5CCBA

Crystal structure of human m1a58 methyltransferase in a complex with trna3lys and sah
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
289
structure length
282
Chain Sequence
MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGDTSPFRSGTPMKEAVGHTGYLTFATKTPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit
publication title Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
total genus 71
structure length 282
sequence length 289
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5ccbA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ccbA02
1OR8A 3EVGA 1XDUA 2BR4A 2P7IA 2YXLA 4YMGA 4PYMA 5ICCA 2FK8A 1YFJA 3QV2A 2XYRA 1RJDA 4OA8A 3G2OA 1QYRA 3B3JA 5GOZA 3C0KA 2I62A 4F85A 2ERCA 4PIMA 1XXLA 4GEKA 4GOMD 1NE2A 1P39A 2FCAA 5FQNA 3TKYA 5DX8A 4HG2A 4E2WA 4YUWA 3FTFA 1ZKDA 5F2OA 3DR5A 2AZTA 1KIAA 3ELYA 3M4XA 4RWZA 5LR6A 4MQ4A 1NW5A 5LQNA 2G72A 2G71A 4DZRA 5K0BA 1L3BA 2AOWA 2H00A 1EJ0A 3OU7A 3P2EA 4PGHA 2OB2A 3LDGA 3UJ9A 5ICEA 1BC5A 1D2CA 1PJZA 2YXEA 4P7KA 2HTEA 3TRKA 5IH3A 4BP1A 3NVKI 5FULA 4A6EA 1XJ5A 1ZHFA 5EKUA 1TPYA 4GC5A 2IPXA 5GIPE 1NBHA 4Y30A 1N7IA 3KR1A 3NWEA 1SKMA 3OU2A 3VC2A 2IBTA 2O07A 3AXSA 2UYQA 3KPJA 3ME5A 2PX8A 1NT2A 3FPJA 1YF3A 3LHDA 3CJRA 5GWXA 1JQEA 5C1IA 2O0LA 5BW4A 3S68A 3JWJA 2JHCA 4DQ0A 1AQIA 3CBGA 5GINE 5LQCA 4QTUB 3M70A 1TW3A 3MAGA 4OQDA 2Z6QA 2XVAA 2F8LA 3KQPA 4IV8A 2VZ9A 4CTKA 3VSEA 3LDUA 4QTTB 2AOTA 3FUTA 2EFJA 2PBFA 1L1EA 5E1OA 3HNRA 1KR5A 2PXAA 3B3FA 5FADA 5LQKA 1L9KA 2DULA 5DSXA 1INLA 2H11A 4M7RA 4CTJA 3UBTA 3ELDA 3GRYA 2OZVA 2G1PA 2ZZKA 3G88A 3OPNA 3QOXA 3P9NA 5CVDA 4B17A 4HTFA 2ZFUA 4M38A 1M6YA 5BP7A 4YMHA 5EEGA 4IV0A 2IDJA 3A25A 4AZWA 3EMBA 5EG5A 4ER6A 1O9HA 4FSXA 2YX1A 2CL5A 2PWPA 4OX9Y 2NXCA 1N7JA 5GM1A 1YZ3A 4E31A 4GOND 3DLCA 3EVBA 5EQJB 5E9JA 1KPIA 4PIPA 3LL7A 2ORED 3MHTA 3GNLA 4EK9A 3LCCA 1SG9A 2P3QA 4KIFA 3K0BA 3KU1A 1JR4A 2PV0A 2HNKA 4QDJA 5B1SA 5FTWA 1BOOA 4RTLA 1YFLA 2EJUA 4IWNA 4KVZA 2Y1XA 4C4AA 5K0JA 5G02A 3PTAA 3EVDA 3KQVA 5DXAA 3GCZA 3BKWA 3BWYA 3TKAA 2EJTA 1JSZA 2GAFA 3P2IA 3LCUA 2IGTA 4BP3A 4QDKA 1JG2A 4E33A 3PFHA 3FUXA 3BUSA 4RTPA 3IHTA 2O06A 3A27A 3UZUA 4ER5A 4POOA 2OO3A 3LCVB 5JR3A 4OQEA 2UYHA 2I7CA 4AUKA 1U2ZA 1P91A 1VP3A 1R74A 3B89A 5CVVA 1JTEA 4HGZA 1VE3A 2BM8A 2PT9A 3OFKA 4X63A 1YUBA 2NYUA 2UYOA 4P7GA 3EMDA 5CD1A 3G8BA 4PWYA 1P1BA 5DRTA 4ER3A 1G6Q1 5T64A 5EIWA 5EVJA 5ERGB 1UIRA 1V39A 3OZSA 3NDJA 3EVEA 3U81A 2AOVA 3A7DA 4GF5A 3LSTA 3VC1A 5EMKA 1M0EA 1RJEA 1L3IA 1XTPA 3OZRA 4YV1A 3P9IA 3PVCA 3GRVA 5LQJA 4C06A 1ZQ9A 4RVDA 2DPMA 5CUQA 3FPFA 4ZTBA 4YUVA 1FJXA 4MTLA 2P7HA 3P2KA 4FGZA 2B25A 2ZWAA 3UJDA 5DTRA 3GRRA 1FP2A 4FP9A 3HVIA 4AX8A 1EJ6A 3OFJA 2ONYA 2I9KA 3FPEA 5DM4A 2R6ZA 2QY6A 3CKKA 5MHTA 4F86A 5DXJA 5LQAA 4QQNA 2B9EA 7MHTA 3FPHA 3WSTA 1L3CA 3E23A 1KXZA 1G55A 4MHTA 1EG2A 3LPMA 3MGGA 3GJYA 5FUBA 3TMAA 1T43A 4M36A 4R6XA 5DLYA 5K0LA 3TQSA 5DSTA 1Z3CA 4RTNA 3DXYA 3JWIA 5HZMA 5CVEA 1JG1A 2OXTA 3NVMB 4Y2HA 5ICGA 2FRXA 4QQKA 4KDRA 3LBFA 3MERA 2AVNA 3BGIA 3GGDA 5EEHA 3Q7EA 1VP9A 1B42A 2B2CA 4NECA 1NBIA 2WA2A 3FUVA 3EVCA 5EOVA 4DMGA 5E2AA 2AN5A 4XUEA 3UFBA 3KPUA 5K01A 3TOSA 1DCTA 2R3SA 2I6GA 4E2YA 1WG8A 4M37A 2P1DA 3CJQA 2PWYA 4PYOA 4RTRA 3MQ2A 1QAQA 4PONA 4HH4A 4ISCA 5EMLA 5HIJA 1D2HA 5F2NA 3A26A 3V8VA 1QAOA 3HCAA 3OZTA 5K8VA 5HEKA 1X1CA 3PX2A 3HP7A 5JUWA 3GRZA 2XBMA 1X1BA 5FQOA 1Y8CA 4ER7A 5K0NA 3HCDA 2P35A 3ID6C 5DTMA 3LGAA 2PXCA 2PX4A 2ZLBA 3MTEA 4GUAA 1QANA 3GO4A 3I9FA 3DH0A 2VDUE 5FWAA 2B3TA 3OU6A 5FA8A 5GM2A 4BLVA 2VDVE 4LECA 1O9GA 2B78A 4QVGA 2ZIGA 1KPHA 1IY9A 2QRVA 4PYJA 1EQAA 1JQDA 1H1DA 2C7QA 2IIPA 4P58A 3UWPA 5HFJA 1KP9A 4XUCA 3EGVA 3SVZA 3TLJA 4PNEA 1SUSA 3BWMA 3R6TA 4YV2A 9MHTA 1NV8A 2YR0A 4GQBA 2O57A 2IH2A 2G70A 3G2PA 3KQOA 2FYTA 5HIMA 4E70A 2PT6A 3JWHA 5K0EA 4YV0A 3BZBA 3KQWA 3P71T 3UJBA 5K03A 1XDSA 2BR5A 3DLIA 1I4WA 3L8DA 3OE5A 3SMQA 4AZTA 5LSAA 4RTSA 3P9CA 5KQSA 3HCCA 2AN4A 4CKEA 1NKVA 5EMJA 5EZSA 3HA5A 3G2MA 3M33A 2AOTB 5H02A 3HVKA 3SM3A 3G8AA 4PYNA 2AN3A 2FK7A 5FWDA 4RTJA 5CCBA 3QOWA 4DKJA 3GRUA 4X1OA 3UJCA 1FPQA 2AOUA 1SVUA 2QYOA 3UJ6A 1KHHA 2Q41A 1KPGA 3AXTA 1F38A 3KKZA 3PFGA 3PT9A 4PYQA 4C05A 3SSMA 3C6MA 1WS6A 1ZGAA 4OBWA 2OYRA 4DCGA 4E30A 2OY0A 2ZSUA 2P40A 3KQTA 2GLUA 3G89A 4HTFB 4RTOA 3KR9A 1TW2A 4QPPA 1UFKA 1AV6A 2UZ4A 2V7EA 3DTNA 5DX1A 4CKBA 1NW7A 1ORIA 3FUUA 5EKXA 4IKPA 4ER0A 4F84A 1I9GA 4KDCA 1XCLA 3SSNA 2GS9A 2ZWVA 3R24A 5EC8A 2BZGA 2YTZA 2ZULA 2G8NA 2EX4A 3DMFA 1NW6A 2XVMA 3DXZA 3HVJA 4KW7A 4OBXA 3KQMA 5D1HA 2JHPA 4HRAA 1IXKA 1G60A 3A4TA 5E2BA 3SGLA 3T7TA 4DF3A 2Z6UA 1X1DA 3FPGA 2JH9A 1WZNA 2VP3A 3IEIA 4FT4A 4U7TB 3HA3A 5EHIA 1RI2A 5CVUA 1NW3A 4G56A 3FTEA 3I53A 1DL5A 3GDHA 4R8RA 1HNNA 3DP7A 1O54A 3KPVA 4RTMA 3FYCA 4UOEA 3SXJA 1AF7A 2XYQA 4CKCA 2NXEA 5F2KA 4E2XA 3UA4A 3LKZA 2ONZA 2ZZMA 1VQ1A 5KS2A 3KPYA 4P7JA 3T7RA 4BLWA 3BKXA 1D2GA 2PSSA 3EPPA 5P8WA 5BXYA 3LX6A 2AVDA 3GWZA 2O05A 3C3PA 2ZZNA 4C04A 2YXDA 4RTKA 5DPMA 2PX5A 3FZGA 2IH4A 3FUWA 5GIOE 1JTFA 4FZVA 1I1NA 5ICFA 5HOQA 3F4KA 1ORHA 3TM5A 3M6VA 3KR0A 3KR2A 1RI3A 3B3GA 5K0CA 3O31A 4HSGA 