5CCBA

Crystal structure of human m1a58 methyltransferase in a complex with trna3lys and sah
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
289
structure length
282
Chain Sequence
MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGDTSPFRSGTPMKEAVGHTGYLTFATKTPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit
total genus 71
structure length 282
sequence length 289
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5ccbA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ccbA02
3P9NA 2V7EA 4CKBA 4FP9A 2BM8A 2NXEA 3TKYA 4CWAA 3KQMA 2JH8A 2ONYA 3NJRA 4XUEA 3AWIA 1X19A 2CWWA 5P8WA 2ZZKA 3BUSA 1I4WA 3L8DA 3Q7EA 3Q87B 4YV2A 4QVGA 1N7JA 1PJZA 2AN3A 3SXJA 2V74B 3BWYA 1AQJA 1UIRA 2C7QA 3R9XB 3NTVA 3A7EA 3IEIA 3OE4A 5BP7A 4C05A 3SSMA 3DUWA 2PX4A 1JQEA 3OU6A 3DXZA 2JHPA 3EVCA 4MWZA 5E9WA 2P7IA 3TR6A 2UYQA 3G7UA 3P8ZA 4ER6A 4KWCA 4PYQA 3I53A 3GO4A 4YUYA 2NXNA 5FTWA 2G8NA 2EG5A 4AZWA 2UYOA 5DX1A 4L7VA 5BXYA 2IFTA 3ELWA 2ZWAA 3UA3A 2H00A 3VC2A 2Z6UA 5GIPE 5HEKA 3M6WA 1KHHA 2ZTHA 2AN5A 3P9KA 2OYRA 1ZHFA 2HNKA 3FPHA 3JWIA 5FUBA 5CIYA 2B3TA 3HCCA 3THRA 1YF3A 3LECA 2PVCA 2HMYB 4DQ0A 2NXJA 4P58A 2HWKA 5EHGA 1EJ0A 4FR0A 5ICFA 4QPPA 4PIPA 5DX8A 3SSNA 5CCBA 1RJFA 3LHDA 3KKZA 1KIAA 1QZZA 4QTUB 5ICEA 3PTAA 2G71A 1XDZA 1R74A 3HNRA 4PYIA 3T0IA 1WXWA 2H11A 3GGDA 5ERGB 2PWPA 2ADMA 4XCXA 1HNNA 2JHCA 3DOUA 1M6YA 2O06A 2PLWA 2ZWVA 4AUKA 3P71T 7MHTA 2PXXA 2GPYA 5E1DA 3EVGA 3G89A 3FUUA 1KXZA 4R8RA 5C9ZA 3PLAE 4EQZA 4RTLA 3FUXA 2ZIEA 4B17A 2HTEA 2ZLBA 2O05A 3G2OA 4GF5A 5FHQA 2BH2A 1QAMA 2Q41A 4PYMA 4BLUA 2VDVE 5DTMA 4A6DA 4DA4A 1RI4A 3T7RA 5E9QA 3EVEA 3ELYA 3UJBA 1JQDA 2BZGA 3A25A 5GINE 3DXXA 2GB4A 5HIIA 1WS6A 3EGVA 4V0QA 1G8SA 3FRHA 1EJ6A 5EZSA 5EMJA 2ZZNA 4CKEA 1VLMA 1NBIA 2PBFA 1NW3A 3CC8A 4FSDA 4BY9E 3C6KA 4PYKA 2CMHA 3AY0A 1X1AA 3MQ2A 5DTRA 4GEKA 2ZULA 3FYCA 1M0EA 3LX6A 4ATNA 2Y1XA 3UA4A 5BW4A 1VPTA 2VP3A 5K0LA 5FWAA 5DPMA 1OR8A 8MHTA 3KQYA 1BC5A 2CL5A 3IV6A 3EEYA 3B3FA 5FA5A 4BLWA 1X1CA 3TFWA 4RTPA 2P3LA 2OO3A 3FPEA 2VDWA 3LCUA 1DL5A 3UWPA 3KPWA 3C0KA 3KQQA 1V39A 5FCDA 1RJEA 1YUBA 3S68A 5ICGA 2IP2A 2ONZA 3P2IA 4PYOA 4F86A 4LG1A 1Q0TA 5KYGA 3B7PA 2CKDA 2ZW9A 5EKXA 1SVUA 2OBFA 4FGZA 4U7PB 2OPBA 1ORIA 1BKYA 5LQJA 3F4KA 5D1HA 2XYRA 5CVDA 3G2MA 3KPUA 4PYLA 2YX1A 4P7JA 3SR4A 1AV6A 1I1NA 5EIFA 3EMDA 1U2ZA 4M37A 2QY6A 3OCJA 3SSOA 2ZBPA 4GOMD 1DCTA 1P1CA 1NE2A 2QRVB 2P40A 2PSSA 2WK1A 3PB3A 1X1BA 4C4AA 2IBTA 3A4TA 3KQTA 3IHTA 4Y2HA 4HTFA 3GJYA 3SX0A 2ZVJA 3E05A 1QYRA 1P1BA 1X1DA 3K6RA 2FCAA 3SM3A 2R6ZA 1WXXA 2C7PA 1IM8A 3ORHA 3DMGA 3G8BA 3OPNA 2ZCJA 1MHTA 1RJDA 3DR5A 5LQKA 5EEHA 1F38A 3KQSA 3NWBA 4RX1A 4LWOA 1JSZA 2PX2A 3PFHA 1RI1A 4OBXA 3VYWA 3ELUA 5LSAA 3PX2A 2XYVA 2YXLA 3UBTA 3P2EA 2OB2A 2EJTA 4HH4A 4IV8A 4PGGA 3P2KA 3OE5A 2AOWA 1WY7A 4IV0A 2AVNA 1EAMA 3E23A 3FZGA 4GC9A 4E2ZA 2PX5A 3U81A 2C7RA 2NP7A 1EG2A 1KYZA 2IPXA 3A27A 3G2QA 3MTIA 2XBMA 2XVMA 3BKWA 3BXOA 2IH5A 1XDSA 3GWZA 2I6GA 3KQWA 4M38A 2PWYA 1WZNA 2AZTA 3R3HA 3HCAA 4ER3A 3H2BA 3R0QA 5DT2A 3TM5A 3DH0A 2P7HA 1PRYA 4YUVA 4E30A 2PXAA 3KQOA 2I62A 3IYLW 3T7TA 4DM3A 4AZTA 5B1SA 4POOA 2B9EA 2ZIGA 1ZG3A 2FK8A 4HSGA 4FSXA 2IIPA 3DXYA 3BKXA 5LR6A 2B78A 5EQJB 1R8XA 2AN4A 2G70A 4E33A 2P35A 4MTLA 3JWGA 1G6Q1 1JG2A 5FULA 4GC5A 3FUVA 3NDIA 1Q0SA 5F2KA 5U4XA 5HIKA 3LKZA 3KR0A 1FBNA 2YVLA 3BWMA 4QDKA 3UJ8A 5EPEA 3EGIA 4V0RA 4F85A 3DMFA 5FA8A 3AXTA 5GM2A 5K0EA 4HGZA 4XUDA 2PT9A 1RI5A 1NW7A 2EFJA 5EKUA 1XCLA 2NYUA 4BP3A 2WA1A 2PJDA 3HVHA 5FWDA 3LGAA 2AOVA 3LCVB 3REOA 3PT9A 5DXAA 3GIWA 3HVJA 5GP1A 1JTFA 3BGDA 5DM0A 4ER5A 4ER7A 3GDHA 4FT4A 2HR1A 2PKWA 3I58A 2NP6A 4HGYA 4YV0A 2AOTA 1VBFA 3KPVA 3OFJA 1NW5A 2UYCA 1TPYA 3BWBA 2OXTA 5EGSA 1SUSA 2PV0A 2QM3A 3ID6C 3FTCA 3KQVA 3C6MA 5DTQA 5E9JA 1R6AA 4G56A 1AQIA 5JUWA 1R8YA 2EJUA 4QDJA 5DSTA 3HCEA 4X60A 3TLJA 4C03A 5K0JA 3RODA 2ZSUA 2GA9A 4R6XA 4BP1A 2AR0A 3JWJA 2ORED 4CTKA 2FHPA 3TM4A 1ZQ9A 2P3QA 3FRIA 1M6EX 3CBGA 4MHTA 5EOVA 3KPJA 4PCLA 4RVGA 4AX8A 3GRUA 3M6XA 3PX3A 1JTEA 3WSTA 4Z2YA 4DZRA 1FP2A 4RSRA 3FUTA 4U7TB 5E1OA 5EVJA 3EEOA 4NECA 3GRZA 2ZBQA 3LDUA 4GBED 3UFBA 3UJCA 5DRTA 1NW6A 2H1RA 3G88A 4RTKA 3CGGA 1JG4A 1AF7A 1TW3A 3EMBA 1ZKDA 4Y30A 3EVBA 4DCGA 1UFKA 3BZBA 1JSXA 5DRYA 2JJQA 4YV1A 1ZGJA 1L3IA 1N2XA 2DPMA 2O07A 2OKCA 3X0DA 5F2NA 3TMAA 1QANA 1MJFA 3GU3A 4C07A 1D2HA 3LBYA 5F2OA 5BW5A 3FPJA 3MB5A 4E2YA 3P9IA 1YFJA 3ERCA 3B5IA 1O9HA 4KDCA 4RVFA 4RVDA 4AZSA 4GQBA 2I7CA 4QQNA 5C1IA 4EKIA 2OB1A 5HZMA 3FYDA 1BOOA 3DULA 1N7IA 3P9CA 2FPOA 3CKKA 2EX4A 1KYWA 5CCXA 3JWHA 3MCZA 4MIKA 4A6EA 2G72A 4CTJA 4P7KA 5CUQA 1FP1D 2FYTA 2YQZA 4GUAA 1QAQA 1KPIA 5GIOE 5EIWA 4AZVA 3FTFA 3GCZA 1JG3A 3OFKA 3THSA 4YMGA 2QRVA 3FPFA 2NNWB 5CVVA 3GRRA 4ZTBA 2IBSA 5ICCA 3OZSA 2OZVA 2XVAA 3HCDA 3GRYA 3LDGA 3T7SA 1D2CA 3LL7A 2JG3A 3EPPA 1KR5A 5HFJA 1FJXA 2I9KA 4FZVA 2XYQA 1D2GA 3TRKA 1RJGA 4XUCA 2CMGA 4PINA 1R18A 1KP9A 3KPYA 4IKPA 4DF3A 1SQGA 4P7FA 3C3PA 4DCMA 4GOND 2Z6AA 5DXJA 5LQNA 3C3YA 4KDRA 4LWPA 1L9KA 3UJ7A 1R00A 3HP7A 5DM2A 4RYLA 5EMLA 5CVEA 4CKCA 2PX8A 4ER0A 4X63A 2YTZA 2KW5A 