5CCBA

Crystal structure of human m1a58 methyltransferase in a complex with trna3lys and sah
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
289
structure length
282
Chain Sequence
b'MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGDTSPFRSGTPMKEAVGHTGYLTFATKTPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit
publication title Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
total genus 71
structure length 282
sequence length 289
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5ccbA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ccbA02
3E8SA 2QYOA 5CIYA 3PX3A 5EHIA 4AZSA 5LQCA 2ZBPA 1I4WA 1R74A 2NNWB 1BHJA 2AR0A 5E1MA 4U7PB 4RWZA 5LQKA 1SQFA 2G72A 3KQQA 1Y8CA 4MTLA 1G8AA 2B78A 2O0LA 3HCAA 4P7GA 3SR4A 1L9KA 2Y1XA 3RODA 3UJ8A 2VP3A 3EVZA 4JXJA 3FPFA 4LG1A 1ORIA 4HC4A 3TFWA 4KWCA 4E2WA 5CVJA 3KPYA 4Y30A 5C9ZA 2ZBQA 3A25A 3LSTA 4GUAA 4E2ZA 4ZTBA 4AX8A 4PYNA 1HNNA 2AVNA 3FUUA 5CM2Z 5E1BA 5FADA 4P7JA 2G71A 4X41A 1VE3A 3CJTA 2I7CA 3EGIA 5K8VA 5ERGB 2I62A 2XVMA 3BXOA 3PFHA 4OA8A 5K0LA 4X63A 4BLUA 1WXXA 3SSMA 3PLAE 2PXAA 2P3LA 3KU1A 2YXEA 3EVDA 3AXSA 2QRVA 3ORHA 4IKPA 2ZTHA 3OFJA 5E9QA 1FP2A 4EMSA 1B42A 2OPBA 2AOWA 3AWIA 3GDHA 1VL5A 4OQDA 1KR5A 4RTRA 1N7IA 4DA4A 3AJDA 3L8DA 5T67A 4F85A 4FSXA 2QM3A 1RJEA 3ER8A 1ZG3A 1SG9A 3B3GA 4RTLA 1RJFA 3PTAA 4Y2HA 1D2HA 4IV0A 2ZIGA 4O29A 3UZUA 5HIJA 5M5BA 2UYOA 1X19A 5BXYA 2YUIA 3BWMA 3A4TA 3O4FA 2OY0A 4RVFA 4DCMA 1EAMA 2B3TA 4EQZA 2YVLA 3CCFA 5GM1A 2OB2A 2YX1A 2E5WA 1NE2A 5FA5A 4C4AA 4OA5A 5EKUA 3TKAA 3C6MA 5EIWA 1VPTA 3MAGA 3SX0A 4IV8A 3UFBA 3T7SA 1UWVA 3DXYA 1NW3A 4QQNA 1TW2A 1L3CA 2GS9A 2NXNA 4WVLA 4YV0A 3UJDA 3TMAA 2ZIFA 2VDWA 5HILA 3DXXA 3FYCA 4EK9A 5FA8A 5DTQA 4DZRA 2N47A 3F4KA 1X1AA 1I1NA 3HNRA 4C06A 3IYLW 2A14A 1G6Q1 1WY7A 2PT9A 3SSOA 1YB2A 4BLWA 1JQDA 2R6ZA 2ZZMA 3BZBA 4CXMA 2IH2A 3RW9A 3KQTA 3FZGA 4FZVA 2ZULA 4ER7A 2HV9A 1M6EX 1KPIA 1JG1A 1DUSA 2AN3A 3QOXA 5FUBA 1D2CA 1NV8A 2DPMA 2FCAA 2WA2A 4BY9E 5EEGA 2IIPA 1EQAA 5EEHA 4AZVA 2G8NA 4CKBA 1INLA 3LL7A 4MHTA 3HVKA 2FPOA 2Z6AA 2JH9A 3KQVA 3ERCA 4XUCA 2C7QA 5EGSA 5E1OA 3CJRA 5BP7A 4CWAA 2VDVE 3BT7A 5F2OA 3G5TA 3JWGA 3FRHA 4PYLA 5JUWA 1Q0SA 3FRIA 2ZWAA 1YF3A 3GWZA 1KPHA 3FTFA 1QAOA 1EIZA 5K05A 2PJDA 3M33A 1Z3CA 1VBFA 4RTKA 3R9XB 1ZHFA 4P58A 1SQGA 3NDJA 5CD1A 5GWXA 4DQ0A 5EZQA 3EGEA 2QE6A 2GAFA 4HRAA 4FP9A 4G56A 4HGYA 4E70A 4F84A 3G8AA 5GIOE 1JTFA 4DF3A 5FTWA 4NECA 2ZZNA 5EIFA 3T0IA 4YUVA 3LDUA 4HSGA 3NTVA 5DM4A 4RTMA 3UJBA 3FUTA 3HCDA 2UZ4A 3EMDA 4XUEA 3U81A 1JSXA 2BR3A 3R24A 1X1DA 4GQBA 3VC1A 1P91A 2VDUE 3FPGA 1XDUA 4HTFA 3I58A 4LECA 5DLYA 3IHTA 4PIMA 3E05A 3QOWA 2DULA 1JG3A 3G89A 5DXAA 5DTMA 3HP7A 10MHA 1R8XA 4EKIA 3KR2A 1X1BA 2WA1A 2B2CA 5ICGA 1EJ0A 3MERA 3ER9A 3BUSA 3KQSA 3BGDA 5H02A 1L3BA 3NMUF 5FWAA 4YUXA 3KKZA 2O05A 1RI1A 3HEMA 3B5IA 4KRGA 9MHTA 2P7HA 5F2KA 3CBGA 2OXTA 2XYQA 4QTTB 4R8SA 3SM3A 4RTNA 4KIGA 4RX1A 4MQ4A 2JG3A 2V7EA 1XDSA 2R3SA 5T64A 2IDJA 5G02A 3THSA 3WSTA 2ZFUA 5KVAA 1UIRA 3REOA 4ISCA 2BH2A 4Z2YA 2FYTA 3VC2A 3MTIA 3E7PA 3B7PA 4R8RA 5CVUA 1NW8A 5T6BA 4PIPA 3SMQA 3PS9A 1N7JA 2GPYA 2EX4A 4IWNA 3UJ7A 2AN4A 3FUVA 3ELUA 4ATNA 1QYRA 4E33A 5MHTA 3I53A 2KW5A 3P2EA 5DWQA 3GXOA 3A7DA 5K03A 4QDKA 4OBXA 4C08A 2AOTB 3FPEA 1KHHA 3IV6A 2P35A 5DRTA 3UBTA 1VLMA 1XJ5A 5DRYA 2BM9A 3KQOA 3M6VA 4GC5A 4PNEA 2AOUA 4QVKA 1FJXA 2G1PA 1MJFA 3NVMB 3I64A 3CC8A 1ZGJA 4FT2A 2XYRA 1R6AA 5IH3A 1SKMA 5DXJA 3OFKA 3LCUA 3DP7A 3H2BA 4PWYA 1KPGA 4E2XA 3G2MA 4RTJA 4YUZA 1PJZA 2JHCA 2AOXA 4RVDA 2PSSA 2ZVJA 5D1HA 3HA3A 3KQWA 4FS8A 2B25A 4PYOA 4RTOA 3GU3A 5K0EA 1NT2A 3KPJA 2H1RA 5JR3A 2Y1WA 1VIDA 4H0NA 3S68A 5GOZA 3UA3A 1VP9A 3DXZA 3GRZA 4U7TB 5FWDA 3EVBA 4CTJA 2JHPA 4DM3A 4YUYA 4PGHA 4PINA 3KR1A 5B1SA 1R8YA 2IBTA 2O07A 5CVVA 4RYLA 5HIIA 3PVCA 4QPPA 3K0BA 1NKVA 2HTEA 4FGZA 1YFLA 2HNKA 1NW7A 5DSTA 1RI3A 5P8WA 5K0CA 1AQIA 1F38A 4C03A 5CCXA 3M6XA 3NDIA 2NP7A 2UYQA 4CTKA 3UJ6A 3KPVA 4GOLD 5F2NA 3O31A 3TKYA 2PWYA 1QAQA 1NBHA 5LSAA 3OU7A 3HM2A 3E23A 4E32A 5KYGA 2PV0A 3TQSA 1V39A 2CKDA 2AZTA 4BLVA 5FCDA 4HG2A 2PX4A 4GF5A 5EOVA 2ZSUA 5K01A 4MIKA 2P1DA 1UFKA 3GO4A 2CMGA 3NWEA 2OBFA 5FULA 2OB1A 1DCTA 2PXXA 1XCJA 5E2BA 3C3YA 5HZMA 2EJUA 2OYRA 3P2IA 4L7VA 2OO3A 2JJQA 2FHPA 3D2LA 2EG5A 2ESRA 3G7UA 4ER5A 1NW6A 3PT9A 3OZRA 5ICCA 2GH1A 1SUIA 1RJDA 3BKWA 3LKZA 1FPQA 3HVHA 1JG4A 3OZSA 3NWBA 4BP1A 5K0NA 3DOUA 3V97A 3HCCA 4CKCA 2P3OA 3GRRA 4M37A 2ZCJA 3VSEA 4K6MA 2XBMA 2NXCA 4A6EA 3G5LA 5K0FA 1O9GA 2BR4A 1TW3A 3AY0A 1BKYA 3AXTA 4RSRA 5LQUA 1R18A 2V74B 5K0BA 3UJ9A 1NBIA 5C1IA 5DT2A 4MWZA 3DLCA 1AQJA 3DLIA 2IFTA 4E30A 4YUWA 3OE5A 3HCFA 3HTXA 3LGAA 3JWIA 3SGLA 2QRVB 1DL5A 1X1CA 4FR0A 7MHTA 1QAMA 2ZBRA 3KPWA 4EVIA 3DUWA 3EVEA 4R6XA 5ICEA 3LCVB 3LPMA 3M4XA 4POOA 1RI4A 1TPYA 2ADMA 5IKMA 3TR6A 1KP9A 4KW7A 2PXCA 3G2QA 3VYWA 2ZLBA 5HFJA 2PT6A 3GNLA 3GRYA 3DH0A 2IH4A 3LBFA 4M36A 2GLUA 4YMGA 2VS1A 3ID6C 4GC9A 3UA4A 4E2YA 2LD4A 4YV2A 1MHTA 3THRA 3M70A 4QPNA 3RIEA 4GBED 5EPEA 2HMYB 3MB5A 3PFGA 4QTUB 4E31A 3DMFA 4CKEA 4FSDA 1L1EA 2IH5A 2YR0A 3CKKA 3ELYA 4ER0A 2NXJA 2ZWVA 