5CCBA

Crystal structure of human m1a58 methyltransferase in a complex with trna3lys and sah
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
289
structure length
282
Chain Sequence
MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGDTSPFRSGTPMKEAVGHTGYLTFATKTPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit
publication title Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
total genus 71
structure length 282
sequence length 289
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5ccbA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ccbA02
3G8BA 2IP2A 2CKDA 2AZTA 4F85A 4EKIA 1XTPA 3SR4A 2ZW9A 5FULA 5K01A 2AVNA 3LPMA 2P35A 5EOVA 4AX8A 4QDJA 3FPFA 3G88A 5EKXA 4QVGA 5DTMA 3I58A 1EQAA 3LCCA 2JG3A 4M38A 1RJGA 3DOUA 2C7QA 3C0KA 4PGGA 1FJXA 2G70A 3FTFA 5E9JA 2QRVB 4ATNA 5D1NA 1VE3A 5HOQA 1P1CA 3AXTA 2ZULA 3PX2A 4GQBA 1NW8A 4X61A 5FWDA 4P58A 1VPTA 2QE6A 1RI4A 4GF5A 4PIMA 3A26A 3KKZA 2YQZA 3L8DA 5EHIA 1NBIA 2QY6A 4RV9A 5DX0A 2QRVA 4ER3A 1ORIA 1NW3A 2XVMA 5CIYA 1JTEA 2XYVA 2OKCA 1R18A 1R8XA 4QQNA 3VC1A 1R8YA 3NWEA 3TM4A 4RVFA 4X41A 4RTNA 3AXSA 1Y8CA 2ZIFA 3B3JA 3BWMA 2E5WA 3AY0A 2JHCA 5K0NA 3D2LA 1JQ3A 1RI1A 5HIIA 4GC5A 3GRUA 2QYOA 2R6ZA 3M4XA 3GDHA 5DM1A 3VC2A 4RTLA 3KHKA 5FADA 3DXZA 5LQAA 3TKAA 3EVCA 3KQYA 2O06A 4FP9A 2PXCA 3EVAA 3GJYA 3TOSA 3HA5A 3HCBA 4GC9A 3CJQA 5E1BA 4CKCA 3RODA 3SM3A 3NVMB 4MQ4A 1IXKA 4WVLA 4E31A 1G60A 3B5IA 1L1EA 3HM2A 2NXJA 3FYDA 5DX1A 4YMHA 3B3FA 1WS6A 3P9KA 3O4FA 1KHHA 4FT2A 4YUYA 4FGZA 4X63A 3UJ9A 1WXXA 1VBFA 1BHJA 5M5BA 2WA1A 3P9IA 2OYRA 3PB3A 5DRYA 3DULA 4YMGA 3FPHA 4GOND 2JH8A 1SKMA 1F38A 2ZLBA 3H2BA 2B78A 1RJFA 2PVCA 3CC8A 3I9FA 3G8AA 1VP3A 4YUXA 1RI2A 2P41A 2JJQA 2G1PA 3IYLW 3GRRA 3CJTA 1WXWA 5DTQA 2BZGA 5CD1A 5K05A 5T6BA 5E1DA 3ELUA 3LDUA 4HTFA 3P9NA 3FUVA 5EMJA 2IH2A 2GPYA 1QZZA 3GU3A 3TPZA 5DM4A 2P40A 3LDFA 1TPYA 1JSZA 1F3LA 1KPHA 3OCJA 4OBXA 3TKYA 4AUKA 3EGEA 3DP7A 1X1DA 1AQIA 2YXEA 4YUWA 4LECA 3MQ2A 7MHTA 2EFJA 2O05A 1KPGA 3VSEA 4YV0A 3V97A 4U7TB 3BKWA 4OQDA 4RTRA 2Q41A 4UOEA 2DULA 3EVDA 1QAQA 4CWAA 1ZQ9A 3HA7A 2EG5A 3P71T 3QOWA 3HA3A 4GOLD 5HEKA 3SX0A 4RTOA 5CCXA 1DL5A 1NW7A 2O0LA 1KYWA 2LD4A 1KPIA 2UYOA 5E9WA 4Z2YA 5FTWA 1AQJA 3DLIA 4CXMA 2PBFA 5EHGA 3GO4A 3I64A 4PYMA 1N7IA 4KRGA 3EMDA 2Z6UA 2VZ9A 1JG1A 5GM2A 4AZWA 5GM1A 4PYKA 3G5TA 2JH9A 2EJTA 3KQMA 5KQRA 2PT6A 4K6MA 4BP3A 1YFJA 3OZSA 2BM9A 1SUSA 2OO3A 3DUWA 3GRVA 3FUXA 3B7PA 5DPMA 3THSA 3BWBA 4EQZA 1HNNA 4PYIA 1U2ZA 2OZVA 3OU6A 4XUCA 3T7RA 4EMSA 2GS9A 4V0QA 2YXDA 5K0LA 4XUEA 3TQSA 4LWOA 4F86A 2ZWAA 3EPPA 4PYLA 2P1DA 1D2HA 1X1CA 1N7JA 3LX6A 4ER7A 1RI3A 3PVCA 4B17A 1VQ1A 3KQVA 2AOUB 1AV6A 4AZTA 5EMKA 3GNLA 4OBWA 5JR3A 5FHRA 3FUUA 3QOXA 4FR0A 5DSTA 3KR1A 3BKXA 1QAMA 4FSXA 1YB2A 2AOUA 5K0EA 4QTTB 4PYJA 3AJDA 5FA5A 4PYOA 3M70A 4DCMA 5BW5A 4ISCA 3KQOA 3REOA 4KIFA 3ANXA 3VYWA 2ORED 4MTLA 3Q87B 4PINA 5EG5A 5DM0A 3JWIA 1P39A 4AZSA 2ZZNA 2XBMA 4P7GA 3ORHA 3R9XB 4XCXA 4OX9Y 2UYQA 2Y1XA 4M37A 1INLA 3RW9A 3M6UA 1BOOA 1G55A 2G71A 3TMAA 1V39A 1IY9A 1JG2A 1VLMA 3BGDA 2UZ4A 4E33A 4Y30A 2IBSA 4C05A 1QYRA 1YUBA 3NWBA 2C7PA 1L3BA 5DXJA 5HIJA 1NBHA 1NV8A 2AS0A 1NV9A 2WK1A 3JWHA 5DRTA 2CL5A 3FUTA 2HNKA 3UJCA 5LQCA 3BWCA 2WA2A 3G2OA 5CVDA 4OA5A 1JQDA 2F8LA 2JHPA 2PJDA 3OFKA 3T7SA 1XCLA 5HILA 2BH2A 4RTKA 3EGIA 4MWZA 3KR9A 3DMGA 3T7TA 4PIPA 5EMMA 5LQJA 1QANA 1L9KA 1KIAA 1X1AA 2PY6A 1FBNA 4QQKA 5P8WA 3CVOA 1FPQA 2GH1A 4HRAA 5F2OA 3THRA 2JHAA 4PONA 3ERCA 4DM3A 3E05A 1ORHA 3F4KA 4PYNA 3UZUA 5CUQA 5EMLA 1JSXA 4MHTA 4FT4A 3KQWA 3FPGA 5E2AA 2GA9A 2EJUA 2VDUE 4GBED 5E1MA 2OB2A 3T0IA 3A25A 5HFJA 3UJ7A 2ADMA 1R6AA 3UBTA 2OPBA 2CMGA 3E7PA 1M0EA 3G7UA 2FK8A 3SVZA 5GWXA 2PLWA 1H1DA 3BZBA 2O07A 2AR0A 1TW2A 2FRXA 5H02A 3EVZA 5T67A 5G02A 5CVJA 3LL7A 4PNEA 5LQRA 4RWZA 1SG9A 4V0RA 3OU2A 4BP1A 5ICCA 4RTPA 4R05A 3EVFA 1R74A 4GEKA 5HZMA 4KDCA 2AN3A 2ZWVA 4DA4A 3OZRA 1KYZA 4EKGA 3KPUA 2CMHA 5CVVA 4RTQA 3G2QA 2V7EA 3CBGA 1O9GA 5LSAA 2P3LA 1XDZA 2AN4A 3TLJA 3P2KA 4A6DA 4M7RA 2XYRA 3P2IA 1YZHA 4EVIA 2FYTA 2VDVE 4X60A 5ICFA 3DLCA 3E23A 1G6Q1 5FUBA 2ZZMA 3SXJA 3O7WA 2ZTHA 4HTFB 2PX5A 2YR0A 3KPYA 3OE5A 4RTMA 2IBTA 3HVIA 4IV8A 1EJ0A 3EGVA 1I9GA 2YXLA 3PX3A 3FYCA 3PFGA 1YFLA 3R24A 2B25A 4WXHA 2UYCA 1RJEA 3IHTA 4XUDA 5FWAA 2H00A 1T43A 2OY0A 2DPMA 2AOXA 3LCVB 3UJ6A 4NECA 1WY7A 2I9KA 3MGGA 2I6GA 4KWCA 3UA4A 4BLUA 3TFWA 5KS2A 1MHTA 5FCDA 2ZSUA 9MHTA 3UJBA 1ZHFA 5T64A 4RYLA 3DXXA 4E2WA 4E2YA 5EZQA 4C4AA 2IIPA 3R6TA 4PWYA 4DKJA 3NW9A 3HTXA 5HIMA 3C6KA 1Q0SA 3P9CA 1MJFA 3QV2A 3I5UA 4DZRA 5KVAA 2YTZA 1G8AA 3SSNA 3DR5A 4RVHA 5LQNA 2C7OA 3RIEA 5MHTA 1JR4A 5FQOA 3UJDA 5EEGA 2UYHA 1G8SA 3BT7A 1XVAA 2NNWB 2NXEA 1UWVA 4QVKA 2PWYA 4ER6A 2Z6QA 1IM8A 2K4MA 3MTIA 2IPXA 5DX8A 5B1SA 5CVUA 4F84A 3MTEA 5K03A 3ELWA 1Q0TA 1JQEA 5E1OA 1PJZA 2FK7A 4RTJA 1ZKDA 3CKKA 5K0CA 2B3TA 5FA8A 3LGAA 1R00A 1DCTA 1VL5A 5GIOE 2HTEA 5K0JA 1X1BA 1JG3A 4RVDA 4RX1A 4HSGA 4YUZA 3KQPA 4RSRA 5F2KA 1EG2A 4QTUB 1X19A 2ZBRA 8MHTA 2OXTA 3BUSA 3V8VA 3OFJA 5K0BA 1P91A 2VDWA 3Q7EA 2AOVA 3KU1A 4PCAA 1YZ3A 5E8JA 2B9EA 5GINE 3IV6A 