1VL5A 1G60A 1NW8A 2BM9A 1NV8A 1XDUA 4YMHA 3DMHA 2K4MA 3TOSA 2PGXA 3BGVA 3R6TA 3M6VA 4PWYA 5FHRA 3VSEA 2O57A 5K0CA 2P1DA 3B3JA 4C08A 2QE6A 4KIGA 5GM1A 3PFGA 1P91A 3HM2A 5DM4A 4C04A 2AOTB 4RV9A 4MQ4A 4OX9Y 3DLIA 1XJ5A 3KU1A 3DLCA 4HC4A 1IXKA 1NV9A 3M70A 9MHTA 3E8SA 3K0BA 5K03A 1RI3A 3I64A 4FT2A 2PT6A 3OU2A 3NWEA 5FQNA 1RI2A 4R05A 3UJDA 5T6BA 5EC8A 3SVZA 1O54A 2YUIA 5T64A 2A14A 2PXCA 1KPGA 3ANXA 2C7OA 3O7WA 4EVIA 2G1PA 3ER8A 5K09A 2WA2A 1Y8CA 1NBHA 3VC1A 3GXOA 2UYHA 4PONA 2LD4A 3KQPA 4E70A 4LECA 1I9GA 1XCJA 4F84A 2FK7A 1SG9A 3MAGA 3NVMB 2VS1A 3A7DA 3CVOA 2NXCA 3LDFA 10MHA 1EIZA 3FTDA 3HEMA 3KR1A 3NW9A 3NDJA 2AS0A 4X61A 4YUXA 1L3CA 3G5LA 2BR4A 2E5WA 4RTJA 3PS9A 2FRXA 4M7RA 4RTQA 4GOLD 5E8RA 4EMSA 2IGTA 2Y1WA 1JG1A 5LQRA 2VDUE 5KVAA 2ZBRA 1NT2A 4OQDA 4RTSA 5EZQA 5K05A 3HA3A 2IDJA 4ISCA 1L3BA 3HA5A 4X1OA 3RW9A 4RTOA 5K0FA 3MGGA 2OY0A 2IDKA 1VQ1A 2AOUB 3M33A 3M6UA 2JHAA 4DKJA 4PCAA 2ZZMA 2AOUA 1F3LA 1VIDA 3BWCA 3O31A 4RTRA 3BT7A 4RTNA 2R3SA 4WVLA 4JXJA 2BR5A 2YR0A 4OQEA 5EEGA 1Z3CA 2GLUA 4KW7A 4OA5A 5EHIA 2BR3A 3I9FA 1SQFA 3OZTA 2ZIFA 3AXSA 3HVKA 4X41A 1IY9A 1T43A 2P41A 4E2XA 3CCFA 3B89A 3FUWA 5GOZA 2ERCA 4PYJA 1JR4A 1VP9A 1XTPA 3MERA 3G8AA 3R24A 4M36A 4O29A 4C06A 4FS8A 3G2PA 3D2LA 3KR9A 3B3GA 4K6MA 4WXHA 4UOEA 4YUZA 5H02A 5KQRA 1YFLA 4RVHA 3ER9A 2IH2A 2B25A 3TPZA 2N47A 4QPNA 1VP3A 1YB2A 5K0GA 1YZ3A 5GWXA 1XVAA 5E1BA 4EKGA 2GH1A 4RTMA 3O4FA 5DX0A 1EQAA 4IWNA 3HA7A 4E32A 3KHKA 4RWZA 1UWVA 3EGEA 2B2CA 1G55A 5G02A 4PYNA 3UJ6A 3MTEA 2ESRA 5M5BA 3LCCA 4QVKA 2P8JA 3M4XA 5FQOA 2AVDA 2F8LA 3BGIA 5IKMA 4R8SA 3HCBA 2VZ9A 4PNEA 2Z6QA 3P97A 5CVJA 5LQCA 4BLVA 3ELDA 4QTTB 4YUWA 5EMKA 3LKDA 3LSTA 3QOXA 2AOXA 4H0NA 1TW2A 5E2BA 2ZFUA 2DULA 5T67A 5HILA 2JH9A 3CJTA 4OA8A 3ME5A 2P3OA 5CVUA 1DUSA 1WG8A 3EVZA 3LPMA 3UJ9A 3PVCA 2QYOA 1SKMA 3HCFA 3UZUA 3SGLA 3EVAA 5CM2Z 4HRAA 3LBFA 4QQKA 4EK9A 3MHTA 5DM1A 3EVDA 1B42A 4E31A 3TKAA 1XXLA 1H1DA 1SUIA 2O0LA 2YXDA 1INLA 1ORHA 3HVIA 5KQSA 3G5TA 4PIMA 2YXEA 5DSXA 5HIJA 1JQ3A 3UJAA 4PGHA 5DLYA 1YZHA 5K01A 5EG5A 2GAFA 4GOOD 5DWQA 1ZGAA 3I5UA 4KVZA 5JR3A 3NVKI 4P7GA 4R6WA 2PY6A 2HV9A 3KR2A 5EMMA 4CXMA 3GNLA 4DMGA 5IH3A 1G8AA 5K0BA 2UZ4A 3NMUF 1NKVA 5CD1A 3QV2A 3DP7A 3QOWA 3CJRA 3E7PA 3SMQA 5E1MA 3OZRA 3V97A 4KIFA 1QAOA 5K8VA 2GS9A 3CJQA 5KS2A 5E8JA 5LQAA 1FPQA 1L1EA 5K0NA 1G38A 5MHTA 1P39A 3HTXA 3MCTA 1HMYA 5HIMA 3DTNA 5HOQA 5D1NA 4KRGA 1KPHA 5FADA 1O9GA 5C0OE 4HTFB 3EVFA 5LQUA 3V8VA 3FTEA 2IH4A 3AJDA 1VE3A 1BHJA 3FPGA 3OU7A 5E2AA 3TQSA 3A26A 4OBWA 4E2WA 3RIEA 3GRVA 4HG2A
chains in the Genus database with same CATH superfamily
5BT9A 2FW1A 4NV0A 2J5KA 3CCCA 3KQNA 4BPBA 3WA6A 4LZZA 1JB1A 4FP9A 1KVTA 5DB4A 3TKYA 5LZ8A 1QLHA 2RJ3A 4BN5A 2ZRPA 1D0IA 3FLMA 1C7EA 5TQ2B 3V8PA 3AWIA 2GBFA 2PNFA 2RH4A 3A1FA 1A1SA 4N5MA 1ZOOA 1G21B 1RWOA 1I4WA 1PJCA 2XHZA 2XPCA 2HOQA 3MOGA 5BMOA 1PJZA 1ZONA 5IDXA 4C5CA 4ISBA 2V74B 3MWDB 4NFHA 4FFMA 4O4HB 3OJLA 5AJWA 2C7QA 5JEEA 3DCNA 1EHIA 1Y1LA 3OU6A 3TR6A 2TMKA 1W96A 1HRKA 1B14A 3SKYA 2ZQZA 2OHIA 4ENVA 2NXNA 1CZ4A 4N7MA 1UT6A 1P6XA 4BE4A 1T8TA 3OBBA 2EW1A 4WEQA 1ECFA 4EECA 3DLHA 3D0RA 2QVGA 3PC8C 3NQ41 3C87A 4LWZA 5LMNB 3A1TA 5GZ3A 1KGSA 3FOAA 2ADOA 3R7BA 3UC9A 4LCJA 3FPHA 3RS7A 2ZR7A 4PO3X 4QGAA 4DYVA 4E12A 4P22A 4MWOA 3OESA 3PRJA 1EGVB 4LXQA 1OH7A 1IC6A 2HMYB 2V5UA 3RYCA 1IHYA 2A9VA 4LJ8A 5ICFA 2QG9A 3N8HA 5IABA 1RSZA 1P0QA 2YZGA 1J42A 1L8LA 3NHPA 4JFAA 4X6LA 1KIAA 1ZR2A 1ZAKA 3PFIA 2G71A 4LXUA 3HUTA 4D9JA 2VPPA 3EAQA 4RY0A 5BMVA 3SNHA 4WCFC 3RC3A 1EX7A 1C8KA 2AH5A 1ECBA 4G8DA 4EG0A 2AZXA 1G41A 2CXXA 5I51A 1SC6A 1O96B 1OLSA 2PFKA 4LRQA 5FR1A 4C0HA 3GLVA 1ORWA 5LJLA 1LFDB 1OGJA 1TM3E 1ZH0A 4D4IA 1S3FA 3RGWS 1AHIA 4R8RA 1S7CA 4B6JA 4HNUA 3OWOA 2B8NA 4XTRA 3RHTA 1EWTA 4Y6SA 4K7JA 2C2KA 2HCRA 1TGYA 3FPKA 3Q8XB 4A6DA 1RRPA 4DA4A 4IGEA 3PF9A 2I1LA 3BK2A 2Z58A 4DSTA 1S9HA 4P4NA 5FO1A 1PT8A 4C4RA 1B23P 4NCAA 4MVJG 5K3EA 1I10A 2P2CA 2DTDA 2E21A 4QPJC 4F3KA 5IRCD 3ZWXA 5JMTA 1N8NA 2G09A 4MEJA 2ZIXB 5THQA 5EHZA 1G6HA 1NW3A 2L42A 2R1UA 4YJ3F 4C1BA 1YJQA 1NVDA 2PMKA 1K8YB 2QAGB 2FN7A 1ITZA 1QHHB 1XZMA 3NV9A 4MW9A 2ZULA 4I4TB 4IKEA 1ZN8A 1C29B 1ZD8A 1EJBA 2JVKA 3FCUB 2RGXA 3FGPA 3PF8A 3PENA 3A9TA 1UJ6A 4ZCLA 3VMFA 3WYCA 1KIFA 3DW3X 2PFSA 1SIOA 3SVTA 3M5PA 4KDFA 4C14A 1RKQA 2DKFA 3HB0A 4ME6A 2DWQA 1ULUA 3AOGA 3B78A 4X90A 2V45A 2EFDB 5AK6A 1BX3A 2QR2A 1LW6E 3P4YA 4LBZA 3EXHC 1JJIA 2OXRA 5DEOA 3ZQKA 4G5QA 1JH8A 4D74A 1H5NA 2X0EA 3TAHA 5EKXA 4JL6A 3GQBB 4WGFA 3KT0A 3WRWA 5HDBB 3T3OA 5TPWA 3TAXA 2NT4A 3DT8A 4FMDF 1IU9A 1Z2PX 2CCGA 3C3CA 3CWCA 3QYJA 1T0IA 2UVDA 1M34E 1JLSA 3FDJA 4I4CA 4QFCA 4TSRA 3OCJA 4GMKA 2JIBA 3PQCA 5G41A 4X94A 5ALFA 3TZKA 1Z63A 2JLVA 2ATXA 4HS4A 1T5BA 2CLFB 2R8BA 2V97A 3Q40A 1EEXB 3BM5A 3T3PB 2IBTA 3GN1A 2JF0A 3DDUA 3KZ1E 2GXUA 2DFKB 3IELA 4FFBA 4YWHA 2CLDX 1VI6A 1MABB 3PU6A 1VSQA 3MJVA 1WXXA 3OZIA 4KKXB 5JC1A 2J6CA 1F48A 3DR5A 3LFTA 1E4EA 1YB6A 1YDWA 2ZYSA 2AR7A 1DP4A 4D3ZA 3ZHRA 1A8SA 1SCDA 2C2MA 4HH4A 4ZV7A 4E7OA 3ZHXA 5EPPA 2COKA 3W3AA 1RW4A 1EAMA 4BMOB 3E23A 5I7EA 1XXHA 1L7MA 