5K05A 8MHTA 2AR0A 3DMGA 1VBFA 1VL5A 3ELWA 5DM2A 5EHGA 4X41A 3ELUA 4ATNA 3EGEA 1R00A 3UJ8A 4BLUA 2JH8A 2P3OA 3THRA 2PVCA 4R8SA 3CVOA 3O4FA 2ZVJA 2ZW9A 4HGYA 2JJQA 4JXJA 3SX0A 4YUXA 3PB3A 3PLAE 5LQUA 3BT7A 2NXJA 1Q0TA 2AS0A 2WA1A 5CCXA 3IV6A 3REOA 4RVGA 3CGGA 3LECA 4R6WA 1WXXA 4BY9E 2PJDA 3TPZA 2YUIA 5DTQA 10MHA 1XCJA 3FTCA 1XDZA 3CJTA 1F3LA 3KPWA 3AY0A 2PX2A 3TFWA 4O29A 3G2QA 1VIDA 3KHKA 4XUDA 3EEYA 2PXXA 3DUWA 3R9XB 3G7UA 3HCBA 2CWWA 3G5LA 3D2LA 3ER9A 3K6RA 3MCTA 5DRYA 2H1RA 5E1BA 5FHRA 3RIEA 4WVLA 2BR3A 4MIKA 4MWZA 3DOUA 3MCZA 3UJAA 3DMHA 5T67A 1XVAA 2QE6A 4EMSA 4QVKA 1P1CA 2UYCA 2ZCJA 5FCDA 1MHTA 3FYDA 4LWPA 2CMGA 4DCMA 2IDKA 4K6MA 3R3HA 5D1NA 3T7SA 3R0QA 1QZZA 2VS1A 1VPTA 2C7PA 4PYIA 1KYZA 3I58A 1HMYA 4C03A 4L7VA 2VDWA 4OA5A 1WXWA 2GA9A 2K4MA 5KVAA 3EGIA 3SSOA 3KQYA 3V97A 2C7RA 2FPOA 3KQSA 1YB2A 3E05A 2HMYB 3FRIA 1EIZA 2AOXA 3M6XA 5EPEA 3CCFA 4U7PB 4WXHA 3TR6A 2KW5A 5K09A 1X1AA 2CKDA 3OCJA 5DM0A 2HWKA 3MB5A 2PY6A 2ZIEA 1Q0SA 5C0OE 2Z6AA 3HEMA 4HC4A 4PCLA 3PS9A 4A6DA 4GC9A 3TM4A 1R8YA 4KIGA 3NJRA 3LKDA 3EEOA 2GH1A 4R05A 5M5BA 2ZBPA 3FRHA 4FT2A 3FTDA 3I5UA 3ER8A 2GPYA 4PYKA 5FA5A 5EMMA 1R8XA 5CM2Z 3M6WA 5DM1A 3I64A 2A14A 3SR4A 3NTVA 2QRVB 4C08A 2OBFA 2BH2A 5DWQA 1FBNA 2LD4A 3NWBA 5E9QA 4EVIA 1G8SA 1YZHA 4DA4A 1RJGA 1BKYA 1NV9A 4X61A 2ZIFA 4RX1A 3BWCA 4FR0A 1IM8A 4GOLD 3AWIA 4P7FA 5KYGA 1SQGA 3H2BA 3EVAA 4CWAA 4AZSA 4YUZA 3Q87B 2OKCA 5BW5A 4PYLA 3MTIA 2BM9A 1SQFA 5E1DA 4E32A 3HM2A 3VYWA 4AZVA 4FSDA 1MJFA 2AOUB 3E8SA 3P9KA 2IBSA 2IH5A 2NXNA 5CVJA 1WY7A 5K0GA 3DXXA 4RVFA 3IYLW 1RI5A 1X19A 4FS8A 4RVHA 4KWCA 4X60A 4GBED 1UWVA 2ZBRA 1QAMA 1VLMA 3LDFA 3P8ZA 2JG3A 1ZGJA 3NMUF 1M6EX 2JHAA 3NW9A 4PCAA 4RV9A 1BHJA 3ORHA 3CC8A 3EVZA 5DX0A 5EIFA 1R18A 5LQRA 5FHQA 5IKMA 4C07A 1KYWA 4YUYA 4GOOD 3BGDA 1DUSA 3GIWA 2FHPA 2CMHA 4LG1A 5HIKA 2ADMA 2P41A 4V0QA 3ANXA 4EKGA 2GB4A 2YQZA 3HVHA 1AQJA 1G38A 2ZBQA 2HR1A 5KQRA 3HCEA 3GU3A 4RSRA 5T6BA 1N2XA 3HA7A 2WK1A 3OE4A 5E1MA 3UA3A 3B7PA 2NP7A 5EGSA 1SUIA 5EZQA 4V0RA 3BWBA 3RW9A 4DM3A 1G8AA 5HIIA 2NP6A 4PGGA 4RYLA 2P3LA 4PINA 2PKWA 3RODA 3X0DA 3A7EA 3P97A 1JG4A 1JG3A 3BXOA 2C7OA 5E8RA 3AJDA 3HCFA 4E2ZA 1R6AA 1RI1A 2PGXA 2PLWA 1EAMA 4EKIA 3EVFA 5E9WA 3ERCA 5C9ZA 2V74B 3NDIA 3HTXA 3GXOA 2OPBA 5E8JA 5CIYA 2IFTA 2NNWB 5DT2A 2P8JA 2ZTHA 3E7PA 4EQZA 1ZG3A 5HILA 3THSA 3UJ7A 4Z2YA 2IP2A 3C3YA 4QPNA 2ESRA 3C6KA 2XYVA 3M6UA 5K0FA 4XCXA 3LBYA 1RJFA 5GP1A 3B5IA 2E5WA 3G5TA 1JQ3A 2HV9A 2YVLA 3KQQA 3DULA 1JSXA 2OB1A 3PX3A 4LWOA 4RTQA 4CXMA 3O7WA 5U4XA 2QM3A 3T0IA 2Y1WA 4H0NA 3JWGA 2EG5A 1FP1D 3BGVA 1PRYA 1RI4A 4KRGA 2N47A 1NW8A
chains in the Genus database with same CATH superfamily
2YXLA 1JFFB 4H6XA 2LUOA 3EPJA 1NZDA 1YFJA 2W8BB 4NIMA 4UMDA 1A4XA 3C0KA 3U3JA 5KJCA 1PGQA 3GUVA 2GYVA 4AS2A 3LT5A 2JI6A 3DNPA 3PDJA 2HLDD 4KUHA 3LKBA 4Y6SA 1YRBA 2AZTA 2LW7A 3RS4A 1R0CA 4UZEA 4LMPA 2QYTA 3N6RA 3ZW8A 3UHFA 2JDID 4C1BA 2ACEA 3HXQA 1ORWA 1FA9A 1Z2OX 2RGYA 2V9ZA 4NZPA 4C7MA 3ONVA 2IW1A 3BXGA 5J4HA 4N3GA 1S2OA 1NN0A 3AEYA 4FGWA 3EXFB 4LE0A 5FBZA 2BRUA 4LZOA 2XB4A 3SZOA 4QLBA 2IYRA 4YP0A 4W7IA 4BV9A 1Y3BE 3NIDB 2VDWB 5JNUA 1I13A 2PX8A 1G20B 4C4RA 4EY3A 4W7HA 3GRAA 3AHHA 1D1SA 3A9TA 1G98A 1MFPA 2ETXA 4OHKA 4PZCA 2WF8A 3G1WA 2RAUA 3B36A 1M34E 3DBRA 4KXXA 4Q19A 2ZU0C 5AKKA 4YXWA 3KXDA 1I2BA 3BMQB 4KYTA 4QTUB 5KQGA 2OV2A 1F6BA 4MVCA 4OXXA 1CUFA 2E6KA 1FY2A 1ULZA 2ZS7A 2Y1DA 4N65A 2YOGA 1RKUA 2G9UA 4RACA 2NTEA 1UBKS 3BAZA 1JPUA 3WNZA 1L1EA 2Z2YA 1DG1G 2Q7XA 1O08A 2ZQZA 5DASA 3MBIA 1V96A 3N74A 3RRMA 4ASUA 5EJ2A 1KDRA 4GWLA 3NORA 2F90A 3KAKA 3I1JA 3L77A 2VRBA 1OAOC 3C3MA 2VTKA 3KD2A 4CQMA 5JXIA 1M6YA 5L3QA 1GUDA 2WNIA 4IV0A 3DCNA 1BMQA 1TK9A 4FSXA 1YOBA 2O2EA 3LHSA 3C2QA 4RFSA 4O2BA 3VU0A 5K6TA 2Y05A 4OX9Y 1YOVA 3I4LA 4B6OA 4IUBS 2FKNA 1N33B 1E3LA 4ZQCB 4BASA 1Z0UA 1L7EA 4N5LA 2AJTA 2W2XA 2ORED 2VCYA 4TQGA 5FOVA 3SOPA 4EK9A 1KU6A 1F2UB 2HFJA 1GTZA 1AK9A 2AUNA 5I8ZA 1L7NA 3K0BA 2FWIA 1CLEA 1NIPA 4L5JA 5T8KC 5DVZA 2O5EA 2W43A 2C59A 4RTLA 1YFLA 2YICA 4IXNA 4JYCA 3ZHYA 2XV1A 3LE8A 1O5OA 2R68A 2B0CA 2G0AA 3WXMA 3PHHA 3HXKA 5CW2A 5K0JA 1DCKA 4TKLA 4IY1A 1TC1A 2D0PB 1FVXA 1C0KA 3T5TA 2LRHA 1E64A 5AH0A 2C7GA 1W25A 1NC3A 5LP6B 1Q44A 2JJ8A 4UXHA 4Y2UA 1DXYA 3FGOA 3QELB 3ZGXA 4ZDKA 4L8WB 5LDDC 3P94A 4R2JA 1N8TA 1FMLA 2ASVA 4MPPA 4FFNA 1YFKA 4QUEA 4QX6A 2OO3A 1FMTA 1FRZA 1RRCA 3R0XA 3C8UA 4Z0TA 2RHMA 1T10A 4XR9A 1C1XB 1C4XA 5G40A 1K2VN 1IY2A 1E79D 5CH3A 4BIIA 4E09A 4OLBA 1WTAA 4AQDA 1KMCA 2TMDA 3GIDA 3U60B 3F6CA 4MLCA 2I67A 5FOUA 3WJ7A 5E7QA 4TS3A 1UWCA 4AY3A 4B2PA 2XDQB 3A6KA 3KHSA 4HLQB 1UBRS 3GMDA 4WMLA 4CTJA 2XSZA 5DNCA 3SK0A 2IZ0A 4S05A 3GDGA 3THWA 1A9ZA 3BK1A 4HAWA 1Z83A 4KO2S 1NRWA 3PFNA 3LFUA 3QKIA 3S6JA 2JIBA 4CCYB 3OIGA 2ATVA 4U5QA 5C32A 1U7WA 1IOZA 3TE7A 2QTCA 3FMFA 3RBZA 5DK4A 2ZWAA 3UJDA 3CVWA 3PQ2A 4NABA 4BGEA 4AX8A 4ZCRA 2GD0A 2P2YA 1CJMA 4QOHA 2QNRA 5DM4A 4BB9A 2I9KA 1FDRA 1V5EA 5ELLA 5G0SA 3N59A 5LNK1 1I6WA 3UCFA 5C2JB 3MTBA 4WNAA 3W1WA 4UTVA 5LXTF 3EWSA 5LBIA 1R12A 2O50A 3IAM6 3AJAA 2JLUA 4DSTA 4IFTA 4IWXA 4NPHA 5AW9A 3ZNQA 3V4RA 