3UWPA 1RI5A 3FUWA 5E9QA 2PV0A 4IV0A 3ER8A 3B89A 3FTDA 3NDJA 5EVJA 5IKMA 5EEHA 2ZIGA 2NYUA 4C04A 1ZGAA 3WSTA 4C07A 3KQTA 1G38A 1M6YA 2PX4A 3CGGA 1NE2A 5EZSA 3LSTA 5KQSA 3EEYA 4C06A 2ZVJA 4E32A 3FTEA 2ONYA 1NW5A 1WG8A 3HP7A 3MHTA 2BR5A 5EPEA 4GUAA 3LHDA 2P3OA 3B3GA 3OPNA 4GOOD 3DXYA 5DLYA 5CCBA 3LKZA 4RTSA 3A27A 1OR8A 1I1NA 3GRYA 4ER5A 2OBFA 3HCCA 3HCAA 2OB1A 3UFBA 4E30A 4HGYA 5HIKA 3M6WA 3FRIA 3PT9A 3DH0A 4POOA 2PX8A 1XDUA 1QAOA 3GGDA 5DM2A 4FSDA 4EK9A 4JXJA 3HCFA 2IFTA 3EVEA 2KW5A 4FS8A 4HG2A 3NTVA 3I53A 2A14A 3KR2A 3ID6C 5GP1A 2AOWA 3BXOA 5GOZA 3JWJA 3MCTA 3DMFA 1XCJA 2PXXA 3DMHA 3GCZA 3O31A 4H0NA 3UA3A 5ICEA 5KYGA 1N2XA 1UIRA 1YF3A 2HR1A 2BM8A 2ZIEA 1XJ5A 3GWZA 3PS9A 2PKWA 5DXAA 4YV2A 5C9ZA 10MHA 3HCDA 2G72A 3LECA 2GB4A 4P7FA 2ZCJA 1SUIA 3P2EA 4QDKA 3MB5A 3NMUF 4QPNA 1BC5A 5EIFA 2I7CA 3NVKI 3S68A 1NT2A 1KP9A 2HMYB 2VS1A 3FZGA 1JG4A 3KPWA 3P97A 5DT2A 5EKUA 1SVUA 2FCAA 3A7EA 4G56A 2BR4A 1O9HA 2EX4A 2AN5A 1UFKA 3EVGA 4ER0A 3LBFA 3E8SA 3R0QA 3K0BA 5FQNA 4CKBA 5JUWA 3OZTA 1DUSA 4KIGA 3KR0A 3GRZA 4R6XA 5K09A 2P3QA 3KPJA 2AVDA 2FHPA 3IEIA 3UJ8A 3G89A 2B2CA 1L3CA 1M6EX 4BLWA 2ZBPA 4HC4A 3HVHA 5K0GA 4C03A 4KVZA 2IGTA 2H11A 2P7HA 3EEOA 3FPJA 1NKVA 5DSXA 4DQ0A 3G2PA 1PRYA 3HNRA 1SQFA 5BW4A 1D2GA 4M36A 2FPOA 4E70A 4LWPA 3GIWA 3NDIA 3LCUA 3U81A 3ELYA 3M6XA 4PYQA 2P8JA 4PGHA 2NXNA 2QM3A 1ZGJA 1RJDA 2ZFUA 3P8ZA 4E2ZA 5CM2Z 1B42A 1ZG3A 3SSOA 3LDGA 1VP9A 3PLAE 3KPVA 2PSSA 2PT9A 3CJRA 3AWIA 4DMGA 3G5LA 2C7RA 5E8RA 2IDJA 5LQKA 4KW7A 3SGLA 2YX1A 3JWGA 1VIDA 3GXOA 3BGIA 5F2NA 5ICGA 5EGSA 2VP3A 2YUIA 1SQGA 1I4WA 3LKDA 4R6WA 3HEMA 1WZNA 3PFHA 4QPPA 3M6VA 4C08A 2HWKA 3BGVA 4OA8A 4R8SA 5EC8A 1HMYA 5LQUA 1TW3A 3MCZA 1XDSA 1BKYA 3TRKA 4U7PB 3UJAA 3C6MA 2H1RA 3MAGA 2IDKA 3OE4A 5CVEA 4ZTBA 4X1OA 4PCLA 4IWNA 4RVGA 3KQQA 1EAMA 3A4TA 1XXLA 5IH3A 3FTCA 4CKEA 1D2CA 2PGXA 3OU7A 3SMQA 2XVAA 2P7IA 3C3YA 3SSMA 4BLVA 3ELDA 2G8NA 2R3SA 4GOMD 2PWPA 3TM5A 3R3HA 2ESRA 2GAFA 4A6EA 2BR3A 4LG1A 3NJRA 1FP2A 1EJ6A 5C1IA 5EIWA 3G2MA 3ER9A 3A7DA 2PXAA 3FRHA 3DTNA 4DCGA 2GLUA 2XYQA 2YVLA 2ZBQA 3BWYA 4FZVA 5LR6A 2HV9A 4R8RA 1NW6A 1FP1D 1L3IA 4BY9E 2NP6A 2ERCA 4HH4A 4HGZA 4YV1A 5BP7A 3ME5A 5K8VA 5FHQA 1Z3CA 5DTRA 2Y1WA 3PTAA 3HVKA 3LBYA 2PX2A 5D1HA 2AOTB 4E2XA 5ERGB 3KQSA 2ZZKA 4KDRA 4L7VA 5EQJB 5DWQA 1O54A 2N47A 4CTJA 2IH5A 3CCFA 2CWWA 2NXCA 3HCEA 5U4XA 2IH4A 1JTFA 1KR5A 2AOTA 5E2BA 5C0OE 5K0FA 2ONZA 3M33A 3FPEA 5BXYA 4P7KA 3EVBA 3K6RA 1P1BA 4AZVA 2I62A 4Y2HA 3C3PA 4P7JA 4OQEA 4YUVA 2Z6AA 3HVJA 3TR6A 3X0DA 5GIPE 3EMBA 4O29A 1EIZA 4MIKA 3MERA 4DF3A 1KXZA 2O57A 2V74B 1AF7A 4CTKA 2NP7A 4IKPA
chains in the Genus database with same CATH superfamily
4GYKA 4YRSA 1NUHA 2GKOA 2AC2A 2Y6VA 3LPMA 5JROA 1YZNA 5CJ2A 3W3AD 5HRAA 4JLJA 1JFFA 2KI5A 2H85A 2MYUA 3BMNB 3ENWA 4FYYA 4PAQA 4PCVA 4Z0TA 4ECAA 5AH0A 2GPAA 3BMXA 3OA0A 2QSYA 1O0BA 1E1YA 2WJWA 3EUFA 2H2HA 2FN9A 2JKVA 2A7QA 3C3BA 4NS4A 1XCOA 2ZXUA 3AF6A 2DEUA 3SQXA 3BMNA 1CE8B 3DOEA 3CX3A 3R7LA 3E6AA 1JXOA 3LCMA 2ILTA 4AKSA 1GTMA 2QE6A 4HX5A 4YO7A 1K7FB 3A26A 3OQMA 1KY4A 1QHXA 1DNPA 3K15A 4YQEA 4D9CA 4D9EA 1CE8A 4X85A 4LDRA 5BNZA 3A04A 4DIOA 3EPKA 5IAGA 2C4NA 2BRUC 2I2FA 3ASUA 1F9AA 1R64A 1Q1GA 1U9IA 2YOHA 2B99A 4MV1A 3LLCA 5K45A 4OKSA 4BRZA 4QTYA 1XNHA 4O8ZA 3V3TA 4B87A 4RTNA 1Y8RB 3LMKA 1H2AS 5EMHA 4ZJPA 5DISB 4UMDA 2FG7C 1PAUA 2BSAA 3KWMA 4NWIA 4HAYA 2PVPA 3WGUA 4WN9B 5LZ2A 1K98A 5KSYA 2VQSA 1D7OA 1KFKB 2NV0A 4FFOA 2E89A 1ZAKA 3GRUA 1Y8RA 2QZJA 2FR1A 4LHWA 2UZ3A 4CMGA 1QXSA 1H2XA 3N53A 4WN9A 1SC9A 4YRRA 3TKAA 3DEHA 4Z54A 5C7LO 5JWRA 5KOIA 3T5AA 3L46A 4TMXA 4Y98A 3R75A 4BCCA 5HZHA 3ADPA 4MKHA 3S29A 4Y2UA 3OTQA 1RC1A 1H66A 5JECA 4IG9A 4FCVA 4CETA 1SURA 1W5BA 3MGAA 1AZLA 4TWZA 4ZO7A 1HFEL 4ITUA 1GFIA 3DVSX 2EX0A 2V3VA 4QFCA 5WRFA 1NR1A 2Z9CA 1WCYA 1S8FA 2CMKA 4IUYA 2BFBB 2LIVA 4MO2A 1X9HA 4OMDA 5I3ZA 4QJ4A 3BAFA 4RLSA 5DHRA 1E96A 1NZDA 4A0QA 2XCRB 2AFIA 2D8AA 3UPTA 1VKNA 2PJZA 2X0KA 1MQSA 1NR7A 1XK6A 2BFBA 3L6UA 4B3DA 4C14A 1XZJA 1UJNA 4C7XA 5KTYA 3ZVRA 1CY8A 1NN1A 1VDZA 5DF1A 5MDHA 4UNNA 1YGPA 4HTFA 4F3CA 3F7NA 1RPAA 2GBFA 1E1NA 2JFWA 1E2KA 1NQOA 2DHQA 2X5NA 4MRAA 1BFKA 1ZIOA 2MSKA 1RZRA 1GNRA 1A9QA 2XECA 2YJ5A 3EGEA 4PLZA 2XQFA 2X4GA 2R6AA 4OB8A 4NBKA 3DAHA 7MHTA 5DTJA 1M2KA 2EZ4A 1H1TA 2V7VA 2SECE 1EK1A 4EMTA 5B1YA 5C4MA 3KLMX 1D2NA 3NOQA 4JC5A 4KWIA 4YAKA 3FCYA 3L7CA 5K8UA 1CUGA 1FBTA 1ZUWA 1HYQA 4PFJA 1G18A 4CMAA 1UKVY 2FSUA 4Z2YA 3O38A 1TEZA 4DT1B 2ZIUB 4FIBA 3KEOA 4TWRA 4CMBA 5ITVA 1QF9A 3EZ2A 3QTLA 2DB3A 3F74A 1T3ZA 4UNPA 5FORA 3KYDB 1PZMA 1EHIA 4HX2A 3RSOA 3OG9A 3W8EA 4TLLB 3QLVC 5IP5A 4BP3A 2YV4A 3IQIX 4NEGA 1A5BB 4Y6QA 4BNWA 3VISA 1MGOA 3D0RA 2G17A 4PYIA 1U2ZA 3KYDA 4ZC8A 3T7RA 2PKQP 1CR4A 3EHEA 3JQ7A 3RABA 4TRNA 2W70A 4LFBB 4IRMA 3EPPA 3C7TA 4ER7A 3BERA 1WUYA 5CJPA 4EMBA 5EWLB 1GTRA 1F8GA 1CJCA 4BB5A 1W94A 1I2AA 4RJIA 2J6IA 4IDHA 4A2PA 1EESA 3I6BA 1NYTA 3WK8A 1FLVA 3OFVA 5E38A 4CF4A 1GKLA 3D5TA 4RL4A 5DSTA 2Q1XA 3EAGA 1K6XA 2G06A 5EWLA 1W4CA 4RZSA 1TVCA 4DIBA 2JIZA 3OZIA 4RF3A 4DN6A 3R5SA 4EDFA 1D2EA 1KAMA 1XTUA 1NUAA 3EVNA 4LHZA 