3L7KA 3U81A 5B7NA 4MUFA 2Q1XA 2XUAA 1UC8A 2FXVA 3AR9A 1NX6A 3NM5A 2N42A 1JHQA 3A6GA 3N5KA 5IT0A 1QFYA 3B1WA 4FYMA 2C92A 4B35A 1QGYA 3JW8A 3Q2OA 4URUR 3ZCSA 5CLIA 1WSBA 3NIGB 4PNPA 4BBPA 2QPOA 3UMYA 4HRVA 1KBOA 4DCUA 1ZJ5A 3DH0A 2HFKA 1J25A 3KUDA 4MARA 4HD8A 4MI9A 5LXTF 1SIUA 4E30A 4ALMA 3RU7A 3C3MA 1L5SA 5THXA 3T34A 4DS3A 5JIBA 1OI4A 2WU4A 2EZ4A 3S44A 2J0SA 1J33A 4HAUA 2ZSFA 3L79A 1CSEE 3K0EA 4JT2A 3REFA 3AEUA 3DL2A 4JLNA 2I29A 1TI7A 1E4OA 4OO3A 5E3JA 1XMQB 2KJQA 2AUMA 5ULLA 3E1GA 2OP0A 4QDKA 5GAJA 4G09A 3E0XA 4KB5A 1K8QA 3T35A 2VJOA 4QHTA 4XUDA 1QF9A 1NW7A 2EFJA 2PS1A 2WINI 2XF8A 3BHJA 4KH1A 4OKNA 4BP3A 3U4QB 2AMFA 3HVHA 3UB4A 3MWLA 3HCPA 5LQDA 3EXAA 1CYEA 4AY4A 2C4NA 3BBLA 4RHFA 1U8TA 3BGDA 5AI4A 3Q3EA 4DSOA 2VDPB 1UXIA 2IIBA 4HGNA 1J0XO 1E3EA 3GT3A 4B3FX 3UMFA 5HZKA 4H4EA 2G1UA 2IZ0A 3HSSA 1I7NA 4R7ZA 1R7RA 1O6ZA 1E6EA 2YIDA 3E82A 4UQPA 1Z37A 3KPVA 3L92A 4DRXA 1FDVA 3BWBA 4MUIA 5F9FA 3ETJA 2HWXA 4YAOA 1C81A 3IQGX 4UARA 121PA 5JPDA 4AC9A 2YN4A 2PJUA 2SCUA 4C03A 1E32A 5DSTA 5C18A 1GU0A 3ABQB 4DCVA 1ZMTA 2GA9A 1OGIA 4BP1A 1T2DA 2YCLA 3LUDA 4A0QA 3N28A 3HDHA 3OE7D 4ZYTA 2RFLA 5EOVA 3HBMA 2R6HA 1UK8A 1W2GA 1NUTA 4IDEA 4NYJQ 1J8FA 1U9CA 4PCLA 2IOYA 1JZTA 4HN2A 3V1LA 1WHTA 3PX3A 4R7GA 3WAGA 2ZAGA 3DDZX 1KAOA 5JBQA 1DKNA 4DDWA 2XA1A 3EIUA 3R9WA 1OA1A 3GRFA 3KO8A 2ZBQA 5KJFA 2FSSA 2XX3A 1BW9A 2B5VA 2GKOA 3DBRB 1J99A 4RTKA 4H1VA 2XUHA 2VHQA 1F2TB 4B8WA 1T5HX 1RXWA 1IMOA 4UXJA 7GPBA 1WDMA 1CR2A 5TT1A 1L7XA 1L3IA 5T4FA 2R1TB 4I66A 1IQPA 2IYSA 4GFDA 1FW6A 1LTHR 5TARA 3TMAA 4BV2A 2H1LA 5IJWA 1EIWA 4I5GA 2C9OA 4IAOA 3KL4A 4M0KA 3UV6A 1EFPB 3D0KA 3KYBA 3WB1A 1EVKA 2V9ZA 5DW3A 4Z4CA 3BQMB 1PIWA 4BIMA 2NMVA 1I6MA 4IILA 1Y4UA 2GM4A 1NNI1 4JR2A 2GCOA 1FYWA 4OHWA 4P38A 1KTIA 3D3WA 5D3MA 3AVYA 3K6JA 3K1YA 2DHDA 3QXJA 1AS2A 3K09C 4HDOB 5EJ2A 3SHOA 5LNK1 3P2OA 2Q8QA 3C7AA 1GNQA 3KKMA 2WSMA 3BFXA 4PAQA 1KY3A 5JS8A 5CUQA 4M9CA 1VIMA 3BIWA 3WRXC 4P5PA 4HXGA 2QL7A 1V8ZA 3H4MA 3RIXA 4IPTA 1NJ5A 3E4CA 2FF7A 3NG1A 5AHOA 1EFLA 3F3KA 2CVPA 5CVVA 4MQ5A 4FIZA 1QU2A 1M7BA 2EZ9A 1XB2A 1SXJB 1ZRMA 1SK8A 4H27A 4RVOA 4ZVMA 4CKZA 3PRYA 4N3CA 1C2YA 1GTL1 1T0HB 2ORWA 3VPFA 2PGJA 3ANMA 5ARBA 1R5OA 2GO1A 2H4WA 2QENA 1T0JB 4UCFA 5FTMA 2P6OA 1PUJA 4US1R 3STYA 4MJLA 3TVYA 5T4HA 4CLOB 4Z54A 2WAMA 1OQAA 2ZBDA 2WT8A 1KP9A 1UJBA 421PA 1KMHB 1UXGA 3ADBA 1N0HA 1PL0A 4Y9DA 2DWOA 1CKEA 4NBRA 3S29A 1L4BA 1RPTA 3C8DA 1Y5IA 1AOXA 1LSOA 5EQTA 1JHVA 5TVKA 4EHLA 5JHGB 5K0CA 5KYYA 1HLDA 4L5IA 1LX7A 2ZJ7A 1A2BA 4OK5A 2JCXA 1NYQA 1PV2A 2QY9A 2X76A 3DC7A 1LC0A 2N46A 4C7VA 2RHCA 4FHGA 4OIMA 4DEXA 1GUBA 4TMXA 1O0SA 3ZH9B 3TOSA 2IOFA 1ATZA 2YQ5A 2CB9A 2WIFA 2ZATA 4R3WA 4ZQIA 1M6VA 2C59A 2VQFB 2F4VB 2YICA 3GP5A 4UEJA 4NL4H 1O6FA 3JVUA 1DS6A 1K66A 3PHCA 5GM1A 4URYR 4C04A 1DUIA 2W4QA 1FMJA 2WBLC 1N5KA 1Q7GA 2QSJA 3FI9A 4JBNA 1QZXA 4KITB 3BTVA 4UHBA 5ESXA 4ZRDA 4D9BA 1XL1A 4RJTA 2X1HA 4ZALA 5JD3A 4EIWA 2BGKA 2QUZA 1T5SA 2HGSA 2P2YA 2ZJ8A 3GCGA 4R2HA 2P2DA 3M4NA 2CHEA 4KN6A 3CKMA 3OTOB 1IBRA 1OZ0A 3FNHA 4LVOA 3GRAA 3GJZA 1ZH2A 3O3MB 1YCGA 3UY4A 3G7SA 4RGBA 4BO8A 4F38A 2O5RA 3D2CA 1QHSA 3EVTA 4H0CA 1OX4B 1DRWA 3G6KA 2RGNC 4KAAA 4PPYA 4G84A 4TMZA 3WDMA 3ZWKA 4ZMBA 3MJDA 3U4QA 4TUYF 4WZZA 3IAS6 4YQEA 2C3YA 2IIVA 2OO5A 4LDZA 1VMEA 2YXPX 2ZS8A 3DE4X 3SZUA 3W1EA 1TKCA 3D8NA 4F84A 1J0BA 4OFBA 1M8JA 3U4HA 1II0A 4LXIA 5EQFA 1RXIA 2YYYA 4MVJH 4XI9A 5B30A 2I6TA 1YQ9A 1G63A 2C4TA 3AF0A 4KXNA 3ULKA 4EEZA 4HVAA 3KQUA 4OB7A 3SQWA 5AVUA 4J2TA 3JYHA 1Q15A 3A10A 2GUWA 3I2FA 3T7AA 1ATIA 1SOWA 2IQIA 3F71A 3DOFA 3ZQJA 3NHUA 4YCBA 2GFAA 3OY7A 2ZYWX 4OP1A 2AFIE 5LMCA 5FUWA 3TTWA 1NNLA 2AG6A 2YZ7A 2HMWA 3NAMA 4B43A 1NM5A 3MUOA 3WV4A 2AIRA 4C4ZA 2FPKA 1YRAA 3BVPA 2YWHA 3K2BA 4RTOA 3ZDRA 2AKYA 2OCLA 1J4AA 1U81A 2R7AA 1MC1A 4LYYA 4OMUA 1Y8RB 2BEKA 4PCAA 3WJ2A 4CKCB 1F3LA 3QUSA 3PEYA 3O4JA 3HACA 4PC2A 1W6RA 4WMLA 3IBTA 3A9UA 1ZXLA 2FW8A 2VRWA 2CE2X 4PRYA 1DEXA 2BBWA 4G1VA 4MEBA 3I5XA 1RM4A 2ZJFA 3HI4A 4QOFA 4M36A 3RKRA 3V1MA 4BCBA 4C06A 1NMQA 1BW9B 1ECGA 2IVZA 5JWRA 1K88A 3PUYA 3F78A 4D25A 3K94A 4J0CA 2GBGA 3OAAA 1YFLA 2XQFA 2OBLA 4I1OA 1DRJA 2POQX 2A30A 1Y89A 1YVDA 1BRMA 3OX3A 4JQSA 4ENPA 3MT8A 1GZ6A 1NVWQ 3OKPA 3QVMA 2XCIA 4WN3A 4Y18A 4ARUA 2ZRJA 1NRWA 2VDRB 4NJEA 1GVNB 2WIGA 3AR2A 1CUUA 4FHZA 5AM5A 3GF4A 4RWZA 4Y1RB 1MC5A 5ADHA 1P9OA 3UCEA 4Y2SA 4BVFA 1CRPA 2C9DA 1F8UA 4G86A 4NMWA 1ZZGA 3MUEA 3G2HA 4R8SA 3O8CA 3T3HA 2CXUA 3OZFA 4WAUA 1B6SA 2EU8A 2PRIA 1O94C 2Z3VA 3I3SR 4HR7A 4YIKA 3WDKA 2VLIA 2QV7A 1PZEA 4IMJB 2EVWX 3V2UA 2AOXA 2XUDA 2OQVA 4C01A 5KNLA 2JK0A 4WLUA 5KTYA 1W30A 1PD1A 4XFJA 3IQIX 3JQAD 1JU4A 2R44A 4WY5A 3EPHA 2OXIA 4CT4B 1N3YA 3BQ9A 4RK1A 3UZUA 1AJEA 4XM1A 1Z56C 3ZWWA 4MKZA 3AR5A 1R5JA 1JG7A 2GYVA 1BE1A 1UAYA 4TXJA 3T7JA 3TFQA 1MFPA 2X40A 1J2EA 3HYCA 4LCEA 3UMRA 5DNDA 2WDZA 1BD3A 3B1JA 1N1EA 4UHDA 3RG2A 4QT4A 5EWJB 1P1FA 1D0VA 3KVOA 4U7FA 4W82A 3L4EA 4PC6A 2ODQA 1N5IA 2FG7C 1X80A 2R6JA 2XMCA 1SC4A 3H9UA 4IINA 5EMNA 4B3JA 4MGEA 2KX7A 4B5LA 5JR3A 4R6WA 3ZGOA 1HV8A 2HXSA 2WSIA 1MJGM 1CUJA 4ZT6A 1V6AA 1CXZA 