5CCXA

Structure of the product complex of trna m1a58 methyltransferase with trna3lys as substrate
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
289
structure length
283
Chain Sequence
b'MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit
publication title Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
total genus 73
structure length 283
sequence length 289
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5ccxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ccxA02
3O4FA 4OX9Y 4G56A 1QAMA 5CVVA 4XUDA 5ICGA 4RVHA 3RIEA 5EEGA 1NT2A 4HGYA 3G2MA 3UJ6A 4AX8A 3FUWA 7MHTA 1FJXA 1O9GA 1X1AA 3V97A 4C08A 4QPNA 3KQSA 5E8RA 4QDJA 2PVCA 2EFJA 2P40A 2P41A 3GIWA 2Z6QA 1P39A 1D2CA 5E1DA 2QY6A 3GRUA 3PT9A 3FRHA 2NNWB 1P1CA 3DXZA 3QOWA 4GOLD 1N2XA 4U7TB 3BWMA 5F2KA 4E31A 4U7PB 2QM3A 3A25A 3OU6A 4MQ4A 5GM2A 3ELUA 5EKUA 3AWIA 3GRYA 5D1NA 2JHCA 3UBTA 5LQAA 2AZTA 2ZBPA 1JG1A 3C0KA 3BWCA 3KQOA 1HMYA 1WS6A 4OA8A 5DXJA 2O57A 4BLUA 2PGXA 5T6BA 5BXYA 4HC4A 3TPZA 2B9EA 2ESRA 3A27A 3I64A 1OR8A 5ICFA 4AZWA 4B17A 3R6TA 2EG5A 2FCAA 3P2EA 3P8ZA 4HRAA 2GLUA 3PFHA 4A6EA 3A7EA 3AXSA 3HM2A 5ICCA 1EAMA 1IM8A 1VP9A 2ZW9A 5GP1A 3GJYA 5B1SA 3RODA 2ADMA 1NW6A 1JSXA 3KQWA 3JWIA 4ER6A 1TPYA 1KIAA 1XVAA 4HG2A 4IWNA 4RX1A 3TMAA 5BW4A 5HIIA 3C3YA 3EVGA 1IXKA 3E05A 1P91A 4C04A 1Z3CA 4E70A 2V7EA 4POOA 2PV0A 4CKEA 1I1NA 2H1RA 4RSRA 5LQJA 2DPMA 2PWPA 3UZUA 3MB5A 1WY7A 1B42A 3E7PA 2AR0A 2CL5A 3OE5A 4AZTA 5KQRA 4XCXA 2R3SA 3AY0A 2UYCA 4F85A 1VPTA 5BW5A 5K0EA 4PYIA 3LDUA 3SVZA 2XVAA 3S68A 3FTFA 5HOQA 5GIPE 3FYCA 4PONA 4ER0A 5LQUA 3I53A 4M38A 5KS2A 3GXOA 1JQ3A 3MCZA 3LBFA 5JUWA 3I58A 3GRRA 5DM4A 2PX5A 1NV8A 3LBYA 1VE3A 1QZZA 3B89A 2HWKA 4FP9A 2IPXA 2OB1A 1RI4A 4P7KA 3Q87B 5E9WA 4EQZA 2ZIGA 3G88A 3HP7A 2ZIFA 3M6XA 2G1PA 2IP2A 5GM1A 1JQDA 4GEKA 5FA8A 2UYHA 2ZZNA 3LSTA 5FTWA 5C1IA 3TR6A 5IH3A 3T7SA 2IGTA 2YVLA 3HVJA 3EEOA 1XDZA 3TOSA 5CM2Z 3VC1A 4E2XA 4M36A 4CWAA 3UJ8A 4PNEA 5K03A 3ER9A 3GU3A 3DMGA 3R9XB 2WA2A 1BC5A 1QYRA 1EJ0A 2ZBQA 3MGGA 2A14A 3R0QA 5EVJA 2C7PA 2JJQA 3KQMA 1JG3A 2ONZA 3EVBA 3BT7A 4QTUB 1JG4A 3EMBA 2OY0A 3EEYA 1KXZA 3EMDA 4NECA 4FSXA 5DSXA 5E1BA 2Y1XA 1DL5A 2FRXA 3DMFA 3EGEA 4GF5A 5DT2A 2FPOA 2ZULA 3SR4A 5E2BA 4YUVA 3NWEA 1L1EA 2CMGA 5DPMA 4PYMA 4WVLA 5KQSA 2ZVJA 3UJ7A 1XDSA 3BWYA 2PSSA 3P9IA 2EX4A 4IV0A 5EQJB 1VQ1A 4PYLA 5FWAA 5HIMA 4RV9A 2OYRA 3FPJA 3G89A 2G72A 3PX3A 2ZWVA 2GA9A 3LHDA 3TQSA 2P1DA 3DLCA 3EGVA 1KPGA 3PB3A 2PJDA 3G2QA 1R00A 4R6XA 1N7IA 1M6EX 3VYWA 4E2ZA 2AVNA 4YMGA 2PXXA 3UJ9A 4EKIA 2FHPA 4KDRA 4BY9E 4L7VA 5FHQA 5K0LA 2IH2A 4RVDA 3BWBA 5FUBA 1VP3A 2YUIA 5CD1A 5CIYA 1VBFA 1NW7A 2PX8A 3KPUA 4RTMA 1L9KA 1DUSA 5MHTA 1AQIA 4KIGA 1U2ZA 4FGZA 4RWZA 2P3QA 1O9HA 4V0RA 3DOUA 3FTEA 2ZFUA 3GNLA 3Q7EA 4V0QA 2PXAA 5DX1A 4E33A 2O06A 4E2WA 3ERCA 2F8LA 5GWXA 4XUCA 2AOUB 3EVZA 2AOTB 2WA1A 1FPQA 3SXJA 4YUXA 1IY9A 2PBFA 2ZCJA 1NBHA 4LECA 5LQCA 4EMSA 1RI5A 1KYZA 2B25A 5FULA 3CCFA 4AUKA 3KR2A 3AJDA 3FPGA 3UWPA 3NWBA 1HNNA 1L3BA 1NV9A 5E2AA 4YV2A 5K05A 1Q0TA 3DXYA 1PJZA 3CBGA 2OXTA 1R6AA 2EJUA 1YZ3A 4C06A 2NXJA 2JG3A 2LD4A 2WK1A 1ZG3A 3M6WA 3BZBA 3UA4A 1NKVA 3CKKA 2ZWAA 2YTZA 4JXJA 3HVHA 1VIDA 4PYNA 3NTVA 4A6DA 2CWWA 3GO4A 3LDFA 2Q41A 4P7GA 5K0JA 2NP7A 5E1OA 1X19A 2XYQA 3C3PA 3O7WA 5EG5A 4X41A 3I9FA 4R05A 4YMHA 4YUWA 