1DUVG 3E2PA 4A91A 3GMDA 3IJPA 1AHHA 1YBFA 2OZPA 2ZBDA 1IBSA 3F6YA 3HL0A 2EKLA 2ORED 3PHBE 3Q6MA 2JAUA 2B21A 2PN1A 1NRJB 1G0OA 3DS8A 4K0RA 3RS9A 4P86A 4TLAA 2Q4DA 3ORHA 3TIWA 4MA0A 2ZM5A 4ZQHA 3TMAA 1BQEA 3PNKA 3PGA1 3ICEA 4MVJD 4UVHA 3CRQA 1RYEA 2JJ8A 1BO6A 1H5QA 2V5VA 3EGOA 3W05A 4JUIA 3DZGA 3O3OB 1CX9B 5SV2A 3BJIC 5J58A 2NACA 2VKQA 2P5YA 1QFYA 4ENSA 1KQ3A 1NV8A 2GZSA 2QD1A 4IOKA 1QKKA 1E66A 1T91A 2PBRA 3PNLA 4GLLA 2LE0A 3QKRA 3SQNA 2XCTB 1TZJA 4GS5A 1CUCA 3FPTA 2I3GA 3IALA 1UMBB 4TQ9A 1CQJA 2E6KA 4UU7A 3TCXB 4OQNA 2TMDA 1AK1A 3VOBA 4WE3A 2O23A 2ZUDA 3W77A 5F2OA 3H13A 3T1YB 1JWLA 3WDSA 8ADHA 1GTL1 2IWRA 4IQ4A 1UMBA 2P9QA 1PFGA 1P74A 2G9QA 2VT3A 3MOSA 3IBCA 5CUQA 1DIOB 3EZNA 2QRHA 1YCHA 2DFPA 4IDNA 1YNOA 2D0IA 3G2KA 1QTQA 2IELA 5F5XA 5FP0A 1TNDA 3NBYC 2DWQA 2FP4A 4KXQA 1M0EA 2FB9A 2E4XA 2OPBA 3DWEX 1SJ9A 4UTVA 3BZBA 2E5FA 2JLQA 1IZ7A 1RLOA 2IYNA 1XPUA 3GLSA 5K0EA 1OD6A 4Q5IA 4MGKR 4F8EA 5CVJA 1UQRA 2JC3A 3IVRA 3ILHA 4E08A 1P7YA 1M1YB 3I73A 4RWZA 5LQRA 1Y4ZA 2CDAA 4HUJA 3SQWA 3CM0A 4H6VA 2O8CB 1AKNA 1FRQA 5HZMA 3HB7A 1QOPB 4QDZA 4DA4A 3WWDA 2E4VA 1XB2A 4G5XA 5HDQA 4DQDA 4DNOA 3ZZ0A 2RJOA 3F7MA 2J32A 4JB3A 4NU5A 1J6UA 1IZZA 1WTAA 1H8ED 3OLXA 4YAWA 2DY0A 3T1QA 4M7RA 2QUIA 3BFXA 1T9GS 3G85A 5GADl 4BJ5A 1XFAA 2GILA 4X60A 5LD2C 4M0LA 2RBKA 2H3EA 1IJKA 1GGKA 3A36A 1I7LA 2B2XA 3D6JA 1PT6A 3MPUA 3ZG6A 5J23A 2WHXA 1WP9A 3L0OA 3UYKA 1QTRA 4PR0A 2JK0A 2LKDA 3S2SA 5JU6A 2NIPA 4RAOA 4Q9LA 3GELA 4J1SA 4QGSA 1QF6A 1T36B 4PSKA 4I8DA 2BM1A 4XUDA 2P69A 1CC1S 4FNMA 4BQEA 4JXZA 1S2OA 1B6SA 3K2BA 4AWXA 3ND8A 2VJMB 1VPEA 3ICPA 3TFWA 1FNNA 1T36A 2OBLA 5CGQB 2WD7B 4ETWA 5AUNB 3NYIA 4E2YA 1Y3IA 4RADA 4FXOA 1MH1A 2X0RA 4RXUA 3TTWA 4F9GA 4LYJA 2R2AA 1ICIA 2VJMA 5CMLA 4EPXA 1Q0SA 3P9CA 4AMYA 1MU0A 4FDTA 2X8WA 2NSYA 2WD7A 3A2NA 1PFYA 4M21A 3UMBA 4YT5A 2ZT8A 1Y7TA 3OURA 4G4SO 1AQYA 1UADA 3LT2A 4IIJF 1TD1A 5JYEA 1A9XA 2WI8A 2WFLB 3FVRA 1DKLA 5C1BA 4EMUA 2R11A 1SVSA 1I4DD 2ANCA 3WLSA 3TR0A 3BB1A 3MXOA 1K92A 3UMMA 2WFLA 4ZI5A 1IMOA 2WP8J 4MP8A 3ENVA 2FDRA 4XTCS 5FFMA 2IXDA 2R60A 4JEUA 3IRUA 1SG6A 2RAFA 1VKRA 4HEA6 3O9VA 3K9NA 2CLIB 3TAXA 4M98A 2G36A 3KL2A 3MELA 3NHMA 3F46A 1UBSB 3BQMB 2HA6A 1EXNA 3TVDA 3WKDA 3MQFA 2APJA 3QKSB 5GINE 1PT5A 1YQXA 2WHYA 4JLVA 4JU9A 1SQ6A 3GAFA 1FFDA 4ESEA 2H1IA 3TUIC 4LXHA 4EFKA 5BN5A 4R2MA 5EEHA 5TS2A 4LHSA 4GWKA 1YASA 3QKSA 1UAAA 1BXKA 2Q8PA 4BLRA 2YZNA 2I6SA 2IKQA 3HJTA 2QP9X 3AHJA 3E84A 1WG8A 3H1TA 1Q3TA 3Q3JB 2QVXX 1TZBA 4HADA 4LZOA 2B0JA 4M8IA 5DLQC 4ZARA 3HXMA 2IEYA 2CVPA 4J2OA 2Y27A 5TE9A 3UY4A 4BWVA 1T24A 5GJCA 3A27A 3GC6A 3LS2A 5LMZA 3VJLA 1X38A 1LS6A 3DE5X 5CDTA 3FRIA 1C2TA 2OHVA 3ETNA 1IATA 2RGEA 5ALFA 1X6VA 4L8LA 3F9RA 4QQFA 2FQQA 2JDID 5BQFA 3AF2A 5L6LB 2O5CA 3C97A 3FDZA 3E2MA 4EK9A 3U39A 3CEMA 4H0FA 2O8NA 1E6UA 3MN1A 1FDTA 2I7TA 4JY7A 1NUSA 2HK6A 2W2KA 3F8SA 3P5BA 2VNHA 4GIBA 1KK1A 4FS8A 4PO1A 2XRZA 5B2FA 5BMVB 3B1VA 1Y4SA 4QWWA 2XTZA 2R7KA 2ZSAA 3EDMA 1TCAA 2O8CA 1XAIA 1RXYA 4MUFA 5A6VA 2BHTA 3DMNA 1JU3A 4QUIA 1XCJA 2DF8A 3VNQA 3GCZA 4H0NA 5DBEX 3SOZA 3LXMA 1UOQA 1VJ5A 1ZJYA 3OX1A 4O2BF 2FG6C 3B1YA 3F6CA 4EY5A 4RW0A 5GMOA 5A05A 4KQ6A 3WNVA 1JFRA 3A9VA 4LE2A 5ECWA 1BC5A 5TS3A 2GNAA 4KSCA 3NP9A 4EJ0A 2EX1A 1O2DA 2HMYB 3KPWA 4GDMA 1EXDA 4D1YA 3BBPA 2FCAA 4L15A 2NZVG 4FBLA 1XXHB 1XXHE 1Z0IA 3K71B 5EESA 1OBOA 1OLSA 4WLNA 4CKBA 5LM3A 2JGNA 2PJUA 4UPVA 5H81A 4YREA 3PVZA 4CEHB 3DDOA 1XXHA 3O1HB 2IHZA 4WKGA 1VCNA 1W9MA 4XA8A 4P2GA 1L3CA 4EW2A 3RYCA 3D1LA 4J49A 1RPZA 1XT6A 2I6UA 1W5AA 2IIVA 3ENKA 2LBPA 3W2FA 3ACDA 4CEHA 1C3OA 4HQLA 2INGX 3FPJA 2ZSEA 4IP0A 4DNPA 3WNZA 1RZUA 3A32A 3AKYA 2XZOA 3Q6IA 1RFGE 4HDQB 3EY9A 1VMIA 2WWGA 1NONA 1SKAA 4OV6B 3T5CA 1DC3A 1M6VB 1GKIA 3ELYA 3TRJA 5JJBA 2DUNA 3ESQA 3PUJA 2E9SA 4U2CA 4Y1RB 4PGHA 1YTUA 2ZVQX 5LOVB 2ZFUA 3RG2A 1FDOA 1ZG3A 2IOYA 4Y2RA 2O4UX 1VP9A 1M6VA 3H04A 4LOJA 1J56A 3IQXA 1QFMA 5CURA 2W2NA 4Y1RA 1Z06A 1A95A 1M66A 1P4AA 1Z6XA 1RHJA 3LFUA 3STXA 1WTCA 2ZRGA 4E6EA 4N8SA 2N9UA 1J33A 1RYNA 3SE7A 2NQ8A 3WJ2A 1X86B 9LDBA 5IFKA 3LUGA 2PEZA 1WIWA 5KTNA 3WLHA 5FBWB 1MG0A 4NAVA 1T0PA 1L4KA 4OA8A 4W5WA 2HIAA 3SC3A 2QGFA 5LQUA 4INPA 2ATEA 5CLIA 3C6MA 5FI3A 4LFCB 4Z8XA 1EXMA 4JB8A 3WGOA 5BV1A 4R7TA 4XIYA 5J5AA 4HDKB 2FY8A 4GYYA 1XXLA 3FTCA 1Q6YA 2Z95A 4QOHA 1RBZA 4EJSC 3ZZNA 2H4FA 1C9MA 3C6BA 2H7XA 1HG0A 2AQ8A 3EQ7A 4RZ2A 2PUBA 1PJAA 1HQYE 2X2PA 4HDKA 2WNSA 1Q74A 3FKQA 3ZNPA 4LBYA 2GSWA 4M6WB 1FP2A 2GHRA 1Z88A 4A9AA 5F12A 3ZHQA 3HJGA 3GF4A 4HP8A 4ZT7A 4QX6A 2JIPA 2HXSA 2XYQA 4J7CA 5JQWA 3DAFA 3HB4X 5AO9A 1ST2A 3IE0A 1OUMA 4L4SA 4A3SA 3M9LA 4M6WA 3L43A 4OQFA 2ACKA 2XJ4A 4TS9A 3C70A 4ENUA 4KITB 4H16A 5CLJA 4J43A 3QP9A 2BE7A 1Y5RA 4XJSA 3PFWO 4Y9UA 1KXJA 3V4PB 1NVMB 2P1ZA 3AI7A 3E0QA 6PFKA 2XHZA 3EA5A 1WNTA 3KEFA 3I6YA 5D1HA 5K4HA 1UBHS 5LOVF 3AVUA 1QGUB 1CU1A 2XF2A 3G6WA 2RHHA 4F2HA 2ZSBA 3GFRA 5JCJA 1Z33A 1PZGA 4PSDA 5FB3A 1GQ2A 4B6OA 5T4BA 4F3TA 3MJCA 4MQMA 4LGCA 4WFJA 1FNCA 2A9JA 1U0HC 2DCUA 2A1TR 1QGUA 2ONZA 3W9UA 3RT1A 3BYZA 1WQ3A 4PLCA 4R51A 2YYAA 2MU1A 3AY3A 1KFCB 3B36A 2WJVA 3GA7A 2C5EA 