1XMVA 2F6RA 3ZXIA 1XZKA 3DYVA 4EUNA 5K0BA 3OCCA 5IK2A 5LZ5A 2OTCA 2DFNA 1CRQA 4EJMA 3OZRA 4V0NA 5J2TF 2VNAA 1S89A 3V97A 3U4MA 4FFWA 4Z7QB 2I7DA 3C7DB 1QJCA 1ONOA 4Z3DA 3SYRA 1UH5A 4H60A 3TIXB 3HTXA 1U7XA 1TKBA 2Q3LA 2TYSB 4L73A 3ZWPA 3IT3A 4DWJA 2WJ6A 4C7BA 5D6XA 5C0OE 4GMGA 3RYFB 1FXWA 4ILEA 1E2UA 4XQGA 3H4IA 5JMWA 1CR4A 2F3UA 1XQ6A 3LV8A 2AWOA 1H3NA 3HY6A 3QY0A 3CKYA 4PLCA 1YWGO 4M0CA 4A2CA 4CMHA 5FDFA 3HXQA 2BEUA 5T3YA 1BXKA 2X2OA 3TRFA 4DYHA 4I6GA 5FFNA 1K6JA 4KQFA 3ND5A 4XJVA 4A36A 5BUSA 2ONYA 3LVRE 1OH5A 1T2NA 2W71A 1HDZA 5HF8A 3RU9A 3KFLA 1P6QA 2I1WA 4CFYA 5JAMA 5SZHB 3T61A 1BN7A 4IOJA 3Q87B 1LPOA 2Q4BA 3RO7A 1A8HA 4FB5A 3IKMB 4TKVB 3W5AA 1LZKA 2JARA 2XT6A 4BNGA 3R9XB 2W2LD 3EEIA 4X91A 5D5PA 3FWZA 1SVNA 1R0SA 5B12A 2PX4A 4HYQA 4U6QA 1I3MA 3EJWA 4W5JA 4A9AA 3F0TA 2D3TA 4B2LA 3C1TA 4O2BF 1B0ZA 4J1SA 4FWBA 1KQGA 2OUIA 3AB7A 4BO9A 3ND7A 3SAJA 3KFVA 1W35A 2ZWAA 1P31A 3VC2A 3D4OA 4R0NA 5JS7A 5KQGA 4XDGA 1FFYA 5CFRA 2IK8A 5FUBA 2I2WA 1WTCA 2OAP1 4CIWA 2DZDA 4I9FA 3JQRA 4GL4A 4FDAA 2WJAA 4P4LA 1X3LA 4LSGA 2OZLA 3AEYA 4HL6A 4BGIA 5ADUS 1GD1O 1VDMA 4B9EA 5FYDA 3C43A 5A71A 3ZI4A 1SBQA 1P19A 4UCXA 4K9DA 1FLDA 2ZRHA 2OG1A 3V6LA 3TFOA 1RLIA 4UASA 5AVQA 1MJGA 1IM2A 4ZYWA 1EVJA 5H4GA 1RBMA 3P71T 4UD6A 2OO7A 1NTOA 3NHKA 3URKA 2OMEA 1GPDG 2WFLB 4MKGA 1AZTA 4HAIA 1FDIA 2BVNA 4O08A 3VO9A 3ZS8A 3ITDA 4INZA 2A7QA 3D6FA 5CJ2A 4N0PA 3RWMB 4EHJA 4HPXB 2OHVA 1ZEMA 5DBGA 3B1KA 4G6ZA 1EWQA 1OWMA 1WCWA 2XWPA 1JAZA 4X3CA 2RC5A 4GI2A 4M6WA 3DKVA 2X77A 4NWIA 5G4KA 4AYXA 4Q1BA 4BLRA 2XTZA 2XIJA 4AJ1A 2GETA 4AJJA 3ZLUA 1G8SA 5KVCA 4LF7B 4X20B 3N70A 2ZZNA 1K08A 3E84A 3HRHA 4FDLA 4XZ3A 1P1KA 3C7CB 1ZA2A 3BJZA 1XAHA 5KKNB 5C52B 3FR7A 5T4BA 2P6UA 1IZ7A 2YWEA 1S9DA 3LX6A 4XIIA 3TIGA 3MK31 1MG5A 1IN4A 3QVKA 4EPRA 1E9AA 2XF2A 4IJWA 5KHLB 5U4QA 4YX9A 4M76B 1UJ2A 1OGYA 1HYEA 3H17A 4GP6A 3DG9A 3C5EA 3TFWA 2OLKA 4J0EA 3BSSA 1OLOA 4UM8B 1L5GB 5AJZA 1O6GA 2YWFA 1L8OA 3GLQA 4QREA 2Y8EA 1A9SA 1GSAA 4JEHA 3S2YA 4KYUA 2Q27A 4RD6A 1L1QA 1X74A 1Y5LA 2GFIA 3O90A 4RJIA 1QYXA 1JAIA 221PA 3P2IA 1KBZA 3HN7A 4F5WA 2EKDA 3HKCA 3KSAC 3KELA 1SVUA 1XAGA 3RYIA 1NU6A 4JLMA 4L74A 4RIIA 1BE0A 1ORIA 2GCOB 2R47A 2UZAA 5E0KB 4FYPA 5HM8A 4IQ0A 2Q5CA 3ZWAA 2WYOA 2Q46A 1NXVA 3PQFA 3S2GA 4YMLA 3A36A 5AJXA 3A05A 2A58A 2PRZA 1YS7A 5C37A 4A8JB 1R0YA 1R0BA 2C96A 3EOBI 5J40A 3TE7A 4A8PA 2CJPA 5IPFA 2WHPA 1QX4A 1WMBA 1SK9A 2BT4A 3ZW9A 1E6UA 2IXEA 1JSCA 2Q2QA 3GCXA 4PWZA 3D8BA 3C7TA 2EFGA 3TQOA 2VSNA 1SFRA 2P0EA 3OE1A 4GX5A 4LHYA 4V38A 3BFVA 5DNAA 5FWNA 3E05A 3GHHA 3TRIA 3ZIDA 2C0PA 2FCAA 1WMAA 2GTHA 3KVVA 3HE3A 3GLKA 3QV1A 2NSDA 2QVZX 4FBLA 4AN4A 4C2BA 3LDHA 4YYZA 4G0UA 5BYJA 4XTCS 1U9IC 1Z6GA 2R8PA 2YHBA 3HABA 1IAQA 2BKVA 3KJHA 4FYHA 4ZEXA 3VV2A 2PVPA 3U4IA 2IIQA 3X1MA 5CEJA 2ZYAA 1USIA 5LSAA 3GMIA 5K3FB 3H8JA 2BUBA 1GUAA 1WA5A 4KIJA 2FPXA 2N75A 3R5SA 2D5AA 4LBYA 2E89A 4M8KA 3BTOA 3QKIA 1KYZA 3MTIA 3PZRA 2IYNA 1FRFS 2Y27A 4OM8A 2HADA 3ZZ0A 4KK4A 4CLEA 4KE7A 2Q1AX 4PHFA 2CYAA 2FUNB 2P2GA 2XD4A 2B1RA 4Q0MA 4ZZ1A 4MDEA 3WL6A 3ZUPA 5B1EA 5C31A 3ROPA 5JRZA 2EATA 2XT0A 2ZUVA 3MAJA 4OGLA 1QG0A 1F8GA 1GFIA 3IKTA 3V7FA 1CRLA 4N1AA 1QH9A 5FIUA 1Q11A 1MVOA 3DHNA 4JSYA 4I2NA 1VB5A 3WRYC 3R7WB 2BFCB 2GPWA 4POOA 1U65A 4UUBA 1YUMA 4TV8B 4DA8A 1NI3A 3CUEF 1EXVA 1QH1A 1SZPA 1U5AA 1EFPA 2AN4A 2B92A 2VJAA 4XWOA 2PGLA 3RWOA 5CFNA 3M89A 2O48X 4HWTA 4UU1A 3IP7A 1G9TA 2WWIA 1FBNA 1ZR4A 3ZCRA 4EUFA 1LS6A 5KOJB 3CF6R 2YJ4A 1FSFA 2B94A 5BN4B 1U98A 4KXUA 4MROA 4WKGA 4G5FA 3IAM6 3R3XA 4M6WB 1C30A 1RI5A 1U7PA 2QQGA 3HN6A 5L3SB 3DOIA 2WA1A 4ASUA 2WTMA 1EM6A 4XFKA 1BQ4A 1P2VA 3LCVB 4JJIA 1HQDA 2VYNA 9ATCA 3SC6A 5CT4A 2LW7A 5ALRA 2F17A 1QVZA 3GDHA 1SQSA 3BDIA 2W00A 1Z83A 4HGYA 2JV2A 4IO0A 1ZAYA 2IGBA 1IG3A 2NGRA 2Q0HA 3DBHB 1TIPA 4ZJYA 2BWJA 3L7AA 1E0SA 1DO0A 1WV0A 2VPXA 4RH3A 4UPEA 3C6MA 5ALQA 1UBOS 2ODNA 4J43A 5A7GA 2I4RA 3G0BA 1A5ZA 3H2KA 3IO5A 3DYBA 3LRTA 2P2LA 4MUXA 5AKEA 4C7KA 2Q4RA 4WACA 3RODA 1RZRD 4BVHA 2D5LA 2I4LA 2R8ZA 3N74A 4J7XA 3TSZA 2HK8A 1LI5A 5FOVA 2HQSA 3G0OA 3I2YX 5BO5A 3L1HA 3C74A 4D45A 3VPXA 3EH2A 4M1SA 1OFTA 4MVJI 2B6NA 2W6ZA 4IIBA 1M33A 1MC8A 2WV9A 3OTIA 1BMTA 1RYYA 3GG2A 2ZSEA 4Z0TA 3NETA 2WF7A 3I05A 4NECA 1DPGA 1NW6A 3ND8A 4DBZA 2IQ5A 2VLBA 3DZHA 3N87A 1U0EA 3EMBA 4BNIA 1R4ZA 4LC0A 2CBZA 1QQTA 1E1MA 1TYBE 2FOLA 2ID4A 1E3WA 3D5TA 3G59A 3K0AA 3LF2A 3QP9A 4PC1A 1Z8DA 4LISA 1MHPA 1T3ZA 1TM5E 1Z0DA 1FTWA 1QHFA 2J3MA 3M6LA 1Q0UA 3NBXX 2OKCA 3V33A 3DOEA 1GLNA 1WWKA 2WSYB 1L4LA 4GW3A 4PRLA 1A9XA 2W8BB 4B4VA 1WP4A 2VQ6A 5CEEA 2UUBB 4G24A 3VHXB 4UTRA 5KPJA 2ONJA 2Q0XA 2I7CA 1DEHA 4Q7QA 2B8WA 2O3JA 3AR7A 3DULA 2ABWA 4IGKA 1H9BA 3KAQA 4FNAA 1E9EA 2A9FA 3V4SA 4RSGA 3VQTA 3T38A 4H35A 4ZXFA 2HNBA 2BF7A 3P27A 4K40A 5LXTB 1XO1A 5AKIA 4OQLA 4CKXA 3GLFE 2FYTA 1I3OA 1XAJA 3OQ1A 4TL6A 4AZVA 4JI3B 1N1GA 1PJBA 2JZCA 3TUZC 2HWWA 3UANA 3ETLA 1DINA 2WZCA 3H11B 4ZCQA 2FW7A 3MTBA 2VJCA 3FGOA 3IT2A 2QTMA 3STVA 4BX3A 1HQKA 4HKTA 1KJQA 3F5SA 1XPRA 2JH3A 2W70A 3VX3A 1S7GA 5AXAA 4KDLA 1W8IA 3DKPA 5JSKA 1YHZA 1W6UA 3DQQA 3LLMA 1O8BA 