2PBFA 4GOND 4M38A 4PCLA 4C04A 2YXDA 1ZGAA 2O57A 3EVGA 3GRUA 3KHKA 4QDJA 4X60A 4DMGA 1F3LA 2EFJA 3BGIA 1JR4A 3C0KA 1BOOA 2P41A 2I6GA 1O54A 1NW5A 2PLWA 4GOMD 4V0QA 5GINE 3P9CA 5HOQA 2IPXA 4EKGA 3Q7EA 3OE4A 5K0JA 2AVDA 1I9GA 3CJQA 2ONYA 3OU6A 3P9NA 4LWOA 4RTQA 4GOOD 3NVKI 1M6YA 2XVAA 1IM8A 1JQEA 3HA7A 1SVUA 5HIMA 2FK7A 5E9JA 1YZ3A 2IBSA 2BR5A 2XYVA 3LCCA 5CCBA 1QZZA 5EQJB 1SUSA 3R0QA 2PY6A 1IY9A 3K6RA 2PX2A 3P9IA 4V0RA 3M6WA 2F8LA 2IDKA 3BWBA 3FYDA 4RTSA 5EC8A 1JSZA 5K0GA 3B3JA 4PYJA 3C6KA 2AN5A 5D1NA 4PYKA 1XDZA 5DX8A 1ZQ9A 1R00A 1JG2A 4RVHA 3FTEA 3FUWA 4X61A 4HH4A 2I9KA 3BGVA 3EPPA 5FHRA 2C7PA 5FQNA 3GJYA 4QQKA 3EVAA 1JQ3A 3MTEA 2HWKA 5U4XA 1P1BA 1QANA 2GA9A 3LECA 3MQ2A 2P40A 4PCAA 1XTPA 5DM1A 3DMHA 8MHTA 4XCXA 4DCGA 5BW4A 5E1DA 3SXJA 1KXZA 3P9KA 2C7OA 3MGGA 3EEYA 3GRVA 4OQEA 5DM2A 2H00A 5LQRA 5GIPE 4RV9A 1RJGA 2PKWA 1KYZA 3P2KA 5EKXA 2QY6A 3TLJA 3TM4A 3EGVA 4R6WA 4F86A 1FBNA 2JH8A 3P8ZA 3A27A 5KS2A 1BC5A 3KQYA 1VQ1A 4PGGA 1O9HA 2BM8A 4B17A 3R3HA 4UOEA 4RTPA 5ICFA 3M6UA 1WS6A 1XCLA 1AF7A 2UYHA 5DTRA 1N2XA 2Q41A 2YQZA 2YTZA 3SSNA 4C07A 5LQNA 3UWPA 4AZTA 2HR1A 4KIFA 3LDFA 2YXLA 3TM5A 3Q87B 4ER6A 1H1DA 4KDRA 3FUXA 3PB3A 3EEOA 4DKJA 3MCZA 3DULA 3B3FA 3LKDA 5DM0A 4HTFB 3LX6A 2CL5A 1T43A 2PX5A 1HMYA 1WZNA 3QV2A 4PYMA 4HGZA 2BZGA 3CGGA 2G70A 2ZW9A 3ELWA 4R05A 4P7FA 3A7EA 3GGDA 3P71T 2CMHA 3DMGA 4YV1A 3G2PA 2OZVA 5KQSA 1AV6A 3O7WA 5C0OE 1M0EA 5BW5A 2AS0A 3KQMA 3UJCA 4AUKA 2PVCA 3A26A 1FP1D 3G2OA 2PGXA 3X0DA 5EMKA 2UYCA 5E8JA 1KIAA 5DX0A 3HA5A 1P39A 5EHGA 5HIKA 2ONZA 5EMLA 2CWWA 3P97A 3I9FA 2NP6A 4QVGA 3R6TA 2ORED 2ZIEA 2NYUA 4PYQA 3V8VA 5LQAA 2B9EA 5EVJA 5LQJA 2H11A 2Z6QA 3G88A 3SVZA 4OX9Y 3FTCA 3B89A 2IGTA 5FHQA 3KPUA 3ME5A 2C7RA 3G8BA 2AOTA 4XUDA 2JHAA 4KVZA 1EG2A 3EVCA 4WXHA 3UJAA 3HVJA 4C05A 2P7IA 2PX8A 3GIWA 2GB4A 1G38A 5DPMA 1RI2A 4PYIA 1NV9A 5GM2A 3PX2A 5CVDA 3OCJA 1G55A 2VZ9A 4YMHA 1OR8A 3C3PA 3FTDA 3LBYA 3ANXA 3NW9A 4KDCA 2P8JA 5GP1A 2O06A 4OBWA 3CVOA 5DSXA 5EG5A 4X1OA 2AOUB 1U2ZA 3JWJA 5EMMA 3TPZA 2FRXA 5CUQA 3LDGA 1P1CA 1YFJA 1YZHA 5HEKA 3EMBA 4P7KA 2WK1A 3FPJA 3ELDA 1D2GA 3KR0A 4PONA 1ZKDA 4RVGA 3KR9A 4ER3A 2ERCA 4AZWA 1VP3A 1EJ6A 1JTEA 3BWYA 3IEIA 3HCBA 5FQOA 4LWPA 1Q0TA 3OZTA 3DTNA 5LR6A 3OPNA 2IP2A 5CVEA 5E8RA 1G8SA 3T7TA 3OU2A 1RI5A 5DX1A 2Z6UA 3BKXA 3HVIA 4A6DA 3I5UA 3EVFA 1L3IA 3GCZA 1WXWA 5E2AA 2EJTA 5KQRA 3NJRA 1IXKA 1ORHA 4BP3A 2ZZKA 3KQPA 4M7RA 3T7RA 4FT4A 5K09A 2FK8A 1WG8A 3LHDA 1G60A 2P3QA 1KYWA 2PWPA 3TOSA 5E9WA 1YUBA 3BWCA 2AOVA 3FPHA 1XXLA 3HCEA 3MHTA 2OKCA 5EMJA 3JWHA 3DR5A 3MCTA 3TRKA 5EZSA 1PRYA 4GEKA 2NXEA 2K4MA 1XVAA
chains in the Genus database with same CATH superfamily
5BOVA 1FVHA 2FPPB 2PTGA 1TEHA 4B45A 1JJBA 1UQRA 3K9QO 5C7OO 1WIWA 4JC4A 3O5AA 1R74A 3ZUPA 2I6FA 1VJ0A 1SXIA 1FDVA 4GI1A 2YXNA 4IKOA 1PR2A 2V6JA 1O58A 2GZSA 3LUJA 2DU8A 3JAKB 1N1EA 4PQRA 1LU9A 1NYTA 2XNKA 2ODTX 3AJ8A 3GA5A 3KEQA 4ZT2A 4EO7A 2JAUA 3KFVA 3KWMA 2CF5A 2OV4A 2XWPA 3B85A 4E1VA 3JYNA 1KY5A 2RC5A 3M9WA 2JKZA 1UEXC 1SUPA 1IN6A 4BAGA 3CKLA 4QRDA 1J09A 1ADYA 1DAMA 5AKZA 1Z26A 1T8YA 3OBBA 4C0HA 1AMUA 1BS9A 4JP1A 3WP0A 1BHSA 4YMUA 2FPRA 5FUVA 3OCUA 4H1UA 1PQ4A 4LYHA 121PA 4P7BA 3DF7A 4RS3A 4DQXA 2XVMA 4M7PA 2VHQA 5AI6A 4G9EA 2FW0A 1HYHA 4FOOA 3VU9B 5KSOA 2JD1A 3DWFA 3WYEA 1U1IA 1Y3CE 1YRQA 3OFJA 4ZVPA 3Q7QA 3OMXA 1DQYA 1JH8A 5B7PA 4BNWA 1Z7BA 1H5NA 4ZOBA 5P21A 1ZKMA 2G1JA 2I4LA 3M34A 3ICVA 3PWSA 3AOEA 1ULTA 3H5RA 4J0EA 2C4VA 1XP8A 1MEOA 1FLNA 1J7KA 1PNOA 2F64A 3I8XA 2FPLA 4KNWA 2PE5A 4MYUA 4JJEA 5EPPA 1N6PA 4O29A 2DPLA 3HVRA 2HRDA 2B36A 1ZK3A 2ON6A 3CLRC 1Q7EA 2W70A 4F3CA 5BRJA 1TJNA 2I6QA 3IBYA 1V1MB 2B3TA 4DLBA 3PWZA 4GM1A 2OXCA 3E7FA 3KSMA 1GQFA 4PX3A 1BCSA 3VQTA 1DX9A 4CKEB 2HHAA 3MK31 4GAEA 4OHWA 4R2WA 1DCFA 4MKXA 2W2XA 3BA6A 2P62A 4RGYA 3DT9A 4JEIA 1QRAA 1FTNA 2JIQA 2OT3B 5AM0A 1AKNA 1W9MA 3LO8A 3UFBA 3DXYA 1NW3A 5CNIA 1Y7PA 2P68A 1O7JA 3FYCA 4NK4A 1IHYA 3B1KA 4G8BA 4PXYA 2FWJA 1I1NA 2GCIA 2UZAA 1T3TA 4RIIA 3N6RA 4C06A 5JROA 1UK6A 3T61A 2R0QC 3OO0A 3U4IA 3UK2A 4YEDA 4BXOB 2HHJA 4GGPA 1FK8A 4CGYA 4CXMA 4L74A 2ZXUA 2V54A 4JI1B 3AY3A 1NULA 3JQBA 4GLOA 4KZPA 4ZV9A 5L6MB 1VG9B 2HV9A 3GT0A 3V7FA 4W5HA 1IBKB 1ZOSA 3UT5A 1TF5A 5FUBA 1E1CA 3G0DA 4D02A 2D1YA 4FFVA 1W8DA 2WVHA 4GI5A 4DIMA 5JYCA 2HSEA 1G6KA 2CMDA 3N0RA 3ILYA 4HDCA 1R6VA 2XUZA 4NAVA 4HGPA 4TVKA 2X15A 1XPOA 1LEHA 1U7ZA 1KF0A 1O2DA 1UBKS 2VBIA 1A2OA 2ZTSA 2WW8A 1MORA 2M98A 3RIXA 2ACKA 1WO8A 2Y6UA 1BH6A 2OD2A 1OXVA 1E9BA 2C4MA 4P22A 5EFOA 1BG6A 3PR3A 5M34A 4RA6A 1WWKA 1PZNA 4HUTA 4CWAA 2R00A 2VDVE 1HUQA 2HLHA 1TTQB 3EEQA 3NKVA 2ZT6A 1AZTA 4BJHB 1V7PC 5FJIA 1N3BA 2GF9A 3GWGA 3I34X 2Q5EA 3MWKA 2NPFA 3TQRA 4D42A 4LOKA 4CTMA 2DG2A 3DGFC 1KO1A 5LZ5A 1FFAA 1ZD9A 3SKXA 3ZWCA 2WHPA 3MJDA 2HU2A 1UMCB 4HNAB 1NJ2A 1GZ4A 1XZQA 4M49A 5H9VA 4Q9IA 3OESA 3RHZA 2RJNA 2W0SA 4UE3S 1L1RA 1PS0A 2Q45A 2XVZA 3I12A 1V3QE 4Z6KA 3V6MA 3UJBA 4TWRA 2GEFA 1OLSA 1Q0HA 3WOHA 4HX5A 3WV5A 2GZ3A 4MUGA 2C3MA 2IOFA 2JGNA 2RI1A 3VKWA 1HM5A 1OBVA 2AWOA 2GJ4A 3KOYA 3QUQA 1PEKE 3SDBA 2FUNB 3TOZA 3G89A 5K3FB 3SHWA 