1DHTA 1DG3A 4HLDA 5GIPE 1G7CA 3TTUA 3IHKA 1GZDA 2G1KA 1VLQA 2OAEA 3WISA 1KXZA 3UCEA 3IE2A 2GZDA 2XQKA 1PTKA 3JATB 4NULA 5K01A 1HPLA 4NP6A 5H68A 2F9LA 3QUQA 1R4AA 4NMMA 3SFVA 3DM9B 1QU3A 2V6GA 4MQLA 4GMDA 2ZIZA 1IN5A 3JATA 4OMCA 4DV1B 5AVRA 2VK8A 1O96B 3UUWA 1OZGA 4GAEA 1YONA 2Q8NA 4AMGA 4BB6A 3Q98A 1FK8A 2KMLA 3F67A 3GYBA 4TQGA 3AXTA 2ZULA 2VLBA 1KJJA 4L1KA 4DE5A 1E1MA 1TAGA 2P9GA 4FMDB 4HYQA 1SXJC 1P19A 1ZD9A 2QXYA 3EFHA 3EBOA 3DOHA 2WV7A 4NABA 5DEIA 1ORIA 5FPYA 5ALSA 1QDEA 2FWPA 3HNPA 1TM4E 1E4EB 1HETA 4M7OA 4YCSA 4IGKA 1Z6YA 3PGXA 5EL0A 1BD4A 1R8YA 3NWEA 4UHBA 3SX2A 3ETHA 4LZNA 2WTMA 2YW2A 2ID9A 3T61A 5CAEB 4QD3A 1E4EA 2ZIFA 4N40A 4RCYA 4BJ1A 4DADA 2PA0A 1UZLA 3T7EA 1IZ9A 4DMUB 3A6DA 4LDPA 2HA5A 2QK4A 3D81A 1AK9A 2GFQA 4UXIA 2CVOA 1YS1X 621PA 3CURA 1ORRA 2V7QD 3I2GA 4FVTA 3I09A 2IU0A 2AF4C 1HLFA 1KKLA 3EYWA 1DI0A 2CV1A 2O06A 3JQEA 3T1OA 3LGSA 1WSBA 1ZJJA 3TOSA 1CUUA 2P9CA 5I3CA 3WAGA 1DPFA 3OZAA 4ZQCB 5E1BA 2C9DA 3TRFA 4GPTA 3ST7A 2YYZA 2XMGA 1R6VA 2WYIA 1OY1A 1KR2A 1SK9A 4EPWA 2JF0A 3FB1A 1DOZA 2YJTD 3MWDB 1ZAYA 1Z7EA 2D59A 3NANA 1JSLA 2PSEA 2IU6A 3IAS6 3QUCA 3ECCA 2CFCA 4JQYA 2VNJA 1K88A 3IHLA 2C5GA 3BHMA 4NH4A 4RA6B 4WY8A 4IXDA 2KYRA 4EGJA 1K8QA 1A2QA 1PWHA 5DYWA 4QGAA 1Z4NA 3OVMA 1WXWA 4O4LB 2X15A 5DTQA 4C01A 4RA6A 1TJPB 4P82A 1XNRB 3WHKA 3I76A 4NE9A 2WJPA 1UANA 2CLOB 2QXTA 1QZZA 3VC3A 3U16A 2GN9A 2JGFA 2P40A 2RK6A 4KRYA 4LXYA 2FFBA 4EUSA 5YASA 4BGDA 2H54A 1H93A 2Q5IA 4LYDA 4IF4A 3DP7A 1X1DA 3N8DA 4QHYA 1T3TA 1JIUA 3DF7A 1SM4A 2IUYA 3FBTA 1SUWA 3A3YA 3W90A 3MBOA 2IVZA 3G9QA 5LBTA 5BRAA 4RTRA 1DBIA 2WY2D 1V11A 4II7A 4YH1A 3IBGA 4CWAA 1NU8A 3KAJA 4GZ3A 2O0LA 1Y42X 1QFZA 4LGVA 5ALIA 4BO1A 1SU7A 1SXPA 5FAKA 2YMMA 4MK4A 3NUGA 5LIRA 3I72A 2QLLA 4YQYA 4YXWA 4DMCA 3TSCA 4HWTA 1KQOA 2PSFA 4JA0A 5DI3B 5GM1A 5MF6A 1R88A 2XWSA 3M9XA 4QAJA 4ND2A 1UBTS 5KQRA 5A1TA 2RGCA 1YQ9A 3HVRA 4GO1A 4RVOA 3LT4A 1P4JA 2BM9A 3FUXA 1ZA1A 3JYQA 5DI3A 1E2FA 1G8FA 2JJ1D 5FNZA 5AVWA 1OBFO 1WNFA 4FYHA 5K0LA 5JAOA 1OB2A 1T2CA 3OQIB 5FUQA 3SAJA 1X1CA 4NYJQ 3KYJB 2GZ1A 4A6PA 3OECA 2X9QA 1YRBA 2VH5R 2O7QA 4HWPA 1YRWA 4I55F 4X8MA 3V7YA 3BWDD 1OXBB 1YULA 2D4AA 3B6ZA 3L7NA 3OQIA 4KYIB 4E5KA 4RKWA 1DRWA 4Z0HO 3KR1A 1NUQA 3BKXA 1E0JA 1G7TA 2I22A 2GM5A 2HBRA 2Q1SA 2DKNA 3QQ5A 3SIPA 5A4MS 1IXZA 5EP1A 4JK3A 1TFRA 4BEJA 2GCEA 3DE2X 1SC3A 4L5BA 5KTMA 4R1SA 3HKEB 3FBGA 3IERA 2ZZNA 4P32A 1NF2A 4Q66C 4WDRA 4H4CA 3BQBA 4PBRA 4M37A 1RRPA 3I9NA 4MQBA 5EJEA 4OKNA 3AR6A 1V4NA 4DLTA 1G5RA 2I29A 3U17A 4IGFA 5L95A 1PI3A 4OUKX 1FVOA 2B6HA 1WB4A 3HB5X 1FY2A 3GEPA 3EGWA 4RKFA 4YCBA 1WF3A 5C8ZA 4C05A 5IAOA 5JXJA 3C6QA 3KVOA 3I5YA 3NUZA 2YFKA 1XA3A 3R9KA 5LQCA 1BFDA 1ZK2A 2WA2A 4F2GA 1WSAA 4M1WA 1CTQA 1QJCA 1D04A 5A02A 2XEDA 4KPYA 3JTEA 4MLDA 4NCKA 1Z4OA 4RTKA 4MWZA 4W9RA 2JD2A 2HN9A 2CW5A 3T7TA 1P7VA 1SC4A 4X8OA 5FWXB 3ZWDA 1HT3A 2H5LA 3BXPA 1VOTA 1TU0A 4KXUA 2WG2A 3CF4A 1Q0HA 2LDXA 4Z1MA 2GCNA 2JHAA 1HE2A 3MMZA 3SMVA 2QX6A 4KXNA 2P30A 2ZWPA 3LQKA 2R5FA 4XB2A 3TUZC 2QQRA 3O7MA 5FWXA 1AX9A 1WD7A 4NLLA 4RJ2A 1XLTC 2YNMD 4CG0A 1Z45A 2GK4A 1O5TA 1G9TA 1MLDA 2WUWE 5GPBA 3IKVA 4E46A 1RE0A 1ELOA 1B8VA 2CXRA 1IN8A 1XDGA 1XZQA 2JI4A 4WADA 3WWEA 2IYVA 1J2YA 3A8TA 2FR0A 3NGLA 4R84A 2H1WA 4L9WA 3LL7A 4YR9A 4DLVA 1H6AA 4FN5A 3BTSA 5DBFA 2R4UA 6REQA 3NIBA 5CFOA 4PS1A 2OBMA 2ZK7A 4NENB 2XITA 3BG5A 4OIMA 5KNCA 4KR2A 2ZWVA 1TQDA 1OPRA 4IL5A 1J1IA 2L17A 1DXOA 2QU7A 5JPCA 6Q21A 3UHJA 1XDZA 1MPTA 4NENA 2GA8A 4YTEA 3BGWA 5CEJA 1CDZA 3MMSA 1JQLB 5LDHA 1UBLS 3LNTA 2OR3A 3ZBUA 2DC1A 4M4SA 3PDHA 1A9SA 6ADHA 1ZBDA 1RRKA 1XJCA 5AKJA 4BMOB 5DBHX 5A4DA 5KJ6A 2G8LA 2GPTA 5AD1A 5SZJA 2QUBA 2YXLA 4N3NA 4B83A 5FEUA 4LNHA 1PTJA 1U3DA 4TSKA 4GE0A 1IZ8A 1Y7PA 1BEUB 3S2ZA 3SZGA 4D80A 2X77A 2ZITA 1BXRB 1GNSA 3UJ6A 3EW9A 3IJ5A 1DAFA 2GZRA 4KWCA 3WK7A 4KLZA 4IF6A 4ND3A 1AGYA 1CNMA 4P2BA 5T64A 3T4UA 3G5AA 3ETDA 3QNUA 1VZ3A 1BXRA 5DWDA 5JZ9A 4DKJA 4ZJUA 2IIPA 2PNFA 5IMBA 1U2EA 2IHVA 3N8KA 4RKQA 2IW3A 1PFKA 1YI8A 1SU4A 1B8OA 3I5UA 5D87A 1N8KA 4INZA 4ZXPA 3HHPA 2R4TA 2XWBF 3O8OB 1Y9EA 4HXGA 3VR3D 1E6LA 1Z07A 5FWNA 2BEVB 1L7RA 4E22A 4JQZA 4ETMA 1PX2A 1UFOA 5TARA 1C29B 3WLLA 4NFHA 3VR6H 4EG1A 3O8OA 1IM8A 1XIVA 3PGLA 5AW1A 4RTPA 4NE7A 2G0AA 4OUDB 3MTEA 3EB9A 2BEVA 4Q1BA 1Q0TA 2XRFA 2VK4A 4OEHA 1TK3A 4MUNA 4AG5A 1NJ5A 1CLEA 3LUJA 4FJ0A 3WLNA 4BV3A 3CS3A 2D5IA 4DEXA 2PUCA 1G8PA 3C4VA 3R3UA 4OUDA 4G8DA 1I3OA 5EHZA 1ZOLA 3VHLB 5JASA 5FBRB 3DQZA 2J33A 3ULKA 5BVGB 4PTLA 4DG8A 3KQPA 5JS7A 2WZQA 1JPUA 2B4AA 5L3ZA 2WJAA 3UVEA 2RKWA 4FFPA 4XPIB 1KS9A 4GVPA 4N5IX 4RQBA 2ZJ5A 4DRYA 4FHEA 1LPBB 1EB8A 5BVGA 1JAYA 3N76A 4X45A 3I8SA 3NC4A 4LRYA 3UWPA 2ZT5A 1Z29A 1XO1A 3HGQA 4GYJA 4XPIA 1VGVA 1ZUHA 4J1NA 5I9NA 3R74A 2KBEA 2RH8A 2JFFA 1NXVA 3FPCA 1P2SA 1SBIA 1U8CB 1JDSA 1O6GA 3H11B 1FMTA 2IOFA 3L6CA 1C50A 1EZ4A 2ONYA 1ESEA 2ALJA 1EP1B 1CY4A 3WTCA 3QI7A 4Q18A 1MB3A 1W19A 2DFLA 2QDXA 3L7KA 4GOOD 4IZ6A 3S1LA 3H11A 3Q3EA 2RI0A 3NX4A 1QB7A 1C7EA 1EK0A 5B57C 4RA9B 4E30A 5K8LA 1ZU5A 2D2IA 4JD5A 2POCA 5G41A 4BQQA 4POOA 2O3QA 4EA7A 5M7EA 5LC1A 4ZYZA 3QQ8A 