3INTA 3OOWA 2G40A 2OXCA 4HT3B 2VJDA 3N1UA 5CXXA 1HEIA 1A3CA 2RONA 3D4IA 4ZRNA 4WBXC 4CKCA 3ADKA 1W36B 4GWKA 1V1JA 3CH5A 2PX8A 1IBCA 5TEWA 4IF4A 5IARA 3S99A 2FN8A 1R6XA 3R6LA 4BQRA 5TJ9A 1XCGB 2PT5A 4HQOA 4B6EA 4ALKA 1GG2A 3D8SA 3WICA 3PICA 3VV3A 1J2YA 2DJIA 2ZWMA 3T4XA 5KTOA 3VJLA 1Y1KE 3WY9A 2QTCA 3OX1A 1WXDA 2XE6A 1W4ZA 1T9AA 5L3VA 2XB4A 1RXEA 2F4NA 1JLKA 3HM2A 1RWMA 3V4ZA 5DM4A 3Q72A 4TKUA 4BMZA 3DHVA 4DWOA 4OHFA 3OSZA 2NVUB 1T6ZA 1G18A 6ABPA 1XR3A 4RGQA 4DAOA 1PNVA 2IHVA 3JALB 5GY7A 3E8SA 4JD5A 1KSJA 3QLVA 4CQLA 4DL9A 4R69A 4RQTA 1MB3A 2H16A 2WE8A 3IP9A 2PT6A 1UP4A 2GZDA 3E9YA 3IDFA 3JQGB 3IAEA 4XVHA 4L22A 2JGIA 4UXIA 4AYWA 1BE8A 3P9PA 2IYFA 4QYWA 2FPWA 1S8AA 3E9CA 5EC8A 2C4WA 1PEYA 1OE0A 2YWXA 2YUIA 1KRHA 1CULC 1EUDB 1KPGA 2HHCA 1R9NA 2P1ZA 5HJ5A 4YH1A 1NRXA 5BW8A 1C8BA 4JENA 2WFMA 4JLKA 5KAPA 3VC1A 1XXHB 4TTIA 1BJTA 1NF2A 4JJGA 2J6IA 4LMBA 4MO9A 2BJHA 2FK7A 4DIDA 4QD3A 4ACBA 4ENUA 2F62A 4KTVE 1QKKA 2IUSA 3LKBA 3WLPA 3A7DA 4PBSA 4TVKA 3X2EA 3F96A 4JEIA 2IC5A 4RL6A 4RSMA 2HQ1A 2Z1NA 3V5NA 1Z6AA 3BH7A 2I2DA 2OECA 4KWEA 1IUKA 3G5LA 4OLHA 4YJKA 1ZC4A 3W2GA 1E20A 4A4DA 1X77A 5EXDA 2GN8A 3PR1A 4PX9A 4QOJA 4D3FA 1QQBA 2YBEA 1U5BB 3C15C 1GYQA 4OQDA 4RTSA 4RW0A 3ZR4B 3IVGA 4YRAA 3HA5A 3UAWA 2EP7A 1KJIA 2C8JA 5DCLA 1KK1A 1Q22A 3ITEA 3NCHA 3WWPA 2G80A 1Q74A 3B2QA 2GILA 3KBOA 3MGAA 3ZW7A 1HMPA 4DILA 3FMOB 3BWCA 3BT7A 3SDBA 5LZ9A 5D87A 4ENQA 4EO4A 4EH1A 4OQEA 2RB5A 5D2CA 1ZI9A 3PC6A 2ZP1A 1D4FA 4M1EA 4S2EA 5BOSA 3K7EA 2WKPA 3OZTA 2QRUA 4KR7A 1MX1A 3V7NA 3JAMA 3LW8A 1MOZA 2C82A 1WDKA 2Q3JA 1JR4A 3K9HA 3L40A 4IZOA 4DABA 2G5CA 4MKIA 5LQAA 1VBMA 3LT0A 1Y8QA 3PFBA 1JHPA 3HKDB 4YUZA 1A76A 1BGXT 2QNIA 4HRXA 2AG8A 2XUOA 5H82A 4NDAA 4R2LA 2TECE 2V6MA 1L5HB 2GPAA 3DTVA 5SYNA 2RAVA 2BGUA 4PRKA 1V9LA 1FX1A 3CPJB 4Q21A 2HCBA 4IIHA 5CT5A 1R0XA 5FO0A 3AJRA 1QK4A 2JAOA 2D5IA 1FOEB 1M5TA 3JD4A 2CLLB 4B3SB 1EQAA 1JWAB 3ORRA 1NVVR 5FXMA 2ANBA 2C4MA 3SS9X 3EGEA 1P72A 4PYNA 5DT9A 1NUQA 4EA7A 3HI6A 3IUNA 3DTTA 4CKEB 2GAJA 4I50B 4H4DA 1CS4C 1ZN7A 2HRBA 3NCTA 2KQUA 1F9AA 3JQFA 4IDAA 5EMKA 4CCYA 4HVCA 4LZJA 1KJWA 5TGTA 2Y0BA 3JRXA 3BERA 2XWQA 3ANYB 3HEAA 4F6CA 1NVVQ 4C4TA 4OA8A 1KDVA 1K9SA 2XAUA 3KEMA 5BWCA 2PUCA 3KKLA 1E8MA 1F2TA 1L1FA 2IRWA 4BLOA 1J2UA 1IFXA 1RS0A 1TDJA 5IM5A 2UUPA 5DM1A 1PAUA 1Y1TA 2WYIA 1GR1A 1OIXA 2QB5A 4E31A 1ISHA 4JI6B 4YMSA 3I2IA 1ZD4A 4IQ4A 5BY2A 3UQYS 1O7JA 3DD5A 3LUAA 4R71A 3I09A 1GFWA 1Y7LA 4B4KA 2FMTA 4V0MA 4D9IA 1HF3A 1H94A 1Y9ZA 1ZS9A 2GEBA 3K09A 5AVXA 1V6SA 2PY6A 2RHJA 4G9BA 5A1JA 1DEAA 4URXR 1KAHA 4K26A 4M0EA 3DVLA 2XV1A 1RFGE 2IPLA 2VUSA 5CD1A 1WQ1R 3I9NA 2BGTA 3IOYA 3CJRA 2BMFA 1FXUA 2XW6A 3HV2A 3IQDB 5LWQA 3KUKA 4OLFA 3ZU4A 4ZDWA 3SN6A 4PGMA 5KS2A 1W94A 4BXOA 1EUCA 3VI4B 4ZU1X 1HT2E 3ZLBA 3PNLA 1WO8A 5EWLA 1HXHA 4C7XA 4ZK2A 5BVHB 1W36C 2BM0A 4D8YA 5JDIA 3GFQA 3C70A 4ZVPA 1Z0UA 1QDLB 2XUJA 4RL4A 4H18A 1ZIDA 3IIEA 3JQBC 4WL0A 2R11A 3VNAA 4CNQA 3FTEA 1K9VF 2V7BA 4X45A 3K0CC 3GLFB 4WEOA 2PZBA 4L85A 1CS0A 1GOTA 1R5BA 3AEUB 2ZBFA 1TJ4A 5B55A 4DA0A 1NP3A 2M6SA 3ZU6A 2HQRA 2GYWA 3AJ9A 1QC5B 2BM8A 3FCOA 3U3ZA 1JFFA 3N7UA 3ADOA 1FJ2A 1R64A 3FE2A 1E7YA 4IFBA 1LLCA 4A2QA 3AW8A 4C6SA 4MULA 4N5NA 4WY8A 5P8WA 4DBVO 4WNYA 4F6LA 1KC3A 3RTCA 4FCTA 3M4YA 2AN3A 2ZE8A 4D9HA 1ZBQA 3SXJA 1OBHA 4FX2A 3LQRA 1CZNA 2DFVA 3QPAA 3TSOA 1VG0B 4YCCA 2QDXA 1A7JA 3CX4A 1UBUS 5KMGB 3P94A 4EY7A 3G02A 5E9WA 5L3RA 3SHVA 1UC4B 1QO9A 3AFMA 3LLSA 3LY8A 1PFUA 3SIWA 2Q18X 3JARA 2JGRA 1K1EA 5E95A 2NPIA 3TEFA 4DMUB 5A5EA 4OIFA 2H2WA 3WMEA 5GIPE 3P26A 3KP1A 1K2WA 3INNA 3UPUA 5TX7A 3EF0A 3U16A 4RANA 4B7XA 4KRYA 3G1WA 3RUAA 3MM4A 5JD5A 3GQVA 4U5QA 3ON5A 1HKHA 1PR1A 1Z0SA 3RGGA 3KOMA 3PIIA 4K9OA 5F2EA 1IG0A 3FJYA 5GJCA 3AVWA 2H9IA 3EFOB 3IPYA 1EINA 1LD3A 4V1CB 4M1KA 1JEEA 3CB4A 3OM9A 5ECYA 5KTPA 2IXFA 1QF7A 2VYVD 3AVXA 3GLIE 2HEIA 1M6YA 1LDYA 5HKBA 1KEEB 3V4PB 2EX1A 1RJ9A 3OJEA 1Z0JA 2NVOA 5H83A 1A27A 2ZYIA 3DJFA 3G0CA 3ENKA 1XJ0A 1J97A 3ROMA 3TRHA 4RS4A 2OGWA 4ZZ3A 3HR4A 2WWFA 1PBNA 3N3BC 3SJCA 4RBNA 4A6PA 3JYQA 3NHRA 3DE0X 4GMFA 1PBTA 4DV0B 2HWYA 3FF1A 1HFKA 2NO1A 1GUDA 3SFZA 4JJ8A 3T7RA 5K3FA 2Z56A 1E69A 1LEHA 2II6A 2QD2A 4GM0A 4OYHA 4Y2VA 3TBHA 1X39A 1WULS 1LUAA 3BFJA 4JH0A 1P7YA 4B81A 4L9RA 3E3NA 4E5MA 4PCVA 2JFUA 1VLMA 4WGGA 5GV7A 2VWGA 3Q85A 4AP5A 4X9XA 1HDRA 3W1VA 5BOVA 3MQ2A 1GUFA 4I1IA 4F7DA 1DT3A 3PI7A 2GF7A 3UA4A 4BTLA 4MNTA 1EFRA 4JNCA 2QUIA 3IALA 1PJ8A 4EG8A 2MHCA 3ICOA 4R1UA 4JYBA 1WHSB 4HF7A 5LLSA 4KXLA 3N2EA 3KLOA 4UEKA 2Z98A 1E1KA 1FTYA 3DYIA 3WZMA 1KYYA 2NO9A 4PTYA 2V4MA 3SKVA 2Y6UA 3H5TA 2PT7A 3BE8A 3ETNA 3QVLA 1TEZA 4TS9A 1RHKA 2BSQA 3CZMA 3HYRA 4MQEB 2LKDA 2HLHA 3M8KA 4YJDA 2LUOA 1ZMXA 4JYCA 1SELA 4O0LA 4CLDA 2XNDD 3RUEA 1JJBA 2ZWIA 5EPOA 4OFZA 2O0HA 4UUQA 5EP1A 1PDWA 2BFFB 1UMBB 1I1NA 3JV7A 4OL0A 3W7VA 2C8LA 3CLTD 5ITWA 1T3TA 3L0PA 1PGOA 1IVNA 2GHRA 5A6SA 4LNUB 2V03A 3DOJA 1PS9A 1XSEA 2AWNA 3C6QA 3GY0A 4YHBA 5JY6A 3JD3A 4C22A 4YMTA 2V6BA 1JQJC 1X1BA 2VCHA 1H42A 1G98A 2A86A 3KQTA 4TN5A 2IXAA 4KACA 3LF1A 1R9MA 1YE5A 2QS9A 1DC7A 1Y7PA 3GRPA 