5COAA 1OLXA 3HP4A 5FYQA 4XYEA 4C0BA 5JS7A 2QAGB 3F3KA 2QJOA 1KVSA 4CNBA 2R44A 1OGIA 2YS6A 4JP1A 2AL7A 2X8AA 1UEIA 3CO5A 3FFAA 2WAMA 3LX8A 4HAXA 1L5RA 2X19A 5F35A 5IKOA 4ZJPA 1X7XA 2JH8A 3EEIA 3PR1A 1HG1A 1P3Y1 3WK5A 4QTYA 1ENZA 2QK4A 4BJ3A 4DNOA 1ULHA 3FMIA 2FEPA 3GUYA 5KVVA 1LSUA 3W5AA 1LTHR 2WR8A 5LJLA 1TAQA 4KZKA 4LBZA 2DERA 3CRRA 2BBWA 3DVAA 4AP6A 4EQ6A 3U5ZB 1UZMA 1KO5A 4QFMA 5EAIA 3AR9A 4HRVA 3OLWA 4Y6GB 3RQIA 4GX0A 4XD7A 1Y7IA 3L4KA 4JOCA 4MQLA 4DBLC 1KXJA 4M9QA 2H8KA 4C0LA 3WGTA 1CXZA 5IBPA 1EX1A 3CWQA 4IHAA 3DLTA 2BE9A 1B3BA 1PS9A 4DWVA 2E1RA 2AXPA 4EMUA 3AI3A 3UHJA 1RKUA 1YR1A 2XKBA 3RBZA 5IX8A 4Q15A 1SQ5A 2WZQA 3PPWA 5KYYA 2GHTA 1CNFA 1M6HA 2HHHB 3AVYA 4D46A 3PWKA 1ISHA 1SVOA 1H2FA 2CVQA 1QCYA 4JH0A 3ELBA 2Y2VA 3R3YA 1RR6A 4X6LA 1TEVA 3PQCA 4L4SA 5ERXA 1XCMA 1GAEO 1G6KA 1A77A 1KI8A 2I1WA 3PUVA 4HDRB 4EW1A 4CGZA 5JWHA 4R1QA 4Z99A 3G0HA 3MIZA 3NVDA 3HZRA 1SC6A 3AYXB 4FE4A 3SU8A 5CURA 4CM1A 4BFSA 3TSOA 4RIFA 1RBZA 4RD3A 3TW6A 3WNVA 1AHNA 4B6OA 3CNQS 1J5EB 3CPHA 4OHVA 4Q3DA 1ECCA 1W36B 1W4CA 4FUQA 2WZCA 1A9XB 2GMWA 5FTWA 4MUIA 5KOIA 1ODIA 3L0YA 3QKSB 4UHBA 1R88A 5ERYA 1ACJA 2AKAB 1DBIA 3CKKA 2WB4A 4LWPA 1RXIA 7MDHA 1V9LA 1T9KA 1D07A 2KLBA 3KDSE 3EUFA 2QX7A 3FTNA 1T24A 2Q0SA 2J1LA 4RSMA 4TWAA 4UUOA 3VYSB 1SOVA 3AR5A 4AJNA 3JQ7A 2CW5A 1PZFA 3HCFA 3KQWA 3NBXX 4LRXA 3CZPA 4P1ZA 5YASA 3FR8A 1EWTA 5B2FA 3DMNA 2YXBA 4TXJA 3L02A 3VMMA 1PRYA 3G8DA 2VF7A 3DO6A 4XVQA 3TVTA 4Q7EA 3ZGLA 6AT1A 1TPYA 5DASA 1LK7A 5L3RA 1Y8CA 1E1KA 2X58A 1X9HA 4GGMX 5B3AA 2KW5A 3TQCA 5BT9A 3T54A 3KKOA 1U2DC 1K7EB 5IASA 1TTTA 1BNCA 2YR0A 4QLAA 1Z7EA 1L3BA 5HUQA 1QGUA 4OM8A 3FB1A 4QGSA 3G0CA 4G67A 1DJOA 1ZGBA 2XUQA 4JLUA 3AF3A 2GNPA 3IOBA 4MV6A 5EHQA 1ZWKA 4LJ7A 2X13A 4ZV4A 2EIXA 4C05A 4I1IA 4KH1A 3P5BA 1T6XA 3E3LA 1JLHA 3MUFA 2WPNA 4UBLA 4X65B 4N3NA 2PZGA 3DFUA 3ITEA 4CT0A 1FQWA 5K3DA 1OKKD 3NHBA 4HGOA 2AHRA 3HXMA 4ZIRA 2FN3A 2AX3A 2BHRA 2D3TA 2H4ZA 4OI1A 5EJ8A 4V0MA 4MV9A 2V9CA 3KQQA 