2BW0A 3VA7A 1G16A 4BO8A 1LX6A 5AXCA 1Z0UA 4G67A 3HSKA 2A8YA 2W2LA 2WA1A 1SK9A 4KUGA 3G85A 2O2JA 3NFRA 3ZV6A 1MAVA 2OILA 2Z56A 4Q4LA 1KKLA 3NMUF 4N5LA 5CH3A 5CYOA 3UV6A 2EF1A 1SXGA 3EPKA 5DNYB 1FCJA 3IDQA 4DJJA 3HJHA 4EL5A 4WFQA 1IOLA 2XYQA 4REQA 2Q2QA 3I32A 2JH3A 3MWYW 4Q3EA 2Z2ZA 2XT6A 3JY6A 2IDJA 4L3VA 2J6BA 4WEOA 3VR6A 3IJEB 3W3AA 4IH1A 2EX0A 3TBKA 3U1VA 4ZYVA 5KUTA 2G5TA 4Y7DA 1OWOA 1JFFA 3ETHA 4PQEA 1Q0LA 4S1PA 3SKVA 3GGCA 4B3SB 3AFMA 3AERA 4R84A 2VNHA 2RONA 2OL4A 3OZAA 4LRWA 2OA0A 2NXWA 1C3VA 5T6BA 5HKAA 5J2TB 1SQSA 1AK2A 1O6BA 3SMQA 5KO2A 5DBIA 5JSUA 1QPZA 4QXAA 5JCOA 1VG8A 3WP1B 2HD4A 4AMYA 3QUSA 4MDEA 3T1QA 4YT5A 5REQA 2TSYB 5BMOA 2REXB 4OSEA 1UXKA 5ITZB 1K3UB 1KQOA 1Q1AA 1VB5A 2JHFA 3JQ8B 4OAOA 3GLFA 1DINA 3F0TA 3ICWA 2F4NA 3LRXA 3SHVA 2R1UA 3MF4A 2QPOA 5KTOA 1A7KA 1KHHA 2VDNB 3OIUA 4F11A 4CT5A 3B78A 2R44A 4ZA2A 3TDKA 1VXRA 3OOHA 2EJWA 5JNRA 3UGTA 4ZTUB 2EZ4A 1YUNA 2AOUA 5BN4B 2WWIA 3DBIA 4KFCA 3ORYA 1UPCA 3M9LA 2J5XA 2QJWA 4BE4A 2Q2NA 2LKDA 3Q8LA 1SG0A 2DLDA 5COAA 3GLTA 3IODA 5L4LA 2GCOB 2QRQA 4R9VA 2BGMA 2KBFA 3BMQB 1RS0A 2OOSA 3HN2A 4QXMA 4ZOAA 2OO5A 1YZNA 2PWBA 2ZVJA 1OU4A 1P0CA 2Q1AX 2B25A 1GV0A 1C3OB 2WAOA 1JHRA 1HTWA 2XA9A 3WMFA 2IF2A 4CLXA 1IBMB 2HT6A 3LXRA 3NHKA 2ASVA 4L08A 1DI0A 2JATA 3A9RA 3OTQA 2ZRJA 3ZI7A 3G6WA 1XBTA 1P2SA 2Q6KA 4G1EB 1FP7A 1TKAA 1KZ9A 2J9FA 3A1NA 1C8BA 1W0KA 2OP1A 3A2LA 3E9ZA 4I3GA 4MGHA 4WXYB 3OQIB 4A27A 1D0VA 3CLTC 3QBJA 4WASA 2VJNA 1N8KA 1PJLA 4PTYA 1TEZA 2FWPA 5ALHA 2JLAA 4R2MA 4CV2A 4WY2A 4P2GA 5K0CA 4PANA 5DBGA 1YFKA 3PF8A 4GS5A 5DHQA 5DU2A 2PU7A 2QLJA 3GRKA 2X9NA 4D46A 3UYLA 3SXUB 1JP7A 4I50F 9GPBA 1A9QA 2FZVA 3LFHA 2PWYA 4QJ4A 3VNBA 4XWKA 4QHTA 1ECBA 3IOMA 4EAAA 2P75A 2QUKA 1SOWA 1AG9A 4HG2A 3CEPB 4GF5A 5EOVA 2A1UB 2ZSUA 1XZGA 2EKQA 4UPDA 5FR2A 3LWBA 2DEUA 4XGKA 3TVDA 3LCRA 4N6GA 9ABPA 1GNLA 2PXXA 2ZPTX 1Y4DE 3BIJA 4PFKA 4U8HA 3P2IA 4L7VA 4YJ2A 3BPSA 2VH1A 1EE2A 3HPQA 3M5CA 4ALJA 3NB0A 2HRCA 1ACJA 1NW6A 3PE3A 1KDOA 1M10A 2QP4A 3DNMA 4BQFA 4Z4FA 1RYEA 4GLFA 4OB7A 3UYKA 4BP1A 2HPHA 1QOPB 5JMWA 3V97A 5F51A 1FSFA 1K5GA 1FS4A 1ORDA 1X1SA 3Q1LA 3V7YA 4QXQA 3MWGA 4UMVA 2JRCA 1I2MA 4IUBS 4Q7EA 2WVAA 2ZAGA 4J9UE 4EUKA 5HF5A 4PG6A 4MWZA 1MJGM 4F7WA 5CG1A 5ICMA 3IHKA 4JBIA 3QTLA 3LGAA 4OB8A 4FIBA 5G3YA 4G37A 3UH1A 1A7AA 2J9YB 5I3CA 4EVQA 3PEEA 3TMYA 1OZ0A 3GLKA 1Z5NA 16PKA 2WP8J 4MUFA 3L43A 4BJ3A 4O63O 5B3JA 2H3EA 2J30A 3FROA 2ODNA 3G2QA 4G9GA 1Y6FA 3THWB 4TYYA 3NGLA 1BYIA 1A9RA 3ZWNA 1G6OA 1XRNA 4P3OA 2ZYIA 4RE5A 3GPLA 1Z6XA 1P7ZA 3EQ8A 4NU8X 4ZO6A 1ATZA 5ALFA 3U44A 1MHTA 5IT0A 2LDXA 1K8ZB 3UW1A 3MWDB 1BMTA 3WGYA 3CSDA 3PKJA 2AHOA 1GFSA 1P1HA 2CNBA 2D62A 4LISA 2ZK7A 4XIIA 3TLZA 1Q0UA 1OX6A 4BUCA 2VT3A 1QK3A 1OWNA 3JRXA 1Z63A 1MB4A 1T6BY 2ZUVA 4YAOA 1C5KA 1E62A 2ZB2A 4MJ7A 4CIVA 5JNSA 4MNTA 1X7YA 4V0QA 5JJCA 3QU7A 4HGRA 3RVQA 2HK9A 3MSXA 5TNXA 5HOQA 3UMRA 2V4ZA 5FO1A 2WTXA 3ZC3A 1KWKA 1GN9A 3K05A 4B3JA 4OQMA 5K5EA 2XVAA 1RM5A 2J8ZA 1IM8A 1H65A 1JQEA 2JI8A 3B5EA 1USVA 3P1JA 3QMVA 2BR5A 5KJFA 5BXQC 4Q4DA 1QZZA 4BLTA 1B4DA 3OZVA 3S2ZA 3OQJA 1TK3A 4M8KA 3WHLA 5I4IA 4BPBA 3GGGA 1SIUA 2IY9A 3OKFA 4X1YB 3BWBA 4RIFA 4AJPA 3W9SA 3ES9A 5TVKA 4JLVA 3AR9A 2Z0MA 1ZUNA 5D1NA 1GGMA 2PZGA 3ISVA 1T5LA 2Q2WA 4KGDA 5ESWA 4UNRA 3V4RA 4FN5A 1PNRA 1II0A 3ML1A 1CUXA 1EAYA 3QFHA 2HWKA 1HL3A 2YV1A 5HX7A 1P1BA 3CVJA 3IP6A 4GOKA 4FI3C 3SI7A 2C8JA 3UK6A 5KC8A 4PCAA 3DW1X 1XTPA 2R8OA 5DM1A 3T1YB 1BWQA 4ACAA 3GUCA 3AF1A 4HCJA 4JL5A 1ADFA 3O2JA 1P5FA 4G5GA 3C6QA 1FNNA 5A7GA 3CZ4A 2XRMA 1UDCA 1EWQA 1QCSA 1NWCA 1YHNA 4NS4A 1XMIA 5AVSA 3AQIA 3PITA 1NNSA 4NU0A 3AF5A 4RS4A 3RVLA 2X5JO 3P8ZA 3A27A 5AIBA 1JBQA 4F4UA 2PJZA 1U2TA 2R6AA 5HUQA 2ODPA 4GMKA 2G83A 1JDJA 2FKNA 1Z75A 3EXEA 4J07A 4YH1A 1WS6A 2XHEA 2IH5A 3T4PA 1PK9A 2QLFA 3V4PB 3RUIA 2R2AA 3SQDA 3I8SA 4C07A 5JZOA 1EESA 3D8TA 3ORFA 4KQCA 4NZYA 2FSVC 4YQYA 1UDBA 3GJ3A 4P3KA 3EZ2A 5ISMA 3PUIA 2HSZA 1OIWA 1ZNQO 3QVSA 4UU7A 3W1VA 2B69A 4CODB 1ZMTA 5LPNA 5FH9A 1I3LA 2PX5A 2X8AA 2CLHB 2RGGA 3O8QA 3ZV4A 4D9MA 4OQLA 2RH8A 3QJYA 5DM70 1Z07A 4L28A 3CO5A 4ONEA 4P7FA 4DUGD 3OUUA 3FVRA 5T8KA 3WADA 2ONCA 3PZRA 3ZZTA 4YY3B 1E8MA 5TEVA 3N2EA 4YA6A 3W6UA 2WTMA 5AI5A 3G2PA 3FNFA 3M6AA 4KSCA 3QELA 5I8ZA 2HTFA 5LZ8A 5C3MA 1G5PA 3K0AB 4OGLA 2BE9A 3F3SA 4YRJA 1KVSA 2PJHB 1TUEA 4L72A 1U8CB 2PUWA 5EFZA 1TDJA 4NHEA 5DSZA 3WGZA 3INGA 3S2GA 4ZYTA 3TFOA 2GJ8A 4G0NA 5EE9A 3ZHBA 4EFNA 4MB2A 3MUFA 5EXXA 3FH0A 4QKQA 5TARA 3BAZA 4J1TA 1LD3A 3I45A 4XYMA 1USUA 3TAHA 4D8WA 4YBRA 4Y1RA 4D5EA 3E18A 2HBYA 3BICA 4K6GA 2XAAA 3RG2A 4Z9FA 2JGJA 1KQGA 4DE5A 1GA6A 4XUDA 1KAEA 2F3SA 4YCCA 4O2AA 2H1VA 3LRTA 3TTTA 4P86A 1E0AA 1ILEA 2I34A 2FETA 3OZIA 4D4HA 3QEMB 3CIOA 2M1XA 3UFXB 1CUDA 4EHNA 8OHMA 4IFTA 3PGKA 5CBKA 1OH6A 3RRNA 3NW9A 5G0UA 1T9AA 2O06A 3UAZA 1H2FA 1MRNA 4I81A 4TKMA 4ZVSA 1ORRA 2QD3A 5CA1F 2WKRA 3AI2A 3GZNA 1WETA 3A6JA 3DO5A 4Y2RA 1J8YF 1KI2A 2BRUA 3FSRA 1R66A 3GJ6A 1VL0A 1Z4LA 2JS7A 2ZYHA 3EMBA 4JY7A 5ILQA 3KJIA 2N1MA 2C04A 2BDEA 1E4OA 3EUWA 2B20A 2VPIA 1B3BA 3GH1A 4ER3A 4LOIA 2OECA 2Q5HA 3MJHA 4LZLA 3QBEA 