2JAOA 2Y77A 1IBRA 1HQCA 2W43A 3PRKE 5BWBA 2H1CA 3EVEA 2ZI4A 3LM8A 1YJ8A 5HRCA 2X23A 2PX0A 2CLKB 3LLSA 1XRNA 3IOYA 2XCSB 3I53A 4B0OA 4ASUA 2XSZA 1AD2A 2B1GA 2G7MC 5GP1A 4K3UA 4LBZA 4IQGA 3JWJA 3L4EA 5E6SB 3UXMA 4FIDA 2PKQO 3RUEA 3U4GA 1LWOA 1XI2A 5EMNA 3VSCA 5IAEA 4ALJA 3DMHA 3UA3A 4Z5XA 2KJQA 4BV8A 1K9VF 2M6KA 1KIFA 4DV3B 4YCCA 10MHA 1CQWA 1QTNA 1L7XA 4B3XA 1BVUA 2GBLA 1B3BA 1TPZA 3NNDA 5E6SA 3WIVA 4BKUA 4EF4A 3V4RA 1IE3A 3OM8A 1U3TA 3JASB 1YJCA 3FPAA 2F90A 1HE3A 4XDZA 4LXUA 1VLJA 1A50B 2N46A 2HGSA 2WWXA 4ER0A 1X7ZB 3PSHA 2R84A 2PL1A 5EHQA 2ID4A 1GFSA 2P2LA 1UPCA 2XCQA 3E3NA 4YLYA 3GPCA 3E82A 4MGYR 2QAGB 4DMHA 3E81A 1MNQA 4KQCA 1Q1AA 2Q0HA 5PNTA 4GDFA 4LF4B 3GCDA 4AJKA 2JIMA 2XDYA 2B1RA 2WDZA 4CFZA 1M2NA 1U99A 1H69A 2QAGA 4AF7A 4UFPA 1Y63A 1B74A 1S8NA 3N3BC 3TQHA 1CDEA 5BY2A 1ZFNA 3W7VA 3B9RA 4HL6A 5IASA 3DHYA 3QFTA 1ISMA 3ROXA 1W5FA 3P4XA 3WP1B 1E6WA 3AHEA 2FQXA 3U81A 1T9DA 3V32A 1RXSA 3QW2A 1GQYA 2EJBA 2Y3IA 4I2NA 2OZEA 4JBYA 1GNVA 3E48A 4J4TA 4P4GA 5CLQA 1Y1RA 3NC0C 2WSMA 3PQ2A 5I9TA 1FTGA 4PN7A 1I24A 2C7RA 1KJQA 2WW8A 4DC0A 5D6YA 2Q6TA 4V0OA 3IXLA 4NCJA 4R1PA 3EXEB 4P34A 4FB5A 5A6SB 4CM9A 4HD8A 1JBQA 3JWGA 2QX7A 1VIDA 2JGLA 2R5WA 5CVTA 2PH1A 1Y9AA 3VZQA 3UUEA 2FFQA 3EXEA 3VSAA 1AS3A 4JHXA 1MA3A 5EC8A 5A6SA 2FJ0A 3D6FA 1KKMA 1VI2A 4RY2A 3ZHCA 1JHRA 3MCZA 3MCUA 4XLZA 3UJPA 1BKYA 1Z16A 4OL9A 4CKEB 2HYDA 4LZWA 5D51S 1IUKA 2CZGA 2JIOA 3EZ7A 4K9QA 3BJEA 3ER6A 1F6WA 2BCEA 2R8ZA 1WXIA 1Y6JA 1XYYA 2OG1A 4CKEA 4YRBA 1YB5A 2O0JA 2O5VA 3C3YA 4RHYA 2IS4A 4RXMA 3DMTA 1Q6ZA 4A36A 4FYMA 1Z8FA 1F51E 5CHEA 1KYTA 2PV7A 2IYOA 3C3AA 4ZDWA 4A6EA 3PQ7A 4B46A 2C9BA 3RFXA 5JRZA 3H0EA 2LP4Y 3FM9A 4TV9B 4DIDA 1XZHA 5L4NA 3J7AC 3QE2A 4RSMA 1NASA 3O1IC 4G5FA 3ZPXA 1PEKE 1RAGA 3LT0A 5TX7A 1GUDA 1YOVB 4IFEA 4K3VA 1QDNA 3BK2A 1V6AA 3OLCX 3QTTA 4KTTE 4TV9A 5AKYA 3I34X 2ZRIA 3LTNC 1GKYA 4YMUA 3K5IA 4RVSA 3CNHA 1XLVA 2DUUA 1YOVA 4DQVA 1R9NA 1XZBA 2ZPTX 4UBMA 4EKNB 1T8PA 5B4VA 3PTAA 2RB4A 1PLJA 3Q8KA 2G28A 1DIGA 1ZOOA 5BSRA 3PEFA 4UXHA 3RBAA 1T13A 3IHWA 1O54A 3EDYA 4UCWA 1E92A 2ODQA 1KMIY 1QZUA 2OKGA 3C1UA 2XDWA 5G1NA 1E3DA 1AGXA 2CBZA 2H2IA 2RHJA 3NBZC 2ZE5A 3H2SA 3IURA 4P7KA 3OT1B 5EUBA 2IV2X 1HC7A 1WMFA 2GZAA 4X7RA 1QP8A 3GJ8A 4KSYA 2QGZA 3H4IA 1PEAA 3JVUA 1NLUA 3K0CA 3CX7A 3ESRA 3QMVA 5A62A 1VMKA 4K03A 1S6YA 2V74B 4FD2A 4BO3A 1T0IA 3LQ4A 4BPBA 4IKPA 4F84A 2IS6A 2E21A 2ZRKA 1DKMA 1TVEA 2VN8A 4GQIA 4DL9A 2C88A 5KHLB 2XT6A 4I1PA 4KNWA 1TVKA 2FMKA 3KUUA 4U9HS 3EXHC 2JLWA 5EWJA 1J2EA 4R41A 5DBGA 2VJAA 4ZO6A 2YINC 4DIUA 2A9FA 3ZV4A 1XVTA 3QA9A 4JX8A 1JDNA 1ENZA 3SLKA 3SIXA 4E5SA 4MULA 5E9JA 2ONKA 4R2IA 3RIGA 1VE3A 4MR8B 1H0HA 3PX2A 5AVSA 4MIEA 1GNPA 2XH8A 1TT5B 5UKDA 1W36C 3N8NA 1EFVB 3K0HA 3TQTA 2Q1UA 3L8DA 3RSLA 3KHSA 4X20A 4XKJA 1AO0A 3AU8A 4MR8A 4JI4B 2Z4TA 3IT3A 1Z6ZA 1H2RS 2Y68A 1QRAA 4RJLA 1O95D 2VQ3A 3C43A 3KC2A 1EFVA 5JRJA 1CUXA 1JHQA 3PUKA 5JSZB 1BG6A 1XD8A 1Z0JA 2GF7A 2QG6A 3Q15C 3G9TA 4JBLA 2AMYA 4J2TA 5IULC 4L07A 5ALKA 4Y0NA 3L41A 4OY3A 1LLFA 3OZFA 3VKVA 4ALIA 5B30A 1LK0A 2J0QA 1GGVA 3MD9A 3VI4B 2YWRA 1G1MA 3URKA 4GC5A 1Q3KA 3EXG2 3Q9SA 4I1SA 1PIWA 4NY1A 2DOKA 3ORSA 3R9IA 1B6GA 2Z2XA 3DBVO 1YQEA 3AJAA 3DHVA 1OA0A 3TLGB 2YKGA 4GX1A 3X1KA 2RKOA 5L40A 3NIGB 3BC1A 3EVCA 1E7RA 3VQTA 4KPEC 1UJCA 3QLEA 4P93A 3TLGA 3H6KA 3QEOA 2HNBA 1PU2A 4RIFA 5EQDA 4JT9A 3TAHA 4FEGA 1J70A 3EGDB 3CUTA 3EMKA 3H65A 3OPYB 3A9RA 1YAHA 1YTLA 4TTVA 3RC1A 3O4FA 4ZAXA 1Z47A 2WIFA 1N36B 1QV9A 1P0FA 1E2BA 1ECBA 2ZIXA 5JSZA 5IDQA 2HEGA 5AKLA 2BBTA 1ZRNA 3K1AB 4UE3S 2YBEA 2G6BA 3EGDA 3OPYA 1T8RA 3VDNB 4ZDKA 4BBPA 1NOIA 1V71A 4BGVA 1VP3A 2A2ZA 3GW8A 2WP0A 3FDJA 3DC2A 2W48A 3HKBB 3LXUX 3ONEA 3K1AA 1H2FA 2XCIA 5KYVA 3U3KA 3SQOA 4MUJA 5AK6A 3LDUA 1P33A 3TG2A 5FV7A 4MKXA 4MYSA 1A4IA 1XP8A 3DQQA 1NOKA 1BJTA 1WMAA 2HOQA 4ALMA 3HKBA 4C87A 3LUBA 4FK8A 4QUEA 1H42A 1N2JA 4LOAA 3WRYC 1CJUC 4K6FA 3MUEA 2QS9A 3FVQA 3VSEA 4F92B 1PG2A 5G1PA 4BN5A 4P92A 4EABA 4PICA 1EFTA 1MB0A 4QXPA 5EUMA 3BMOA 3TFQA 2PXHA 1GPLA 3EXAA 1BWPA 2XIJA 2IEZA 2XE8A 3C85A 2LD4A 2QQGA 2X7JA 3AV3A 3OKFA 1AY0A 3R3WA 4WFIA 3AR9A 4EKYA 2C2WA 4ZMRA 4V0MA 4HZIA 3CMCO 3WWPA 4E07A 2EFEB 2NZXA 3ADKA 3GLRA 3KSBC 4FFDA 4OHKA 1CKEA 5E7QA 4NARA 2PT6A 1UKEA 3KP1A 2A4KA 1DARA 1F2DA 1GO2A 4L5AA 1ZN9A 4EQZA 2OK7A 2QEQA 4DV0B 5SZKB 3QVTA 4WECA 4V0QA 4UHEA 3MT8A 2YXDA 4XUEA 1ABFA 5SYMA 5JQGF 3KAKA 3P9QA 1AXGA 1N7JA 4BEBA 4YMLA 1PR4A 4MPTA 1XRLA 3KOYA 1SUEA 3FI0A 1RZRD 3AF0A 5ILQA 2KLBA 4E15A 1YU6A 5AUPB 1Z35A 1P2UA 5AVYA 3SICE 3JS5A 3NOXA 2EJCA 2NGRA 1Y7LA 2ICAA 2QX8A 4ZN6A 4G5HA 1HK7A 1ZY2A 3UT0A 4X24A 1KYQA 4A8JC 1J9EA 1IJFA 4EYGA 3TF5A 3QBTA 1K06A 2Y0PA 2KLHA 3PC2A 1M5RA 1FYEA 2QUJA 4ZT4A 1IL0A 4AJPA 5BW5A 4E5DA 5AHOA 3P1JA 5T7BA 2W6JA 3RYTC 1HLPA 2X1VA 3AEYA 1V25A 2B5WA 4IUCS 4MV3A 4XI9A 3UFXB 4CL8A 5I45A 2GF9A 4EHKA 4B0PA 4KR6A 4US1R 4UM7A 1CJVC 3CEHA 1W0KD 3L0ZA 4R83A 3U3JA 3W4IA 1F20A 1BVYF 1ENOA 5BSWA 3IP3A 4TX1A 4HMPA 1W48A 4HNGA 2D5BA 5E4JA 3STVA 2JLBA 2PUHA 4OK5A 4JYCA 1C3EA 1ZISA 3F8TA 2VSXA 2Q5EA 3HBMA 4KGVA 4PAOA 2GCPA 2FQ1A 4PF1A 