4MHTA 3VNVA 1ZD4A 3FOCA 4O2AA 5DLYA 1GNQA 3PE3A 4FTWA 2J6BA 1PEDA 1ZN2A 1MAHA 5HJ2A 1Z3CA 3JWIA 2Z8YA 1MABB 2B1JA 4RZQA 3BD9A 1GNVA 3LBFA 3PC7A 4YJGA 1KK2A 5EJ5A 5DNDA 2DKNA 3REQA 4J3JA 4C4ZA 3E22A 4KK3A 4Q1BA 2YRFA 2ILVA 1A96A 2C29D 5EJ4A 2ZU6A 3CPSA 1ZIOA 3MFYA 5E2AA 4B45A 2ZI6A 4FVTA 1QRRA 3B20A 4XLZA 3C1OA 4BE7B 4NMWA 2RGXA 1XXHB 3H9UA 1L7DA 3U1TA 2PMDA 4FU0A 4ZQHA 3A4LA 1JWAB 3ETDA 3KB8A 3UAYA 3W77A 5CX1B 3K5WA 3K16A 4M46A 2HRZA 2Q4TA 3HN6A 3DTYA 1BDBA 3IAUA 3FDIA 3O1JC 1ZVKA 4J0IA 4UW9A 1Y9AA 3HU5A 1EE1A 4OF4A 3SZ3A 3V8VA 4BGVA 5HS6A 5CR9A 1US8A 1UEJA 2X2FA 5B64A 4FDMA 3HABA 3W78A 1VA5A 1SD5A 3CKYA 4KXMA 5FQOA 5A1JA 2G76A 1CE8B 2YV2A 2QYSA 3L6RA 4KXWA 3D4BA 2BH2A 2X9VA 3AZQA 4PS1A 1GT91 3MYYA 1MX1A 4DADA 2ZLBA 2JAUA 3L6EA 3QVVA 4GUAA 4AKHA 5K51A 3OF3A 5GM2A 4LZNA 2P0EA 4BMZA 2FN3A 4WWHA 1JQDA 4C1NA 3PLNA 4NMXB 3EEBA 1KP9A 3ILVA 3N6XA 4R3NA 3G5UA 2HPZA 4MP6A 4WACA 4XUCA 3ZWQA 4F4UA 4YP6A 4HKTA 4P4SA 2OCLA 3TRJA 2BTQB 1YAHA 1EVZA 4XB1A 3NR2A 4DCCA 1XRNA 3JWHA 4QJ4A 4ZI3A 3W04A 4N7RA 4S2EA 3HL4A 4JUBA 3S0JA 2BDEA 4JWKA 4MYCA 3YASA 5IH7A 3GAAA 4C7OB 3QVOA 3RUCA 4RTSA 2IZZA 3CF4G 1CQPA 1XZBA 4L73A 4LCEA 1R64A 4CMEA 5ELMA 4ZEOA 1XZKA 4CHGA 3D8BA 5IJWA 3A1TA 3HKCA 5AKZA 5TLSA 5CCBA 1JYSA 5HTOA 2ZJ4A 1CNEA 5A3JA 2D5LA 3GFFA 3IR7A 1E5LA 2H0RA 2JHFA 5FI1B 3LH5A 2P9TA 2ZRNA 1IN8A 4R5MA 4TYMA 2P2GA 2FZCA 2FSVA 3U31A 5KI6A 1J70A 4JLKA 3QH4A 1Z28A 3LWDA 3OFVA 2CD7A 3HO8A 1P9RA 1KZ6A 1W1WA 5D8DA 1NG1A 1W35A 1NI4A 1QO9A 3TXXA 4I46A 3VOAA 3PGJA 2PRYA 4ZI7B 3DE3X 4K6FA 1N7GA 3KZXA 3JD2A 4W9NC 2JD2A 3IEIA 1W4AA 2CL6X 4NFYA 1EFHA 2PZFA 3B9QA 5CVUA 4E46A 4G8JA 4G56A 4ND2A 4URHA 5DBIA 3OEYA 1R8QA 1HNNA 5FD8A 1JKJA 5B30A 4LIPD 4RPCA 4FHCA 3CEHA 5FPYA 1AF7A 4GR9A 3QKWA 3IBYA 2IHVA 3GZTB 1TTQB 4J9VA 3NOVA 2NXEA 4COOA 4O08A 3IKTA 2POQX 4V24A 2Y71A 1CEEA 2D00A 2NZJA 3EIUA 3DEIA 1SXPA 4UZFA 1R0LA 3I9NA 3B9PA 4PW0A 3H2IA 3U7FB 1KJNA 3EJWA 1XKTA 3IDFA 5GJVC 1JSRA 4MEBA 2JL1A 3UWKA 4H35A 4EABA 1U0EA 2HGZA 1O6BA 1QO0A 2HQSA 4M1OA 1KQNA 2RJ3A 3PZBA 1JR3D 4UQLA 1A3CA 4BXOB 4DS3A 1XHEA 1M9NA 4FZJA 4E14A 2JRLA 2PVSA 4EJSC 4TM8A 5EJAA 3R7NA 4BLUA 2JH8A 2PNFA 2P3OA 1F0PA 3U7QA 1YU9A 1BHO1 2WF5A 2XUPA 4FEGA 5EIBC 5EWLA 3ZCPA 2BELA 1WXEA 2EKLA 4RZUA 4AN1A 2I99A 4RGYA 4M1WA 4IHAA 4NHEA 3H2SA 5CIQA 3WL3A 3D5QA 2NZYA 1GTG1 2F2TA 3ND9A 3WRVA 1FQKA 3H19A 2VYND 4NFHA 4O59O 4WGGA 5AM0A 1U7DA 5HXAA 3FJYA 1YIDA 2BHNA 2FB9A 4K8RB 3C87A 1ZD5A 5A5EA 1KEVA 3AEQA 4OAQA 1FUEA 3FBTA 2W2LA 4IQGA 1J7KA 1NMEA 2IOQA 5IZCC 2E82A 1T5DX 3TQQA 2IHZA 2W90A 3NU1A 2G5CA 1KAHA 3DUWA 1U1CA 1UDCA 5IJAA 2QUKA 4DCVA 4EG3A 1RWPA 2R7KA 1WQ1R 3HZRA 5KBYA 1NY5A 3DOUA 1QVVA 4U39A 2VQEB 2HYIC 1SD2A 2VJDA 3MPOA 1L4BA 3BD7A 4BQRA 1Y5LA 3F0TA 1O6ZA 1YR1A 3OCVA 3O92A 1AE1A 3UK0A 4UARA 2PS0A 5AW5A 4MVJE 3ZZTA 1J0DA 5IFLA 4AWXA 1PZNA 3L6BA 4OA5A 3W7VA 4GGPA 1HZJA 3KQYA 3X1WA 3WLKX 1RWVA 2GPTA 3COWA 1XZPA 5A4DA 4J1TC 4WY2A 3OZFA 2VCHA 2B8NA 3DFIA 1WY5A 4NPAA 5JRJA 1ESDA 1K6XA 5F7ZA 3QF4B 2HWKA 3MB5A 3BORA 4FI3C 1E1LA 1LBIA 1NFFA 2IIBA 1V47A 3UAGA 2X19A 1VL2A 3QG1A 4YRQA 2NSLA 3GEDA 5B55A 3MOGA 3LY5A 2DZDA 4D9GA 4ESHA 1A0OA 3QY9A 4C4SA 5EHZA 3KYIB 3W2HA 1E3TA 2FSFA 2IXBA 2W0MA 3HACA 3MMNA 4XWTA 4C2AA 4J94A 3UKDA 1NUHA 3EFOA 4L4YA 5LP1A 2XEXA 3KV1A 4RPGA 2HCJB 4WOBA 1WL8A 5D7BA 3ZWKA 5JYEA 2OCGA 1KAOA 2R6FA 2OBFA 2XXBA 3C4VA 3PC8A 4PZYA 2Q6KA 4TLAA 5E9QA 2WHQA 5EJIA 4PLCA 3A6PC 2WOJA 4A9AA 2SCUA 5FOSA 4M1TA 3BWCA 3I9V6 4V03A 3DE2X 3OZUA 3GD5A 3NV9A 3RSHA 5BNTA 3UANA 2RHTA 4R69A 2PTGA 4MGYR 4ERNA 4HNTA 4PBSA 4XR4A 5K1ZA 3TNLA 1V8OA 2C9BA 3D4IA 3LS2A 3AF1A 4LRUA 4PYLA 2JJMA 3U4GA 1N3YA 1T8SA 1SQFA 2VN8A 2FX5A 4N82A 2EP5A 3EOAI 3KJIA 3NRCA 2HADA 3PDCA 5I7RA 2AOUB 2XT9A 1XTUA 5IBPA 4REOA 3Q0TA 2QX7A 3SQDA 4PLFA 4CLOA 2IXEA 3ENQA 2OFOA 3TIWA 5IAAA 1WUIS 4HNQA 1B0UA 4DCJA 3CUEF 4QSMA 1KI7A 4WZBB 5DXFA 3AGPA 5KKNB 1UMBB 1J8FA 1L8XA 4J6EA 2XKAA 1M6EX 3QQPA 3K09C 2R751 1KDOA 4B4UA 5L3SA 1K5PA 3I37X 1BHJA 2I2FA 4C7VA 2JLCA 5M7EA 2F3UA 4B3BA 2EQAA 5C18A 2VBGA 2ACWA 1E99A 3NANA 3RLFA 5IKMA 2YZ7A 1NGSA 3KCNA 3H0KA 4HDMA 2B1IA 1Z5UA 1PBTA 2MINA 1L4MA 2FHPA 1KSGA 2GCNA 3ANXA 3UQYS 3GEEA 4L50A 4QYTA 2O2HA 1YQEA 3HCEA 3FCSB 2V6JA 3JQFA 2HDHA 1OWLA 4UAGA 1P2SA 5IVPA 2V6BA 3G7NA 4IS2A 3TR5A 1EGVB 1E8NA 2B36A 2QM8A 1N3LA 3Q9LA 3SYTA 4F5YA 4BX8A 4J9UE 1XTIA 4XJSA 6GPBA 1BW9A 2EGHA 2EBUA 1QH0A 2CNWA 3DPIA 4H16A 4P5EA 4LF6B 2LW6A 4FLFA 4J0CA 4FWTA 2I7XA 1JXAA 3PRKE 3WNBA 4IIGA 1JSCA 3BXOA 4D2IA 2GJKA 1NR5A 5FLKA 2C2OA 4DNXA 1QQ5A 3M6AA 2FZKA 3FSJX 4HAYA 4J0HA 4D80A 3EVFA 4JKOA 4KXLA 1DPFA 5G4KA 2H4WA 3J80A 4J8PA 3X1DA 3PCRB 1NT4A 1JHDA 1LQTA 5IVHA 1Q19A 1AKNA 3HMQA 3TBKA 5JCJD 4IJKA 1H5NA 4HWOA 3KWMA 3RYHB 1VSTA 2JGAA 3L8YA 2JAWA 3R5FA 4C43A 4D7AA 3I83A 3KC2A 5AM4A 3C6KA 3JVVA 4PBRA 5F4BA 3ZU2A 1CR5A 2FZEA 4F2GA 1GGKA 5IASA 2DJIA 5AUQA 1JQ3A 1FX0A 4GXQA 3WLFA 4X92A 4K81B 1Q6ZA 5FUVA 3KOUA 4RKQA 1SOVA 4ZN6A 5ILQA 1P62B 2Y1WA 2WTXA 1FYWA 2CB0A 1DRUA 2DFTA 3WMXA 4DIMA 3I9LA 3VR0A 3ICVA 1OR8A 4DCUA 4W63A 2ZKLA 3DOHA 4Q3KA 3MGCA 1QYRA 