1E5VA 4DIDA 4WMLA 5CA0B 1F1BA 3T5CA 2H2IA 3Q7SA 3I2KA 4IKEA 3DTNA 5EJ8A 3AUAA 3HC7A 1BDMA 5CVEA 4GQAA 3HPRA 5LU9A 3U17A 3ILVA 4MV7A 4NZ9A 2OWDA 4BKMA 4B3XA 2D74A 3I5UA 1EXNA 2O2CA 4IHJB 1C1DB 4GEGA 1J0AA 4WVFA 1GR1A 1IXKA 4X84A 4M7RA 1Z2OX 1N2CE 3Q9LA 4GPZA 1XTJA 3HLYA 4HY3A 4UULA 1B3RA 1T3LA 3CNEA 5KNDA 1LBIA 3QKIA 4A36A 4YJFB 4EPVA 2FPGA 3DVRX 3GG2A 1U9JA 1JZSA 4OREX 1KEUA 4E6EA 2K4MA 1AY0A 2VPZA 3KM0A 3D4IA 4A2QA 2P1ZA 5FJJA 1WBDA 1GA4A 1LLQA 1C30A 1EXDA 1VMAA 2F9FA 2HMWA 1GILA 2QX8A 2ZBPA 4KN9S 3BAFA 3HEBA 5IYZF 3QWHA 4Q18A 4RWZA 3EF1A 3RSGA 4XEUA 2PZAA 4I50A 2RHTA 2DFLA 3KQQA 2O7QA 3WVNA 4IZ6A 3QX7A 5EYPA 4AWBA 5BQFA 4OKNA 5TMPA 3LTNC 4G5QA 4YRRA 1RQXA 3ZW8A 1KMIY 4HRYA 9LDTA 1L7EA 3GA7A 1RWNA 2BEVB 4R1MA 3VPAA 2VP3A 3EVZA 3KV3O 3RVRA 5CDFA 4ETNA 3QEOA 4MSUA 4L6CA 4RENA 3TLMA 2UUBB 3D3NA 1X38A 1TM2A 1M2JA 1IY8A 4C2TA 4TL9A 4G5XA 1T2NA 1G9TA 3RYFB 2WLTA 1A04A 2QTVA 5DLDA 2IYAA 1WW8A 3ITKA 2WU1A 3MPOA 4BVBA 1J0BA 1RAFA 4G1MB 2WUDA 1M0SA 2HZBA 2C9BA 2CJXA 2J3HA 4RD6A 1KNXA 4R1UA 2PXAA 5HOEA 1ST3A 2DQZA 3OEEA 2QRVA 3T1HB 4B0PA 3KYJB 1FJHA 4FOLA 3GUHA 4J76A 3AWIA 4NH4A 2MCFA 5FD8A 2QQ0A 4BE7B 3B3AA 4MI3A 1FLVA 2JLZA 4AKTA 4H7HA 4UUMA 1K75A 5KKCA 3FWKA 1UXOA 2OE2A 2WUFA 1OH5A 5ICSA 1V71A 2FN9A 4MV6A 4PNPA 4YGYA 2FMUA 4YP5A 3SR3A 1X19A 2C88A 1H1LB 1OJLA 3AUUA 5EL0A 4KTVE 4RVFA 4M0FA 3I0ZA 3SJBA 4D0GA 2ZRAA 5BN3B 2A9VA 3NNDA 3RYIA 2HJRA 1LI5A 1FUKA 1W581 3MTAA 1VBMA 3NRJA 5FI5A 3B1WA 2CV2A 2VPTA 2YJGA 3CNQS 3KLNA 1VLQA 2MOKA 4BVAA 3LWZA 3C6MA 3TGLA 1TT5A 2R8XA 3TLAA 3W9UA 3MAGA 3S8EA 2Q4EA 1FNSA 5EIOA 1T91A 2JEOA 1L7VC 3I4FA 1Q2UA 1BHO1 1H2BA 3TTUA 4YV0A 3PI6A 1YQXA 4RMGA 1CUUA 2EWMA 2A94A 3IVMA 1LJLA 2PLRA 2ZIXA 4EK9A 3LOPA 4IX1A 3B2QA 3ECAA 1YBAA 2CHQA 1CQIA 3F4KA 3O8LA 1ACLA 2GZAA 2QD1A 5E3IA 3RYCB 1WY7A 2PT9A 1CBUA 1JLLA 4JLSA 3BZBA 2OG2A 3LE8A 2LRHA 2X3FA 4PCUA 2DQ4A 2GMWA 2IH2A 4KR7A 3LT1A 1YB5A 3NRBA 1BEZA 4NF2A 5I9LA 2AG5A 1WUHS 5EPUA 4WL0A 4B71A 4JKOA 4FFNA 2FCAA 4F21A 1N2OA 3O03A 3SZMA 4QM7A 2I8AA 3ZNQA 4BB6A 1EQAA 3MJTA 3GI1A 2Q19X 1DIHA 5K4GA 2QAJA 2R8BA 2JLWA 1ISHA 1TAHA 4D1YA 5BR4A 4NOMA 3R6LA 4H4DA 2FF5A 4J49A 4PHFA 2FPOA 4DZTA 2N9UA 4OHVA 3DTVA 1USWA 2DHDA 3SIXA 2C7QA 1VHJA 2H92A 2QTAA 1KMQA 3LOUA 3ZWXA 4ZOQI 1H3EA 2M6LA 5AKYA 5EE5B 5HVNA 3DDSA 2XDPA 3C43A 1SMKA 4L85A 2A5FA 4W5JA 2XE4A 1FX0A 1YZYA 1KVTA 3N2KA 2FSGA 1W59A 5A3SA 4F4DA 5ITWA 1GEGA 4O02B 3TQOA 4AG5A 1EDEA 1SQGA 4KVFA 4Y8VA 5CD1A 2ZU6A 5GWXA 1SHUX 1KY2A 3ZBPA 1YASA 2FEOA 2DTDA 3BBLA 2QRGA 1TRHA 1G0NA 1UIMA 3CRQA 3PX7A 1L4YA 1SCBA 3SSAA 1NJFA 3WNZA 2COEA 4TV9F 4BC1A 1YDWA 1GPNA 1XLTA 3ESRA 2C5BA 1W5FA 3PNMA 1SXQA 4G0WA 4ZQBA 1EVIA 4DDVA 4AYTA 4F5WA 3U81A 3BCSA 3PEWA 4LJ6A 3HUFA 2BGJA 4EI7A 3W4JA 1QE0A 2O8CB 2IIQA 4MR9B 2FWBA 3JD4A 1RW4A 1LNQA 2H1IA 1KDYA 2C96A 1N25A 2LW6A 2CJPA 5EXEA 2MM2A 5AKIA 1Z56C 3UMSA 5IN5A 1R8XA 3GJ8A 2FRVA 1QHEA 5BWLA 1NU6A 5JG7A 5DASA 3QYJA 4O08A 4QUDA 4AU1A 4D81A 4UHBA 4KPEC 4TL7A 4PF1A 1GKYA 1QM5A 4AIRA 2IHUA 4CCSA 1QU3A 3K96A 1QO0D 4HWSA 4E94A 4X00A 3GR6A 5ALEA 1DAIA 1MN6A 2X7JA 3LHFA 4UBIA 1JXMA 4BNZA 2SCUA 2OFPA 4V0OA 3AY6A 4MCAA 2OQVA 1XRJA 4MHOA 2IUEA 3TLGB 3K0HA 1GADO 1U0GA 4FC7A 5K9ZA 1O5TA 1TM4E 3OECA 5A7FA 1MAAA 2ZSAA 3I6BA 1PF7E 4Y2SA 4ZVQA 1XMSA 4E3ZA 4F9GA 1YS4A 3N7UA 1VKJA 4N3NA 4WCFC 3W6OA 1ZD4A 1XHFA 3CFYA 3KK0A 1X80A 3D2AA 2H1OA 5K0SA 1EWYA 1KZ6A 1PWHA 1UXIA 1V1JA 3EPJA 1CRZA 1GSIA 2HF2A 3PSAA 5DN6D 3OETA 1EKXA 4B48A 2AOTB 5FL7A 3CF4A 2ZQYA 1AA9A 4CQJA 1E2BA 2XADA 1SFRA 2W6CX 5A1JA 3CKMA 3COJA 3UMFA 1G7RA 4CCYA 4LX8A 4NDNE 2VT7A 3CC8A 4PZLA 1YGYA 2QRNA 3H16A 4Y6SA 1EFAA 2XA1A 2PRSA 3ZXXA 1TA4A 1G0OA 4NPHA 4EKNB 1CIJA 1O87A 3MMXA 4U6QA 1OBOA 2HSGA 1NMZA 2AUNA 4PWYA 1K7YA 3N07A 2HT1A 1XTRA 2AOXA 1VJ5A 3A4LA 2XCSB 5AVZA 1Y3IA 5D1HA 3HA3A 1NVVR 4NJMA 3PCXA 4WCVA 4RTOA 3HXKA 4RCZA 3ZW7A 4XVHA 4TMTA 4O4HF 1OYOA 1QV7A 1ZN2A 4PM4A 4BNDA 2ZI9A 2Z57A 1C7JA 1AURA 3SZGA 3Q6NA 4EVRA 2OM6A 2BMWA 3R40A 1RXUA 3HJNA 1Y8AA 3DBLA 2WSSD 4F2GA 1QE5A 3AL0C 4G4GA 2QTLA 2VYFA 3B1XA 1N9GA 4J2TA 4JLWA 2GBPA 3PVCA 3K0BA 4M86A 5DMHA 1ONSA 1RU3A 1PYOA 4G97A 2IS2A 1Y6RA 2F1RA 4L4XA 4B46A 1BDIA 5P8WA 3ZU4A 1ZHHA 2RGWA 2DY1A 2XMQA 4NZOA 1KWGA 1SWVA 3IOBA 4GR9A 1CY8A 3WFJA 1BEEA 1KYVA 2P8SA 1R16A 3AHCA 1DCMA 3M4NA 4S1WA 3UJ6A 1YKSA 4FIZA 1W1WA 4TRJA 4HLUC 3V4ZA 3WL6A 4CVNA 1L7RA 3KEOA 5A2GA 5B2EA 1LK5A 2AJLI 1ZFNA 3L7KA 5LSAA 2O2EA 3EFOA 3BGSA 1O8BA 2LGJA 3TQSA 5F1YA 1UC4B 2H1FA 3D0OA 5EHNA 3F98A 3HYTA 1GPWB 1J0DA 2GYWA 1SKUA 3G2NA 4ZO8A 5K3SA 1NLUA 3JQGA 1LSUA 5HQTA 1R0WA 3BFPA 1V5FA 4ANFA 1NPTO 3Q2OA 4KPFC 4UM9B 1KP2A 5HZMA 3DO6A 3IEPA 1POWA 3A3PA 2CHGA 1U0HC 2YHIA 1WNTA 2YY6A 2ECOA 1NYLA 5EJFA 1Z68A 1O5OA 2R68A 5HTKA 6ADHA 2VRWA 7REQA 2YHSA 1G66A 2WIAA 3HJCA 4FI3F 4UFOA 1FNMA 2FEMA 2QL9A 4TYMA 1F20A 1GZ3A 1IUPA 1HGXA 1CUVA 2BV3A 2E82A 4TYPA 3WIDA 1P2FA 5HJ5A 5TX7A 1A71A 5HRAA 5ES3A 3NNSA 3DLIA 1MC1A 3P26A 3WBJA 4RWEA 3MS7A 2DX7A 4JBYA 1DO8A 2JJ2A 3AR2A 4KLAA 1W94A 1R3UA 1XZ8A 1AGPA 4WJZA 4X1KA 5EUMA 3U09A 3ZBQA 2AEFA 2IP4A 4IQ0A 1BSVA 4FR2A 