1X1DA 5C1PA 4FMPA 1PDVA 1IM8A 4HFMA 5DLDA 2HSDA 1HDCA 3DMGA 1AM4D 1R12A 4UPVA 1RJDA 1G66A 4JJKA 1CJTC 3X43A 1X13A 4ZI7F 4WD3A 1L4GA 5I9NA 1WMEA 1P0FA 3FMFA 2D7CA 1JFFB 1ZVKA 3U13A 3ZLVA 1C3OB 1PFWA 3N2GA 4O59O 2C7RA 1Q91A 1F1JA 2JK1A 4WIAA 3WLKX 2PS9A 1E7SA 2R8EA 2X3FA 2CJFA 4Q4LA 5IWCA 3HQ4O 4E6EA 2M2IA 1GIAA 2GT1A 2Y0DA 1VCHA 2BM1A 3M3DA 1H2FA 1Q3KA 4NPCA 4QIHA 3KOUA 3BX1A 4UDXX 5IT5A 3PKZA 2I2BA 4XXHA 1UK6A 3A6JA 2ZETA 3WX0A 3IVCA 4F1KA 5IHXA 5K5EA 3ANNA 3GL9A 4LX8A 4IF6A 3AR6A 5DSZA 2GPBA 1J23A 4RHCA 4S0ZA 4MS3B 1CJMA 4OLAA 1QVRA 2G9ZA 4OHUA 2JIZD 4BX9A 5BYBA 1G6Q1 5FULA 4US0R 3PUJA 3BWMA 2ZAYA 3A0RB 3M81A 3I0ZA 2BLLA 2ECPA 2Q99A 3UWKA 1KWKA 3DZCA 1VJCA 5DE3A 4IIDA 4MKHA 5IJAA 2PT9A 3NU1A 4H7PA 3PUKA 4LJ5A 3STWA 3TZ6A 1CTQA 2IKSA 4HB3A 1E2FA 3EXFA 2OP1A 4DMCA 1AKEA 3E03A 5FBWB 4IOLA 5JDIC 3CA8A 3AONB 3IKJA 5DXAA 3VO2A 5K0ZA 5TMEA 1WU7A 1HT3A 3CRW1 4FT4A 4HBZA 2IXDA 1FNBA 1GGNA 1VKRA 1CZHA 2BTQB 4FC6A 2ORIA 4ZVKA 2BGRA 3KALA 2ZXEA 3C98A 1GWNA 1LK7A 2DBVO 1WL8A 3KJGA 1IHUA 4FQ8A 5H80A 3K1AA 1CQZA 1MAHA 1NU8A 1NUUA 3FTCA 5FWXB 3F8SA 3QRWA 3FYHA 4BX8A 3C6XA 5HIAA 2PUDA 3TZHA 2MM2A 4C0LA 4GRAA 2YIMA 1LF5A 4RFSA 2G7MC 5EIBC 2V7PA 1AGRA 4OU4A 1HYGA 2ZS9A 3LQYA 1TT5A 2GPSA 2V8OA 4E14A 2XMGA 1TT7A 5KYYB 3W5SA 4XX0A 1Z5ZA 4OB6A 1D9ZA 2EJWA 1GA1A 4EO7A 5JQWA 1RWQA 4YP1A 2OFFA 1MB2A 2FN9A 1S8NA 4JHXA 2IA5A 3FUTA 5E1OA 3G2NA 3BIXA 1GTG1 3C1AA 4FWIB 4G4SO 2BFBB 2Q5EA 5DRTA 1AMNA 1JILA 2XUPA 4RFLA 1LLFA 4ZQCB 3TLAA 3UK1A 3E3LA 3NJ8A 1H0SA 1C3JA 4XJTA 1YKGA 2RHMA 1KZHA 1P0CA 1S96A 3S2EA 1YRQA 2I9PA 1K06A 1PZHA 1L5HA 5ICMA 1VIVA 4H7EA 5CA0F 1QSGA 1WD5A 4LPSA 4MSUA 5BW5A 5L4NA 3WHIA 1HDEA 1RWNA 4Q4CA 5H5JA 4LF9B 3VFDA 4X3PA 1QRUA 5HDQA 3QPBA 2FPRA 4QDUA 4DLYA 1OH6A 3ZHTA 4OB8A 3SICE 1JAYA 3IP3A 4BMYA 1QJ4A 3P9CA 4QJ3A 4JBWA 3NHJA 1ODFA 2QE7A 4F4HA 1GAJA 2XB2A 4BFUA 4Q7LA 4UATA 3THWB 1F6DA 1TOAA 3BRWD 1X7WB 3DGFC 5AXBA 3FNRA 1I2ZA 2PAAA 1QAQA 1OC2A 1N0WA 3K9FC 1VECA 1V8OA 3CZ9A 4FHCA 2JLWA 4LEIA 2Q5HA 3DO5A 5AUQA 4IQ8A 1HDOA 1ZM7A 4F4IA 4D9EA 1GTRA 3QSYA 4L8GA 3O2QB 1XNJA 1HTBA 2AUTA 3GLHB 1YI0A 4ZVVA 4DXAA 5L53A 2CKMA 1XP8A 2Y71A 5HFJA 1W36D 2ID8A 1CVIA 5GVSA 1OZFA 4FUTA 3DDWA 1AQ6A 3N2ZB 2EBHX 1OV6A 3EFHA 2ODBA 4WASA 2R9VA 4N82A 1B8OA 1YIAA 4GOND 5C8XA 2N3ZA 4RZQA 4U2GA 4FOOA 5EUBA 1Z7EA 5DBOA 1BS2A 3JAWA 1WW2A 2PMDA 4YCMA 1C9EA 3S27A 4ZIRB 3QELA 2Z1DA 3SF8A 2BL4A 1ISGA 3QU7A 4S24A 2EFEB 4U7JA 3GGPA 3HKBB 3M6VA 4PWYA 1DZIA 1G3MA 1VKNA 1CUHA 1ZL0A 4JWKA 5EWMA 1H1TA 5F64A 5JNWA 5L7TA 4ITUA 5B7GA 1KJ9A 1OLSB 4JKIA 3O38A 3ZQUA 4A8HA 4BKUA 3Q7PA 1Y7HA 2Z83A 1RE1A 5B1DA 4CDGA 1LVUA 1XJ5A 1B7GO 1U04A 3KU1A 1T4BA 3DZJA 3OEEA 2FN3A 1NV9A 1BGVA 1F17A 3SOZA 3OZUA 4DSUA 4OHOA 2OCIA 4P53A 2ILVA 3OIYA 1W85B 5HUJA 1JHAA 3PX7A 2I3ZA 1W34A 1N0VC 1C3VA 1RYEA 4BNYA 1KFCB 4JL8A 5C8ZA 2I7VA 4N7JA 2ZB8A 5DHPA 4B3XA 5ALMA 4N0QA 2DLCX 1ZGHA 2XMPA 1JP7A 1RAEA 1SZCA 2HXGA 3WWYA 2IHYA 3KVNA 5FL7D 4S04A 4Q1EA 3QLEA 1GQ2A 4B84A 2C54A 1KSFX 5C3MA 2QT1A 4WOJA 4D44A 2UYHA 3HU1A 5IC5A 4YRZA 3K9NA 4W7SA 2O8BA 2O2EA 1XRJA 2DVMA 3DKRA 1RPNA 3I04M 5B6CA 1ELOA 3JSXA 4TWIA 1ODSA 2R7LA 3P4UA 3GJRA 2EBFX 5GZ1A 2GEFA 5BURA 5L4LA 1OPXA 4WV3A 3MWEB 2QTLA 1G1AA 3OETA 2HT6A 4M0MA 2EZUA 5AI8A 4K0KB 2ENUA 4FCCA 4TYWA 2DHRA 1FNSA 5IMSA 1E9CA 2V55B 4IWYA 4IIGA 4Q02A 4Y6PA 3MLBA 5FOXA 1OLUB 2A5YB 4EMSA 5MGBA 3GGJA 4E11A 5LQRA 1DSSG 1K4MA 1N2CA 1YQXA 2Q4TA 2R86A 1NT2A 2DBQA 1RZ3A 2VDUE 2ZBRA 3QXCA 3TCXB 1QTIA 4CKYA 3TI7A 1JS1X 2ZJZA 1L3BA 4NBUA 5HQ3A 1XKXA 2YJZA 3N0RA 1QBGA 3WRVA 3PC3A 1Q1NA 1BDBA 4D92A 2AMYA 4RNCA 2I2CA 1UBCA 4Q37A 2ZZMA 4E13A 1I3KA 1X0VA 4A0FA 1HZZC 4I7EA 2RAPA 4UEQA 5ADWA 1JE0A 1X6VA 3GH3A 4X71A 2J0UB 1B0AA 4JY7A 1RTTA 3L9WA 1JIUA 5IHPA 1F4VA 5C5EA 1N92A 3NT5A 4PZYA 3I4CA 5FTLA 2C07A 2OGUA 4IMPA 3QY9A 2CNLA 4LRYA 5DTJA 3R8CA 3ZC3A 3R3UA 5GZ6A 3SDZA 3OZDA 3EAGA 4F4FA 1FK8A 2HYDA 3B6JA 3T0GA 3UAOA 3CUUA 3HLYA 4BNDB 2O5EA 1P8AA 1HFWA 2P27A 3K2QA 4B46A 2YMLA 2Z9BA 2JJ1D 3H83A 3QSGA 2XE8A 3D3JA 2PDAA 2QD1A 1CZOA 2NZ2A 3OQIB 3WIOA 1VP3A 5CT6A 3BMOA 5DBIA 2D0IA 3SJAA 3AYZB 5TIIA 1R4AA 5K6RA 1UBRS 2XOEA 1TNDA 1UBJS 5LP6C 4JYAB 2FEAA 2GCIA 3LFUA 2QGFA 2VT7A 4MWGA 2ESRA 1B15A 2VDMB 4O4JF 4X1IB 9LDBA 1NG9A 1FMFA 1O94A 1JVSA 5BMVB 1YQEA 3AFHA 2V6JA 4YRFA 4Z9YA 4BLVA 2OOKA 4NOKA 3FKSA 5HQJA 3QX3A 2G28A 2VKQA 1O96A 4R1LA 3MYRA 4GI1A 1C3LA 4LDPA 4YDSA 4FONA 2NUPB 2I4MA 2W4MA 1H69A 3BOSA 1MV8A 1CUSA 4NFLA 3UMBA 2EERA 4CLRB 1ZH8A 2PN1A 5DGCA 4HBGA 1W0JA 1AKRA 5FBQB 4HX2A 2WTAA 4MDYA 3W4JA 1N3BA 2F48A 5KBYA 1VXOA 4DCNA 3FLAA 4H3VA 3NGMA 4B8ZA 4ECEA 4TS4A 2BKLA 2VYQA 1U2QA 2HRDA 1I51A 2H2AA 1XLTC 1OYVA 1XF1A 4PGHA 1W75A 1YJXA 2B4TO 4JU9A 4XM0A 5KKAA 9ABPA 5HXAA 5D84A 2I3GA 2JIDA 1WX1A 3TYXA 5KNCH 1GU7A 3DD1A 3K70D 4U8HA 4L50A 2JI7A 3NMUF 4BVGA 1Z08A 1PJ2A 3G5AA 4I3GA 5IKEA 1YCDA 2IKQA 1M1YE 2F64A 3RSLA 4IIVA 3PVSA 1JHXA 4YT4A 5EAIA 1TD1A 2YJ6A 5JCOA 1N5MA 1E0KA 1E63A 4GS5A 4BFLA 4R8VA 5F35A 3T3IA 5AW4A 3TD2A 1CZRA 4ND3A 2OV6A 2X2PA 3P0FA 4A7PA 4OUDA 4TTPA 5ALKA 3FMPB 2P91A 1BHJA 3G9TA 