3B3JA 1J49A 4FQ8A 1F2TB 1NE2A 1P39A 5CXXA 3QPWA 5C3UA 2HLNA 5L4LA 4EG7A 4D44A 1HDYA 2ZROA 4JUDX 3OM8A 5GV7A 4EKNB 4F9FA 4QJIA 3GJ4A 1CUGA 4QJ5A 4RWZA 3I5YA 1E2HA 4OREX 1EJ0A 2JF0A 1URPA 3FVVA 5JE8A 3DHYA 1NAIA 1FSZA 3G0CA 1BG6A 3K73O 1O03A 1O6CA 1PX2A 2GK7A 3IBFA 3O4VA 4R81A 1ZHFA 4BU1A 2BJWA 4KBYA 2CJYA 2VHWA 4N3CA 4DC9A 5I8WA 1MA3A 3MG9A 4KUGA 4R68A 4CGZA 2V9PA 5D6YA 1YULA 3B1ZA 1SUWA 2XDAA 2GNAA 3ZXIA 3FMVA 3EGDB 4C6TB 2BEUB 2H9IA 1HE5A 2YN0A 1Z25A 1N57A 3FI9A 3IXLA 3ZLTA 5LZ4A 2MSNA 4B6SA 1M73E 4E51A 4W5NA 3NZEA 4UU1A 2JBAA 3CNOA 1R8SA 3JWJA 1UC5B 1QE0A 4KXVA 4XASA 5AMXA 1ABBA 2A9FA 2FW9A 2QT9A 5ECDA 1RXVA 5EJEA 4QATA 4R2WA 2C2KA 2FMFA 5FLXA 5JAHA 2OXEA 3JQBA 1UP7A 3ZKAA 1DSSG 4HGNA 4C6SA 2ROQA 1F0NA 5J1TB 4AB1A 5BN5A 3ZDXB 1D1QA 3LO8A 4AF6A 1Y4UA 4JSRA 4TKUA 5KZMB 1CLUA 3RVQA 5BUCA 4YJ2F 2GK4A 5ELXA 4COKA 3L4KA 1UJNA 1SBIA 1XDDA 4OSOA 5FUWA 3TL2A 1YVUA 3SHFA 2O8VA 2PH3A 4YYEA 4D9KA 5JJ5A 3DZFA 4U9IS 4KREA 1QP7A 5AW4A 3OIDA 5KJ1A 4Y7CA 4J2HA 5FNVA 4V2UA 1O9HA 4L78A 2A35A 4S1VA 1DKUA 1K7FB 4I3HA 4TRJA 4ZJPA 4JI6B 1YZ3A 3OY7A 1EEXB 4M9QA 1C7EA 1GPKA 1OYVA 3C6QA 1SU6A 3QFHA 1S3SA 2C95A 4E5PA 4JHXA 1PNRA 4EB0A 4DREA 3IE0A 4OH7A 4HRVA 4H7EA 2UXCB 4EB6B 1L1QA 2BFCB 1UZLA 1WIWA 5JVDA 4EVSA 3CA8A 2OLJA 1BOOA 4R83A 1Z0SA 1HLGA 3B7GA 3T7EA 1E1RD 5A9SB 3A1EA 4WAUA 4DT1A 1WB9A 3KE8A 3W5UA 9LDTA 1ODIA 1P72A 3ONFA 1FFBA 3BKWA 1XNHA 4HLCA 1DPGA 1A5TA 4QU8A 2OHGA 1FNDA 1PR1A 2PM8A 4D0LB 2H4XA 2EJTA 3P2IA 2Q3DA 2ZM6B 3T5AA 1Q12A 4TSFA 2XYPA 4NXNB 4BEWA 1VMKA 3PBKA 2REXB 1Q1ZA 1U0SY 2QLMA 4XXHA 4E33A 1ZVQA 2VNIA 7REQB 4QRDA 1X7ZA 4MDYA 3IHKA 3UZUA 1G6HA 4Q16A 1U2EA 4TTVA 1WHTA 7MDHA 5JNLA 2GFQA 3T35A 5JR3A 3P2JA 3L1VA 5K3SA 3ZTWA 3PPIA 3I09A 2A9JA 2DQ4A 4B9EA 1QR2A 1YS2X 1C8BA 2D13A 4CQLB 1EWTA 5KSWB 1RAAA 3D6UA 3AJEA 1BXGB 3ETNA 3IEKA 5ADWA 2VA8A 4TKVA 4NEQA 2Y0DA 3LPNA 4YLGA 1DQYA 3BERA 4NX2A 3P9IA 3L8CA 5CNIA 1FFYA 4ZVSA 3PWSA 5AHOA 1SPXA 1DBPA 2BGLA 4EG4A 1NJ8A 2VYVD 1P3JA 4BNNA 4C0QC 5U1PA 1DE0A 3QE2A 4KE8A 5DTRA 2LZ0A 1P1JA 1VXRA 2JFNA 2A9VA 4IQ4A 5EZYA 5K4GA 4G3XA 2DU8A 4BVKA 5JH7A 2XUZA 2C04A 2ZBGA 1JR6A 2N0SA 3IVXA 2GGSA 4DSAA 1UJMA 2W4MA 4IJ6A 3D7MA 2DXIA 3AVWA 1KZGB 3H9GA 1T8TA 1YD7A 4FOOA 1N2HA 4ETIA 1QG0A 2PPVA 4QWWA 4TTRA 4OQYA 5CMLA 5E6RA 5EWJB 2ZJ2A 5J2UB 3TQOA 2QVXX 1JG1A 2XVXA 1N9KA 4KQ6A 3COVA 5DGXA 3ZWDA 2JAQA 1IG0A 1KEKA 3CKMA 1B42A 3IUBA 4IZOA 4FK8A 1MRZA 3EIXA 3I32A 3ZWVA 4HV4A 2B5OA 3EUEA 1WD5A 2FG7C 4M0CA 4EHFA 4C5AA 1CKEA 1FLDA 2QMYA 2NVUB 4LOKA 1JLHA 4W82A 5LOVF 4JGBA 1XA0A 2PWYA 3F90A 1JJVA 2QLLA 4KXQA 4ZOLF 5A03A 1A5AB 2MM2A 4OJMX 4R1SA 5K4AA 2VSNA 5HIJA 3GJ6A 3N58A 4JOBA 2BEVB 2YBEA 4Q93A 5I4CA 2J3EA 3DLAA 2HV8A 2WAYA 4I4NA 4J91A 2Z4SA 5FBWB 4DDVA 5ADHA 3PX2A 5DE3A 1AN9A 4G5SA 1OFHA 3KLPX 3RT7A 4JMLA 1I30A 3SG0A 4KR7A 3V7WA 2J3IA 3HEBA 4HAVA 4BKMA 3JQGA 1Q16A 2ZG6A 1EINA 3HY3A 3OCZA 1ZCBA 3N5KA 4MB0A 5J4KA 1PJCA 1LI4A 1V35A 4IOLA 4URXR 3H05A 3IUEA 1K08A 3N5CA 4AUNA 1SHLA 1HDXA 2XCLA 3A3NA 4S1TA 3SVTA 1BWSA 1X3LA 2FUNB 2H5IA 1RMTA 1VYUA 1ZSVA 3V1LA 4C2UA 2XW6A 1JLRA 1GQRA 3G2PA 2EDAA 3C97A 3DJFA 4FGKA 3Q6MA 5ALPA 1HF3A 1DKNA 3KQWA 2B4YA 1G66A 1O95A 1TF5A 2P9YA 3P71T 3SF8A 2OZLA 3H65A 4I55B 3E1GA 3OJLA 2DY0A 4IDNA 2C2YA 5JZMA 1P1KA 2IIQA 3W5BA 1ZGZA 4ANFA 5L40A 5J2UF 2IYNA 1A1VA 1EP1B 3WIUA 2YJNA 3BFKA 4CFYA 3O8QB 2WIFA 5LB2A 2CF6A 2ZJ6A 1N34B 4L9SA 4IJMA 5HM6A 4L8LA 3ISVA 1F38A 5DNWA 1W49A 1ZGGA 5CM9C 1RKQA 1SHZA 4KX5A 1PNQA 1OLXA 5EJ6A 4ZT2A 1JJ7A 1X7YB 2XA2A 2GN6A 3E9MA 2QX9A 4HTFB 2BI8A 3QXXA 1TYCA 1JAZA 1TYBE 3ANSA 1M54A 3WFIA 2Q3BA 4YRJA 5KCMA 4CKBA 1OFUX 1T2FA 4JJGA 1M0WA 5BV0A 5JAOA 3SJZA 1KOFA 4OGWA 3EYWA 2Y1OA 4I4TA 2YY7A 4G4GA 4OD0A 3DMFA 5F64A 3ZU4A 4FMPA 4X7RA 3EDMA 2Y67A 3R40A 1HLDA 1G291 4N9WA 5AI4A 1IHOA 4EPRA 2L18A 2WJJA 3EBOA 1G9XA 5E6UA 3VR5D 3HH8A 1K97A 2ZR7A 3V8MA 621PA 2HY7A 1FFDA 3RU9A 1U5BA 5B7QA 1A50B 3LXUX 2Y1CA 2FSPA 3SBXA 4BO6A 1TZMA 1EP2B 1JR3A 3VKWA 5ALXA 4R1LA 4PE5B 4I5GA 1G8FA 4IKEA 3T3PB 4CKCA 3LKZA 1CUHA 4GH5A 2E89A 3KPYA 4DCNA 1VSQA 1XEWX 1RPJA 5J2TB 3ECCA 1ILWA 3OKPA 3PYLA 5DW3A 2QRPA 1IJEA 2FSHA 5JZ9A 3LG2A 4EO9A 1E6KA 2G9ZA 2WKRA 1P6UA 1XTZA 2E2WA 3FZGA 4EOGA 2RKOA 4OUDB 4OHZA 2DR2A 5B3JA 1TJYA 4DZZA 4PN7A 3OTGA 4N9QA 1MC4A 3F4KA 4QBGB 4DV2B 4C30A 2VLBA 3ZJTA 1KZ9A 3ABSB 3HJTA 4LYHA 1K27A 4FM9A 1NLFA 1QMPA 1EX7A 3UWMA 1U4NA 1YKSA 4D4LA 4I6JA 2BFEB 2BGGA 3GVHA 3IMFA 1KEZA 4Q9AA 3FZQA 4ALKA 1WBBA 1R00A 4F11A 3IOMA 5EXTA 5IPFA 4A2WA 4RANA 4U6NA 5H9WA 2PO7A 1YE8A 2ZW9A 3GBVA 5TVGA 4AJPA 1XZFA 1QFXA 4GSKA 4LK3A 5LQUA 3BT7A 3VAAA 1JQLB 3PJGA 4AWAA 3NGLA 2OXCA 1TVEA 4XRGA 1KMQA 5LWQA 1FVHA 1N92A 2DFNA 2YZGA 3REOA 5KJFA 1V1RB 3ORYA 4TXHA 5JCOA 5K3BA 2PJDA 1E60A 2W2KB 3EFEA 4QREA 1KMHA 2WU1A 2EFYA 2Q1CX 2RB5A 3UATA 4C9BA 3MRTA 1KOGA 3JATA 3WAJA 2MIIA 4O4LB 1MO3A 2X5KO 5YASA 3T3NA 3D6FA 4OXKA 1SNYA 3INGA 2ZGVA 4DY4A 1TA0A 2ZS9A 3N3AC 1ML4A 3LIIA 2CNLA 3CUTA 3KAQA 2QSZA 5FI3A 1U1FA 4MI9A 4WCFA 4XB2A 1F9AA 2ZRAA 1ACJA 1M1YB 4AJKA 3GLHA 1UPUA 4G1BA 1AKVA 1TAQA 1YZGA 5FFFA 5A71A 3F74A 1LFAA 