3UAYA 5BV0A 4NCIA 4TLMB 1VI5A 2Z8XA 4OMDA 5KTKA 3IP3A 1QIEA 3S4YA 4IF6A 3BJMA 1K7FB 3ODGA 2ZETA 4BNTA 1U3GA 1HYQA 3SS7X 4F56A 3A37A 3TIXB 3C5HA 2XOKA 3TI7A 4MRNA 2ID7A 2F6RA 2WIKA 5JY1A 3W8RA 3EMKA 3QXSA 4QDUA 2F1IA 4WUVA 4CKYA 2P90A 1DTEA 1MP0A 1ZK0A 2Y1CA 4PZZA 2FN8A 3K7EA 3TSZA 2PBFA 4BNJA 1X14A 4C2BA 1Z0IA 1CEYA 1LLUA 3EXFB 4G4SP 2E87A 3UAOA 2CLDX 1BCSB 3OAAA 2C5LA 4ENPA 1OAOC 1N36B 1EFVA 2EFJA 3C6YA 3LHKA 2M9MA 3H0CA 4JLBA 4J03A 3ZU5A 4BN4A 4IOJA 2BKLA 5H4GA 1HX7A 4LY6A 4D3ZA 1HQKA 2TS1A 3OZUA 4NZMA 2FNAA 3ADBA 421PA 3T3NA 4ZAWA 4CETA 3GN2A 1GYRA 4RIGA 4GOOD 1JPJA 3NETA 1KAQA 4WKNA 3OCXA 5CG2A 3A1DA 2FW8A 5L6LB 3DOJA 4UM8B 1IN7A 1Z06A 4WLEA 5BQ3A 2O3QA 1CRLA 1E96A 4EY4A 3B3JA 4DYVA 3HS3A 3AETA 1XDZA 4AI6A 4HZGA 2X41A 1XB2A 3UT5B 1QR6A 5K6TA 1E1CB 2NLOA 2OFFA 4BQEA 2B34A 5ABPA 3QA3E 4M0EA 2IWRA 1IWPB 2A9PA 4XD7A 4AD8A 5TRTA 3E9EA 3GIDA 3JASB 4YK7A 5E6RA 2LBPA 2QD4A 5M3BA 1V1RB 2ZJ7A 1E6CA 2QK4A 4IJ6A 4FTWA 4URVR 1FC0A 2ZRLA 1Z33A 2YWJA 3KWLA 3Q7IA 4JHLA 4RA6B 1K8XB 1GPAA 1F7VA 1S1CA 4Z4GA 5ALDA 2V6BA 3MTGA 1JHPA 2H4XA 3NBAA 5TE9A 1O89A 2VYND 3MD9A 3NQ41 2E9SA 3NAMA 3OOSA 4R4JA 4RXUA 4QG3A 3I72A 4XYEA 1XA4A 5I5EA 1ZM9A 4RV0A 1O9HA 2WHPB 3DEFA 1QCCA 3AV3A 2C2OA 1NIJA 3WLLA 2L42A 2R751 2RHRA 2AKYA 1QJCA 1UH5A 3BWDD 3AHEA 4FEYA 4M0UA 1UZNA 2NO6A 3EZLA 4X45A 4AZTA 4QHSA 4E5MA 3AJEA 4TV9A 1OLSB 3WFIA 3KLMX 1ZVQA 3IMEA 4EX6A 3IQEA 3TKLA 3SC4A 1HDCA 3NPMA 2G17A 4LI3X 3SPXA 4AF6A 4ARUA 1IL0A 1LKZA 4MCIA 2WHEA 4GNRA 1C4WA 4UMDA 4FPXA 3S3TA 4D3XA 3R7LA 1NJ8A 4I6EA 3DL7A 4HGZA 5J63A 3HXOA 2G76A 2B8EA 2X5XA 3ELWA 5TS2A 3T06B 3WL5A 3UCFA 1DARA 1R4ZA 4IIVA 3RQSA 4UCXA 3G9XA 2HF7A 3R3ZA 1F2TA 4OK6A 4ECEA 5KQSA 4KYIB 1AV6A 3GRPA 4D3FA 3VR0A 2I2WA 4FDUA 1DFGA 1PG0A 2PVCA 5BMVA 5BWMA 3GFSA 4REQB 3C4QA 3ZHQA 1E9CA 2OC4A 2PGXA 3V8MA 1NMQA 2QTHA 3R3YA 4LJ9A 5G4KA 5E8JA 4N03A 4B6SA 5DX0A 1QTQA 3OLWA 2IQ5A 1JFFB 3AFOA 2VATA 4R5HA 3L1JA 4HQOA 4BLOA 4CIXA 4GM0A 2NP6A 3RI3A 1XZMA 3AERB 4C21A 3FNRA 2EHDA 1PFVA 1QG0A 1A9PA 2Z6QA 4I6JA 3I2JA 3OA0A 4BV2A 3FTCA 1EVJA 5NLLA 5ECDA 4Z1MD 1CDOA 5C18A 1BVRA 3ME5A 3O4IA 3P0IA 4HI0E 4AJEA 4YDSA 3ZWDA 5REQB 2OYSA 4B47A 2EX1A 2XQVA 2HXYA 4CCAA 2ZJ0A 1GFIA 1YR7A 4WLOA 4CF3A 1J6UA 3DKKA 5FOQA 3GHHA 1LS1A 1RI2A 4N5DA 3AI1A 1Z7WA 2QD2A 1E8NA 1GG8A 1QYXA 2BGIA 5L3RA 4BTLA 2VZ9A 5BWCA 3CCCA 1FTWA 2EJBA 1XK7A 1CF2O 4K9QA 1Q3TA 4X1OA 3A32A 2AOUB 3CV3A 2WJZB 4MI9A 2NUPA 2W00A 5D00A 3VV3A 1FRNA 3IV9A 2YWBA 1NN5A 3IX7A 1EZ4A 4U2FA 5KPJA 3GFFA 1MJGA 2YWCA 3D3WA 1Q22A 3R41A 4D56A 4DQDA 1DEXA 3GVXA 1KK0A 2V58A 3VSCA 4CF5A 3JYQA 4I55A 3JQQA 2EFHB 2HA7A 2JFYA 4L5BA 3MAAC 1YS1X 4Y9TA 1GOTA 1QQBA 1T8TA 2QG9A 1XFAA 4UTXA 2XCLA 1NI5A 4WZBE 4O1HA 3OPNA 3BVPA 2IE8A 4Z4EA 3HZHA 4WN9A 3VJKA 3NNNA 4UPEA 1XI2A 1NBMD 2QMUA 4FW9A 1Z18A 3BBPA 1AF4A 3C70A 1AKTA 2I2BA 2Y66A 1A50B 1N8TA 1P2GA 2J9FB 4B4DA 1WCV1 1R0BA 1TEVA 2Q28A 2WU0A 1WPRA 3W2TA 4NOJA 1H9BA 5C7YA 1SIOA 3W5IA 3BWCA 2X4LA 1JQBA 4M1KA 1KJQA 2OCGA 4QPJC 4D2IA 3HCRA 1QVZA 3NGMA 5EZSA 1RHQA 3FRJA 3C87A 3BEOA 1BE8A 1OA0A 3MJ4A 1U2QA 1X2EA 4WOKA 3QUTA 2AG6A 5JMPA 4EHFA 3CB2A 8ATCA 1APBA 4H15A 5LZ7A 2Z5LA 3DMDA 4JJ6A 4OQZA 5GONF 1SQFA 5LJLA 3NM6B 3HJTA 4Y9DA 2FWAA 5CU7A 3P20A 2B78A 2H1LA 2YASA 3SJZA 6NULA 1ZSYA 3GVHA 1CSEE 1MX3A 3PEVA 4A0SA 3VDRA 1QCDA 2IPMA 4HC4A 2A3RA 3PXAA 1KYTA 4TTRA 4XWYA 1JKJA 4CQLA 4TZ0A 2Q8NA 2CFCA 5IZCC 4YJ2B 1GTJ1 4FIDA 3QA9A 1KZ1A 4ZTBA 1K06A 3PHIA 4AX8A 1W88A 2IXGA 1ZM2A 4Y2QA 4G5FA 2JGFA 2WE7A 5AK0A 5JAQA 3EGIA 2YINC 3DT6A 3W3ZB 1F2VA 5DCYA 2XCRB 2BD0A 4LXTA 3HY4A 4BTEA 3IE0A 3PLAE 3NXSA 2DQYA 2OAP1 1JFSA 1FL9A 1VMDA 3L02A 4JJ8A 3TXAA 3W5UA 2XJ9A 5JNVA 3PE6A 1VE6A 4AJ9A 2Z2XA 3M6FA 4RDCA 1NXPA 3AI3A 3RBAA 3GDHA 4J7UA 3EG5A 3TLKA 1QRUA 3L8DA 4BQIA 1MQSA 4GI2A 1XC7A 2QR5A 1G20A 3RVDA 1SG9A 3N8IA 4BNHA 3PJDA 3RRMA 1HWYA 3HYNA 1XX6A 3BJZA 2QL7A 4KG7A 1D7OA 2WG2A 3VU0A 5K6AC 1NVTA 1RRPA 2GLXA 3I52A 2UYOA 1KOGA 1ZBDA 4U2GA 3L6BA 4D44A 2Q7XA 2YN4A 3MQFA 4NNOA 4BKPA 4G36A 3U44B 4R40A 2WFMA 3AUFA 1Q1NA 4Q39A 1QHSA 1A82A 2CLEB 3NTXA 1NF3A 1UANA 2B99A 2QF7A 4PRLA 4Q9HA 3TIWA 1FXUA 4C9BA 3S2EA 2VWGA 1B15A 4RH1A 1CUHA 3H1GA 5KKNB 4Z86A 2BI7A 3SX0A 5B1EA 4WZAB 5LU8A 1JHYA 4TL8A 1NFFA 4NBNA 1P0PA 3BSYA 3IAFA 1X7YB 2G1UA 2WYHA 1E5QA 3GQBA 4ND2A 4BEJA 4TN1A 3A6HA 4D97A 4GKKB 4LW8A 4EUFA 2EKZA 4ASUA 1XZFA 4LJSA 4UQPA 5ESDA 1MMFB 2XXAA 1Q1BA 1YBVA 1BVYF 1AU9A 2PKXA 1ZZGA 1JAYA 1GVNB 2YV4A 2WJ4A 3ITEA 5AVRA 4OPMA 1A1SA 4U7DA 1T1JA 3KFXA 3ICEA 3BCUA 4YMTA 3HJGA 1WDWB 2WTAA 2PKEA 3DOFA 4IJ5A 1S1MA 3ZTTA 4ALKA 3UW3A 2DPMA 5GV7A 5IDVA 2XZPA 2FX3A 2O5RA 3CVUA 2WQZA 4MUEA 1ZUNB 3VKFA 1CYEA 3ROPA 2IXDA 2Q29A 4C3OB 3RVNA 5JIBA 4F45A 3L4SO 2VRCA 2YVAA 3RKSA 3JD2A 1E6KA 5L7WA 4H7PA 5HCUA 3KZOA 1E2UA 4FWIB 2JAPA 1JEQB 1PQUA 2ISQA 1U80A 3WC4A 3ZLTA 3BRCA 3LXXA 4LA4A 1UAGA 2NZYA 4P2BA 2PEZA 3W2EA 4BB5A 2EGGA 2O48X 3FMPB 1ECPA 3PQ3A 1J49A 1GY8A 4YAIA 4PX5A 3Q11A 3N75A 3KO8A 2JGMA 5LQNA 5F5NA 3KXPA 2WAAA 3F6SA 4F60A 4LDZA 4AN4A 5GJBA 4E70A 4F84A 4MMXB 1JKXA 1EMDA 1RHKA 3EEBA 3HUDA 3CNLA 4YO7A 1W6RA 