3NVKI 2BR3A 4LWOA 3T7RA 1F3LA 1FP1D 2P7IA 5EC8A 3DLIA 4X60A 2C7OA 5HIJA 5BP7A 3NW9A 3WSTA 4CKBA 3UA3A 1WXWA 4HTFB 4IKPA 1RI1A 5F2NA 3KR9A 3LPMA 2XYRA 1YUBA 5CVDA 2UYOA 3KQQA 3TM4A 4CTKA 4X61A 4IV8A 2QRVB 3B3JA 3FUTA 1X1BA 5EMKA 3BUSA 1KR5A 4HH4A 4HSGA 4PINA 4BP3A 4F86A 2GB4A 3CJTA 2AOUA 1RJDA 3FUVA 2ZIEA 2AOTA 1QANA 2V74B 1AQJA 4KRGA 4Z2YA 4WXHA 2IDKA 2VDVE 4ER7A 5KVAA 5DRTA 2PX4A 3FUUA 2AN5A 1JSZA 3A7DA 3BGDA 2NYUA 3KQYA 8MHTA 3BXOA 3BGVA 3ELDA 2YXEA 3O31A 1NBIA 5DLYA 2JHAA 3OU7A 4AZVA 4OA5A 2XYVA 2XBMA 4KWCA 2BH2A 1UFKA 5K0BA 5CVEA 4EK9A 4CXMA 1M6YA 3KQVA 1R8YA 2PT9A 2OPBA 4HGZA 4CTJA 3SSMA 2YX1A 4OQEA 2BZGA 4GBED 4R8SA 2B3TA 4RYLA 2KW5A 4OQDA 4DF3A 3P2KA 5IKMA 2OBFA 4QPPA 4KVZA 3G5TA 3DR5A 1SQGA 5DSTA 3KKZA 2OB2A 3G2OA 5EMMA 4FSDA 3HA3A 2I6GA 2ORED 5C0OE 3VC2A 3AXTA 5HZMA 5LQNA 2C7QA 3KPJA 4H0NA 4RVFA 1RJGA 3LX6A 5KYGA 3PTAA 2PX2A 1YFJA 4LWPA 5ERGB 5D1HA 3UFBA 1ZGAA 3ME5A 3P97A 3LCCA 1YB2A 1YZHA 4KW7A 1EQAA 3DTNA 2YXLA 1AV6A 1XXLA 3OZSA 3P9CA 2I7CA 3OCJA 4MHTA 3NVMB 3TKYA 3BKWA 3FYDA 3FPEA 3PVCA 2G71A 3BGIA 2HV9A 3C6MA 5U4XA 2E5WA 3GRVA 2BR4A 3G8BA 1JR4A 3P71T 5HILA 3HTXA 5E1MA 3E23A 4E32A 4PYJA 2GS9A 3JWHA 3NDIA 4FT2A 3EGIA 2NXEA 4GOMD 3MTEA 3VSEA 1FBNA 2FYTA 4GC9A 3M6UA 2HR1A 2GPYA 2OKCA 3P9KA 3PFGA 4FZVA 1DCTA 4DMGA 3CGGA 5EMJA 3UJBA 1G8AA 5EMLA 3BKXA 3GGDA 3IV6A 4P7JA 5FQNA 3OZRA 4FT4A 2ZZKA 4QVGA 2IBTA 5DTMA 1I4WA 3SMQA 3UJDA 4BLVA 2IFTA 10MHA 4MIKA 2IBSA 2HMYB 2NP6A 3L8DA 4X63A 3R3HA 5K0GA 3LGAA 5DX0A 5H02A 5EHGA 2NXCA 1EIZA 5EHIA 4QVKA 5FQOA 4RTNA 4RTLA 3EVEA 5K0NA 2YXDA 4RTJA 5EGSA 4RVGA 1EJ6A 3B5IA 4R6WA 2GAFA 2PT6A 3MCTA 4GQBA 5EZSA 9MHTA 1BOOA 3SGLA 1SUSA 2OO3A 3OPNA 3TFWA 1PRYA 2XVMA 5P8WA 4OBXA 1ZGJA 1L3CA 1X1CA 3M33A 5E9QA 4P7FA 3KPVA 2P35A 4DCGA 2QYOA 5F2OA 2AOXA 2H11A 2PXCA 1RJFA 4OBWA 1SG9A 2UYQA 3G2PA 3FTCA 3OU2A 1G60A 2CKDA 4R8RA 2C7RA 2AVDA 5EEHA 4PGGA 5DM2A 1VL5A 5DWQA 4DKJA 2ZSUA 2B78A 3TLJA 4GOOD 4MTLA 3V8VA 1R8XA 2YR0A 3IEIA 1NW8A 4ATNA 2BM8A 4XUEA 3KHKA 3PLAE 4M37A 2JH9A 2HTEA 3HCAA 4GOND 5FA5A 3T0IA 3CC8A 4MWZA 3EVCA 5JR3A 1EG2A 3X0DA 3KR0A 2QE6A 3LCVB 4GC5A 5CUQA 1O54A 1QAOA 3GCZA 5LR6A 4E30A 2JHPA 5E9JA 1X1DA 3HCFA 1TW3A 2O0LA 3MQ2A 3GRZA 4PGHA 5LQKA 3ELYA 3KPWA 5EKXA 1I9GA 2ZZMA 1G38A 5DTQA 4K6MA 1RJEA 4RTRA 2PY6A 2AN3A 4KIFA 4YV0A 1KPIA 5LQRA 2AN4A 2VDWA 5CVUA 3UJCA 5LSAA 2Z6AA 3ELWA 2GH1A 3ER8A 3A26A 1XJ5A 2PKWA 3E8SA 3G8AA 5M5BA 3HNRA 1G6Q1 3HCEA 3OZTA 3HA7A 1Y8CA 3NJRA 4BLWA 5K09A 5K0FA 2Z6UA 4DZRA 5DM1A 1MJFA 1NW5A 4ER3A 2UZ4A 2VS1A 1ZKDA 3NDJA 4F84A 5K01A 5DX8A 5DM0A 4DQ0A 3UJAA 2ONYA 3FTDA 2FK8A 4M7RA 4AZSA 1M0EA 3CJRA 5HIKA 1L3IA 1FP2A 4P58A 3RW9A 1JTEA 3A4TA 4DCMA 2O05A 4EVIA 5CVJA 1H1DA 3KU1A 5G02A 3TRKA 5DTRA 2VZ9A 3LL7A 2IIPA 4PCLA 4QQKA 3DP7A 4E2YA 4PIPA 5CCXA 3SSOA 1KP9A 3FPFA 2I62A 1XDUA 3MTIA 3I5UA 4YUZA 2EJTA 3FPHA 3GDHA 1Q0SA 1G8SA 5E8JA 3EVFA 3EVAA 5FHRA 4DA4A 3KR1A 3ORHA 2HNKA 2G70A 2AS0A 2O07A 3DUWA 1D2GA 2IDJA 1MHTA 1G55A 3DMHA 3TM5A 1NW3A 4ISCA 3KQPA 3OFKA 1UWVA 2CMHA 3M6VA 5EPEA 3JWGA 3PS9A 3EVDA 4X1OA 1P1BA 3B3FA 3SSNA 4PYQA 4BP1A 4RTOA 5DXAA 5EOVA 4EKGA 4C07A 3FUXA 5GOZA 4FR0A 3ID6C 1RI3A 3F4KA 2FK7A 2ZLBA 3ANXA 3GWZA 3IYLW 4C03A 2P8JA 1YFLA 4PWYA 3B3GA 3MHTA 3NMUF 3OFJA 1KHHA 5K8VA 2BR5A 3THSA 3LECA 4CKCA 4RTPA 5T64A 2I9KA 4ER5A 3MAGA 