4EAAA 2F59A 2RONA 3T12A 2AV6A 3WZLA 4DDUA 5LIRA 4KO1S 1N6KA 4ZXFA 1DIGA 2YH2A 2WZBA 1PNOA 3RJTA 2PKQP 2YHUA 1O8CA 1YA6A 1SCQA 1XRSB 4GBGA 3M81A 2GF9A 4QDUA 3TLYA 3VR4D 4YP9A 2FP3A 3U3OA 9ABPA 5DI3A 2UV8A 5JASA 3FFXA 2FEAA 3DZIA 4JVSB 3TUZC 1EHCA 2WWRA 4BKPA 2H8KA 5SYMA 2ID7A 4KEAA 1Q0SA 2GAJA 3G5AA 3USZA 1QIMA 4LRQA 1DRJA 2MJLA 3EY9A 3VR2D 3M1IA 5SZKB 3SKYA 5CT6A 4BJHB 4HEQA 1CVLA 4JOCA 2PXHA 3B5JA 2OC4A 4R1TA 2QMOA 4FW9A 4RZ3A 3TX6A 1ACLA 5B1HA 3WLSA 2PA0A 2EZ9A 1T15A 2WUEA 1JJIA 5FJIA 5JW6A 5KX5F 1CSEE 3TIGA 3S44A 3RAGA 2AT1A 4WKOA 3R7FA 3K1AB 3PFFA 4X64B 1YNSA 1ISPA 3PQ7A 1EUZA 1G8SA 2EQ5A 4UZSA 5FR1A 1NV9A 4CMCA 5KWVA 4I14A 4FR0A 1JQ5A 4U02A 4CM7A 1OX5A 2BFPA 1I0ZA 2QXYA 1IEVA 3EXHB 3GY0A 3R0JA 2HA5A 2VUTA 3H1AA 4G23A 4MRPA 1RXYA 3ZNPA 2BGRA 4AT1A 5JZOA 4LXHA 1J5PA 3O73A 4DNFA 1PT9A 1UK9A 1KFKB 2VSOA 4YPVA 2KY9A 2CDBA 3QIVA 4I8IA 2GJSA 3C41J 1R4MB 1M2NA 2B5WA 3JCZA 3MEQA 4PFKA 4TSRA 3UB3A 1T9ZA 4ND8A 4DMUB 5BQOA 2G1KA 2RBGA 4XAQA 2FMHA 1MKYA 2JRCA 4JBGA 3L0IB 3KO8A 5ECYA 4IINA 1MGOA 4MVWA 2PL5A 2YWGA 1Z16A 3PEFA 1MR3F 2IHYA 3IV7A 1VLMA 2P3SA 3QPVA 1YS6A 1N0WA 5FFNA 3OX3A 2EFDB 3GA0A 3PNSA 4HNGA 2EKDA 1Z38A 3K71B 2ECQA 1Z2PX 1YR7A 5C4IA 1PJQA 2ZK7A 4FYHA 1E61A 1WPQA 4G9BA 3SJAA 4V0OA 1XJWA 1NQAO 1QG6A 4ZXPA 1K6MA 4WV3A 1D2RA 1FMCA 4WESB 2VG8A 1RXSA 3I92A 3V8EA 1FRNA 3AVUA 4I1UA 1G38A 4HDNB 4RJKA 2ZBQA 3LPAA 3QM1A 1GTRA 1JEAA 1QYDA 1DT3A 3VH2A 4J3NA 1XTVA 1OREA 1FNBA 1GUAA 4MUBA 4N0PA 3DV2A 3HA7A 4WZZA 1MTOA 3CVVA 3TL6A 1C2TA 2QQSA 1RXWA 4D3DA 8OHMA 1ZOIA 4BVJA 1WCIB 4C4TA 4EJSB 3GJQA 3DHVA 2J8ZA 1WU7A 3HUEA 3N8DA 4PQGA 3RVOA 2B1QA 3QEJA 4ILEA 4JBLA 4RIIA 2OCIA 1Z68A 3PUKA 4AYXA 3VZQA 1JG3A 1RWBA 5CLFA 3FIJA 1S2MA 3I61A 3B2NA 4O4HA 1USVA 1O94D 3HCFA 2PLWA 3R5TA 5C1PA 4RLSA 2V1UA 3V4LA 1XX6A 3U13A 3Q9NA 5A6VA 3BFVA 1U80A 3EE6A 1KH2A 4HQRA 2H52A 2WT4A 1VGQA 2Q9CA 3AKEA 4LYEA 1JEYA 3UWOA 3DDCA 4YRBA 3C70A 3T7IA 5CFOA 2ZTUA 1L8LA 2LR0A 3ZDRA 4BC0A 4EUSA 3MWDA 4AVYA 3UOAB 1XCMA 5TX7A 4XCXA 2QJFA 2PDAA 5DYYA 1FLAA 1U3GA 1RBMA 4UFOA 4ZT3A 4FMBB 1V7ZA 1YR9A 2DUJA 4HFJA 4HJRA 2XHZA 5ITZA 1IB0A 3GLVA 3GVIA 4LWOA 2VLIA 1AHIA 4IDDA 3I62A 4B82A 4DLWA 2IYXA 4EHLA 3TLGA 2L69A 2GF7A 1ZHHA 4KIWA 1U3CA 1OT3A 1X3SA 3S2GA 3SZMA 4C88A 1GKIA 1N25A 5LCXA 1PG2A 3T7AA 5HG0A 3SNHA 1G16A 2P6OA 4GD3Q 5GVSA 4V1CA 3Q3EA 4RY2A 3DZJA 3WLTA 5KYWA 3DDHA 3CHYA 2WJAA 1KR2A 3RTAA 1X7HA 4KSYA 4TN5A 4Q3BA 3RVDA 2DBRA 5JMTA 4LX8A 1ZKDA 1XLTA 2VDLB 2BE9A 3H18A 4HWRA 3VBCA 4KB5A 3OCUA 3V5NA 1P75A 1OIXA 1KVUA 1U8FO 3IMEA 4DCTA 2RE8A 2H00A 4I9UA 2IPNA 1IY8A 3KETA 3DBHA 1KKMA 1YI0A 4P86A 3NVKI 2QMUA 1N5JA 2CHUA 3ESXA 1KZ4A 1SIWA 3FYUB 3GZJA 3NEYA 4P2BA 1U9JA 5ITVA 5IUJC 1GXSA 2HSZA 3HZZA 4UU0A 3UAZA 1SHJA 2A0KA 4WJZA 3VTKA 4EUKA 3E5NA 3UH0A 2IXTA 1W96A 3QUTA 3GLFE 3A1UA 4AUMA 2O54A 1Y98A 3AETA 7AT1A 1LNSA 3KR1A 1J9GA 5CEEA 1DB3A 3KPJA 1ODSA 3T0FA 1XCOA 3PGXA 5CLLA 2WSYB 3FPJA 1ICEA 1AGYA 1TM5E 3OETA 1VE5A 1L0BA 3PNBA 1P1HA 2OESA 3C3AA 3OC0A 1GEGA 1ZOLA 3CRZA 3ZHSA 2PLRA 4JLBA 4CN9A 4K1LA 1NNEA 3VAZA 4DMRA 5B7NA 4DSOA 2Z6QA 1BA2A 1LNZA 3IJ5A 3LDUA 4HMOA 3HMKA 3LRPA 4JWTA 4IJUA 4WK2B 4BS9A 2YBDA 2A1UA 2BRUC 3PDIB 1E6LA 2EFJA 4EW6A 1JWBB 5KTKA 2YHAA 4E5MA 3GDWA 5LZ8A 1INLA 1Z18A 3UK7A 1FW8A 3ELDA 2B21A 2VF4X 2B1GA 1S01A 3K8QA 3P96A 4QOFA 2OCYC 1CUUA 4GG1A 4IIFA 1OJ7A 2G1PA 2O8DA 5B2FA 1HWYA 1GEEA 2KE5A 2QS9A 2QN3A 4UBNA 4KLZA 3T1TA 3TGLA 1R50A 2IDJA 5AI0A 2VOEA 1MFZA 3KJGA 2AMFA 4R1OA 2J46A 4PFJA 2NXCA 2QQ5A 3BREA 3O75A 2C2GA 3TNDA 1SHUX 1OI7A 4OHOA 5ES4B 4DRXA 1JUDA 3TD9A 2C07A 3U4DA 3PCXA 2OSVA 5TMBA 3K70B 5BQ3A 1YDWA 5CB4B 2FH5B 1EKXA 2WIJA 1EHIA 3GBPA 1G1MA 1MRSA 4DDTA 4B3TB 2QN9A 1C8LA 4ENRA 2HF2A 5FLEX 4M1YA 2IUTA 1L4NA 4OHWA 3L7YA 2HT6A 2UVQA 4FI3F 4BFCA 3GG2A 3I9OA 3R5HA 4X84A 1AC5A 1R5NA 2O3RA 2P67A 3AESA 4F4IA 1C2YA 3NHSA 1JFRA 4QGHA 1VL1A 2D2IA 4Z4EA 1RRGA 2SNIE 1YB5A 3DCJA 3CT4A 3IBCA 1CIJA 3FVWA 4JXZA 5FOWA 5FV4A 3DFUA 2C4HA 1KKUA 2IKSA 2VDPB 3SQNA 3FDFA 4BNUA 1REQB 3QVLA 3PJFA 5KYNA 2I4TA 1E77A 2O06A 2R6JA 2WC1A 2VYVA 2HHCA 2RH8A 4CG1A 1KS2A 2HJHA 1U2ZA 3AR6A 3IV9A 4P6VF 4UDXX 3TSYA 1OXUA 1Q7BA 3E0QA 4Q4DA 4HGZA 3AHFA 4OV6B 4RNCA 1VE3A 2BM8A 1I8TA 4WNCA 5GJBA 3TZEA 2VZLA 5BMVB 3G8BA 2GMWA 1P1BA 3DP9A 2HCBA 1SUPA 4E21A 4ZAZA 2FX3A 4AJ2A 4CHTA 4DXAA 2QORA 3GNTA 3IP8A 3R74A 3T15A 3U3DA 1DKMA 1RQRA 4JP1A 2OK8A 4LAFA 5K0ZA 3K4QA 4K9PA 1WNTA 3LC2O 4X6UA 3P1JA 1W87A 5AVUA 1IAQA 3KALA 3AVQA 3SD7A 5FAXA 3BDVA 4RQUA 1NR1A 2ZIVB 3VNRA 4BO9A 5JMWA 2GBIA 2OP1A 1X87A 1PT6A 3BQNB 4JLUA 4PGAA 5JSZB 2R6ZA 1V3UA 3QMPA 4LDZA 4Q02A 4R9RA 3GEIA 1QH8B 2A5JA 2ZYSA 2CCKA 3AKZA 4D8YA 1UKAA 2C3UA 4CCWA 1EWYA 3DAOA 3QLUA 1RFLA 2AEMA 2XLBA 4LJSA 1W47A 5ALDA 3H87A 3U44A 4P3XA 3LPMA 1ULUA 5FXMA 3U5ZB 1QGUA 4X6LA 4FYKA 1CNMA 1YQWA 4XE5A 2M98A 4PR0A 3UVEA 2WYOA 1QCYA 2BHTA 3NH6A 3DLPX 2VJYA 1U2PA 3F49S 1QFZA 4Y2HA 1QKIA 1CY8A 3AONB 1DFHA 1VG9B 4QQKA 4YMVA 3BGIA 4NBLA 2QMZA 3RB8A 3I9JA 1TGYA 4L2IA 2X2OA 3HGTA 3ZY2A 5BQFA 2A0FA 4RDCA 4EYGA 4PC1A 4IDGA 4H17A 3V32A 4QE3A 4PLPA 5HQ3A 3GFTA 1PEAA 