3VDQA 3TJZA 3T0IA 3Q8MA 1IK4A 2BHTA 3RS7A 3AYZB 5A5VA 3HDQA 2HJHA 3EXEB 3M89A 3ZH9B 1YC5A 5HR5A 4OHCA 2HA3A 5FI0B 1U3TA 4G0QA 1P91A 3FPGA 1GRNA 4QLAA 1XDUA 1QH8A 1RYNA 2XOXA 3PQ6A 5DLYA 3T5PA 1PWEA 1TU3A 4NLLA 13PKA 2BWJA 2CUNA 3OM8A 2V0NA 4YFYA 3TLXA 4DR7B 1N77A 4I46A 2QEQA 1F17A 2VAMA 3CR3C 3PHHA 4ZCSA 2XTJA 3TD2A 1M34E 2QUJA 1I3OA 4GZ6A 1PT5A 1Y3BE 3QLTA 1B74A 3HEMA 2FSSA 1HI9A 3G0BA 1SUCA 4F2HA 2NU9A 4TZKA 2QSZA 4U63A 5JALA 4X7MA 3DQQA 5UKDA 3QXGA 2H1SA 4DIUA 4Q15A 3QELB 1XDSA 3EWSA 2Q6VA 4NE2A 4XIFA 5EMHA 4ZT3A 5DLPA 5KYVA 3FWPA 4QPCA 3S29A 2A0KA 5EJ4A 1NMEA 2Z9CA 3DDOA 4MP3A 4RHTA 3QSYA 2BSQA 3P0RA 3TIVA 5GLFA 4C0WA 3F4BA 1SCJA 1DJQA 3O0TA 4NCAA 3BB1A 4YASA 3UBMA 1EX9A 4OKIA 2BCGY 4UBJA 4R98A 2NSDA 2IDZA 1HDXA 3NIBA 3ZLVA 3T15A 3U9SA 4MVYA 3TZEA 2NADA 3G13A 5AVJA 4M0KA 3Q7PA 3Q3IA 4Y1RB 4QSMA 1C0KA 2YJ5A 3EFEA 5AM2A 2FQ1A 4DV2B 3Q2KA 4XUGB 5TT1A 1P9NA 1R0ZA 3E9NA 1HE2A 2ZE7A 4IIBA 4O2AB 3DZKA 4Y0VA 5DRTA 3WL8A 3ZV7A 2J3KA 2VSOA 2E4XA 4H17A 3H04A 3Q41A 1WSWA 3ZQJA 5FPKA 2NU6A 1U4NA 4PZEA 2VTVA 3UQZA 5AUQA 4WHMA 4RULA 3KXDA 1ZRSA 2GDJA 2VF5X 1C4KA 2XYRA 1U0BB 3T5GA 3GZNB 2OSVA 3EAGA 4NYMQ 1QOZA 1IIBA 3A06A 2ZI5A 1EBBA 2XV1A 1WD7A 4QUBA 1Y9DA 2EFCB 1L6IA 4L8YA 3GU3A 4AKGA 1X7ZA 2C1EA 2Z5FA 1WU7A 4GUDA 2PKQO 3MTBA 1G8FA 3G0GA 3OCYA 5JR3A 3SU8A 4G4JA 1SKYB 3R09A 2WPNA 2QNBA 3MYRA 1E79D 4DLSA 4D80A 4PINA 5CVVA 1KYQA 3OD1A 4EYOA 4WLFA 3TJRA 3E53A 1YFLA 4A0HA 5JY6A 5CW2A 3AHGA 2W2KA 3WBFA 1N6LA 1K3FA 3I6IA 3GBVA 2PD3A 1AOXA 1F38A 1W1IA 2V3WA 2FSPA 2V7XA 3HYSA 5HF9A 1DV2A 1XTKA 2I2AA 2XYPA 4FMPA 1UWKA 4E7OA 1R2QA 3O31A 4CJXA 1KMNA 3FI9A 3ZGNA 4XYLA 3E23A 1SHJA 1NP6A 3WYBA 3ZD9A 4C0XA 1BAPA 1C30B 1FSSA 1W34A 2WFAA 3HKCB 1U7UA 1ZCZA 3O2SB 4IG9A 2MU1A 4X90A 3U4CA 4MIKA 5F64A 4OI4A 4YRFA 4V3CA 2ZSEA 4I50B 4ZYYA 1OC4A 1D2NA 1C1XA 1E9FA 4N0PA 1KU0A 5IKOA 5EYPB 5E2BA 5KOIA 4P5PA 2EJUA 1K7EB 1ARZA 1TQ4A 4PAWA 3GLIA 3U3DA 3T7IA 2QN7A 4KO4S 2ZUDA 4Z9AA 4P4LA 1GG9A 2XB8A 5CURA 2E6KA 4IICA 1Z4QA 2BISA 3L4BA 1N3YA 3D3QA 1C7IA 1FPQA 2H7YA 3EAQA 2E7ZA 2RJ3A 1EFRA 4BO6A 4R8KA 2WKPA 2VSNA 1ITZA 1RE1A 2QTVB 3IOEA 3L04A 3VSEA 1KJNA 5KOHA 4A6EA 3G5LA 3KAJA 4FYYA 3AY0A 4JLNA 6GPBA 1R18A 1E1RA 3LGSA 1I4TD 1MJ5A 2I2FA 4MAAA 4TT3A 1RWQA 3I5YA 1QGDA 2WTEA 1E64A 2Z58A 2C5EA 2QRVB 1WKVA 4P4UA 1CC1S 4G09A 4RH3A 3I04A 2Z3WA 1IYZA 1BWPA 3A6GA 1LFAA 3P2OA 2ZBVA 2RGXA 3I42A 3ABZA 1NT4A 1BCRA 3TI9A 3GNLA 3GRYA 2VZEA 3OE7D 4EABA 3LBFA 4OK5A 1C9DB 4YMGA 4FMDF 1PZGA 2AX3A 4CI9A 2LD4A 3THRA 2WT9A 1R10A 2PCJA 3JRWA 3T4XA 2GBCA 4HPJB 4KZKA 3CYFA 2RHMA 4QTUB 4EFKA 4YRPA 3IRVA 4S2EA 4U02A 5D5HA 1A5ZA 3VR3D 2C4NA 1KH3A 4XX0B 3W5JA 3RYIB 2O2SA 3TIFA 2IZ0A 3SYLA 2BKVA 3CHYA 4UKDA 3UMGA 4J43A 4B84A 4Z3KA 5CDSA 2C5FA 2JEZA 1U0LA 1P9WA 1JNYA 1TT5B 3AESA 4I4LA 1NVKA 3EEFA 1FQOA 1GLGA 4ZMBA 2CBXA 2CYAA 4HEJA 1CFJA 4KQXA 4YPOA 2NPOA 5AICA 2ZIXB 1UADA 2GSWA 1LVUA 3VAZA 3U3JA 2A5JA 5L8VA 5DYWA 1CQIB 1Y98A 3B60A 5BV8A 1BIFA 5AM1A 3TZBA 3I05A 1JLLB 4LSMA 3P9IA 1P7YA 3HBLA 3L0DA 4ID3A 3WMGA 4BZPA 1SZCA 1XEWX 5TC4A 3CEJA 2G5CA 4FD2A 3BFKA 3TCXB 3ETLA 1ZD8A 2J3QA 1F1JA 4HH4A 4LZZA 3BGVA 2H5EA 1GPUA 5FTNA 3LIPA 3PQ7A 4HQRA 1XU7A 2QI9C 2CNWA 4HBZA 1XF9A 4IYJA 2I65A 3WIBA 1JQ3A 4TROA 2VYQA 5U4XA 2P91A 4DDWA 1LPBB 4ND6A 4PO8A 1XZKA 1ZM3A 1Q15A 1SVMA 1I5RA 1L7PA 3PDIA 5HUJA 2O8FA 1PSZA 3K94A 4BGEA 4DCGA 4D9FA 8MHTA 4WRRA 2C7OA 4EG6A 4C7KA 4JYAB 4LN1A 2F43A 3PZBA 2RAFA 2WABA 4I9FA 4RV9A 1DS6A 2QTTA 4R1OA 3RK1A 3OJOA 4I2VA 4GRAA 1FX0B 4IBOA 5BSRA 1FMTA 3N2KB 2AD1A 2OAEA 4E31A 1E1LA 2BF4A 1IDOA 5JAIA 2VL7A 3B6IA 1SUDA 5CFNA 1IRIA 4ETWA 1QR2A 3SQMA 4A8JC 3MAJA 5BN1A 3PXXA 1EK5A 3FR8A 2Q41A 3OY2A 2G77B 4S12A 2XNJA 2HLNA 4WX2B 2WTUA 4ERNA 3UWPA 4ZEOA 3N8HA 3ZY6A 2IELA 4LGYA 3KD2A 5BR7A 4JI6B 3FYUA 3QU4A 5BQ5A 3B3FA 1Y8RA 3BRSA 4KO1S 3G8CA 2FPIA 2J0VA 1JEYA 1E9EA 5B3AA 3WKCA 5LFAA 1J97A 1XJQA 1Y1PA 4MQEA 2W6ZA 1BXKA 3TJMA 1WMEA 1LLDA 2P4SA 3CNHA 3R2JA 3PK0A 4KXYA 3SYTA 2MYNA 3HVUA 2EIHA 3A7EA 2W2NA 1D03A 3EDMA 2Q5QA 3GLRA 2YC4C 4FWTA 4BVGA 3AVVA 3O7WA 2OLKA 3CLUD 4D4LA 4IL5A 4WXMA 1FFCA 2BZ1A 5DHSA 3B9BA 1NUAA 4I4IA 4M1QA 3IQZA 2JCXA 3LXUX 5B64A 1W46A 3L93A 1L7DA 5JQWA 3QWFA 2SCUB 2HWYA 1NZJA 4P3XA 2A92A 2QZ9A 5T3UA 3E15A 4NV3A 1L6RA 3ZE1B 4DC9A 1P39A 2XI4A 5DI9A 2X2EA 3I9FA 4YLYA 2D7CA 4LHWA 2NYUA 1TM1E 4DR4B 1SC4A 2H11A 3D7MA 4TLBA 1PJBA 2H2DA 2WDZA 3G88A 1KTVA 1MRZA 2ZR9A 4J3NA 3SHQA 3SK0A 3SVZA 3UENA 4BLQA 2C7RA 5JQGF 3RRJA 3UHAA 1U6IA 4DXHA 1Q1QA 1X80B 2HKIA 3QRWA 4M88A 5JI3E 1UP6A 4N47A 3TUIC 2OORC 4FMCB 1G5IA 3B52X 3I2IA 5GGXA 3MRTA 1GO2A 2WE8A 2WU4A 4XD2A 1QVRA 2OBXA 2QSJA 1KH1A 3BRWA 3D0QA 4RIEA 2F9MA 4FDMA 3A6DA 4XB6B 1NXQA 2YCBA 2Y6VA 1M8FA 1QVWA 2H0AA 2AMJA 4YP6A 1U2ZA 4CCYB 4ZDKA 5IJWA 2DWCA 4LY9A 3ZU3A 1RMQA 1LTQA 1XTZA 2QTRA 1FP4A 1Z4OA 5LDHA 2BHLA 2YJZA 4YQEA 2A5LA 4R8VA 2QLNA 5EIEA 4MZXA 3EGOA 3I39X 4ZMSA 1Q0TA 4DMHA 3GFPA 4XH9B 4NJMB 2CNDA 4MS4A 1CDZA 1TI7A 1IPHA 1R0SA 4X54A 1GDHA 1AX9A 1CS0A 1VHWA 5BN5A 3ZKWA 5AFSA 3RSLA 3SNKA 3GCZA 3MUOA 1G4UR 3BK2A 5I7WA 2EJTA 3ZU6A 1RLMA 2RHGB 