2VP3A 4HTFA 3U81A 4C4AA 1JQEA 3THRA 1ORIA 3QV2A 1F38A 4Y2HA 5FCDA 2QRVA 3HCCA 1SKMA 2AOWA 5C9ZA 1R18A 1TW2A 3JWJA 3LKZA 4PCAA 5EZQA 3SX0A 3LKDA 5HEKA 1VLMA 1ZHFA 1D2HA 3C6KA 4QTTB 4YUYA 5ICEA 5DRYA 1BKYA 2IH5A 4UOEA 1R74A 1WG8A 1ZQ9A 3K6RA 4QQNA 4QDKA 5EIWA 5HFJA 3R24A 1JG2A 1T43A 2BM9A 3HCDA 3P2IA 3P9NA 3SM3A 2P3LA 4RTSA 3HVIA 3KQTA 1SVUA 2ERCA 1SUIA 4Y30A 3M4XA 4RTKA 1QAQA 1NE2A 5FWDA 3MERA 3KPYA 3FRIA 1INLA 3DULA 3D2LA 4GUAA 1N7JA 3PX2A 3K0BA 2B2CA 2DULA 2IH4A 3M70A 1WXXA 1WZNA 3LCUA 2AOVA 3LDGA 4DM3A 2R6ZA 2ZTHA 3G7UA 3HEMA 4KDCA 4PYKA 3H2BA 5T67A 1KYWA 4PIMA 1XCLA 3CJQA 2PWYA 4C05A 1XTPA 3IHTA 1JTFA 5GINE 2JH8A 2H00A 5K0CA 1XCJA 1RI2A 5CCBA 2PLWA 3EPPA 3G5LA 3QOXA 4ZTBA 3B7PA 4YV1A 1ORHA 2Y1WA 2N47A 2YQZA 3REOA 1KPHA 1UIRA 4FS8A 3FZGA 2G8NA 5FADA 1AF7A 3TKAA 2OZVA 4O29A 1V39A 3HCBA 3DXXA 2P7HA 3OE4A 3CVOA 5GIOE 1BHJA 4PYOA 2ZBRA 2VDUE 1SQFA 2NXNA 3T7TA 3DH0A 3HVKA 2P3OA 3HA5A 1YF3A 5EIFA 4RTQA 2K4MA 4LG1A
chains in the Genus database with same CATH superfamily
1UOQA 4HZUA 3ZU6A 1JXMA 3ZQJA 5E7MA 4LC1A 2J3HA 2QV0A 3O0DA 5FA6A 2RHHA 4GPZA 7MHTA 3PQEA 1X1AA 1K3UB 3RU2A 2P9ZA 4F4CA 2P41A 3DDSA 5LDGA 5K4AA 3O2SB 3ZD6A 2FGJA 4E51A 2YRFA 3Q10A 1SOMA 1TU4A 5CX1A 4F3CA 2VHQA 2YICA 1NTOA 3KSZO 1NI3A 1KE1A 1WD5A 2SHKA 3H5IA 2CVPA 3UFXA 4D4IA 3EZ6A 3LE8A 3VKUA 3NMUF 4YRSA 3BORA 3CR7A 5BSHA 5J4HA 1QDNA 2OV3A 3IXLA 4OOFA 4URWR 2O7NA 1I9CA 2H07A 2A88A 1BW9A 4H17A 2Q45A 2VTDA 4OXYA 1FTNA 2VP0A 4LRUA 1MQ8B 9LDTA 2ZSHA 5JU6A 2HWWA 4FGSA 4ZHQF 1KEWA 3K4PA 2BKVA 1N3LA 3H99A 1R3DA 2FCAA 1BKDR 1Y5RA 2AFVA 2RMKA 3AUUA 1E63A 4ZO9A 2V6FA 3NNSA 2OXRA 4JGGA 4KR2A 1X7XA 1NI4B 1LC3A 3AXSA 2EAUA 3HN7A 1E7RA 4E22A 1OXUA 1ORWA 5GP1A 2QQSA 1JMKC 1OX6A 1XZDA 5JSQA 9LDBA 1JUDA 5I4BA 1GA6A 1QVWA 1N25A 3DBLA 4B9EA 5JC8A 1MAHA 5BUZA 5IK2D 3C3YA 3EVGA 2GBIA 3ZD8A 2IYQA 3PQ4A 5JQGF 4QWWA 1QHFA 1FXUA 5F7ZA 5ITZA 4UE2A 3DFMA 3B9QA 16PKA 3DFKA 4CMIA 4S1TA 5KPJA 1K27A 1PK9A 1PT5A 2DPMA 5TT1A 4XYEA 2PSFA 4D26A 6AT1A 5ERXA 4B7XA 1DIAA 1VIYA 2GZAA 3DV9A 3OTHA 4P3KA 4ENQA 1HSOA 1W4LA 3ZK9A 3GFSA 4B6RA 3TEJA 2AR0A 2HCFA 2DKOA 3JD0A 3SDBA 2IU0A 1XZIA 3RAEC 3P0EA 2VZ0A 3LOUA 1F48A 3EK2A 3EQZA 3GXBA 1LPMA 4CQNA 3FTPA 1T34A 1MG5A 3LC0A 1CSEE 4I3GA 2W8ZA 4ME6A 4RIIA 2KS6A 5IASA 2P2YA 5K8IA 1RYNA 4HXGA 4OIMA 3GRRA 4YCAA 3OZUA 2ZTMA 2DG2A 2VN8A 3LBYA 1UAGA 3RVBA 3U0VA 4YX9A 4HN4B 4FGUA 4Q3OA 3VDQA 2LGJA 4MVJA 1BXKA 2GJ8A 3CZCA 3NIGB 2MINB 4M1YA 1KDVA 4G1VA 5F1YA 4WA7A 5BSEA 3ZJ5A 3I2JA 3Q87B 4UUQA 3ZQUA 4KE9A 1Z75A 3N2ZB 2ZM6B 3PXUA 4MV7A 4BN5A 5FWXB 3QEBZ 1A0OA 1U1IA 2FRDC 4QEZA 1GU1A 2YNMD 3D0QA 1CZHA 4ZVLA 4ZZ3A 1M2OA 4M6WA 3I8XA 5DHRA 2Y76A 1Y8AA 5K03A 1JKFA 4YGXB 1YIDA 1JEEA 3DMGA 5H68A 2C3YA 2OXCA 4ZZ2A 5K7SA 4XH9B 1OYOA 4KQGA 1BC5A 2XKBA 2BGJA 4RD0A 3STHA 1QK5A 1LPSA 3RSGA 3UENA 3U6BA 1JEYA 1W5EA 4J1TA 4UD2A 4BXOA 2YY6A 2IDMA 4EFLA 3LBAA 4NECA 2VXCA 3JZFA 2NPFA 4I50B 5I7VA 3N0RA 4R1PA 1MJGM 1TVCA 1T3TA 1YV9A 2WZQA 4ZEVA 4FMPA 2IK8A 3R8CA 1VMAA 2W37A 4MW9A 4S35A 4HEA6 3V1YA 4BLRA 2VK4A 3VR6H 1XDSA 2IHYA 1EGQA 3KKKA 4DYDA 1QNLA 4Z51A 4FM9A 2GCPA 3GMDA 2QTMA 4MV4A 5AK6A 1U0GA 2PMWB 4I1PA 2ZIVB 2OCBA 3TQSA 3UV6A 2QQFA 3KYJB 1XMPA 3KYBA 4OQZA 3ZWVA 1J0CA 2QG9A 4KR3A 1MT3A 2RKWA 3L7CA 5BNWA 1XPOA 2OQVA 4YGYA 1YQTA 4IGKA 1WZUA 3NAMA 4QNMA 2DUJA 