3IJEB 4DKXA 3T5PA 3ZZTA 4OBWA 3VDMA 2WABA 4YJHA 4M0LA 4LYAA 4LYJA 2V1XA 4E7PA 4EEKA 4ZCRA 1RRCA 4Z3OA 3RSFA 2RBGA 3HL4A 1Z5OA 1W4AA 1E5XA 5EIAA 3JZDA 2H85A 3M2TA 1M2VB 1V8FA 1E2EA 1LPBB 2J31A 3KV1A 1OT3A 1MMFB 1DAHA 1P4JA 1H0KA 1SOAA 1VGVA 3EGDA 3L8DA 3CSDA 3COSA 3CLUD 2PSEA 3Q7EA 4WLVA 5JCJA 4FD3A 4I9GA 1UKEA 2QQ5A 4KQGA 3BWYA 3NNNA 1M34A 4R2XA 1NFRA 1T4GA 1JIKA 4MWZA 3KHSA 2RAFA 4DR3B 1BXZA 3L6BA 1ZCAA 2QTFA 4HGOA 4HQ6A 1TYEB 3RSOA 4TKUB 1MQSA 5BXYA 4D4MA 2ASEA 5A5GA 2H5JA 2OD7A 4WNAA 4IV5A 2VWHA 1RADA 2I6FA 3JQGA 1Y4AE 1BS9A 1ZC3A 5CLLA 1D0SA 1U0JA 4MQEA 3PPXA 5EJ8A 3DMYA 2AC4A 1YF3A 4RAOA 3PL5A 4INAA 4Y2RA 4BATA 1N0UA 4MH0R 3D8TA 3X2SA 3SSNA 4TLAA 2N9UA 2PV7A 4K6GA 5ANRB 4OLBA 4LRXA 2XJ4A 1VPDA 3NLLA 1SBYA 2PKXA 3RS3A 5E4JA 3WKBA 5C4MA 1NPYA 1CUFA 2ZT8A 2WR8A 3GDOA 3MJSA 5CCDA 1W44A 1OXXK 4DUZB 4Q4AB 2VDOB 4MW4A 1E89A 3EXG1 3B48A 1BS1A 4DTCA 1Y3BE 2NUPA 2XOXA 2GPYA 4MW2A 1FRNA 2BELA 3ZNQA 4D0NA 4NU8X 4TWAA 4EYQA 4H0FA 5A4FS 7YASA 4BN4A 5AI9A 1DFGA 3BEOA 1X7HA 1NNUA 1C0PA 2ZLBA 5GV8A 2HLNA 3SKXA 1Z4KA 3PNVA 4NCIA 5F52A 4Y2QA 1ZMBA 2VDVE 4TQGA 4BUCA 1G4AE 3FWPA 5IDYA 4Q19A 2IS4A 3V1YA 3X2FA 2IUTA 4XUGB 3DFUA 4WTOA 3N39C 3QFFA 2ZKLA 4V0QA 3USCS 1YVPA 1WHTB 4QNRA 4POAA 1U0TA 5BYKA 1CFJA 3V7YA 4MMZB 2BUAA 3C6KA 2FEKA 2OBYA 4HRYA 1E98A 1XU4A 4M54A 1RKUA 2GD1O 3A1CA 3BF8A 3AUTA 1HOXA 3SZMA 1GSOA 2BMDA 2CJWA 2J48A 3AL3A 3IVAA 4I1PA 1GZVA 4F2HA 3STTA 1D04A 1NQOA 1PR5A 4OXIA 3UG7A 1DARA 1S6YA 2MR5A 1RPJA 5KAMA 4OQNA 2V4ZA 3U4CA 3GP8A 2I34A 3V4RA 3U48A 1XMOB 1E3MA 2H4FA 2Y6VA 2C97A 2DF8A 1JHMA 3PEEA 4ND1A 1J56A 1W581 2IYEA 3W6PA 1E62A 2O2DA 4DGSA 1P60A 1G17A 4OMDA 2J0QA 1QO7A 4ZMSA 2DYKA 3WLAA 1VRVA 2I54A 3DOHA 3U2QA 4LG1A 5INTA 4E46A 1SKYB 4TGLA 2AX4A 4KGVA 2OBFA 4U7PB 2K6GA 5GONA 1I6LA 2IZ7A 3BH0A 2AG5A 2O8FB 5JCPA 2HLDD 3MRXA 4B31A 1FZTA 4KODA 3MZ0A 5AK4A 1TKAA 4PYLA 1OHHA 3DB1A 3IUMA 1PR2A 4M46A 1XRLA 2J4DA 3W1WA 4AJPA 1U0RA 1UKVY 2H0RA 2F55A 1U2GC 4G1MB 4NBTA 4DMKA 1P1CA 3AVTA 4E5PA 2ZUBA 4NOJA 3FHLA 1PZFA 1E3QA 3SXUA 4CG2A 3BRWA 2X2FA 3ZGXA 1N6LA 1NI4B 1Z0FA 3C3AA 1B43A 3U7FB 1QIEA 3SX0A 3HDGA 3KJEA 3TQRA 4N6GA 3W6UA 1CERA 3SZLA 1CUCA 2B7CA 4BKRA 1Q0PA 2JVIA 3HYLA 1DOZA 1IH8A 1S4MA 2EKQA 3I5AA 3IE1A 4I55A 3V2IA 3VU1A 1MF7A 1XMSA 4RX1A 4CIAA 1DFHA 1JSZA 3ESRA 5IG2A 4FFDA 2O5CA 4WNAB 4GI5A 4F45A 4LTNA 1YZTA 5KNDD 2Y1GA 5I8PA 3QBVA 2HDOA 4MYUA 5E6RB 5E6UB 2YZKA 3QI7A 4OFXA 1IRIA 4DIOA 4D0LB 1ZO8A 3WYEA 3VNBA 2UYYA 1XTKA 4BBZA 4CF6A 1WOMA 4CHTA 5IYZA 4UDYX 2IWHA 4Z4EA 4EY5A 2P68A 2ZRBA 3NIDB 3R7AA 3KCQA 2H4XA 1Z3IX 3BMCA 1YBFA 4B76A 2PKRA 2WU8A 3HCAA 1V26A 3TIFA 1J2TA 5EWMB 4QU8A 1TJ5A 2FMIA 2FQYA 2PXAA 3CTMA 1CUZA 3IYLW 4X1YB 5AP9A 3ZIAD 2E4VA 1SVLA 2QJOA 1BN6A 1GADO 3P9SA 3SS7X 4YRKA 3H4TA 3WRYA 4WDRA 4FKZA 5F7ZA 3ZWYA 1XEWY 2OHHA 2C2YA 3NTUA 4BO3A 3G9XA 4DTIA 1QCDA 2VNIA 5TGDA 1BQEA 2VBIA 3GUUA 3EZYA 4KQHA 5A05A 5HIKA 1NE7A 3ORSA 1B93A 4XQ9A 5AOAA 3QMPA 1HDGO 3W06A 1EWRA 1U7UA 4TQ9A 4YAEA 1BIFA 3UJ8A 4QFBA 5KTRA 2QN2A 2JJ8A 4Y1RA 5K0EA 5KNBA 2EDAA 3GMTA 4WZBE 1WOYA 1M2EA 2A5LA 3RH0A 3KBBA 5IWAB 2QAGC 2CXNA 4HLUC 3F5MA 3GDFA 4JVNA 5ALHA 1ONBA 1BMFD 4KPYA 1UDAA 1ODCA 4DC0A 3HXKA 1O4WA 3A9CA 3AOEA 2XSZD 1AZSC 2ZM6B 1VE6A 5FBZA 3EUAA 3UHFA 1A5SB 2NLOA 4YC7A 4JJAA 3QVWA 4TTRA 5EGSA 4PSKA 1SUSA 1NLMA 1MVNA 4ITRC 3W04A 4MW5A 4WESA 1VLLA 2PAFA 3KWLA 4CN9A 1SZDA 4DDMA 5HTKA 2H48A 1BSVA 3P96A 2ZREA 1SVWA 3PSHA 1NULA 3TSYA 2QBYA 2FPPA 2JIZA 1ZDMA 2LDXA 1EBBA 3JWJA 4F96A 1FX0B 3M3PA 4LDNA 4U2EA 2ZB3A 1RIFA 3NVAA 3QLJA 2P3QA 4JCCA 4P3OA 2IHZA 3L0OA 4CI0B 4L4RA 1JL3A 2HO4A 1U11A 1V8BA 2VPQA 2Z30A 3HR7A 3U9SA 5JZBA 1C7IA 4H7JA 1UMCA 2GZHA 3T52A 4DZRA 1Z5VA 5AHXA 4PLTA 2LP4Y 4G36A 1KK0A 4PFKA 3W9BA 4F91B 5TNXA 3MTGA 5DM70 3N0WA 1W1IA 4GBED 1OXBB 4N7BA 2V65A 4CDMA 1J49A 4XYBA 4CEIA 4CM6A 2QVXX 3FVTA 1AX9A 3TGPA 3SXPA 2ATCA 4YXFA 4E22A 3LPLA 3MSCA 4UNIA 1PYDA 1EX6A 3G13A 4ZOLB 2IT1A 4MUKA 3TNJA 3GVCA 2O07A 4CMCA 1SOUA 3ZDCA 1OYWA 1XTJA 1P33A 3OT1B 1B6RA 1M2NA 1GLVA 1ENPA 1XHEA 2P9QA 2QPLA 3AJEA 4IIXA 3TS1A 2OG2A 3CX8A 2DRIA 4EEXA 3HJFA 2IEIA 4QICA 1V5FA 1YH3A 4REOA 1YFJA 1VIAA 5EZYB 4W5OA 3D7MA 3H5RA 1EAYA 2ZTUA 3BN3A 5I3ZA 3O2SB 4PLYA 3HBLA 1E9BA 1V37A 2FETA 1KYWA 1DADA 3JWHA 1Z29A 1M2OA 3FDFA 2WD9A 4QBIA 2VAWA 2E37A 2IYTA 3L7BA 3I37X 2G72A 2H06A 4ZAFA 3KETA 1II9A 3VH1A 1MR3F 4D8XA 5K8LA 3IDZA 3OFKA 3J80A 1G5HA 5A06A 3QMMA 4BU0A 5F51A 3MLAA 1X1SA 1SCUB 3I6YA 3UBMA 5DTEA 2YY5A 3OA2A 1E79A 1Q2XA 4N6OA 4P34A 2CXSA 1DMSA 2JHFA 4BNVA 3HBAA 4YK7A 3L8CA 1UJ4A 4CZ2A 2Q1UA 2P78A 2XYQA 4TL8A 3NT2A 3P0RA 5A4MS 1AN0A 1JHDA 1U0GA 2H1FA 2F67A 2B35A 2GWHA 1ISPA 1XCPA 2EFCB 2CUNA 2Y05A 3ENNA 1JPVA 5AK0A 1V4NA 2Z6AA 3PLRA 3RADC 5E6RA 5E6UA 2VAMA 3HV0A 2PCLA 3T3MB 1OFVA 4JJ4A 4KIWA 5BSFA 1E8NA 5LIPA 1IL0A 1G60A 2JLXA 4LZLA 4X92A 3HBNA 3DMHA 3DDNA 3MMZA 2QTTA 1LRLA 2CF6A 3IEPA 4C0SA 4FINA 3R6TA 4IFTA 4RPGA 4R0MA 5FHRA 4ZZIA 3RVOA 1XLTA 2HUNA 4QA9A 5AKKA 2X9GA 1M2FA 4BNWA 2PHZA 2VXOA 4ZD6A 2UUOA 5J63A 4JLJA 1WXGA 4YAFA 1RYMA 2PZJA 4PZEA 4U9HS 3EIFA 5CVCA 