4HAOA 1GDDA 2XCOA 1CPYA 2XVYA 3DBLB 5FIUA 5BR8B 4QDOA 2OXFA 4YACA 4YRZA 1YZVA 1N9GB 4CM3A 1ZVMA 3ZIAD 4JLKA 2HZ7A 3ZCPA 5AJWA 4I1IA 1CLUA 1QC5A 4QUGA 3VSBA 1Z2NX 2Y0EA 3VI3B 4CHTA 3TTYA 5ALTA 1SY7A 3QMWA 5FP0A 5J9FA 4RPLA 3FX2A 3KHUA 5DFAA 3OTOB 4CLOA 4LWZA 3LUGA 4K3UA 4N0MA 2OUKA 4B5LA 3EFOB 3ETGA 1U9CA 1OBFO 4JEHA 4R9RA 4UNNA 2XMRA 1QIDA 3HCAA 5DM60 3DVLA 5L95A 4AY2A 2GA8A 5F4ZA 4UEOA 3VOTA 1N5IA 2FZGA 2VQ3A 3QC8A 3JQGB 2MWMA 3K72B 2VHTA 1YC2A 3NWJA 4LOJA 4RJJA 3UJ8A 1CETA 3ENQA 3LUAA 4HWPA 5E7IA 1LNZA 3SYKA 2IXAA 4E0BA 4E2WA 1G3UA 1PDWA 3IMFA 4YCLA 1NP3A 1Y7IA 2CE2X 1EFLA 1J56A 1I2BA 4LXIA 3BX1A 1MPXA 1RSZA 2QY9A 2YHIB 3NJ4A 4R0NA 5AHWA 4JA2A 3WAKA 1M8GA 4EG7A 5CX4A 2YHBA 1T3ZA 1VXOA 3V4VB 3HKBA 2P4UA 2CCKA 3CVYA 5ED4A 4HXEB 1FYXA 5A4MS 3IV7A 3ZGOA 2KE5A 7REQB 1YZFA 7MDHA 1SPBS 2AF4C 5FLKA 1RFLA 1KDRA 3QQ8A 4C0QC 1WVMA 2O0KA 1R4MA 4G0XA 4ND4A 3E1SA 4ZAFA 2WZCA 1NJ1A 3VPBA 4CNBA 3QWIA 3CE9A 4M0PA 4RKEA 2QPTA 2ZSDA 3D6VA 3QXJA 4OQDA 3FCCA 4RFVA 2C8VA 4X0EA 3PDJA 4F85A 2AG1A 3OD5A 1NR7A 4X1KB 4JUBA 4Q5IA 3HU1A 3VDXA 3B6EA 4ZCPA 3DVSX 1ZAYA 1KOFA 1N92A 2ICAA 1YJXA 2ZJ4A 3WA7A 1W4ZA 3M3HA 5JS7A 4DPLA 3T5TA 2Z3VA 3MOIA 3K0CC 1A95A 1SNYA 4KBFA 1FE8A 1IONA 1BQ4A 4DN6A 1DBQA 3FHCB 3ZGLA 2QPLA 4R7ZA 4HBGA 3KETA 3KB1A 3REQA 2B1JA 2AWNA 2GK6A 2F59A 4H1VA 4IVQA 2A1IA 1CG6A 3PQ8A 1F5SA 4YMIA 2MTBA 3ZVLA 2J7KA 2UUAB 4YCDA 3T7SA 1EINA 3L0SA 4RQAA 2ZWPA 2NXNA 1W25A 3W1EA 1JDZA 2OEPA 4OU5A 1P6QA 4KR3A 3U62A 3DXXA 4IEEA 3AKYA 4QOJA 3IRUA 2ZANA 5KDDA 1XTIA 3C74A 3HO8A 1TZCA 4BLWA 3DEAA 2RB5A 1WXEA 3ZWYA 4I1PA 2EGUA 3AB8A 4BQNA 3WRXC 2G9ZA 2VOJA 4TMFA 4GL2A 3MG9A 4YAGA 1JECA 1E1QA 1JDVA 4JR1A 5H3LA 3VVCA 4OQFA 5LL6P 2QJTA 9LDBA 4BMVA 4BO2A 4EJFA 4NFSA 3V1LA 2Z2KA 2HY7A 3AY7A 5HDBB 5I3ZA 3RU9A 1UKVY 2AFIE 4ITRC 3FPLA 5CXUA 3GUVA 3QVUA 5CTJA 3AETB 2FOIA 5ANRB 1YACA 2EBWA 4E5KA 1O0BA 4Y6QA 3OPXA 5HKOA 1QG4A 4YONB 5CJPA 3OC6A 4RY9A 3OT4A 4PPYA 3TNFA 3W34A 1G291 1PL6A 2JH9A 3KQVA 1KVRA 4R2XA 3V1TC 4ZAZA 3WYGA 4FZRA 5E6RB 1V2HE 1VI2A 2IY8A 3FRIA 4OI2A 2PD4A 2JIOA 2IYEA 3QFRA 1CLEA 1UEIA 3GCGA 4RZUA 5H3CA 4A0RA 4RTKA 4AWXA 3NDJA 1YA4A 5LCXA 1NX6A 4IUYA 3AO0B 4HD8A 1XO1A 4FDVA 1I80A 4IOKA 2XR1A 4OI0A 2VBGA 3G5MA 3P5SA 4RFSA 5LMUB 3NCTA 3ICQB 4YUVA 3LDUA 2V8BA 1GGJA 2J67A 3C7DB 3QNUA 4BP8A 4KAJA 1EFPA 2E5LB 5EAIA 2VTDA 4LJ8A 5JZSA 1AKEA 3OJXA 1XVUA 1ZIPA 2UZ3A 2XTMA 2Y0BA 2A86A 4X7RA 5KU1A 3T9BA 2BI8A 5BNZA 1R9NA 1GL3A 1LPAB 1JG3A 3BS4A 4TV9B 1R12A 5JPCA 2QUAA 4LS3A 4B82A 4UM9D 2EARA 2R8PA 1MENA 1X1BA 1KFCB 4CL8A 1U7XA 3BB4A 1VECA 3FFTA 3PXBA 5H8WA 4F8YA 3RIGA 4KPYA 3L6UA 2HOQA 4PPGA 2OV1A 1T1GA 2J3MA 5D3MA 2ZYGA 4QFCA 3TAXA 4UOQA 2X76A 1OWMA 2SKCA 1SZDA 4JUDX 3WRYA 1RVDA 3QVKA 4ZQIA 4X7BA 5A06A 3BILA 5AW1A 1EX6A 5K99A 3LUKA 4JOQA 2WUEA 1F2TB 3PFNA 4TKVA 3E2PA 4K40A 1OZGA 1XLUA 1GT91 1LV8A 4CLEA 1CQXA 1PUIA 3IURA 1Q50A 2NSYA 3L46A 1S2GA 2XT0A 5BMVB 2VJOA 4IMIB 3E7PA 4AKEA 2NTNA 5G4KB 5IF9A 1THTA 2ZYTX 3EDYA 2EYQA 3FY4A 3H8JA 4ALNA 4UTNA 3AUXA 2X13A 3GRFA 1CUAA 4C76A 1J42A 1O1YA 3H5IA 3ZY2A 3FUVA 1JYSA 4UBOA 4EG3A 1KDTA 1S3GA 1A27A 2BJWA 2GZDA 1E9VA 5BPHA 1MFZA 4RKWA 5DWQA 1ZA2A 1U4SA 4D98A 5K03A 4DDUA 3U13A 2DECA 1DIRA 1AO3A 3FPEA 4X7PA 5KTSA 2WYIA 1LJUA 4U6NA 2IGBA 2R8EA 4Y1FA 3JQFC 5HXAA 3PLNA 2BM9A 1L7QA 5HJ2A 5A5EA 1PZMA 3EXHA 1ZGJA 5BNTA 5ALIA 2QMOA 2WM3A 2WEKA 3PD1A 1I6WA 1OXTA 1OI4A 3V33A 4A0GA 2JGRA 4UU8A 3G2MA 2IYOA 1ZGBA 2NUPB 1RKUA 4MPRA 1RAAA 1AHHA 4RF5A 3R20A 3D3WB 2J9GA 2HUNA 1O95A 1XF1A 1HQYE 2HRZA 4KQWA 2B2XA 1NG9A 3FVVA 3D7RA 1YD7A 2P0EA 4I55B 3KKMA 4UHKA 1CUBA 1DAFA 4D3DA 4UFPA 4LMRA 4L07A 2Y1WA 3S68A 1NRXA 2NV6A 1LDNA 2CDBA 2PFSA 4BO0A 3EVBA 1DGQA 2JHPA 4MARA 4WN9B 5KOYA 4D5GA 3IBFA 4QLOA 5H16A 1F2DA 1J0EA 1PYGA 2D5LA 3DZDA 1MB0A 2FX2A 3CMMA 3CISA 4O4HB 1HDOA 3GFTA 3RUDA 4IDEA 4TKZA 5I45A 2YDYA 1OPRA 2ZWOA 4B2LA 2O5EA 4R3UC 3AC0A 1YB1A 3TTSA 4NS1A 5JTTA 5D6OA 3FDJA 3EQ6A 3LBIA 2UYQA 5JDIC 1YR8A 1ZH8A 2CDCA 4D99A 3TKYA 1EQ2A 3BDAA 1E2QA 2NO9A 4EJ0A 2JLVA 2BBOA 1GGHA 2ZDQA 3C48A 1VMKA 4Z9BA 2G3YA 5F33A 5K01A 4D9EA 5U1PA 3RC9A 1N5OX 4LSZA 3TUZC 3BIOA 1VBKA 3E0XA 4D57A 2O0HA 3LBAA 5LIPA 2CL6X 3HO6A 3UJ3X 3QHAA 1M7BA 1IATA 5DOZA 4ZHQA 4Y2UA 1G5FA 2P6PA 1GCUA 1X92A 3G7UA 2CKMA 3OKPA 1EGQA 1U5BA 4AT1A 4CQLB 4ND8A 5HF8A 1JKJB 4IIEA 5TB5A 2I8CA 4K2HA 4K1LA 4IHAA 1NQOA 3GGPA 2BCJQ 4LBWA 5AO9A 2QI9F 2OZPA 2PYIA 5EGNA 1K0UA 3F5SA 4PGMA 1H2RS 3ZN2A 4EQ6A 4F2WA 1W88B 4F72A 1NVFA 4K6MA 4N7RA 4DHEA 3BORA 2NZWA 2WUGA 2OBYA 2BR4A 4IINA 5FKJA 1W76A 3ORSA 4UVGA 2GZ2A 4R1QA 4QQ8A 3ZCTA 4F7DA 1KRWA 2FFJA 4ABTA 1C14A 3T7CA 1RYDA 4G07A 3MTDA 3MT9A 2IP1A 3SGLA 1GIAA 4EYQA 4FR0A 1FJGB 2GAOA 7MHTA 2F55A 3MOSA 2W2LD 2X23A 5DI3B 3RFXA 4IDQA 1AUVA 2JV2A 3AVYA 1J2TA 2PXCA 3WDKA 1Z22A 4GKAA 1G20B 2FWRA 1EHYA 1X0XA 3DDWA 5AJUA 3R3SA 1OWLA 2X1LA 2I9PA 2YWDA 3M70A 4DWWA 1B2LA 4FYKA 3ZNOA 3L1HA 3FAKA 2OBNA 2YN2A 1RHRA 3H5TA 1PSWA 3FYSA 1MCZA 3VR6D 2WAXA 2QNIA 3L41A 4RCYA 4XDYA 4XKJA 1CP2A 3W3AD 4TXMA 3ZD8A 2L82A 3B13B 4CM5A 2VSQA 5KNBA 5LMNB 1E61A 3QE4A 4B3TB 2YXDA 1GUBA 