3ENNA 3BWBA 2GFIA 4FJ1A 1V3UA 1PWZA 1KU0A 1FU4A 4R7GA 2QJWA 3STUA 1PR2A 5BN5A 4P7BA 2AW3A 2PX8A 4TYYA 3U49A 1L9KA 3RWOA 1I6KA 1LDEA 4CKBB 4KIGA 4RADA 1VG1A 4XOUA 2EDCA 3BD6A 3D1VA 1CUXA 3UN1A 4CU5A 1YTUA 3IKLA 3GOHA 3THOA 4C0JA 3A06A 4O4IB 4TLMB 721PA 2A5JA 2WUWE 3PXEA 3LYLA 1YRYE 4AKSA 4B7UA 1G7TA 2CF6A 4OB6A 2V7QD 5KWVA 1APBA 3EVZA 4HXYA 4DA9A 1VG9B 3PD0A 5EPOA 4M88A 3MOGA 2BFEA 5J59A 2D1RA 2PZBA 3T5GA 3TLCA 4BX3A 4OL0A 4HNQA 5FBRB 5IC6A 3NHJA 1OIXA 3VYVA 3WYCA 3WYDA 2ZXFA 1RRKA 5KQPA 3FFXA 4DJAA 5I7OA 3JY6A 4Q9JA 3NWBA 1NV9A 3RS4A 5EN4A 4TS9A 2O8DA 1F0PA 5DW0A 3L07A 1A1SA 4FYVA 1H23A 4CMKA 1SKQA 4RPKA 4N82A 4UTXA 1ZG3A 5JYBA 2VWGA 3O74A 1HT1E 3WGYA 4X1YA 2QX9A 1KMQA 3SIPA 3K2QA 1YACA 3VISA 1SKAA 4RMNA 5AM4A 2ZYAA 4RS4A 3L7AA 4K8OA 3A4YA 3A3OA 2WSIA 1UK9A 1YL5A 1RBMA 1SWVA 3GQBA 1X9IA 1G7SA 5ER9A 1QIMA 2W2LD 1KEPA 2YYSA 3INYA 4MB0A 1KK1A 1F3LA 2I2FA 2QVXX 1YH3A 2FLVA 3D7NA 3TE7A 4LRYA 4D0RA 4TYMA 5LOVA 2VTVA 4HYTA 4RVSA 4JYZA 4EZEA 4R1SA 4LZPA 2RKOA 3QVGA 1TIPA 4V38A 3U3XA 2H8GA 1RZUA 3ZBQA 3RABA 2LW6A 4X8HA 3CNBA 1NVEA 1EG7A 2P2LA 3P19A 4UHFA 4YBZA 3SLKA 4ND8A 3FX2A 4QARA 3EBOA 5TC4A 1Z6XA 2IHJA 2J5KA 3ZNNA 4HT3B 3ASUA 3EZ2A 1E6LA 1U9JA 1KO7A 1DZ3A 2OC9A 2XTNA 2OQIA 4FFLA 3NIFB 2NSDA 3VOAA 5FX2A 1BKSB 1G59A 3UOWA 3B6IA 3BGDA 1DAPA 2HT6A 1UMDA 4UREA 2YXEA 1NDQA 4Z8YA 2XW6A 1C1YA 2OHVA 3OTIA 4HRXA 2QVCA 2MJLA 4YRKA 1NXXA 2Z9CA 6LDHA 3L6EA 4BMPB 4XLTA 4Y7DA 1LCIA 4UHHA 5L40A 4NZOA 2PGOA 1QBGA 4EZBA 3DZ8A 2D1SA 4OQDA 2WLTA 3WDKA 2CJXA 3U2QA 2PFKA 1A9QA 3TSAA 1DFGA 4G36A 1VIMA 1LH0A 3KKZA 3KYCA 3X2EA 3P0IA 3H2HA 1RAFA 3PA6A 1E62A 4G0XA 5KC9A 4KBFA 4RA9A 3ZWOA 1W52X 5AYVA 3OWOA 4H0NA 2C5EA 3UHPA 2C77A 1XKXA 4QPCA 2IIQA 4W7SA 4ZQCB 4L5BA 5JS8A 4M86A 1L4BA 2BFAA 4TVBA 3ECAA 1N75A 3HPRA 4TVKA 2VNSA 4BC0A 4Y6RA 1MOQA 3BQMB 1PD0A 4JHLA 3F78A 3FWHA 3DLBA 4NR0A 4ZANA 2I8AA 5EL0A 3PC7A 1WMSA 3WLHA 4C4ZA 3BIOA 3KXIA 3UF0A 3UT0A 3M6IA 1OXVA 4I19A 4I5EA 2Z4TA 3WWOA 3ZWMA 5CMLA 2BR4A 3I1YA 1JR4A 3NH6A 4XRGA 2XCIA 4YCMA 1GGKA 4UBIA 1MZPA 3U1TA 2A8YA 1NBMD 4QUJA 4YH1A 5F7JA 1CQXA 1MAWA 1JBKA 2F1RA 3IBCA 2RSLA 3RHFA 3DZDA 2QVZX 2VKTA 4R2IA 1FJ2A 1GAEO 3IJRA 3WI7A 1Q16A 4XIFA 4XB6B 3JYQA 2QDXA 1NMEA 3I6ZA 4QYMA 2C5HA 3IIEA 2ALJA 3OZRA 3TS1A 1DRUA 1DO8A 2LPMA 1GARA 3H2IA 1GDTA 4L4UA 4X63A 1KZYC 2QM8A 1D1PA 2R6FA 2YWCA 4Q6WA 4W6QA 5TQ2B 2C2YA 3EVEA 4IKEA 4RTJA 3EIEA 4LPSA 4X65B 3DYIA 3MBOA 3ZV3A 4XWAA 1FRNA 2PT6A 2YZ7A 4WVFA 2OLJA 3I9V1 2C1ZA 5C37A 1X1CA 2V96A 2HPZA 3REQA 4OSEA 4OBWA 1FMTA 3L82B 3ZEIA 4HN9A 4X7PA 2IE8A 1W94A 1VL5A 2H85A 2JGEA 4DSTA 2NMVA 1P2GA 4TQGA 3R7DA 3HWSA 2X8JA 5AI8A 1OBVA 1W36B 3SC4A 1VE9A 2WFAA 3RC8A 3AVPA 3MCUA 3AQIA 1A5TA 1GKKA 3RU7A 1VPWA 2ADOA 2OBYA 4EBFA 1LLFA 2ZRDA 4IG9A 4ND4A 3FVRA 1Y4AE 4UHEA 3LDHA 3C8HA 2JHPA 4RZ2A 1X1DA 3MQ2A 4PGHA 3U3OA 4DDTA 1KMMA 1ZH6A 1T6YA 2QP3A 2Z08A 3VR6A 3TLAA 4ZA2A 4YRPA 4EI8A 1JI0A 4ZOEA 3KFVA 2YVAA 4RTRA 1V4VA 1ZK4A 2BD0A 3IKVA 2ZWPA 5KTYA 5LQRA 3M34A 4EEKA 5GONF 2AN4A 5CFMA 1IHXA 2A7QA 3NUGA 2KY9A 1W4AA 3K6SB 2GH1A 3K9HA 1O57A 2V54A 3A2LA 2CBGA 5M5BA 2ZJZA 3OIWA 1FUIA 2QRHA 1EBFA 4F6RB 3NKVA 1ETUA 3NJRA 5TXGA 3MWFA 5K09A 3CEPB 1M1UA 3WAKA 3ONEA 2GVNA 4RK5A 2X0EA 4CCYA 1OXKB 3JVUA 2WVGA 4LOHA 4B4OA 5THQA 2ZYTX 5TMPA 2HIGA 5BVHA 5LDDC 3NNDA 4FHEA 1VDMA 