4RSGA 5DYTA 4QDXA 3AH8A 3EY4A 5FD8A 2QVZX 4YHHB 3KZMA 1ISPA 2C04A 3P26A 4ZO8A 5FV4A 2PYDA 4BNKA 4JKOA 3EGIA 3ND9A 3COVA 1U2DC 2O54A 2DWCA 2OGWA 2WAMA 3WGLA 2PTHA 4QQKA 3P20A 5KQPA 2ZXEA 3L0SA 1E3WB 1WP4A 3WK9A 3E05A 1SELA 2F59A 1JRLA 3H2YA 5K4AA 2VP9A 1QCZA 1KOLA 1JHMA 4C0KA 1VCOA 5E1MA 5CX4A 5H59A 3U3RA 1E3WA 1YZUA 3ESYA 2XGMA 2VI5A 4L72A 4Y6OA 2Q0SA 3AR3A 1QG0A 1H1DA 1QGAA 4GMGA 4KLAA 2NU8B 1TW2A 1J4AA 3SZRA 2Q2QA 4BQSA 2BFNA 3H9GA 3Q1KA 5AKIA 2A58A 2CB9A 2NPIA 1RRGA 3TX6A 2QUZA 1SOAA 2AIRA 2QJTA 3OHSX 4BFCA 4HFRA 1OIXA 1TMKA 1QE5A 3DZDA 1BRTA 2AN3A 3NYQA 4IIEA 4D3XA 2O8EB 1NJ2A 5BSTA 4EGFA 1E9BA 2H06A 1P0QA 2IXEA 4IZIA 3SXPA 4BVKA 1SBHA 5GV8A 4MNTA 4TROA 4YECA 3VV2A 4DBVO 1MIHA 3DT9A 3PE3A 4UD6A 2ZWMA 3V8NA 2O8EA 1T8TA 1DIRA 2PZJA 1EXWA 4D0NA 1ZXLA 4GVLA 1N2SA 2CHFA 1R8SA 1L7NA 4KLRA 4D8WA 2Y8EA 5ICFA 3T7JA 1I7QB 3G2HA 4HPWA 2C4MA 3A2MA 1H65A 3RT9A 2FCRA 2GNOA 1R5OA 5AHRA 5GGXA 4FMDF 4LC0A 1E6CA 2C8VA 1SCJA 4EENA 1U0JA 3U09A 3OLQA 2FUG1 1PS9A 1LXCA 3L3BA 3G79A 1C0PA 3GYGA 5F77A 4ZALA 4JWTA 3T0GA 1OXUA 1VG8A 3ZDDA 2MSEB 3GUZA 2Y0BA 1T43A 1PNQA 2O6HA 2AOXA 1B3RA 4NV0A 3WLJA 3TBKA 1U98A 1A7UA 1MAAA 1IOVA 4XYMA 5CA0A 2W71A 4R2XA 4QZVA 5LQSA 5T57A 2D62A 2WF5A 2YWGA 3IELA 5JALA 3ETGA 3GAAA 4NMWA 1CJBA 1I8TA 3CEJA 3G3EA 4CTOA 4FOTA 3HPRA 4UU8A 1L7PA 1E79A 4JUBA 3V4LA 4BUJA 2Y92A 1ZVVA 2CCGA 1EGQA 1V35A 3VYSB 1ZU4A 4ML3A 3ZWVA 4I7EA 1SC6A 3I1FA 3EGXA 1XTTA 4P33A 3W8FA 2VT2A 2F3RA 3U19A 4HNHA 3SD7A 3NEJA 3RSCA 4GLOA 1NFRA 3T15A 4A0GA 3ELWA 4BX8A 1EA7A 4DCSA 1PJZA 1NP6A 1TZKA 1UT8A 2WU8A 2PGAA 3E5HA 3Q7RA 2B2NA 4GEGA 2WZDA 4OTZA 5B12A 4MWSA 4B3TB 3BK1A 1P3DA 3RIYA 3D3KA 1DCTA 4PM4A 3QIAA 3ZY5A 5FL7A 2II6A 1FSPA 3BRSA 3RIMA 1IN1A 5U9CA 1XEWX 3DC7A 4H9GA 3ZE8A 1LI5A 1T0BA 5TRTA 2MM0A 2V5UA 3BDAA 3N70A 5FUXA 3V8VA 2VXYA 1ZSVA 3JD0A 3AUKA 4KXXA 4BFTA 1M2EA 1GU0A 1ZCBA 2QN2A 3IV6A 3LBNA 3FUWA 3AVYA 4D9MA 1DKOA 2LXNA 4I1VA 4PC3A 1AQ6A 3CX4A 2A5YB 2J6HA 3B1WA 1RPJA 3K1TA 2JLVA 2EDAA 4O4HB 3N8IA 3LC7O 1TYAE 5KNLA 3EEYA 2BP7B 2P75A 2P0EA 3QITA 5CYGA 1NW5A 4B09A 1Q21A 2MYTA 2ACWA 1GRQA 1SN7A 1UZMA 4OJKA 4W7SA 5KJ1A 4O4HA 1NG1A 2C5FA 2OAQ1 3ABOB 4HZUB 5SYAA 3W6PA 3G82C 4QYWA 2BP7A 3PU6A 5BN4B 1OKKA 2H4XA 4GWGA 3GRYA 2Q5LA 2Z2JA 3U3DA 4ER5A 4HRYA 5ANRB 3RUFA 3CCCA 5ECYA 1JU9A 1GPMA 4YLEA 3CW9A 3B3AA 2CXXA 1Y3AA 2R8PA 3IQWA 4HZUA 3V33A 5IAKA 4BQPA 5BN4A 3S2GA 4QPJC 3SEFA 3ZJ4A 2ZEJA 1P60A 5IABA 2W6NA 3MILA 2XUDA 1MC8A 4YX9A 4C2UA 4HXFB 1AC5A 3A4YA 3C2QA 4HY3A 2UVPB 3K09A 1WV0A 4OP1A 1JF8A 4PX5A 1E8MA 2FZVA 2QI9C 2ZQYA 4YJFA 2A14A 1II9A 2IOFK 2NN3C 3L4BC 5EZ6B 4IY1A 3KWJA 5CFNA 1I6MA 2XMRA 4DCUA 3OJXA 3I2KA 4YN3A 3VZDA 5M2QA 1T9HA 3QH4A 2UVPA 2JCSA 3DMFA 1T2VA 3GJ6A 3H3XA 1L4NA 4QUAA 1JT2A 4HNTA 4QELA 1UIRA 2FVXA 1HG1A 1PBNA 3JZFA 1E77A 3LQFA 4R1LA 2QYHA 3R3YA 1ZVKA 5DHTA 3LY7A 5JMOA 2GB4A 3HUFA 4HGPA 2DQYA 3Q6NA 1NVAA 2CFIA 1XJ0A 2HMTA 1NZJA 3EEIA 5MFZA 3O1LA 4FKBA 3SDSA 1QHNA 3RVJA 3FBWA 4V38A 3A2LA 1NGSA 1IHUA 1Z13A 3KYBA 5JCOC 4D8VA 5C1OA 3VSBA 2P68A 3AFMA 2AV6A 2PWZA 3OX2A 5A5FA 1IB0A 4QG3A 3OZTA 2QMZA 2RHWA 3QFRA 4MI1A 4R1TA 1QO9A 2FXVA 4MQEB 1J7JA 3L7YA 4L02A 4PX9A 3VR1A 1IN6A 1QR2A 3I3OA 4AURA 4B43A 5BURA 3QVSA 1ZW6A 4B47A 5B4UA 3LDAA 1LPPA 2ZBPA 4JJ6A 3M89A 1TLTA 3HVHA 4PZYA 6YASA 2IGTA 4MQEA 1EFDN 3MTGA 5KZMB 1FDVA 1KO5A 2IXBA 5L6MB 3HM9A 1D2AA 1GL7A 3RF6A 1RMQA 2J85A 4TTTS 2D0DA 3TDNA 1JA0A 1L4LA 1PRYA 2ODNA 3F6EX 3N2EA 4U5XA 4W8OA 2JI6A 2Q1WA 1I2MA 4UU0A 5IEBA 5F9FA 2QUAA 1J0XO 1BU8A 3QVUA 4L8FA 1YZLA 4URZR 3FPRA 2HTFA 1AK2A 3EXFA 4KQKA 3UXYA 5IUJC 3OLYA 2W0MA 2GBPA 2QZPA 4P54A 1JAZA 1B42A 2C9YA 3DDZX 2SKCA 1T1JA 3OLWA 2ZRAA 1E60A 4DMGA 3UHOA 2I2WA 3KVYA 3WMRA 4XGQA 5KYUB 2V9CA 1UPFA 3VR2A 3T9AA 3WBJA 1X7HA 2HK7A 3QVXA 1U28A 4KW7A 4F0JA 1BEEA 3AUUA 4NMHA 3M6AA 3FNBA 5ICGA 5F2NA 5DN6A 3VTKA 2VP3A 3NT4A 3VBCA 4QSMA 5REQB 5J2UB 1MN6A 2FZGA 3RSGA 1RAIA 4GBGA 2WHPB 3ZJYA 1H6BA 2HEIA 4U7WA 5EZYB 4C08A 5GGYA 4YS6A 1TO1E 1HMYA 2DT8A 4GMKA 3PI6A 5REQA 3UJAA 2H8GA 1A69A 5J2UA 1PJTA 3ZD7A 2WHPA 3HXLA 1RRFA 5EZYA 1EDZA 1OI3A 2JLRA 2C3PA 4B80A 5EE3A 3GH3A 1GSIA 1ZM4A 1UK9A 2NQ2C 4J8PA 4D92A 4D2IA 2BSXA 4B2LA 2J3EA 3SMQA 1RWWA 4UNQA 3VOTA 5IM4A 3CF0A 4UTXA 2GEUA 1UMDB 1NJ1A 4BVAA 1ADYA 1C81A 1U04A 4FCWA 1K3UB 2YS6A 4EHAA 1NLYA 4K86A 3RD5A 4EGCB 1DAMA 3GGJA 4D4HA 1TEVA 1UMDA 3WMGA 3IIIA 4C89A 4IDOA 2QSUA 5IX8A 2GZHA 4LBVA 4WPGA 1AKYA 5EXPA 3AUYA 3NB0A 2GJ9A 2H63A 5TB5A 1ZWKA 4RELA 1D3AA 1TVMA 3W5VA 5IWAB 1FXUA 1Z3CA 4PWZA 3MTJA 4HRXA 5FHQA 4RYDA 4MVJH 4MRNA 1G6HA 4C4SA 4KCGA 5BNTA 3ROFA 1ZI8A 2NZ8A 2Q3BA 1W5SA 3O1JC 2IH5A 2ID8A 3K31A 5LWQA 1JTFA 3RCBA 3BHNA 4B81A 3EZLA 2AJTA 3JPYA 3GPDG 3ZCQA 1JEYB 2HI0A 1ZGHA 4JC8A 3ZEIA 1VPVA 3C3PA 4MJLA 3VAYA 1CZNA 3FWKA 3MJHA 4QVIA 4OQEA 3W8RA 4XLTA 1CYDA 3AP2A 3UTCA 3EMBA 1TCBA 2JLAA 1ILEA 1FRFS 3CZAA 4M49A 4M9SA 1SVOA 1VBNA 1ADCA 1LPOA 4YUAA 1SBTA 2VJQA 1OOEA 4QGFA 4WA7A 2HWXA 5K51A 1CWUA 3NBFA 4AP5A 4BVBA 2OQ2A 2Q3LA 1A1SA 5EIAA 1QF7A 4KDIA 2GXQA 4MVXA 1OFUX 3GFBA 3LCJA 4TSFA 5EZ5A 3RF7A 4AJ9A 2FUCA 4PZ9A 4D41A 