2NYAA 1CHNA 3AP1A 1U8XX 2W2OA 1MB3A 2QX4A 1UC5B 3F5FA 1E7RA 4IJMA 3VNQA 4YXFA 3OIFA 1UBHS 5U4QA 2I6GA 1XYYA 2H5IA 4QXPA 4Y0NA 3RKUA 4HQLA 2V7GA 4RTJA 3S7ZA 1L5RA 3DQZA 3Q7EA 1K5DA 2IA5A 1U2DC 1QCYA 2JIRA 3D5TA 2DFDA 4CMCA 5K0JA 3KE8A 1W93A 3GQBB 2CHEA 1ZGZA 1E59A 4YP9A 3ZPXA 1BMQA 2HEGA 2JD2A 3AVUA 2XXAB 3I1JA 3D7LA 1Z6GA 3R0QA 5DYNA 1JSCA 2PX2A 3QKSA 2E4UA 1P3Y1 4PVCA 1UBJS 5E95A 3DTYA 3ZDAA 1CNFA 1MOQA 1QKIA 2ID8A 2Y92A 4FYXA 3C1AA 3QW4B 4KK4A 3WWCA 1Z6ZA 2VJAA 2RHCA 3JAWA 2PIDA 4Q1BA 1JEJA 2A7XA 2FG6C 5B53A 3KXIA 2VSFA 1CY2A 1P3JA 1SIBE 2GNAA 4A4DA 3BE4A 5JFOA 3SS9X 1ENOA 1P60A 1YZUA 2AEEA 2IHTA 2OLJA 4QAQA 5DLEA 2E55A 4L57A 5CFOA 3C8HA 3WNCA 3AM1A 4F6RA 5THQA 5AW2A 3BIWA 2B5WA 3BERA 3INRA 4M9RA 4BMYA 2IEZA 5B7QA 1JDBB 3U7HB 1MA3A 2GEVA 1RYHA 4MVJG 1M2VA 5BSVA 2I4RA 4XGNA 3IGFA 4YCBA 1W0KD 1CD5A 1U4OA 3EGDA 5JBNA 3I62A 1VA4A 2PKRA 3CPHA 4UD6A 3ZWBA 1K6XA 1C3LA 2R2GA 4XPIA 5JNUA 3D5QA 3L82B 1HT2E 5TGDA 1KSFX 5AJTA 5KHLB 4HDMA 2JH8A 4BAZA 2WKQA 3SC3A 4U5QA 3ASVA 3L05A 1XJWA 3PXUA 1FYEA 3M6UA 3UCEA 3U3OA 3FXAA 2UYHA 1H85A 3DV0A 4JFRA 1N2XA 3ONWA 4HXGA 2D2VA 3KCNA 4YUAA 1RP7A 2R8RA 2VQSA 4JP8A 3ROKA 3V4LA 3ZEAA 1G4AE 2YXLA 4ER6A 2X6QA 1KQNA 2E5FA 3C6ZA 3VPCA 5ITVA 4DKJA 3MCZA 4BMCA 5LKAA 1XPJA 2DYKA 3ISTA 4HOYA 2V59A 5H68A 3RHSA 3TSYA 4W7HA 4WK4B 4O3MA 1G8JA 1MVOA 3EWNA 4GRIA 4LPSA 4H6PA 4RK7A 3MWEA 4MS3A 5B7NA 1XQYA 1SXPA 4HB2A 4INOA 4ZP1A 4FE3A 3H2HA 3L7DA 5J5VA 7ADHA 1RZRA 4JI3B 1Y5NA 4Q7KA 1SC3A 4JIGA 3COYA 3N2YA 5FPTA 2XDAA 1X74A 2NU9B 4WCDA 3LT5A 5JHGB 2D1FA 1WPGA 3KTDA 4UXHA 3RSOA 4F1KA 3CH7A 4MGZR 4UM7A 3UMYA 2Q3CA 1CUJA 1LWNA 1Z0DA 1DO0A 4EB3A 3I5MA 1XRRA 3E9DA 3R6TA 3BH0A 4H7DA 3SD7A 4LC0A 3QBDA 1FTGA 2ZS9A 1LRLA 3M1AA 4ZD6A 3U48A 4G84A 3FPBA 4WV3A 3H83A 4F4CA 4KX5A 3WAGA 3C3WA 1JMYA 4ICIA 3TEMA 4WNIA 2FQXA 1EX7A 1UBMS 4OLHA 1XD2A 3EVCA 3R76A 4IQFA 1R8SA 3BMNA 4YHBA 3CCBA 4MRMB 2PX8A 4RPKA 3VPHA 2V45A 4RY8A 4B09A 5JNLA 5EZYF 4NMWA 2QROA 2DB3A 3NHYA 5CVDA 3KG2A 1P4JA 2AHRA 1GQYA 1VCIA 2ZU0C 3ROFA 4TXNA 4TYWA 1TADA 4ZOLF 2OZKA 2PSEA 2NU6B 3N76A 2XAUA 3FOCA 3JQ9A 5CUQA 1HKHA 3E9RA 2D0IA 1ZCAA 4LC1A 4NZPA 1XCPA 1RP1A 1X94A 4NBWA 3HSYA 2P4QA 3VHLB 2FEXA 4NENA 3I1YA 4ZDIA 5LYJA 4PN3A 3BJIC 2Q8PA 1IG0A 1JTEA 2JBWA 4AKHA 3CN7A 5EHQA 4LMBA 4GMHA 4WFKA 3MRXA 1CB7A 2VRNA 3KNZA 1ZI8A 3OIDA 1PHRA 3BJRA 1X7ZB 3C1TA 5KYNA 2Q6LA 2J4DA 2IXFA 3VX4A 3SQNA 2Z6UA 4WK6A 2VJMA 2D2FA 1D09A 1E99A 3T3MB 2X4GA 4YLEA 4CKZA 3IPRA 2HIHA 3H87A 4WN3A 5CB8A 5C4GB 4P31A 5K09A 1QHHA 3PJFA 1IZ0A 1M2OA 2P2GA 2R5FA 2W4QA 3E3OA 1XV5A 1G3QA 2QXYA 2W98A 3AU9A 4OBBA 4EGAA 1TO2E 1Y80A 2W2KB 1Z28A 4LSGA 4QT4A 4GEKA 4HZIA 4NI5A 4XWAA 1FNCA 2A7QA 2O8VA 2QYOA 1H2ZA 1YK0A 5CIYA 1YNSA 3AI7A 1CQZA 4AZSA 2RD2A 4PPQA 1V26A 3L3BA 2WWWA 3PNBA 5C32A 3CZ5A 3PICA 2JGAA 1HDEA 4FLFA 3TLEA 4FK8A 2OGWA 2WNIA 3V5NA 4F3KA 1GT6A 5LQSA 6REQA 4F38A 2O0LA 4DV4B 3D2CA 4N8EA 4KQMA 5KTMA 4LX0A 2IUTA 1GDTA 3IBSA 4TX1A 2WI8A 3FNIA 4LY0A 2J3LA 3QWZA 1RNLA 2OD9A 1C1XB 2JFUA 2RHOA 2Z2JA 4DR6B 4QPZA 1Y3FE 1JIVA 1L5ZA 1GAJA 1P1IA 2J5KA 3ASYA 3ETEA 3HBFA 3KPYA 1ICIA 3LA6A 3LSTA 4GMGA 4NR0A 4WKCA 1N5JA 4AZ3A 4BNMA 3F3KA 3ZDZB 5AQ1A 3NHBA 4P7JA 2B8JA 3URKA 4AULA 3CJTA 1AHPA 4UUOA 2I7CA 2PGDA 2WD8A 1HORA 1IB6A 4TV8F 1B14A 3RU3A 3LD9A 3VO2A 4OATA 1YB6A 2HPVA 2IIVA 2Q99A 3IB3A 4YALA 4G5HA 4CLHA 5KOHB 1Q74A 2YV2A 3A4NA 4BU1A 2CT8A 2WPDA 4IKPA 2QD5A 1XA0A 2RFLA 3O8OA 4OLJA 4OHFA 5CW1A 4DJEC 2VT2A 3W9YA 4E08A 3GPDG 4PSUA 1LDGA 5JXJA 3OCWA 3QTTA 2O2YA 1MC8A 5J5AA 2G63A 3IBGA 1T4DA 1YTUA 5EKSA 1RXSA 1XTBA 2LDBA 2Q7DA 2D0OB 3ER8A 2EIXA 4D8UA 2W0MA 3K0EA 4FUTA 5K3CA 5AUPB 4L5YA 1CDDA 4L9RA 1E1MA 4UBLA 1YIAA 2WFZA 2BGNA 1UODA 4QFBA 3TD6A 2WMNB 1BCRB 3CZMA 1FTQA 4RGVA 5IK2A 1UXHA 2QA5A 4MPTA 5TMDA 5K7SA 2WMOB 3TCNA 5FBZA 2R6CA 1L5VA 4YN3A 3SJCA 3W2HA 2YJ4A 3PDCA 2GN8A 3P4YA 4CM6A 4X8OA 1NDHA 2NTJA 5CVCA 2R8YA 4PC7A 4PSVA 1IVNA 1UPUA 2RGAA 4GI3A 4LYAA 4KQIA 4C4AA 1PGJA 4CG1A 5D85A 3H5AA 5SY6A 1BXGA 1DC6A 4AUMA 1ADJA 3SEAA 4GT1A 3SZ3A 3EDOA 3OLCX 4BPRA 4E5DA 1RAGA 5JAHA 2GS9A 4WVLA 4PHGA 3FTPA 4Y2GA 3EODA 3HB0A 5AKKA 2FEKA 5E38A 4Q4HA 1D4FA 4Q7MB 5LA6A 3RK0A 3AESB 3CVXA 4BGDA 3AIIA 2ERXA 2R4QA 4XIJA 4A73A 3IYLW 1OZFA 3IUJA 4B7ZA 5ERXA 3MS4A 3U1TA 3IP9A 4A0QA 5IN4A 2NVUA 2R7MA 3GZTB 3IKVA 4Y0AA 4MYSA 4MQUA 1UJBA 2YYSA 3JSXA 4KMOA 1FRZA 2DPGA 4KTTE 3AW8A 4KHZA 1V41E 1G5RA 1JG1A 2QG4A 4O4JA 3WS7A 2FMHA 2FEAA 4WNAA 1DJPA 4HL6A 1CQPA 1E89A 3M5WA 1Q20A 2IIPA 3FOFC 5CYFA 1UJ6A 3I6ZA 4BNLA 3JZMA 1JG6A 1HFWA 2KI5A 4LGVA 5DH9A 4A8PA 5CDTA 4JVNA 1NKSA 4C14A 3IEKA 1JFRA 1VFPA 5H59A 2Z6AA 4XJSA 2FJ0A 1N2GA 2YWFA 1JA1A 4PYRA 5J2UF 3HWRA 3RC7A 3JWGA 3FRHA 1U8EA 3MCVA 1KO8A 1NOIA 4MVWA 1WF6A 3PDIB 5AKXA 5J40A 3USCS 2O8FB 2JJYA 3GVPA 1EIZA 3VNVA 5BR1A 2V8OA 2HA2A 1PAUA 3B70A 4BU0A 4GGMX 2F43B 1NZDA 3OWXA 4P58A 3BTOA 5JD6A 4DQ0A 4ZI5A 1XMPA 3JVIA 5KNDD 2GAFA 3A14A 4HRAA 4D9KA 5EQTA 2IV2X 3G8AA 1QGUA 2QRLA 1L7AA 1QUEA 3F74A 1SOUA 5GIOE 1BDHA 4S1VA 4RA9A 2YY7A 1LPSA 2X40A 3GF4A 3QY0A 4D43A 2O3JA 4CG3A 1Z5ZA 3FUTA 1QZ3A 1G21A 3PNVA