3FWHA 4FHEA 5EOVA 1QOPB 4DOMA 1E3JA 5JXJA 2AN5A 2QUBA 5DP1A 3KQHA 1J24A 1BQEA 2ZYWX 1WR8A 3NWJA 4HOYA 2IGBA 4BBZA 1ZSNA 3H1BA 3OA2A 3JYOA 5D00A 1Y6GA 2RGUA 4MVJD 2R2AA 3I0ZA 1CR4A 4FEYA 1RJWA 2R1ZA 1WABA 3PITA 4O3FA 2I4IA 3WYGA 3PIIA 5BV1A 3E5MA 2FPPB 4BLRA 4K2HA 3AHDA 5J5CA 1N0IA 1M2OA 4G4IA 1OOEA 4TXJA 3U7JA 1H93A 4TV8A 3B1KA 2IIVA 3GRZA 3W34A 3BF7A 1K8QA 1OLUB 1PJ4A 2JCXA 2VHXA 3D2AA 3U49A 4GPEA 4PC7A 4BVAA 1TEXA 3L7JA 1HNXB 2DPGA 1SIUA 4PSUA 4GOXA 5LUAA 1B4DA 2NT3A 4HDSA 821PA 1ADGA 2H08A 4A3SA 1HMPA 2VDVE 4LECA 4OSEA 5G0UA 2ZIGA 3JZDA 3RTEA 2FQ1A 3UFXA 3R8XA 4CL8A 3PXBA 2GARA 2P90A 5F9MA 4OX9B 1ZUNB 2G17A 3EVNA 1N0VC 3HDGA 1R9NA 2A84A 2IEGA 3TOZA 4PLHA 4EHDA 3KQOA 5K0EA 1AZSC 2DHCA 4TLBA 5BSFA 2H2DA 1K9SA 1W7AA 3CTMA 3COYA 1XBTA 1C0LA 3RYCB 2YVUA 2SKCA 5LSAA 5A5FA 5KQSA 2HI0A 4HT3B 3NTRA 2WD7B 2Z5FA 3TOVA 2Z1NA 1LD3A 1QU3A 2A92A 4GU5A 3FOBA 2GRUA 1AS3A 4EZEA 5TE9A 4DKJA 5ICGA 4M86A 4DLLA 2AWNA 2J6HA 4M1SA 4NYJR 3MWLA 3HN7A 3TB6A 1Q3KA 4CT4B 4A73A 3L49A 1JJFA 1O8BA 4OKSA 2D1TA 3C6MA 3DVSX 4E88A 1I3NA 4F56A 1J1ZA 3OE7A 4HPJB 1J97A 4QDXA 3VKVA 4E30A 4UNQA 4ZAGA 1ZNYA 5ENDA 1FVFA 2YV4A 3GPDG 3P9ZA 4RHEA 5C8YA 3STYA 1ZUHA 3EY4A 4E03A 5EHXA 4TS4A 3KXKA 5HFAA 3SSNA 3WKAA 2PAFA 3DKPA 1M0SA 2J3QA 2XTMA 1X1RA 4L8YA 2YTZA 2VHQA 3EARA 3I4FA 4KGXA 2AMVA 3T1OA 1JRLA 1P44A 1Y1KE 2EQBA 3AERB 4J4HA 3RTGA 2J5RA 2NN3C 3V46A 3VSDA 4ARZB 2D6FA 3WAGA 1E4VA 2NVWA 4NYMQ 4CLRA 5HM8A 3VGPA 4U7TB 4A0HA 3HA3A 3UBMA 4LSWA 3ZX5A 1U3UA 1TB4A 2HA6A 3CB2A 4OG2A 4U2BA 3BVPA 1ABFA 3IUNA 1WPGA 1LV7A 3LQFA 1NPDA 3G68A 3PL5A 4ZZ1A 4JI4B 1XDBA 2GK6A 4ZYUA 2R87A 4Y6LA 4HX5A 1NLMA 3S7TA 2QMQA 3DC2A 2EBHX 2O2IA 3ODGA 1YXMA 5E95A 3OO1A 1K7CA 1B2RA 1RWXA 3CG4A 1Z7YA 4BLWA 5LJIA 3H0EA 1D2GA 3UK6A 1SVIA 3LP8A 3LX6A 3F47A 1LNQA 3LOQA 4ALMA 1W36C 2ZJAA 1AV6A 1OI2A 4BVEA 4CM8B 4Q01A 3PEUA 4IQFA 5DPMA 2OUIA 3HI6A 5CHYA 3A04A 5U9CA 2XXJA 3BEOA 3FUWA 3N0VA 1PU2A 4BCBA 3Q7PA 3W5VA 3E81A 3QVTA 3I1YA 3RGGA 3WHIA 2WSSD 1SG6A 1EPUA 1DVRA 1YGPA 1EBFA 3TM5A 4C0LA 1OBOA 2QZ4A 5AVJA 1FMFA 1AMNA 4AG6A 3H84A 2QJOA 3OTWA 3WVNA 2PGNA 4ARUA 4MW9A 4DANA 1T2UA 2HOQA 1FFWA 4TT8A 4UBJA 4LSGA 3T38A 4FFMA 4LDRA 2QX8A 1DEKA 5K3OA 5LIPA 3THRA 2AG1A 4GS5A 4R8SA 5LN1A 4KQIA 2DHEA 3GLQA 3KDAA 4X5OA 2TS1A 3AIOA 4AP6A 2XD4A 5H3LA 5DO9A 3MSXA 2DQZA 4YDSA 1U2SA 4DAEA 4ARIA 2GSDA 1DXOA 2OO5C 3FKQA 1LW6E 2Q21A 2ZRJA 3C6BA 4O8CA 1UAAA 3DE6X 3MJ4A 4N3BA 3HHPA 4QFMA 2IZ6A 1T29A 3CGGA 4XKJA 3FPSA 3VR3D 4JY7A 1HYEA 4QYWA 4HS9A 1IE3A 1K6JA 3N86A 2AMLA 1U0GA 4LXTA 5D6NA 2QPTA 4C4PA 4BO3A 1F3LA 1OBVA 2OD9A 5G0WA 1M2VB 3SHTA 1OX6A 1AUOA 1L5QA 3KEOA 5JEDA 1PFGA 5A62A 1E58A 4MV6A 4PRKA 3LT1A 2PZ8A 4TS9A 2P6UA 1XNRB 1G0OA 3BCUA 4GP6A 1Z0KA 4JOSA 4J0GA 5BVHA 3PQ3A 4MIKA 4NBRA 1T1RA 1C3OB 1LPAB 5DHUA 3BS4A 1JDJA 2XD9A 5DK6A 2JIRA 2PLNA 4XQGA 4P54A 3SIRA 3QFSA 4B34A 4MUFA 3TW8B 2W2TA 3RRJA 1DAKA 2QTVA 2IYSA 3KG2A 1M34A 3MTQA 4HMQA 4UOQA 5CX4A 4U2DA 4ZCPA 3SC2A 3M1LA 3SFZA 4B9AA 1Q0UA 2ZSJA 3ICPA 4OHBA 3S99A 5A6SB 5CHEA 4AUEA 3TG8A 2XE7A 1U28A 5GONA 4L7VA 5FBLB 4BFWA 2FWNA 1DBQA 3CZPA 3QK7A 4Z86A 1P1RA 3LY9A 4F2DA 1L9XA 3ZK9A 2BMDA 2QU7A 4ZKEA 3FVQA 3AZPA 3M6XA 3MSCA 4MS4B 4RD0A 4UHBA 5H5JA 1ZUIA 5DF1A 3RYFB 3LQ1A 2J48A 4DR3B 3QVJA 4J7AA 4K5QA 5C0OE 3IP5A 2X40A 3RHTA 1NX9A 2BGNA 2PT5A 4NEHB 4AP5A 3TIFA 1FYXA 4HC4A 3UKOA 4D9HA 3UEOA 2FPMA 1YRHA 1ZGBA 2HCFA 1G21B 4XH9B 1DTEA 5IABA 1Q7GA 1VKNA 5AVTA 4G85A 1X74A 1MO5A 4FT2A 1PDVA 4PYKA 5K3AA 1OIWA 4HNAB 1T36B 3V4PB 3UMGA 1CZKA 1JB9A 2AFIB 1XL1A 3OM9A 4YA6A 1FFHA 2OCXA 4RCVA 3RREA 2WJYA 5JTTA 3DVRX 5DWQA 4C0XA 1F4VA 2LD4A 1ZHOA 1QDNA 1Z29A 4B2YA 2QRKA 3PHLA 3ZDQA 4EF5A 2OFXA 3ZEAA 1ZVVA 1E9VA 1ZMTA 2B20A 3ZV7A 5FTKA 4LC1A 1JHRA 1YA8A 1P7CA 5M2QA 4NESA 1KJYA 5CFRA 1HT3A 3ZYCA 4D8TA 2HPAA 4QASA 3AM3A 1QB7A 4W1PA 4PY2A 1MW8X 1NVGA 2J31A 3WO1A 2FW7A 4LHYA 1SK8A 1Z9BA 1DOAA 2PTHA 3OQJA 3FHLA 3TTYA 1L4EA 1Q1BA 4J4TA 2E21A 3RCBA 3C4QA 3PC8C 5J4VA 3RFXA 3NG1A 1DXQA 3VHRA 1CUWA 1ZDMA 2AK2A 3BMNA 2VSQA 1PV2A 4WLVA 4LY6A 2EWWA 3VYVA 2P5YA 1T6XA 2SBTA 3CX6A 2Y1KA 4F38A 4FNOA 2ZYVX 3KXLA 2XMDA 2ZOSA 4BVBA 2QUIA 4MQEA 3L7CA 3KHTA 1VLLA 4GE3A 3GEGA 4H0FA 4Y1EA 3ORHA 1PZMA 1IUOA 4KE7A 2A9KA 2IWHA 1VIMA 3NBMA 1DAMA 4UFNA 2OBYA 4B6EA 3IO3A 3VNUA 1DP4A 4JSYA 1B1AA 4IDPA 2YQZA 2EFCB 3C24A 2ZJ3A 4TYQA 1BEZA 4Y2VA 1RWWA 3KTFA 1C4OA 1E6CA 4S1OA 1N2XA 3ND7A 4WECA 1Q7EA 1W44A 3AF0A 3B7PA 3RRXA 1T24A 3LCRA 5EZQA 1A9PA 5IMBA 1F8FA 5T4FA 3MIIA 4DJDC 2QXTA 4HUQB 4B87A 4BWVA 4LZZA 4R1PA 3T9AA 1ZZGA 3X0DA 1P3DA 5KWSA 4HAOA 4ND6A 2I6UA 4QWMA 5BN3A 5LU8A 3VC3A 2ZYGA 4JP3A 1GCGA 2PGXA 2O2CA 4DBLC 5IP5A 3D4OA 4A1FA 2QAGC 2XMPA 2Q1DX 4CLEA 5A1TA 1FJ2A 4G86A 4J0QA 1P5RA 2OPBA 4LMBA 5IX8A 5EHNA 2XCUA 1S2IA 1H5UA 3QXJA 1UMCA 4JI8B 2FPIA 3UJ7A 1DBWA 3HWX1 1PWYE 2CWDA 4MX8A 5JC8A 1KYYA 4KDEA 1XJCA 1PW7A 1AV7A 1CJUC 4U2KA 4WVFA 1CF4A 2POCA 1O96A 2PZGA 3A2LA 4RPIA 4HZUB 3ZWYA 4UNSA 2V3VA 4KV7A 3G5TA 3L6UA 3L41A 1IDOA 3DEFA 2IS1A 4IJWA 5JALA 3L18A 1QRSA 3O95A 4Q1FA 2HN9A 3UN1A 4W1QA 3L7LA 1C9JA 4NOJA 1FJGB 1Y63A 2JB9A 