4ZCIA 3P9XA 1NU6A 2C61A 5GV8A 1EK6A 3JQAB 2UYYA 1T8WA 3LPCA 5ILQA 1H1DA 1Q74A 1ZVJA 3COPA 4DA7A 3A9UA 5HOEA 3IP8A 2CT8A 1HK7A 3KEFA 3EVNA 4N3AA 4PZAA 1NMQA 3NBFA 1P7ZA 2BFOA 4EY3A 4FB4A 4FYKA 3TJZA 1KRHA 4FWTA 1Z4MA 1PN3A 3W2HA 3W2IA 4UC4A 3QVLA 3S5UA 4DA4A 1COWA 2HQRA 3EVFA 3EWAA 2AS0A 1O97C 1FB5A 5BSVA 1WV1A 3OICA 2WSYB 4OGGA 1G4HA 2IEYA 3CHYA 2B21A 3HB1A 4DMCA 2KWIA 3VNRA 4D3YA 3NV7A 2C92A 5C52B 2I8LA 3CVYA 1C1DA 2HNAA 4J1TC 4PGMA 3WMWA 3VSBA 3ZHQA 3CF2A 3RYHA 2BP7A 2H5LA 4YJHB 4EJMA 5JFTA 3E2MA 3P9YA 4G5OA 1JDUA 4C03A 4D4LA 1MOZA 3UHAA 4CQLA 4HS9A 3O82A 4XDYA 7REQA 2RGRA 1U4OA 3EOBI 3MJVA 1G5PA 3E3AA 4XKJA 2R7MA 1BRTA 4UUAA 3G17A 4EYOA 5I9SA 2DCUA 1LGYA 4WWHA 4TVOA 3GP5A 1NI5A 3V8QA 3A6KA 3EC1A 4W9NA 2CD7A 4C4AA 5JCXA 3IKTA 1IPFA 1GQFA 1MLDA 3TMKA 3NBZC 5E4TA 4BQEA 4GD3Q 1CDEA 3CT4A 4L74A 5KBYA 3CZ4A 1JYEA 2CVHA 5FOVA 2QTRA 4KV7A 2XRMA 5G0WA 1NMYA 3CUYA 2YW2A 3FOFC 4MGEA 4RAOA 2JLYA 3P9PA 2WWWA 1C0KA 4TUYB 4XARA 4V39A 4ZU3A 1W75A 1NRXA 4ZZIA 4ETNA 1BKYA 4XJVA 2WYWA 3IR6A 2QPTA 2X77A 2VJAA 3OIVA 3PQDA 4H4DA 5LYJF 1Q0UA 3H9UA 3GDGA 5IT9A 3MJFA 3P5SA 3HCDA 3I2HA 3R3SA 5H16A 2O8CB 3BBLA 1X7ZB 4LUCA 2BEVB 4CETA 4B71A 3BMNB 1Z4PX 3FRIA 3H2JA 4LMPA 4P4UA 2O8BB 1JT9A 4BLSA 1W1IA 2DFNA 2ZB8A 1Y9DA 1GNLA 2KJQA 5L3QA 1WBBA 4ZJUA 3B2QA 2GK4A 2Y27A 1MJHA 2BELA 2VLIA 3E9QA 1B8UA 3PL1A 2X5NA 4H7PA 3W2TA 3GJTA 4E6EA 2PQ0A 4D44A 1XGKA 3SS7X 5JY6A 1KYWA 3GYBA 1AK9A 4RH3A 3QBEA 3ONDA 2RGUA 3IHTA 3PQ2A 2OAGA 3C7DB 4H3VA 3ZXSA 5GINE 1GXSB 3TQQA 4G3XA 1E98A 2RK3A 3U1BA 2PPLA 1T4MA 2JD1A 2QGFA 3KS9A 2DUMA 3FZGA 3WIBA 3WK7A 3OAAA 1EZ4A 3LC7O 2BHRA 4PQFA 3WA6A 1R0RE 4AY3A 5JXWA 5ALTA 4DMKA 4UHCA 4HMQA 2GAIA 4HDKB 2WLSA 4BQPA 2R60A 4BNNA 2WJVA 3G0IA 3GEEA 4XVHA 2RHBA 1XLUA 3B12A 4QICA 3HM9A 2GAAA 1HLDA 1FLAA 3EN0A 2C2ZA 4AP5A 5LLSA 4A73A 4BWVA 4QODA 4YIKA 2HJWA 1ZD9A 2VDNB 4G56A 4O2AB 1E32A 3WL4A 3W5JA 2FHSA 4LKOA 1V4BA 2Q5LA 4RZIA 5AO9A 3PU6A 3BFJA 5A7HA 3VR5H 5ESDA 3RB8A 4F6LA 1VPLA 2ZB4A 3BE4A 3ICWA 5SYMA 1KNXA 2VNHA 1HE2A 2QAGB 4H3SA 4LE0A 4NONA 1CR5A 3OCYA 1E4EA 4B31A 2C29D 3OTOB 1HNWB 1YDMA 2X1MA 1MDFA 1T36A 5F7OA 3PPWA 1U0BB 1FFHA 4C6TB 4ENVA 3TCKA 5A6SB 4E03A 4JLAA 1GSIA 3CS3A 4CM1A 2CB0A 4YREA 4CG1A 2WQZA 1A7JA 1BH2A 2GEJA 4O4IF 4HFMA 3D2CA 4R69A 1WO8A 2JZCA 1NYRA 3VPBA 3IAXA 3IV7A 3I64A 4MRMB 3U61B 3RSHA 1YL7A 1QP0A 3EXEB 3RF6A 1BG6A 2VPPA 2C5AA 2FWJA 3P2EA 1DINA 4YAKA 3AP2A 4PEVA 4Z0TA 5ICCA 4IW3B 2CVFA 3L3BA 4IAOA 1UC9A 3FF4A 4MQMA 4QXMA 5AXAA 4LIPD 3BM5A 1DHTA 4WNCA 4R8MA 4AZ0B 1G2QA 4M0EA 3LUKA 4N8SA 3T5CA 1R8JA 2GI4A 2WJ4A 1JSCA 4KN6A 4ZDKA 4D25A 4RQAA 1P91A 4IBOA 2PUBA 1BXGB 3GJRA 2COEA 3GA0A 4W8HA 4JI2B 4L0QA 1M2VA 6YASA 2ZS9A 1T6BY 4EG6A 2IPAB 5NULA 4PW0A 2PGJA 3GHHA 1I2CA 4LF4B 3MGBA 3G1TA 4JITA 4N40A 4A15A 3F9CA 3R3XA 2C0PA 2FPPA 4KKVA 1ZDMA 3ZKWB 4F4FA 1CCWA 5FLYA 4MS4B 3N2NA 3ZHYA 4DJTA 4UXJA 1UPFA 2D4HA 3EZYA 3D8NA 4YMLA 2KBEA 1RYDA 3L4EA 3THYB 4D98A 2H29A 2ZRFA 2CHFA 2BI7A 1BO6A 5K2OA 5HGXA 1EFKA 2CNDA 1Q1AA 2HQBA 3CVJA 2FMTA 3AL0C 1DB3A 1PJSA 4FKZA 5KS2A 1KJJA 1KWKA 3C7AA 1IEVA 3OQHA 1KJIA 3SEAA 4F8JA 3L5OA 4K9DA 4PZZA 5DM4A 5JUWA 3QKRA 3Q3JB 3I5YA 4YQZA 5F9MA 5JNLA 1CX9B 4XFJA 3Q9SA 5TB5A 1D8TA 1PVVA 2D06A 3YASA 3RJTA 1HF3A 5A06A 3CB4A 3H2KA 2FCRA 2F3RA 1U7DA 3LP6A 4K1LA 1IN7A 2PZLA 2GCGA 