4PXYA 1KDZA 3QPAA 4BNMA 3D7MA 5JPIA 2NZJA 1LWNA 4IGIA 1ZNWA 3DYBA 3G2QA 4JGGA 4K0RA 4JLVA 5H3HA 1Q95A 4LQCA 1JAIA 4Q9NA 3B6JA 4YRIA 1I33A 1A9XA 4G4IA 3OQ1A 1E6KA 1KJNA 2OMEA 4RXUA 5E8JA 4DCJA 5DF1A 2ZUEA 1XDGA 3KKZA 2XUOA 1SVWA 4PC2A 5CXQA 1IIBA 3QOWA 3SHTA 2EIHA 3DTVA 3PRJA 1Y4ZA 2ZI9A 3KSRA 4MHTA 3H7AA 4CVNA 1H69A 5CT5A 4ZJUA 3OZUA 2R97A 2Z2ZA 4HDRA 2XD9A 3TSAA 1TEHA 2NO9A 3CR7A 1N2XA 4CETA 3NHSA 1NFQA 3NT4A 4OAQA 1HDYA 3OF2A 4OQMA 4CMCA 2QROA 4COOA 1PL6A 4WK0B 4XYGA 3VC1A 4DIFA 3K9GA 3KQVA 3HYSA 5E4YA 2I6FA 4RETA 1U04A 1VCOA 2X3FA 3DW1X 3M6FA 2HWYA 4DEVA 1S9HA 1Y7PA 1PT6A 2PLRA 2W00A 1ZNQO 5EUQB 1SXJB 3QMPA 4YC7A 3SC4A 1XZQA 2QX8A 3D4PA 3Q3IA 1GA6A 2ZJ7A 1RHJA 3JWIA 4Z0HO 6Q21A 2DVMA 4PZCA 3R7BA 4ZP1A 3URMA 3G2NA 1TL7C 2JZNA 1JYSA 4O08A 1TO1E 3IYLW 3F4LA 4M86A 3R7LA 4NV0A 5FTMA 1E3LA 1DBWA 3ICQB 3G02A 1FNSA 4O2BB 5AIAA 1F2UB 5DGTA 2BELA 1Y6QA 4ER3A 1T3LA 3PDWA 4EDHA 1NGSA 3CB2A 4Q4DA 3VM6A 3ABZA 5JQGF 4Q47A 3F6EX 1RJDA 3NP7A 1LVHA 2Z1MA 1DC5A 1J07A 3K32A 4AN0A 2W2LD 3IC5A 4KV9A 3LWDA 3LYAA 1G5HA 1E1QA 4CF6A 1PFKA 4WTOA 4DLBA 2IF0A 4KLNA 1M5UA 4O1IA 5K0CA 1NTRA 1ZISA 4TN1A 6REQA 3DHYA 2HCJB 4CR7A 1VJ0A 3DVRX 2D0DA 1KVTA 1A04A 1GUBA 1JKJB 4RAQA 4U6SA 2CNLA 3TMYA 2XWSA 3FHOA 4GPZA 4NF2A 4B4DA 1E8NA 4XW2A 3C70A 5JJIA 2K2QB 1IU9A 2XXJA 3GLIA 1PTJC 1EA7A 4R3NA 3DLBA 4YCNA 3E7XA 2XE6A 4K9SA 1HI9A 4ENSA 3L05A 1WJGA 3ACDA 4LJSA 3UPDA 4BE9A 3MB8A 1CS4C 1USKA 1XCGB 2NOAA 3KALA 3TUJC 1NL3A 2ET6A 3SCZA 5D00A 4U8GA 5T4HA 3LUJA 4JBWA 2CT8A 2Z8XA 2B20A 3Q7TA 1E2PA 3C3WA 3FNBA 4Z49A 1Z6ZA 4GYJA 4IM7A 2XECA 3HUEA 3NNSA 2R79A 3Q9SA 2H9AA 3UG6A 3NRBA 1P1FA 4LV5B 3ZHZA 3QX9A 4MS1A 1J24A 1E1QD 4MR8B 2FHPA 1GXSA 1BZYA 2BFEA 4GNRA 2Q1SA 1M2KA 1JPJA 4DR3B 4JX9A 3RC2A 1FUUA 3KPWA 3Q9NA 4V02A 2XV1A 3GNTA 1DAIA 4B3JA 5FHQA 5A4FS 5ANRB 2C95A 1JKIA 1A5BB 1N2OA 1T8UA 4HNGA 1E9CA 1C1YA 1IEQA 2FPRA 3ET4A 4W8OA 4P5PA 3V42A 3JQ9A 3V4LA 1GPYA 1H2RS 5KNLA 3EXAA 5HMMA 4AUEA 1AKMA 5TQ2B 2IOYA