1ZINA 2KLHA 3DMPA 1MU0A 3FSRA 3OM1A 3WDSA 2C2HA 4H0NA 2RIRA 1Y6ZA 3EVGA 3CVUA 4OQPA 4AO8A 1D9XA 3ETCA 4D9NA 4DEVA 4UHCA 4UULA 3JAMA 1CR2A 1T1JA 3ITDA 3JYHA 4PPFA 1R0XA 5GOTA 2PBLA 4UCXA 2JFZA 3MS2A 4EYOA 3EWNA 1HZZA 1OLOA 2X4GA 3OIVA 1C5KA 4GGMX 4PGHA 2QTGA 3D1JA 1A4RA 1RMQA 2XRYA 2R62A 2ZTSA 3G6KA 3OBIA 4Q18A 1NE7A 3JAWA 1KAEA 5FULA 4P81A 2W42A 1ZM3A 3U9LA 2ORIA 4IHJA 2YC4C 1EXMA 3IX7A 1YZFA 3OU2A 4MKFA 2REQB 1ZESA 1NT2A 4RFLA 3H42B 3AUYA 5JXGA 2JEOA 1E1CA 1EHYA 2V3WA 4O63O 4K46A 4ZAXA 5HKLA 3V2UA 3VOBA 4DQ0A 2IS4A 1N2CA 4US0R 2O48X 2A5YB 4UPDA 4NCJA 5AHRA 5E3IA 3HYLA 3SN6A 3WAKA 3WA7A 3S2IA 4G41A 1A9YA 1M8FA 2HZ7A 2R48A 4X66B 5HCIA 4X71A 3RVLA 1SUAA 1TADA 3IDZA 3JYNA 5KQLA 2HA3A 3B6EA 2IXDA 1MHPA 3ZY3A 1NNLA 2JAPA 1YKFA 3NHZA 4G5XA 4MEAA 1ZOSA 4GYYA 4IXWA 1M2GA 2AL7A 5FL7D 1JIVA 4DLZA 2DULA 5DSXA 2R8BA 3PXCX 3L1UA 1K4YA 2R1VA 2BSQA 3LWNA 4HFMA 3P9SA 4I5EA 3DR3A 1BEUB 1Y4AE 3QBDA 5G1NA 5JROA 1PJLA 3I72A 2NO1A 3ZGLA 5LYJF 4CF7A 4I8DA 1RWQA 1VCNA 4YAFA 1PLKA 1UBLS 3AK4A 4KPEC 2TSYB 4FDAA 2HT1A 3EG9A 3TZKA 3JQBC 4WXRA 4JT2A 4MS3B 2HA4A 1IBMB 2PCLA 4CUZA 3AJRA 1QORA 1X7XA 3ZGZA 1RHQA 5EQJB 5E9JA 3IUYA 5IBQA 1MJGM 3N2GB 3KTOA 2WTUA 1YGYA 4C29A 3LCCA 1SG9A 3EZNA 4HAIA 4PRYA 3DOEA 3E82A 3GFVA 2NU8A 4YUAA 4TROA 2IOFK 1OF1A 4PAQA 1VGVA 4ALNA 1GSIA 1E9BA 4IBOA 3VTZA 3Q6NA 2ZUBA 1LB1B 1AQYA 5EFOA 5KNDA 4F4CA 3GRKA 1VKJA 1JL3A 4EKYA 5TB5A 5TQ0B 3KHUA 4J1NA 1I3OA 2AKAB 1E9AA 3FCYA 3GCDA 5ER6A 2GCOA 4FFDA 4K26A 5C34B 4BMOB 4E3ZA 1YMVA 4NK4A 1HE3A 4QDKA 4IIHA 4QG3A 1U8XX 2EP7A 1QJ4A 1M6HA 1R6TA 2NPIA 3AFGA 3BUSA 3K3PA 4HRXA 3D9QX 1JLMA 4KGZA 3BJZA 1GKLA 1Y8QA 2WUWE 5IKPA 3QIAA 2XXAB 1IQRA 2DLCX 2Q62A 1Y1RA 5DIZA 5BQXA 1ECJA 5AESA 4MYHA 1KSFX 2FZ5A 3OD5A 3SQMA 1EUQA 1G7TA 2Z5VA 3OZSA 4KITB 3VKHA 1Q7RA 1P2DA 1WCV1 2TMKA 3KYBA 2DECA 4KAFA 2X7JA 1L1FA 4JHLA 4KQCA 1R6BX 2ZI7A 3GHYA 1HL7A 2LWIA 1KKLA 4ITUA 2CZQA 5EJ9A 4RHFA 3RAPR 3T06B 2DE0X 1QMGA 3QVGA 2NYRA 2OM2A 4FHZA 3LAWA 4RNDB 1H9CA 3VM6A 1IOLA 3H97A 4YRDA 1NLYA 3UHOA 4O1IA 3VJKA 2H29A 3WIEA 5KINB 1PK7A 5IXSA 4F86A 1IBKB 2WKSA 4LF4B 2YIDA 1CDDA 1YS1X 2WFZA 1H2RS 1K66A 2F17A 2Z2ZA 3K9GA 4FLMA 4H27A 4MW7A 1RCTE 5IC5A 3B38A 1ACMA 1JBKA 1HNZB 2BGUA 3TQSA 2L82A 2CBGA 5JYBA 4MVJA 2ZYDA 4XI9A 3RE1A 3ZUGA 3Q7RA 3GLIA 3U40A 3WMWA 4UTZA 1MB0A 1SZCA 4LNUB 1NR7A 2QXUA 3U62A 4CVNA 1Z0IA 1YVRA 4D3YA 1LBQA 4NCAA 1UDWA 2P2ZA 1F1JA 4CMIA 3KYCB 2VEOA 4Z0PA 1L7PA 3CPJB 1NLUA 4NC9A 2RHBA 4G0UA 3Q7QA 4A2PA 3VAYA 1ADBA 1UFOA 3B51X 4QRHA 5DGDA 3LZDA 1RR6A 1U04A 3PXEA 4KTVE 1U3FA 2H8GA 2R6AA 4YLEA 2ZE6A 1WULS 2J3DA 3TPCA 3BXEA 1U5CA 4IDHA 4MZDA 2J87A 3TOSA 2G83A 4L85A 2J0QA 1Z4KA 1B0ZA 1C7JA 2QAJA 1U1DA 2Q1UA 1J2JA 1V16A 1Y4ZA 4WINA 3MQ2A 3SPXA 1U31A 3PYMA 1BMTA 3GJZA 3OOJA 3OOEA 1AIPA 5CT4A 1FS4A 4JI3B 4HNVA 1G8HA 1C14A 2MOKA 4D4GA 5MFPA 1G8MA 1ZJZA 2HNBA 3GP3A 1MOZA 3AHCA 1MAUA 3O47A 1JR2A 2XADA 2ZRGA 1J21A 1KZHA 1PLJA 3DEZA 1HDGO 1W4LA 2HIMA 5K0NA 2BCJQ 1MD9A 2AFRA 5DTMA 4MB6A 5CYFA 5CBKA 4BLVA 1LPNA 3R2JA 5FA8A 4F5ZA 4N7MA 2WB2A 3ZWNA 1EEHA 1P4JA 1X2BA 4U7FA 2ZCVA 1TC2A 2FQYA 1IVYA 4DG9A 3MWKA 4B43A 1G19A 1OU4A 2BC9A 3OWXA 4RS3A 4N3AA 4UHDA 1E3EA 3LYUA 5NULA 5J4YA 4TYPA 3ZE6A 3WHPA 5CXUA 3VR6D 4UC4A 3PXAA 3DBRB 2XODA 1I36A 2M32A 4QUBA 2VYFA 3ZU6A 3X2SA 1QTRA 1KYVA 3OE5A 1OMOA 1YZUA 3ZVRA 3P9CA 5CU7A 1LLFA 5ALSA 2J59A 2F55A 1J42A 2FK7A 2OCKA 1GNSA 1QUFA 1T4CA 2DSTA 2NZVG 2NZ2A 3FPAA 3GHHA 3R7DA 1KQFA 2GYUA 3COSA 2JFXA 2I33A 4HXFB 1BWQA 1UKYA 4PNPA 4P82A 3VKUA 4BEJA 5LA6A 3GOQA 5U4QA 3SSMA 1WV1A 4C05A 1BNCA 2J7KA 5LXTA 2Y3IA 2DG2A 3BTSA 2WQ7A 4CQMB 3OLCX 3UV6A 5L3QB 3ZIDA 2ZANA 3KT3A 2RGNC 4G4SP 2PKQO 1OFUA 3D3QA 1FS5A 4MROA 4CMAA 2XQGA 2FPWA 3LDHA 3JVEA 3TGWA 4N3NA 4RFSB 4NU0A 4O2BB 1PD0A 3Q8XB 3NNDA 1YOVB 1N5DA 4OI0A 3HL0A 3IULA 5D1HA 4R2HA 5ERXA 2H6EA 3E7WA 3W0LB 8GPBA 1CJBA 2L2QA 2WICA 4JSTA 2NO6A 4MQUA 4PXYA 1X1DA 3ZGVA 9GPBA 2PSFA 2VP3A 4KKXB 1WMDA 2VJMA 2C31A 1MT0A 4UCWA 5THXA 3H9JA 4PZAA 3FYSA 1FPMA 2HXSA 3QYJA 2I6SA 3JYQA 4GMFA 4W5QA 3L3BA 1BE0A 1Z08A 3ESBA 3ZH9B 4DBVO 2VRCD 2ZJ7A 4GEGA 3FE2A 1WXHA 4CBVA 3DB2A 4TWAA 4XEHA 3B7WA 2DOKA 3KB1A 4G5HA 3NWOA 1DLJA 1WSDA 1VC2A 4WZAA 4LVCA 1ULBA 3WZ2A 2NAFA 4BOYA 1ZUD1 4QT0A 3V42A 5AUPB 4S12A 2FGKA 1CYDA 4XTCS 4CMGA 5CDFE 1G6KA 2RC5A 4X85A 5KPJA 3L6DA 2ZZNA 1D5CA 3FROA 1MVNA 2XB6A 2VZ0A 4ZPXA 3IQEA 1JIXA 3JARA 2X0FA 3NOXA 3FM9A 4FFVA 1I1NA 5A3SA 3P5SA 3UC9A 5JSFA 5JJBA 3UMSA 3VR3A 5K0CA 1AQJA 3WQQA 3Q15C 3OIWA 1KJJA 3NKFA 3MINA 1VBFA 1U0LA 6AT1A 3KU4A 2JFUA 4E94A 2F48A 4HZIA 2LKCA 1E7YA 4CMHA 5B5SA 1HQDA 4TOIA 2D2XA 3T5CA 4QVIA 4AWBA 3OHPA 1E0KA 4LOAA 3THWB 1Y4DE 4GI1A 2KBFA 2QG4A 4C22A 4UTPA 3F1KA 1UT6A 2Q27A 4ZU6X 1I94B 4H60A 3TLEA 1KVTA 1T8WA 1T2VA 3U7HB 1K7YA 1Z8HA 4E1AA 1NXQA 3S8YA 2ZPAA 4R1MA 2EEZA 2XBLA 3JQDA 3LDAA 4R6WA 3SBOA 1KSJA 3A05A 1EI9A 1WB4A 1BX0A 3LLMA 4WNAB 5AK4A 2ZQ5A 4FDTA 3D6VA 5AI8A 5KKCA 3BQBA 4K2AA 5I4IA 2FUEA 1N6NA 2VHJA 4BWGA 2IXGA 3QX9A 2GYYA 3PUZA 3DOCA 3K9QO 4O2AB 4BRZA 2V98A 2BT4A 2BPOA 4MR9A 2J08A 4AIIA 4IDOA 4IZIA 2V7GA 4RVNA 3VPHA 