1LXCA 5C1DA 1DVRA 1BA3A 4N9WA 2F67A 2ZIAA 4TMXA 1E1KA 2AE2A 3EAGA 1S8FA 5HR5A 2WJIA 2OK7A 2BHTA 3WWDA 3S0JA 5CRIA 5B1HA 4LJYA 3BH0A 3EULA 4LJ8A 5COQA 4UBNA 4ZU1X 1FX0B 2D2FA 1HRDA 1OAOA 3EG5A 1Y4UA 1NXWA 4WASA 4RHUA 3PUIA 4JC4A 1Z2AA 1C8BA 2C4HA 1VMKA 2ZBQA 2XNCA 4JROA 1TZ2A 1PJ4A 1UC8A 4RAQA 3ZIAD 4DOMA 3HADA 3W06A 1IZ9A 1SB8A 2QRLA 3NBKA 3RTEA 2OY0A 3VU1A 3C7KA 3EMDA 5DSXA 4JLOA 1EQUA 5I7SA 3EGEA 2LKDA 3OOEA 1OYWA 5AVSA 3EPRA 4ZI5A 1YR3A 2XUKA 3TRFA 3GEDA 2FEXA 2D5AA 2JF0A 1WPGA 1CQIA 4I55B 4X24A 5HQTA 4FCTA 2CE2X 5C31A 2OYRA 4B3SB 4TT3D 2XNSA 1MFPA 4MDFA 5HK8A 3PFFA 5DCUA 4OLBA 4YJ3F 2X9LA 1QJ4A 1MA0A 5FJIA 3T0GA 2GOYA 1QO0A 3DYBA 4GYKA 3CKYA 2ZANA 3GLIA 5EXDA 1IN6A 3PGLA 1DBQA 2JFPA 3CNLA 1ZGCA 3ZCXA 3WIOA 1BJKA 1L8XA 2OD9A 3NLLA 3VYSB 2VHEA 1UEIA 8ATCA 1NW7A 1NFRA 1XZQA 4FR5A 4QYWA 1ZAKA 1MC1A 2QTHA 4IKOA 1E4OA 4B44A 3ZLJA 3SIXA 2C3PA 5JJKA 2G8LA 1GV1A 2HN9A 1NM5A 2O52A 3CZ5A 3ST7A 3JWPA 1RWVA 1V41E 1EP2B 2Q46A 1BN6A 3JRXA 3KZOA 3LQ4A 3N8KA 1Y42X 3PXXA 3HJNA 4JL5A 4BMNA 4P93A 5AMXA 1QYDA 5G0SA 4CIBA 3R9XA 2GVZC 2R84A 3FNQA 1E3QA 4X00A 1CJKC 4PHHA 3KXPA 1H5QA 1E0DA 4X93A 2VAPA 1I2BA 3KSMA 1PGPA 3BCUA 3OETA 3WTBA 1YO6A 3G2HA 5K8LA 4AY2A 5FULA 3PQ8A 5ED0A 4M55A 1EK0A 3AHDA 1JDBC 3BSSA 5JTUA 4YV2A 2WD7B 4KPUA 1E9DA 4G5QA 1GQSA 2EJUA 2FX2A 2NUPB 2VRCA 1RHJA 2LD4A 5G1NA 3V8BA 3C41J 1PF7E 1CF2O 3CKKA 5JH7A 3MS2A 4XSVA 2CSUA 4XSGA 4EY8A 5M29A 1JHRA 3KZXA 1TVMA 2GNOA 4GP7A 1ONBA 1R16A 1I2DA 1VG8A 4CEJB 4Q7JB 5FBZA 3PFBA 4LDQA 4M2LA 1X7GA 5B1DA 2CLDX 5EXTA 2ZUWA 1DKRA 4OH7A 3I32A 1J8QA 2JARA 4X41A 3TTTA 2YINC 2NGRA 4OJYA 1G8PA 3IRUA 5IT0A 1PJ2A 2C78A 1IOWA 3EEQA 3HH8A 4PX2A 4EB3A 1PEAA 1QFMA 3PIRA 4X60A 1JU4A 1NLZA 2QMEA 3B82A 1J1UA 1E3WB 1P4GA 3I6YA 2LIPA 3RVSA 4A2WA 4JENA 3KR9A 3PZBA 3ROFA 3T3DA 4PZ9A 4X85A 3R7BA 1XTKA 3ROKA 4AROA 5CXUA 1E66A 4H35A 5F5XA 4IV8A 4WMLA 1ISPA 1UJCA 2GILA 2R25B 2ET6A 1EUDB 5ES3A 2GN6A 2SECE 4DV5B 3D6UA 4IJQA 2VRBA 3PGA1 5C8ZA 1A76A 1IN8A 2R66A 2ST1A 3ZWKA 1WR8A 3D64A 3H1GA 5AIBA 1AQJA 2IOFK 3ABRB 4IPTA 2WAYA 1IN4A 2WU0A 1ZVKA 2PEZA 2HDHA 2PM8A 3VR5A 1EFVA 1Z5ZA 3A7DA 1GSAA 3KOWA 1DKOA 3BIJA 1KC1A 3ER9A 1GPLA 3QVJA 1E7MA 3GDFA 5C8YA 2D7JA 2CUTA 3T9DA 2C58A 5CX4A 1JJFA 3JYPA 4QSHA 4DQXA 1JXQA 2D1TA 3SHQA 2OD7A 4GBED 3CY6A 4RYLA 4DZTA 4FGJA 2IIVA 3RQIA 1DIRA 1P4HA 4L73A 4TXHA 4ZT2A 1H6CA 4BIIA 2BISA 2NZWA 3KEGA 1ZGGA 3DR5A 3ITNA 3B1FA 1L1FA 3VC2A 3B20A 1D2MA 2NU6B 2C4KA 2J07A 3WGLA 2W6OA 1U0LA 1L7DA 2BGRA 1IY1A 2Z1DA 4NCIA 3J7TA 1ISHA 4D0SA 3TW4A 2C5BA 5CIQA 2GEKA 3K1TA 5JVDA 4HN2A 4XJSA 1Z2CA 4OQQA 2FV8A 1SOWA 1YVEI 1V2HE 1FNNA 1ZGZA 4KQ1A 3Q1KA 2WMNB 3GLUA 5AW2A 2IXAA 1VJ1A 3AY7A 3SU8A 1NPTO 1JE1A 4B4UA 3NVMB 4ZAYA 3CH7A 2O8FB 4G0OA 4FJ2A 1T6XA 1J97A 2JI6A 2IYAA 4KYIB 1H4TA 4WBSA 2GKGA 1O95D 5E1MA 4YROA 2F17A 2ZQ5A 3IFSA 4R7ZA 3LA8A 1FMCA 1X80B 2HHAA 2NG1A 2BKXA 2ZJ7A 1C3OB 1MH1A 1OLSA 3L6RA 3OX4A 3PDUA 4X8LA 1F1JA 4ZOLB 1C14A 2XJ4A 3WLKX 3W1EA 2FYTA 4KB5A 1IIRA 2GPSA 4JFAA 4NK5A 4YI5A 2AZXA 1GGMA 4KEAA 1CS4C 2VJLA 4DIMA 2VNKA 1ORTA 3IQWA 4D6XA 4KODA 5J2UF 2OCDA 3ASZA 4NU0A 3I1JA 3P1JA 4TMVA 1C30B 1DBRA 2OQ2A 3UJDA 1S96A 1WBJB 3EUWA 4G2NA 2HUNA 2IWHA 1TZJA 5DX0A 1R4AA 1X94A 1ZYUA 4HAWA 4L0DA 1BDMA 1QX4A 1JDJA 2NW6A 4TQ9A 1K7YA 3CLSD 1IH8A 1R37A 2E7ZA 1IQ0A 2FUNB 1BGVA 