3U7FB 1WLYA 2G08A 3K1YA 1E3QA 3FWYA 4HR7A 4HS9A 3VH2A 3G0OA 1V7PC 1OBCA 1U8YA 1FTWA 3FCAA 4PGGA 4UZEA 3BL8A 3GMIA 4FQ7A 3QYAA 4ATNA 1A9ZA 3HDQA 1EWKA 2W8ZA 3H8SA 3FCSB 2ZSKA 3PQDA 4TKZA 4EL0A 3RWOA 1FB5A 1Z25A 3A9WA 2NOAA 5C3UA 4C7MA 1PJCA 2O52A 3SZ3A 4F3RA 2PUEA 1KQPA 3ZU5A 3IMCA 1MX3A 2LCFA 1YL6A 1LBSA 4CCSA 1FFCA 1YE3A 1YR8A 2VH2A 3H3FA 1ICEA 1OWOA 4C3ZA 5FBQB 4DLSA 5LZ8A 5HVNA 3LC2O 3KJGA 4GOXA 2I3BA 1ZCFA 3CHYA 3FHLA 3QSYA 1VDMA 3B13B 2N1MA 1L8QA 1NMYA 4NZOA 5LQMA 3DE4X 2QKYA 3T5DA 4EHFA 2BFAA 5LYJB 4TKUB 5AXAA 2ZE8A 4BVGA 1TIKA 3AHDA 4JP2A 5FXMA 3RROA 1XQ6A 5I01A 2JCYA 4C6TB 1PQYA 1Q91A 2XUJA 4BRWA 3DEFA 3C41J 5LYJA 2ZDHA 1T35A 1M0SA 4TKUA 4DC1A 2HPHA 4CODB 4I08A 3W1VA 4FN4A 2BV3A 3E3AA 4YMVA 2R65A 4C6TA 4Z0NA 4B2PA 4FR2A 1L4YA 1O8CA 1N5KA 5TEWA 3OTWA 4IM7A 3ZHBA 4MKZA 3FYDA 2JFZA 4MI9A 2QP3A 1W73A 3U26A 3I9V1 3EULA 3C7KA 2XMZA 1W46A 3EWIA 1QHEA 2UZ0A 3IE1A 4WBXC 1KZ1A 2IIBA 3ZV5A 2A92A 4BZQA 1BHJA 4IGEA 3F7TA 1ZH0A 3P9IA 4G1VA 1QVZA 1WU7A 4NFSA 4Y7DA 4YJKA 4LF9B 1VM6A 2V4UA 5D6WA 3BA1A 4I19A 5AJYA 3UB3A 1LGYA 1HDEA 3UAYA 1DAKA 1RI2A 2M32A 3N5KA 3P9RA 1TMYA 1GQQA 3TQCA 4EY3A 4FYVA 5K0ZA 1E18A 3DTYA 3KVVA 3TW4A 2JRLA 1IJBA 1L8OA 1D6MA 3G0IA 3D7SA 4Y1EA 1GNQA 1P8AA 1GYRA 1U7ZA 3FUVA 5BUSA 2GAJA 1LD3A 5KINB 3BFJA 2CJWB 5ELXA 4G63A 4G0XA 3HADA 1CUBA 4OBXA 1EUZA 4PPNA 1TJ3A 2CY0A 4L22A 4RDIA 4AX4A 4C0HA 1M1NB 3TSAA 1EDDA 2CJWA 3JSAA 3I8OA 3PQ3A 4LQ4A 4X90A 4X95A 2E37A 5ETJA 1M83A 2XA1A 4RK1A 3NBAA 2CXTA 2NYVA 3DUFB 1E4VA 2ZJBA 4FMPA 3D4NA 4CCWA 1PNOA 1RQ7A 3OC0A 2PE5A 3P0IA 4K9LA 4C30A 5AUQA 3ZI7A 4IFTA 1U7DA 2RGRA 3L1JA 4FSHA 2X4LA 4JYMA 4V02A 3DUFA 1P73A 2LIPA 2VZ9A 3GBSA 4HUQB 3NG1A 1LPNA 1ULBA 1KI6B 3OZVA 3WL6A 1I2DA 4DSNA 4KAJA 1GCOA 2J8ZA 1X1EA 4K6MA 3KS9A 5AJVB 3OUUA 3D4OA 3UC5A 1F12A 3VAZA 1V5IA 2YIJA 4HUQA 4I50B 3I0MA 4L73A 1LLDA 1SUAA 1W1WA 3CUYA 4L4XA 3ESCA 3SQDA 4MJXA 5IDVA 1U0OC 1H4TA 1RI3A 2I4LA 1ZIYA 2J08A 2O3UA 3QY0A 4I50A 4B17A 1MAHA 3O8LA 4JJIA 1XQYA 4WCDA 1GA4A 1BJRE 1T5IA 1XYVA 2J9GA 1YZVA 3HN2A 3Q2KA 3WFZA 2P4HX 1U5BB 5SZHB 1TUGA 4NHOA 1JQJC 3ZDCA 4X71A 2E55A 3C3XA 2JJMA 3AEQB 3KXDA 2YHIB 1WPQA 4PYOA 4Y2SA 4AY6A 1F06A 1U5BA 2VJPA 1OZHA 2XYGA 3ZHRA 4TTQA 4PHFA 2XBMA 2X6RA 3H4MA 3I6ZA 3WB2A 3AEQA 4YXWD 2V0GA 2YHIA 4XCXA 3A1VA 4XQ0A 1XPOA 4N18A 1E32A 4KX3A 4UEWA 4E3WA 1JDBB 4PHGA 3ZWQA 1T6YA 5EGNA 3HCRA 3M1AA 4X8LA 3HYSA 4S0ZA 4B31A 3CUSA 3MLEA 3HZZA 3B51X 5DLDA 2AS0A 2B61A 3SF8A 1ZCZA 2F00A 5DRTA 2V7XA 3ZWXA 4B44A 5K0TA 2X9LA 3UENA 1BDHA 2JRCA 2MHCA 2WU0A 4FYIA 1U6JA 5K5EA 3IMKA 1IIBA 2VTVA 3RHZA 2WKSA 1SD2A 2A0XA 3OKAA 1VCMA 1VI5A 4CF7A 1A0OA 1HYGA 4QBFA 4F4CA 3L07A 3MJRA 4E5VA 1TE2A 3ADOA 3B9PA 4LYFA 1MZVA 1PQUA 1S3SA 2FU5C 5D7NA 3ZCSA 2PT7A 1DKNA 3IAXA 4D3SA 3QBEA 3AY6A 3W5SA 1U5AA 1O94C 2OBNA 1SCAA 3PNPA 3RSZA 2B1JA 2YIDA 3TN7A 4RDHA 3KQWA 4L9RA 3FVVA 1GNTA 2O2HA 2OB2A 4PO9A 1LK5A 1RJWA 1BIFA 3DEYX 2ADMA 3LHKA 3ZCXA 5G4KB 1HKUA 1TZ2A 1JAXA 1SOVA 1YZTA 1NNSA 4G23A 2Q4TA 4MW0A 2X8BA 3JX9A 1J42A 4W4TA 4X91A 1W34A 3OJ0A 4X5OA 3NR2A 3EVZA 1MVNA 3ZHOA 4D56A 2QQSA 4R3NA 5G4KA 1M2HA 5FNVA 3RTGA 1RAHA 5CFQA 3RU9A 2REXB 2KB0A 4Y67A 4R05A 4JLAA 3FWPA 2WAOA 4MOWA 4J91A 4Z51A 2XGGA 4F8YA 5DDIP 3RIXA 5K8IA 1V9SA 2QSZA 4ZRNA 1CEEA 1XMXA 1JLKA 2PYIA 3AHHA 3QWIA 4RQUA 3WIEA 1QG4A 1W0JA 1CK4A 1P0CA 2X13A 3DQPA 2AHRA 2CSUA 5KWJA 4MGEA 2YVUA 5ES4B 3EASA 3NHJA 4ESOA 4Z1MD 2NTVA 2VWGA 4MITA 4HS4A 4EYEA 3M4YA 3PQ6A 4NZPA 5B4TA 2PVSA 1E61A 1RYDA 1N1EA 1QCSA 1J0AA 4TKLA 4EY4A 4XWWA 3DD1A 1PR2A 5C5EA 2AQHA 4O0LA 4BYGA 4LZJA 4NNPA 2W58A 1ZMRA 1YB6A 1YR3A 2CFRA 1FLDA 3OICA 2PCLA 3X44A 2MM2A 3FYCA 4Y2XA 2H57A 4QA9A 5GZ3A 3PD1A 1V1MB 1DADA 2BGJA 2M6SA 1RJEA 2OUKA 4GOJA 4IJMA 4WXHA 5JLAA 3P9PA 1YUMA 4PGFA 4D5GA 3TPCA 1VYUA 2X86A 2ZR8A 1HV8A 3HBFA 3LL4A 1IWBB 1ZIDA 4MRRA 4NYMR 4PO3X 3S5UA 1M75A 2I6GA 1KHTA 3VDMA 1T1RA 1U5CA 4BO2A 1V1MA 5FR1A 2OC4A 5KMGB 5KNCD 1KO1A 2OXEA 4ZAVA 4ZU3A 3SX4A 3A06A 2HX1A 2G9NA 1Y3CE 3NCHA 1UAYA 3PITA 2QN3A 2ZYVX 4BGUA 3H75A 5E3JA 2WSIA 3VU9B 2H0AA 2HDNB 3CR3C 4YDSA 2C97A 3E9YA 4H4EA 4O1HA 4PY2A 3WMWA 3ZWMA 4GKKB 1KRXA 3W6OA 3FD8A 3VR6A 3RIEA 4F4DA 3RKSA 1THGA 2SKEA 1OX4B 1N6NA 4K7JA 1C5KA 4KQ2A 5F2EA 4CU2A 3VU9A 1DTWB 5ABPA 3R09A 2Y9PB 2R1VB 3JQQA 5KHAA 4ILKA 1I01A 3H4TA 1OX4A 3NM5A 4PLTA 5IW8A 1FYXA 4QULA 3TK1A 4AT1A 2CXQA 4KDEA 4RE6A 2X0JA 1DTWA 4PVCA 5EJ5A 3QHPA 3NATA 3ZLBA 2R1VA 1QRSA 3RC3A 2F67A 2A9PA 1UDCA 1QIKA 4ZMBA 4RVDA 1SVWA 1R0ZA 2VSNA 1B76A 3SZMA 1JE0A 1QRTA 3UOWA 3UKOA 1QQBA 1P91A 1RM0A 3AM1A 5C52B 1U94A 1Y6QA 1UXKA 4G1UC 4HN4B 5I47A 3UW3A 1ZWLA 4P4UA 1ZINA 1FSFA 2IP4A 3QXGA 1LPSA 3WL7A 1TK2A 5IRCD 3NXKA 2WC1A 2NUTA 5C1PA 3B89A 4IMRA 2PQMA 1XZGA 2QTAA 1DB3A 3NDJA 2YDXA 4TUYB 4AJ4A 3Q0EA 5FJJA 4KZPA 4Y2TA 1I7DA 3AEUA 3C5HA 3OPQA 3KQTA 1GDTA 1GYQA 3KKPA 1L4EA 1NTOA 4GKBA 3TX2A 1LC0A 1Z4LA 4QNMA 1HE4A 1R5NA 4QDTA 1RPTA 3ISTA 4TUYA 4UJ5A 5CH8A 5C34B 4BO9A 3K1ZA 3IPXA 4EX6A 3HXQA 3MHTA 1VJ0A 1RBMA 1ZXXA 3AM4A 3B3GA 4V03A 4UTNA 4IIUA 2C61A 2O3SA 1Z15A 4TVSA 2GDZA 2QR3A 5HG0A 4BTEA 3S27A 4OYRA 4U0KA 