4PZZA 3RUDA 4P6VF 2X4DA 1Y3FE 2X0KA 5A04A 3OSUA 1N32B 3I6BA 5KHOC 1QZ3A 4OJKA 2JKYA 3S0JA 3DCYA 2AI2A 1LSJA 4F72A 1CEYA 1JIIA 2W6CX 4WESB 4BU1A 5ITZA 3AF1A 1L4UA 1MQ8B 2FFBA 2E82A 4OJQA 1ZUNA 2ZT5A 3JQDA 1ZIPA 1XLUA 1GAQA 2NSYA 3DVSX 2JAXA 3AVPA 4UZSA 1L4YA 4QULA 3AUSA 3K70B 1HQYE 3D6UA 4CEJB 2WC1A 2FVXA 4FB4A 3BK7A 4BZZA 1R50A 2W6IA 3TOVA 1C3OA 5EKDA 1DWOA 1M2VA 1GNPA 1RLJA 1JEAA 4IQFA 4L75A 4GLJA 3VR2A 3VYRB 3HU2A 4TKVA 1W9HA 1CQXA 5EINA 5F4BA 4E5KA 4EJ6A 4HB4A 1YMVA 3JZFA 1BEZA 1NZJA 4W1SA 4EG3A 1G2PA 3FGNA 2GSDA 5H1YA 2NSJA 4M4SA 1LDGA 4PVCA 2AS0A 3IVMA 1GP2A 3HZRA 3GVIA 3QWIA 3WJAA 3L77A 5KZMB 2CLIB 2H1IA 2EARA 2WPNA 4IRUB 4XB6B 4PLFA 3HPRA 1IN8A 1M8KA 2OQIA 2PQMA 2XUGA 3D8HA 3GJ7A 4MYCA 2QGZA 3U49A 1D1PA 2ID7A 2PSHA 5K0FA 4DRYA 2C2ZA 3I62A 3EDYA 2P9JA 4RV5A 2QRPA 3W5UA 3PA8A 5A3SA 5LQMA 2D1RA 1TU0A 3ZG6A 4JXJA 1EE1A 2W4IA 4B74A 5JWOA 2H1SA 2BR3A 1SQFA 1QNLA 3EJ6A 2ZIFA 1T43A 2P41A 1P2BA 2B99A 3LUPA 3R3YA 1VP9A 2SBTA 3EZ9A 3IV9A 5MF6A 2BGGA 2VK2A 3B3GA 3KOXA 2DFTA 1MORA 2FUKA 3C14C 3O8QA 2HWUA 2E0IA 2PL3A 2V7XA 1W4BA 3CZQA 2FHSA 4DQLA 5BWNA 1A77A 4C7OA 5FNVF 1VHJA 3DBIA 2FJUA 1ADFA 2P79A 3KOOA 4HYEA 2VEDA 2Q62A 1KHTA 3CRNA 4P86A 3ZD7A 5B58T 4JDUA 3PSAA 4PG7A 4TSKA 5HMMA 3KQHA 1O95C 5JZOA 3R9KA 3CVWA 1ZUIA 1QIKA 2Q2WA 2J7PA 1USWA 3K6KA 4FYJA 4CL0A 3L7IA 4OXQA 1T36B 3LCCA 5CA0A 1ABBA 4MK4A 1PL7A 5FQOA 2V6FA 3VNQA 3WRXA 2FLKA 1UANA 3TX2A 4BJHB 4DDVA 1L2TA 3L4BA 3OHPA 4PNEA 2AX3A 3HN2A 2VTDA 2IW3A 1KE1A 3ZY3A 4Y1GA 1CV2A 3VZCA 1XPUA 1CJVC 1EUQA 3WO0A 1P0IA 1EHCA 4KYVA 2FZGA 3KXIA 4YONB 3AP3A 3C5VA 1KAMA 1DUSA 4D02A 1RHQA 3GFOA 4G25A 2OQ2A 4AKSA 2G36A 3T7KA 3S28A 4HNGA 2WUEA 3EVAA 3KDAA 5CM2Z 2YHUA 4P33A 4TUYB 3GH1A 4EDHA 5LWHA 4Z7JA 3QLVC 3H99A 4DIEA 1IIRA 1VG8A 2YFHA 1MD9A 3K1ZA 4HX9A 2LGJA 2EQ5A 5AM3A 4O8CA 2PTHA 3HKCB 3LP8A 4NDZA 3U3XA 2Q1TA 5G4KB 5EG5A 2VF4X 1P81A 3DPSA 4AZ0B 1TRHA 3Q98A 2BN4A 2ZI5A 2YFKA 2O59A 3AZQA 4KQKA 3KWJA 4DW8A 1BD4A 4FKMA 3W6OA 4BWGA 1X7DA 1OOEA 3Q0TA 3SMQA 1T8WA 2EV9A 4BEJA 2GS9A 4H1WA 4HZGA 4MCAA 4XEHA 2EYQA 3QUBA 3V3TA 2F8TA 3BA1A 3WIVA 1DKQA 1GLGA 1T8YA 5IP5A 4MRAA 1V9CA 5IYZF 4PR3A 4FJ0A 3EVFA 2QTVB 4BO2A 3SQLA 1LVGA 2FPIB 2VBCA 3L8MA 2PL9A 1UPUA 4K87A 1Z4LA 1U3TA 2Z5LA 3TTYA 1V71A 2V7EA 4ND5A 4DJFC 3SBXA 3OJOA 3HFSA 1QYDA 3EISA 3FSEA 1E6CA 5DWDA 1TC1A 3B9QA 3CRMA 3N0VA 1RLUA 3RUFA 3G85A 3AUFA 5JAIA 3H0KA 4UAGA 3RC7A 1RLOA 3RNOA 5AM4A 3CO5A 3CX3A 2IDZA 1BCRA 4OLJA 5J58A 1GGJA 1EP9A 1N2EA 4Z4GA 3CPSA 4ZI2A 4W99A 4JLWA 1UKZA 2GM3A 3NOXA 2B0CA 5B3JA 5IUJC 3OE4A 1JA0A 1HFJA 1QE5A 1O0CA 3II6X 2P7IA 7REQB 2JNWA 2A1IA 2ACWA 4D8TA 2PYDA 2XVXA 1YVRA 3LMKA 3R7WA 4L4YA 4EYEA 2ZU6A 5DEIA 3BDAA 4EHNA 3QU9A 2NZYA 2WJPA 3RTGA 1HE1C 1W52X 3P9YA 1FJHA 3F6EX 4O4JB 4A0GA 1KHHA 4AS1A 1GPH1 4LUCA 4YXWD 1A9QA 4I3HA 1SKQA 1MAWA 2AFRA 2OGSA 3GLSA 5H59A 1A9RA 3PR2B 2V0GA 2XCUA 3ZK7A 1CCWA 1OMOA 2JJYA 4U2KA 2QTHA 4UNNA 4EENA 1FY2A 2WAAA 2X7HA 4ZT2A 3N8GA 2XYHA 3NBYC 2COUA 3GVXA 1HWYA 4YP0A 1PWZA 1UOPA 3HNRA 4PYIA 3L0ZA 4UUAA 1BHSA 5JNRA 2J9ZB 5A6SB 1NMYA 3ZV7A 1IHPA 1VL6A 2BTOA 2RHGB 1GZ5A 2ADFA 2FZWA 3URMA 2FMXA 1O94D 3HGMA 5E1DA 3ZU5A 3G89A 1IHOA 3UB2A 1C41A 3RFTA 3OF5A 2L18A 4MUEA 3GA5A 5C9ZA 3PLAE 3CKLA 1QLJA 1ODTC 4RTLA 3FUXA 3JVVA 1L7NA 1PD0A 3IBYA 3B70A 3QX9A 4AZ0A 1RAAA 4GR5A 3ILHA 3TPFA 4HEA6 3F97A 1EK5A 1GDTA 4Q9LA 4XCVA 1QZUA 5DK6A 3VAZA 3X1WA 2JJ1A 2GVZC 2CEAA 2X5XA 3OEHA 4A82A 2QDKA 5I45A 2HM7A 3CVXA 4C0JA 4LIPD 5I3CA 3A6KA 1HNZB 5COQA 5ER6A 3MXTA 2ERYA 6GPBA 4Q4DA 5C5DA 1V2GA 1ABEA 2I6SA 1UZMA 3D1LA 3Q3JB 4K3VA 3ZN2A 4QXQA 5D7BA 4EL0A 2VPYA 1S2LA 2JAHA 4IH1A 3NUZA 5G53C 5I5GA 3CLTC 1JE1A 2P5UA 4DFDA 4BPRA 3FYCA 3WTCA 2X5NA 3LD9A 2Y1XA 1R8JA 4IUCS 3P9RA 1VPTA 4EDFA 1N2GA 2DXIA 5DJ5A 4IGIA 1YR9A 1Y42X 4LHWA 1GL6A 1TZKA 3VR3A 4RD0A 4EW2A 1DV1A 2JFQA 3IDQA 2OO3A 3GNQA 3ZK9A 1TQ2A 3IJPA 1DCKA 1M2WA 4HOYA 4AJHA 2G5TA 1K8RA 1T9CA 1OWLA 4J1QA 3EYAA 3BTSA 5ALYA 4IOKA 5EKTA 4QWMA 1TVKA 3IQFA 3VOBA 3EEBA 4EGJA 1L5KA 4PGFA 1CF9A 4WCFB 4ZCIA 4O3MA 4KOEC 1B1CA 4H1HA 2D5BA 4NULA 1QDUA 1SC9A 3VHLB 1DI0A 4UUPA 4DIMA 4YJGB 2JFZA 4BFYA 4LNHA 1I2AA 5DU2A 4XYMA 4A10A 1A7AA 1P1RA 3RS0A 3ZWBA 2C0CA 1SQ6A 1X8XA 4AJ9A 5A4DA 2J3QA 1SVIA 3EMDA 2A2ZA 2JCYA 2FFJA 2QRNA 2BKAA 2CSUA 2GN6A 2Y0PA 2ZI6A 1UBLS 3JQFC 3O3CA 1YZUA 3YASA 4ZKEA 3O1HB 5SZJA 4BE9A 5MGNA 1WETA 2XA9A 5HF9A 2J3DA 1GUYA 2JFWA 4NIMA 3K0AB 4X6XA 4MW0A 4Y2HA 4PLWA 2OK7A 4XVQA 5G2OA 2WYHA 5JAZA 2HN9A 3NBZC 1FDRA 1D3AA 2YHSA 2W8BA 4RK7A 1SUAA 4F3YA 4D6XA 1W25A 4D98A 3K0CA 1TMGE 2XNCA 4RVCA 3MUFA 4YGXB 3VYWA 1ZUHA 4TWBA 2YXLA 3PJDA 4MRNA 2RHOA 4OKSA 5EJ7A 4C0AC 1WPRA 3M5DA 1XN1A 5BRAA 2VHEA 1F7VA 2KPOA 1OROA 1M54A 5FLKA 4EI2A 1BHQ1 2X1LA 3MOIA 2DQSA 3OZXA 3UHJA 2ZIXA 1GPMA 3HU3A 1RCTE 1Y7TA 1B0PA 3V42A 2PZMA 4BNHA 5ALEA 4D7AA 2IH5A 4GOXA 2XEXA 1F5SA 3KUUA 1C7QA 4IJVA 4WKCA 4BLSA 3U39A 1TM1E 2NZ8A 5E7IA 4B3RB 1HEUA 4E1AA 1UQRA 2B7LA 2ZSJA 3AETB 1EYZA 3ZDBA 4HQNA 3EEFA 3JQ6A 5HG0A 4HZIA 4P4SA 2QU8A 3UGTA 3ACDA 1E4VA 2E1RA 2CHFA 3E5HA 1OF1A 4AAYA 4WXMA 5SYAA 3T7TA 5ES4B