2Q6KA 1ABBA 2WT8A 1WMFA 1IUOA 2GAFA 3SDSA 3KK0A 1PRYA 3IE2A 3SC3A 2FQWA 3ZDZB 3M33A 2HK8A 3AU9A 1SXIA 4FXOA 4P7FA 2JFBA 4TXMA 4CGZA 1R12A 4POAA 4YAJA 4ARCA 3K9FC 3JAWB 1T8PA 1SG9A 1YQUA 5IVDA 3TIGA 2IXFA 4LZWA 3L8FA 1II8A 4DJ5X 3LLCA 4A3SA 3C3AA 4TXJA 3ZLTA 4GL2A 1DBVO 3PDIA 1ORVA 3NOVA 3B2NA 4CM4A 2C00A 5T4BA 3VU3A 2OCPA 2XZPA 5CFLA 5EJFA 1R3UA 1R64A 3T5BA 2DYKA 5HHTA 1Z0ZA 4DCCA 3T1YB 5HWSA 1CV2A 2Y8EA 2XQGA 3I1FA 1AS3A 4MWZA 4OGWA 2UZAA 4PLZA 1I30A 4RM2A 5CU7A 4IMJB 5IEBA 3X0DA 4BPRA 2ZSAA 4RZSA 3QEJA 4P4GA 4D4KA 4CR8A 4RENA 5FNZA 1T0JB 1BCRB 2HRRA 4GU5A 2JFUA 3HCFA 3MRXA 1C29B 1TW3A 2O0LA 3GRZA 3JWEA 4JP1A 1GPUA 1P29A 1ZUIA 3R40A 4L8WB 3T3GA 4EW1A 3C6XA 4ESEA 4D9GA 5CEJA 1CQPA 1J0EA 2IEIA 1ZI8A 2HHJA 3JTEA 3KKMA 3P2YA 3TZCA 1Z15A 2QTVA 4PLVA 1FMFA 2F90A 3DBRA 5EMNA 3HKDB 4XASA 1YT5A 3G59A 1SC6A 1K8RA 2HA4A 3ELWA 5CT8A 3A26A 2PKWA 4B1FA 3NHBA 4JB0A 2RB5A 4I3HA 2OSVA 2WYIA 1AGNA 5LN1A 1DG1G 1DARA 3D7SA 1TO2E 3D7RA 4ND6A 1DZIA 2CUNA 4I7EA 1QNFA 1P18A 1O03A 1Z28A 3NBAA 4KAJA 4AS1A 2XF2A 4LBWA 4X1IB 5CLIA 3UAZA 2H52A 2VP9A 1FYEA 4XA8A 4PHGA 5ALHA 2ZRNA 3K30A 3VNQA 1II0A 1FP2A 4Q05A 2ZITA 4TMTA 1B73A 3U4AA 1P0QA 2UXCB 3M8KA 4RUKA 1TQ2A 3TRKA 3OEED 3S1SA 2W2KB 4G65A 1ISJA 2VPXA 5CCXA 3ADKA 3I9MA 1JVSA 1SELA 2XBLA 3TQHA 5BNIA 2QLBA 1XDWA 3F67A 2X1LA 4RULA 5B7PA 3U60B 1HFWA 2O2JA 2RDMA 5B1IA 1IEXA 3L92A 3BCHA 2QK4A 2AHRA 2DLDA 4MYCA 1CJSA 1D2GA 2I2CA 1A8QA 4OAOA 3EDOA 2YJ3A 2WHQA 2R8XA 1T26A 3FCOA 1OAOC 3GPCA 4NTZA 2YZ2A 4RQUA 2WHPA 4ILKA 2FEOA 4LRTB 4FEYA 1YE8A 4QQRA 3G0CA 4MGKR 2FMIA 4RM3A 1E2EA 1GNPA 1FRVA 3OZAA 1A9XA 1N6LA 1NSTA 5AI6A 5EOVA 1Q0HA 3O0TA 1G3UA 2HAEA 3HHPA 3PC2A 1FA9A 4KDEA 2P1RA 5FR1A 3PDWA 3ANXA 2FPMA 2PUEA 3MHTA 2P8JA 1YFLA 3V3TA 4BBZA 2G63A 4DNFA 2WWTA 1XD2A 4J1QA 5J1SB 4RTPA 5EJAA 3RAJA 3GPLA 4LF5B 1DJMA 3PE6A 1X39A 3RC1A 1T2AA 1CUYA 2CXQA 2KE5A 1Z5UA 1US8B 1GTMA 4OGFA 4JKYA 2QUKA 2Q0SA 1TW2A 2CFSA 3Q6IA 2ZIXB 2V6GA 5JIBA 1QIHA 4UPEA 2ZDHA 1GZDA 1JDZA 3QPBA 3DOJA 3FDIA 1A8IA 4LJ4A 1K97A 1U94A 4L8LA 3L7MA 3UHOA 2YMLA 5LU8A 1Z4OA 2QN6A 1UODA 2XAAA 3QVXA 3QF4B 3DULA 4BKQA 1N0VC 1KMCA 1HTBA 2EDAA 4KJZA 4YASA 3VZRA 3LF1A 3AHJA 3MVEA 3BMCB 4KI0A 1X3LA 2X0KA 1U2RA 5CDYA 5T4EA 2NU9B 1MO2A 2Z56A 3HUUA 2JAPA 1BTOA 1T9KA 5FPTA 1ZOPA 4HPWA 1JL3A 1ZLXA 4PV7A 4G4IA 1V6AA 2OBXA 4JJ6A 2A5DA 2FOXA 3UW3A 1XCJA 2H17A 4YV1A 3LT5A 3V2GA 3MD0A 1UJBA 3E8XA 4IMIB 3LPNA 1G64A 1UIRA 3T9AA 1KO1A 4DWWA 4XGQA 4NU5A 1Z0UA 3GN2A 3MJ4A 4S05A 2HSDA 1FTGA 2R7KA 3QFTA 5ARDA 4EB8A 4IGAA 5GIOE 3EC7A 1YBVA 2HBRA 4CFSA 4EDHA 4OXIA 5K3SA 3RU3A 3RYFB 1YF3A 3GLFA 3L4BA 1BZYA 3C1UA 2G1AA 2QAIA 2ZWMA 3M9LA 3FGZA 1G3MA 5DCWA 3OWXA 3O8LA 2PR2A 2XDWA 3VR3A 3NHFA 3SFZA 1EXVA 3TIFA 1QAMA 5TS2A 4TTPA 3L43A 3ZKAA 5ICGA 3NIDB 2ODQA 5AW5A 4NFYA 1YVDA 3UUFA 1D1TA 3M5WA 1M34E 1M3SA 1M5TA 3DTVA 4NBSA 4O5OA 5DYGA 1OGIA 2P5YA 3RC3A 2LBPA 3F6RA 2Q5OA 4BGEA 2NNWB 3QOWA 5IZCA 4XWWA 1PFVA 4OHFA 3B13B 5JO0A 4QPZA 4MS3A 5EXEA 5FV4A 1QX3A 1H0SA 4BFZA 3ZJUA 1NKTA 3HMQA 1P1KA 2R8YA 2FPLA 1JG1A 3HACA 1YOBA 2Q5CA 3K1AB 1L0BA 2HUPA 3B1WA 4KJXA 3O92A 3G49A 5ICFA 4CIXA 3GCWA 2R86A 3NP9A 1YBHA 4XX1A 4NXNB 4P6VF 5EIHA 3COSA 3RASA 4J0EA 3LXMA 1W1WA 5KTOA 1PVOA 5KPDA 1KSGA 5JZOA 3RFVA 4GP9A 2IDZA 3CR3C 1CHNA 2I3BA 1GZVA 2V5VA 3E05A 3OD5A 3R3VA 1Z3CA 