4NZYA 1M3SA 3WWCA 5JDCC 1G41A 4D82A 1P62B 1PWXA 4J76A 3W7AA 1O58A 4HKTA 5IDYA 3QUSA 4WASA 3LLUA 4J7XA 5HCIA 2FQYA 2AX4A 2KM1A 1JR6A 4BAUA 4M8KA 2B34A 1PNRA 1LF0A 5JVDB 1B1AA 2BGLA 5BSVA 3WRWA 4CQLA 4MYDA 4BAGA 2Z1NA 3GJTA 3K0FB 4XQGA 1J2RA 2HBZA 1N0HA 3AONB 4JBIA 1KMQA 4HLNA 5HOEA 1GYPA 1GM5A 1RQPA 5AM0A 5J40A 1IB6A 1OCEA 1S4QA 1UK8A 4MQ5A 3OCVA 3SPXA 4F4HA 4X65B 3K0FA 4FHCA 1FUIA 3OPVA 1K7CA 4UVGA 3UK1A 1EUCB 3ESDA 2K6GA 4IHAA 4PZAA 1BYUA 5JYBA 4CR7A 5HUHA 3ACCA 3D3WB 1NT2A 1XKXA 1T3HA 2IV7A 4BN4A 3S70A 2CNBA 5EKUA 1EP3B 1R8QA 3KEGA 4G56A 1SCIA 2QTLA 1NPYA 5I9MA 1L5ZA 5E3IA 1W6RA 3QJ5A 3ZY4A 4AAYA 3A70A 4Y3UA 1K4YA 2G63A 3COPA 2RGXA 4GMHA 4Y0AA 4HEJA 4LJ4A 3NASA 3QA3E 5D5HA 3VZPA 4Z9BA 5L51A 1YIDA 3KPJA 2Q2NA 2VP4A 4QPDA 4GYWA 3LBHA 4FZJA 4CDRA 4D9KA 4KQEA 1AG9A 1CP2A 2BZSA 3BN3A 2D0PB 5C8XA 4KH1A 5IYZA 2QHXA 3I62A 1EGMB 1Z5NA 2QN8A 3D4PA 3KFVA 1GZ6A 5DGHA 1OJLA 1XTRA 3HDHA 5KEIA 1TGVA 3VMFA 1F2TB 2C99A 4TS4A 1X8LA 2FPWA 5EIBC 5DSXA 5F23A 4WZZA 3HNRA 1XRQA 5C8VA 5TMPA 1NI4B 5IDXA 4ARZB 1V95A 5EE5B 3B8EA 3NDIA 4C7OA 4IZHA 3V1KA 1MXHA 5LUAA 2IDMA 3M6XA 4LTNA 3EDOA 4CKWB 3GT4A 3Q5DA 2P8JA 4WGGA 2NXNA 1EVLA 1NI4A 3UNXA 4C1NA 1L4UA 4GSLA 4E2ZA 5JBQA 1MRNA 3H9QA 3HEBA 2OSVA 3O4HA 3QX3A 3BXEA 4X92A 1YR6A 4CKWA 4KYVA 1VHLA 3G5LA 4QIHA 5KNBH 4RPIA 3WYDA 1WZ2A 1Y3DE 4NJEB 1R9MA 1RHQA 3L18A 3AQ4A 3KFXA 3DT6A 3MJVA 4HI0E 4MW2A 5JMPA 4LMRA 1KSGA 5A0VA 1HF3A 1QONA 2PKCA 3I45A 1EINA 4QPZA 1E20A 4KK4A 2HWKA 2XUFA 4DJTA 5TF0A 1E9AA 4TKVB 2HLPA 2I6XA 2JK1A 2Q1YA 3NHFA 4QOEA 3W3ZB 5EIOA 4OQZA 1CHDA 3LBAA 4HQRA 1JZQA 3PI7A 4WK4B 3OE4A 4BASA 1OI2A 4CKZA 1NKSA 1ADGA 3SHVA 4RVGA 1RIFA 3EDCA 1AUQA 1E6EA 1G291 3DF9A 4S1VA 3WLIA 2H16A 4G07A 4CLXA 3MSCA 4DA7A 1RQGA 4JJGA 4H7EA 4LJAA 1RXUA 4R1NA 4EUEA 2ODTX 5BV0A 5ERYA 3AMVA 3WE7A 3WLTA 2ZB8A 5JZSA 3GUVA 1RXEA 3TM5A 1L8AA 4BBAA 1OBHA 2QRUA 4ERNA 3L8YA 3RHFA 4M9UA 1F4VA 4ES6A 2GK3A 3AILA 3AG5A 5EXTA 3CR8A 2ID7A 2Q46A 3DTNA 5FO1A 2A9RA 4DCGA 4L0QA 4DMMA 4ZI7A 5A9SB 1SZCA 4AKHA 1EUQA 2GFIA 5FOSA 4CM9D 3JD1A 3SZLA 4KX5A 2PA3A 1P17A 1S02A 5CA0F 1Y3FE 1ZNQO 3QVOA 4KYTA 4EARA 5C4IA 1D1PA 1T2EA 5A9SA 3U9SA 1YQGA 4MEJA 1Z3IX 1JDJA 2GTHA 2ZTSA 3CX6A 3M9WA 3OWHA 3L06A 1C1YA 4UNSA 4MI6A 5JLJA 3KQSA 3D54D 2DT5A 1OPXA 2WUDA 1EAYA 1XUOA 1JYEA 4P0QB 2O5RA 2HWUA 1IU9A 2VZ8A 3M6MD 3ZKWA 5BXYA 3SI7A 1SRRA 1CFZA 4BU0A 2MT9A 2H1LA 2OC9A 5E9AA 1HI9A 3TINA 3TRIA 2AZXA 2TRSB 1NUPA 3FAKA 1CY6A 1A2BA 2PJHB 3CH6A 4XWTA 3VNRA 2MR5A 2ORVA 5IVPA 3GJ0A 2OGTA 4RF2A 2IXGA 2ZW9A 3AZOA 4BATA 2ZB3A 4V3CA 2VJCA 3U4IA 3DE7X 2EF1A 3HDYA 3L1KA 4Y2YA 3TTVA 3ZQUA 2Z2KA 7MDHA 4BIMA 3DOUA 3G2LA 4QU9A 3JAKB 2NV2B 4F5YA 2AHOA 4MHSA 1KY2A 5F9MA 2ORIA 4OHPA 1VL6A 2PIDA 2KBFA 1AT1A 1VSVA 2AYZA 2ZAGA 4L85A 5LUBA 4GF5A 3WGYA 3JAKA 4DXHA 5HGXA 1U7OA 3RAGA 4MUKA 1E2JA 1T26A 1D7AA 1QIFA 1LSUA 4IJ6A 4K6GA 5I7EA 1WLFA 1V2HE 3DG9A 2XVMA 4MPPA 1QKIA 4MUXA 2OO5A 2XR1A 4O4HF 1RWMA 4PSVA 4EHDA 1T2UA 1M0TA 4V2IA 4UOZA 3PYMA 4OP3A 5DHSA 3RS8A 1NVBA 3ZXUB 5JEDA 3EXIA 2R00C 4MPRA 1ABBA 3T4XA 1NXSA 1EE9A 5K0NA 2FMUA 4TQAA 4DNQA 3SC2B 1J8YF 4R8LA 2JJYA 4G0MA 2FWNA 1OH7A 3L79A 1OTXA 3HBJA 1UPXA 3KQYA 4RZ3A 3SC2A 4GP9A 3A3KA 5BV2P 3D59A 1WOYA 3L6OO 3DBOB 1VIYA 1PCXA 3WFJA 4L75A 3AJEA 4N9QA 4LQCA 1OXMA 2EV9A 5DLPA 2FA9A 4RHEA 3NVAA 1LDEA 3UAOA 4AW9A 4AP9A 1L1EA 3L1HA 1XG5A 2J41A 3EQ2A 1ZC1A 2JJ2D 2K87A 4IGAA 4KI7A 3WGJA 4JLDA 3EQ9A 1CS4C 2HSGA 2P77A 2P9HA 3FPBA 4JITA 3WL5A 5F3RA 1DQZA 2P65A 4J07A 4OXQA 4WFKA 2ZLBA 1QWOA 1RJFA 3LT5A 3U7RA 3DOJA 2JI7A 3N1UA 4FW8A 5CTJA 5H4GA 2WJHA 1O3YA 5LP6B 5K05A 3THOA 2V9PA 1SCKA 3M0EA 2JV2A 5JH7B 2O7SA 2IH2A 1Y1KE 5JD4A 4JYAB 2NX2A 5DWVA 1WABA 4NBUA 1ZJ6A 1JHDA 4O4JA 5LP6A 2GHTA 1QIEA 4ZODA 4QJIA 2C58A 2D1YA 1ST3A 1CF2O 2PU7A 3TKYA 4KDFA 1K27A 4FFBA 4D57A 4Z3OA 4F9EA 2GZ2A 5JH7A 3T35A 5AVQA 4YRCA 4CL0A 3GR6A 3GWGA 4Q47A 2A7XA 4WQMA 2P67A 3ONFA 3FZQA 1RYFA 3D7RA 2DULA 1J9ZA 1QAQA 2J3DA 2PUTA 5TT0A 3AETA 1CETA 4L8VA 3OFSA 4Q3AA 2HR1A 4LPSA 5E9WA 1KYWA 3D2AA 3GZ4A 3PD7A 4FLEA 4C2BA 1E98A 3BWVA 1QORA 1W75A 1A71A 3QKTA 3F4BA 1FNSA 1KZ4A 4GX2A 4MO9A 4W6ZA 4N41A 3EMDA 4Z9YA 1EDEA 1U1FA 2QZ9A 5IVIA 5JSKA 1DZ3A 5LPNA 4ME6A 2X22A 3B85A 2GN8A 3OHMA 1FLNA 3PF9A 4XUGB 2D00A 4EHIA 3K0KA 3A4NA 1UOOA 3PPVA 1OT5A 3ILYA 2AMVA 4P53A 1DCKA 2QNRA 3Q40A 4ZOAA 4A15A 1X74A 4LSMA 5C3MA 3QMPA 3NTLA 1F2UB 5EJ8A 2WWTA 1M2JA 1D2HA 2HQRA 4H1TA 2Y6UA 1U2RA 1XQ9A 3O84A 2IOQA 4MWOA 1IHPA 2OMEA 1F2UA 1P5JA 4JL6A 4LE1A 2ZRQA 4JQOA 5EMKA 3U7IA 4EUHA 3CVWA 5J2UF 3QNMA 3ESAA 1TIPA 4WLEA 4B6GA 1V41E 4OJMX 2V98A 2CLLB 4N7MA 4DREA 1I51A 4YT8A 4OHCA 4PYJA 3KTAB 1HKHA 4YROA 1DRKA 2C83A 2VCYA 3TG8A 1RRVA 2VF8A 4QOGA 3KQOA 1HT0A 1QO0A 3OMLA 4HDNB 4PO8A 1EXVA 2ET6A 5IM4F 4CJXA 1S2MA 2ST1A 2FX2A 1ZN7A 1KBOA 2X58A 3KTAA 3VVMA 3IXQA 1O6BA 3A10A 4DPLA 3KTDA 2GHQA 2YMLA 1JG2A 1ZEJA 2Q5QA 4N5DA 2BRUA 1K2WA 2MMGA 1Z4JA 4XW2A 3D8SA 5JDIA 4YRLA 2HKIA 2RJNA 1PZNA 3DLTA 3T3EA 1YVPA 1RMYA 1AQNA 2IZ6A 2NUAB 1L3BA 3R5KA 1MX9A 2WK1A 4OGFA 3OI7A 4B4VA 2F3TA 3QUAA 4YY3B 1KQNA 5BO5A 2JHPA 4KL8S 1NYQA