5ED4A 3E35A 3JW8A 4RYDA 5AM2A 1V5GA 3KOMA 3T1HB 1F4LA 4CDMA 1DKPA 1WMEA 1CW2B 1ZMBA 4YJGB 3INRA 1TU0A 4BO1A 2Q0SA 5JCOC 3REQB 1HYHA 5EZ5A 1FNNA 2CMGA 3E22B 4RHUA 3TFQA 3WE7A 3QXSA 3FOAA 1J90A 3U2QA 3KUCA 2AXQA 4CFSA 5HJ7A 1HR0B 4CEJA 2OBBA 1GVHA 2GOYA 1KYZA 2Y8EA 3AIMA 3DE1X 1XXHE 2I65A 2MSDB 2CVHA 3OMWA 4GXTA 5DU2A 1YDFA 2QZSA 1WO8A 1ZMOA 1UM9A 2TRSB 3DEAA 1S4MA 4ETMA 2JGMA 3ZZNA 3QE9Y 4DR7B 1CY6A 3D8NA 4M55A 1XZMA 3ES9A 4QPDA 1LLQA 1EJ2A 1RXCA 1WW8A 2PY6A 3ZY5A 1TMOA 3GLRA 2ZBEA 3P0EA 3O9MA 1US8B 1MAWA 2JFHA 1NRIA 1I6KA 1B3BA 1F51E 1ZU4A 2M6SA 3NCHA 3OZ7A 1E7WA 4B3MB 3M6IA 3GGPA 1H2YA 3EF0A 4JKYA 2ZBPA 3DOJA 1XZ8A 4FBLA 5I4BA 3I28A 3RABA 5CPFA 2MDTA 3TLAA 5CM2Z 1TI7A 1ZBQA 5BSUA 2F00A 1XRRA 4Z3KA 2CW5A 1UF9A 2A14A 5B1EA 5IBCA 2HDWA 1Q91A 2OKGA 2XUJA 3BQ9A 3N2KA 2ANBA 2HSGA 3DGFC 1GPUA 3BSWA 1PUIA 1EDDA 3K1TA 4WE3A 3W4JA 3QPCA 3PNQA 2PIAA 3QPUA 4NDNE 4P4SB 5CA1F 3LX4A 4G5RA 4DDWA 1BAPA 3H7IA 1SOWA 5KYGA 2OCDA 2J7PA 3ACDA 1R8JA 3E53A 2CLEB 3EQ6A 3KEMA 5KMGB 4DLXA 3WLJA 2OKCA 1T1EA 4MRSA 4D6PA 4EECA 3NO4A 3AZOA 3HB1A 4OLHA 3CKLA 1XZDA 2CK3A 3TQHA 3WGJA 3DOIA 2P0YA 1SWWA 3HKCB 4NG5A 1YQUA 2J41A 4IGAA 4BLOA 1CR0A 1M3SA 4ENWA 1XYVA 1IHPA 3C98A 3EK2A 1IXYA 2IH5A 3VPFA 3ZY6A 3ZU5A 5F7XA 1B93A 1GQOA 2GM4A 2E4AA 2P9BA 2LE0A 3GARA 2D5BA 2YZMA 3IYLW 1SBQA 4FDLA 1F2VA 2KBEA 3OZBA 2X1MA 4AN4A 4P83A 3OAAD 4GBED 2G1JA 3BJRA 5CB6A 4ZQBA 2UZAA 1IZZA 1HC7A 3LGXA 4TUYF 3HM9A 3BIXA 2YNMA 2NGRA 3DUFA 4Y67A 5E7IA 3BCRA 3OQHA 1O77A 4KRYA 2GRAA 3DLTA 1NONA 1NI4B 1PYGA 1TIPA 1I33A 4HEJA 4MCJA 2WAXA 4YN3A 1P5HA 1OZAA 4ARSA 4YUYA 4EFNA 2C1ZA 5HIKA 2KJQA 1CR6A 2QA5A 3R5SA 3BRWA 1AKTA 3HVHA 2W6JD 5KOHA 1JKXA 5C8DA 1JKJB 1LDYA 1PNVA 4LRSB 2PQMA 3C39A 3JPWA 1X7WA 3PQ6A 5AW0A 4B47A 1QNLA 3PK0A 3PQDA 1IUKA 1TK3A 1OXKB 3CLTD 4URFA 2MU1A 1BHQ1 1Z22A 3C48A 1RQGA 3OOHA 4MAAA 3TQFA 3IAXA 1QO7A 4EEXA 2IV3A 1W46A 3VDXA 2XMQA 2X5JO 3GGJA 4PGGA 1CC1S 4AMUA 1QJCA 1L4KA 4B2LA 5F4ZA 1Z4PX 2Q5CA 3P26A 5AJTA 3NT2A 1J99A 4YQYA 2VP2A 4MRAA 3ZQ4A 4KTTE 1AKYA 3MS4A 1ULHA 2OZEA 4G5OA 3DE5X 3Q7SA 4EO4A 1JVBA 4LF5B 1R2QA 2GCPA 1C4KA 1Y33E 1ZA2A 2FZVA 2I71A 2V7BA 3Q5EA 3R3XA 4JUFA 1OI3A 4R41A 3RGWS 3RS9A 3TIVA 4QUGA 3PQ5A 1KQGA 4N0QA 3HTXA 1PT8A 4Z4CA 1NVUQ 1Z36A 4N5DA 2FZLA 1NASA 4TTJA 3ZD8A 1IBSA 3KDSE 2QRQA 2PZBA 3SX2A 2W6QA 3I34X 3NJ4A 3Q12A 1P8JA 3SYNA 3THSA 4V39A 1QM5A 2B8WA 5HF9A 5AW6A 2C3MA 4KWIA 4UTXA 3U7QB 1YR3A 4ZO9A 3UKJA 2RG1A 1IUNA 2CFIA 5EWLB 3SBDA 3R3JA 1ND6A 1KVRA 2PRJA 2YFYA 4FHDA 4HEA6 5A9RA 4Z4HA 1VLVA 4X1IB 1ISJA 1VE6A 2G9QA 2XLCA 3KQQA 5B3AA 4JJAA 4CXMA 2ZATA 1YRWA 5E38A 4RTQA 2JGJA 4DMCA 1CG6A 3DM9B 3JZAA 3T0IA 1ID8A 4HBGA 1NOKA 2PKCA 2BMEA 3AW9A 4RHCA 1TJ3A 1KZ7B 1FTNA 1N4DA 1ZJ5A 3ETLA 3AEQB 1SD1A 1RJDA 2E5FA 3ZHXA 2VNSA 3VR5H 4GZMA 3TKYA 1XXLA 3OJFA 1IZ9A 2FF5A 4CF4A 4UTRA 4XWGA 4YUWA 4R31A 3ZV4A 3MXOA 3PRJA 4P4LA 4C3VA 1NXVA 3LMKA 2Q6OA 3BSFA 3CZ5A 2VUHB 4L76A 3B1WA 1KU0A 1NW5A 2JLQA 1EB9A 5K0BA 1XPUA 3HYSA 5CT9A 5FNZA 3QWZA 4LUCA 3D3KA 4EY4A 5AVQA 1Z6GA 1BC5A 3Q3JB 1S6YA 4P7KA 1USUA 5BSEA 1BMFD 5DTJA 2GKGA 1FFEA 3FNGA 4QUHA 4C01A 1TPYA 1MEEA 2WF9A 3I6MA 1FB5A 1TK2A 5FL7A 4QOEA 1FQJA 1VIVA 1E1YA 1VECA 4ZDIA 4UCFA 3NGMA 2VXOA 1YZQA 5FOTA 3U09A 1NOJA 3BTOA 3C7KA 1OZ0A 3LUAA 3R3YA 3ZW7A 4NZ9A 1AQIA 3FNHA 2D59A 3WK7A 1PL8A 5TC4A 5GZ1A 3FN4A 3ABQB 5JQGF 1GGEA 1ZM4A 3DMTA 5DGTA 3U17A 5TRTA 4CTKA 2BJHA 1AF4A 4L6CA 1M10A 2WUDA 1Q1QA 1A9SA 5KYVA 3IUSA 4R2KA 4YIKA 1EVYA 3KBBA 3R5JA 3JQ8A 2P1RA 3SQWA 2PUHA 5LZ7A 3WNQA 4A8JC 3R6LA 1M83A 3EFOB 2XKJE 1G8JA 2AUMA 2P2LA 3ZWAA 1PTKA 3ITKA 5CVDA 2JLZA 2FCRA 4MQ5A 5ECGC 1HRDA 1GAJA 2X42A 3NC1C 1KETA 1TT5A 2UVPA 4F6RB 1NI5A 3MWGA 4ZKDA 4AZWA 1BYUA 3EMBA 4MO9A 1JIJA 3HUFA 2A3RA 2SCUB 3DVAA 4NZMA 1YZKA 3TINA 1I4EB 2BEKA 4EP1A 4A36A 4OTZA 1MRNA 2PK3A 4ITVA 1RQXA 4N76A 3IP6A 3EVBA 1VPLA 2PCJA 4RA6A 3VA7A 5EE1A 2F3RA 5KSOA 4HEHA 3OPYI 5LWHA 4EL0A 4QDJA 3IJEB 1HETA 3DAHA 3K15A 4QPZA 5ALKA 4EI2A 3KQUA 5KWIA 3EH1A 1GPBA 3PGA1 4MS1A 3T9BA 4L6IA 3P4XA 4UXJA 1B2LA 1KYTA 1KRHA 3IAFA 1BO6A 1XI2A 3GCZA 3TZHA 1P19A 3PGVA 4CLOB 3PI7A 3BRCA 1DBIA 2WDZA 3RJ5A 4D0RA 4WZBE 3VR4H 4INAA 3WLOA 1NMSA 4JBHA 4EZIA 3AF6A 1G42A 2O6LA 3KVNA 4X9XA 3WL5A 4QD3A 4LTNA 2WTNA 2Y0EA 3ESZA 4KOEC 5L3SB 4AN0A 3Q8LA 3GUZA 5TARA 3PD1A 2X1HA 4F45A 1M1ZA 4PF1A 4WOCA 1HTBA 1QQ6A 1R74A 1Z37A 3EFHA 4QGFA 5GAJA 5T4HA 4HDMB 3INYA 4ZANA 3BE5A 4ALLA 5JWHA 1JECA 2MINB 2I3GA 3EQ9A 2B4QA 1H0RA 1R0BA 2OXFA 2E48A 2ZJOA 3W8RA 1UPBA 2BSXA 3ABIA 5LQSA 3UXYA 4BWFB 5H0IA 4F4HA 3LUHA 4WLUA 5FKJA 2Y1FA 1M1UA 4MUEA 1RC8A 2VXCA 4ZOCA 3HSSA 1H2ZA 1N5IA 2NP6A 5J5VA 4RKYA 2VT6A 5CURA 5ADUS 3WRXC 4C06A 3AUJB 3LKVA 2I1QA 4F0JA 2XZTA 2Q18X 1UJ2A 3D4NA 4F6CA 1ZR4A 3B13B 1UANA 3QOYA 1UOEA 1S1MA 4RUKA 5F51A 1AGXA 1AOXA 3LQRA 4G0WA 1H8HD 3HXTA 4I0WB 3D8UA 3TL3A 3A4NA 2ZIXA 1JNXX 4QO8A 1YL7A 5G4KB 1QF6A 2UXDB 1J8MF 5F52A 3CW2A 3WSTA 2AZMA 4YJ2A 4U63A 4FEEA 3TMAA 2G36A 4HUJA 1RZRA 5H82A 3D64A 4LE2A 1UP4A 2C0QA 4KX3A 3ZHQA 4Q9LA 2XGGA 1E63A 4G37A 2X3FA 1W75A 2Q28A 1RQPA 1ZRMA 2IWRA 5BR4A 1ZQ1A 1OXBB