5FWYB 1Z2EA 2D2EA 4EUSA 4G1BA 1W44A 1VHTA 1SKYE 4EPWA 1AMUA 1E2UA 1FF9A 3QTLA 1VYVA 4OIFA 1UKVY 1WY7A 2I2XB 3K32A 1LK5A 1MF7A 3D2AA 5J47A 1NBEA 1MOSA 1NN5A 1PZMA 5FI3A 2JIPA 2H4HA 3QNUA 4BGVA 2HU8A 1Y3DE 2W0MA 4O6VA 4W82A 3LQQA 4F85A 1AK2A 4GE0A 3OZVA 2ZPAA 4O4HA 1TUEA 3KSRA 3N58A 1HKHA 2EZ4A 4M49A 2JRCA 1OFTA 5AOAA 3FYCA 3C3BA 4WEQA 2FUKA 2ZQYA 3I53A 3PITA 1GG5A 1JQ3A 4MKIA 1M67A 3E7FA 5JRZA 4DG8A 2Y2VA 1ODIA 2XT6A 2ANBA 4IIJA 2IL1A 3H7IA 1UZUA 3JTMA 4MMZB 1GRQA 1WQ4A 3D4BA 3Q5EA 3A1VA 4Z3DA 4AO7A 2VBGA 5FUMA 4H60A 4NAVA 1P6QA 1SKUA 5KMGA 4Z9BA 4EY7A 3GOQA 4CT5A 2R44A 1YR2A 2HGZA 3GGJA 3OT1B 2G5CA 1RQNA 2MU1A 4JI5B 3NEAA 3NHLA 1PQYA 1QM5A 5CA0B 2RONA 4AJ1A 3VV2A 5J40A 3NHPA 1O87A 2JGIA 3E3OA 3HKEB 3SJAA 2GPNA 4HDSA 3TNDA 5IHPA 3I0NA 5EIBC 4UTZA 4Z9XA 2H63A 4WZ6A 1XVTA 3IAS6 3JATB 2PR7A 3TLGB 3EDYA 3AU8A 4GPEA 4NMLA 5J9FA 2P90A 1Z0FA 3QVWA 5FI5A 4YXFA 4MJXA 3T7EA 1ZNWA 2CWDA 5JBNA 2QLNA 2VBIA 4R3WA 3T3PB 1MB2A 3LIIA 3MGGA 4QLBA 2C7PA 1MENA 2QMZA 1V1RA 2G67A 2VNAA 3EMVA 3FNGA 3GL9A 4WY2A 4CLDA 5JXHA 3ZWAA 1JPNA 2DSNA 4BTVA 3U4IA 4D0NA 4URHA 2OR3A 1DAEA 5CYGA 2OFXA 5DT2A 3BQ9A 1X8JA 2QI9C 3LC1O 1KJNA 1R9JA 4HQFA 4HZGA 4UHJA 5IX8A 4B0OA 4WY5A 4I5DA 1UM9A 2GUWA 3LLVA 3LS2A 4MP6A 1LWNA 5EFZA 1AHNA 1CUCA 2AUNA 3AEYA 3KKPA 4P3PA 1JSLA 5D6NA 5KX5F 1FY2A 5G0VA 1V9LA 1UJ4A 4QDXA 2POCA 5C1PA 4B2PA 5A1TA 3F7OA 2XMZA 3PX3A 3EF1A 3NHYA 1NUSA 2I22A 2ISSD 4UJ3A 2OUIA 1QP4A 4PAOA 1WABA 5LWHA 5BUQA 3QSYA 4IYRA 3NOQA 5ETJA 4QGGA 2QMQA 5DE3A 1R00A 4TYNA 1DIGA 4L5IA 1NX9A 4O8ZA 3REGA 2O4CA 1IWOA 3OMXA 4AP6A 3F3SA 3M3DA 4LXYA 1UBLS 1JT2A 4FGLA 1UXIA 4Q37A 4IH1A 4CEIA 4FGZA 3T3EA 5L7WA 4LBYA 4RLFA 1DV2A 1RKUA 5B30A 2ZJOA 2WE8A 2V9CA 3NBYC 4NS4A 4E33A 4M1MA 4FQ7A 1ZAYA 5B1EA 1RWWA 3DM5A 3KZMA 4ZRMA 2AK3A 1ELOA 1EI9A 2LR0A 3WAGA 1M34B 3EUFA 2WIBA 4K28A 5LQCA 4ZVRA 3BTUA 4RD3A 4F2WA 4M98A 2VO1A 3KE9A 1IN5A 1T0PA 1U8UA 1XN1A 2I80A 1IN1A 3QEMA 1SIWA 2EKDA 2B8NA 3UIEA 1AB5A 2RHRA 1E58A 2Q1WA 2NXJA 3TSZA 1ISRA 4C06A 4K6HA 4JT2A 3R23A 4BQFA 1MABA 4DR2B 3ZZNA 3G2NA 2OFFA 2Z04A 4HHEA 4ZKEA 3KOOA 4GWLA 2CWWA 2VCEA 4OB8A 5J2TB 1EP1B 5K0JA 2XTZA 3PSHA 2V65A 4C30A 5FT9A 4RCZA 1EH5A 4PC6A 2H65A 3MINA 4YRTA 1Z0AA 1S8OA 3MWYW 3WNZA 4AJOA 1WB4A 3LY8A 2H4YA 1SBQA 5B4TA 2CLHB 1SKBA 1XQYA 3MTBA 5BP7A 1D5WA 3NQ41 4JJ7A 3UT6A 1RPJA 2AEMA 4I8XA 2C1EA 4K9LA 3WLFA 1ENZA 3BXZA 2Q1XA 4B47A 2PL3A 2WMDA 2YBDA 3WYBA 2P0AA 3GMSA 2Q3HA 1CR4A 4HSGA 4OM8A 1L8OA 4A92A 6PFKA 1SHUX 3BFPA 2Z8XA 3D3QA 1MIOA 3E84A 4U5XA 3T34A 4YAFA 4D3XA 2EQAA 1IAVA 4FN4A 1AN9A 2PS0A 1N6OA 2FWRA 2P27A 2PUVA 2VDVE 4GH5A 4HATA 4JDPA 4BJ1A 5DHQA 2BEWB 3ZY5A 3U37A 5U9CA 4JT9A 2XTMA 1LTHR 2HF7A 2NYUA 1ZHHA 2W4MA 3D8HA 2IOQA 2X2FA 2P6OA 2HRZA 2AXNA 1PFKA 4Y2TA 3TVYA 2JVIA 2ZUCA 4Z4GA 2GSWA 3K0AA 1N5LA 2D0IA 4B87A 1WMDA 1M6YA 3KQVA 1R8YA 5CG2A 2A1UA 4UJ5A 2OMKA 4PZDA 3CZQA 2HXYA 1EJ2A 3M4YA 1YRLA 2WAMA 4CLXA 1R0XA 1NATA 1PFYA 1SXJC 3MXTA 3IPXA 2Q4TA 4J49A 2CFIA 4MRVA 4UM7A 4YNBA 2OB2A 4L3VA 1NBME 3OM0A 2W6MA 4PM4A 3SHTA 4S2UA 5KQLA 5KYGA 2IS4A 3M6MD 1Z73A 3QSGA 5LMUB 1E6CA 2WJGA 2X1VA 2V8BA 3SC2B 5AM3A 3ME5A 1QORA 2IYVA 4UM9D 5HSGA 2C7BA 5FNVF 4DNPA 421PA 3TQFA 4YAEA 4HP8A 5ELMA 1W25A 3EGDA 5KB3A 5DMXA 3K05A 3U19A 4MHTA 2R68A 2AD1A 4IXDA 1NFFA 1DAHA 2CXRA 4H6XA 3DOIA 4O2BB 4KL8S 1Y6JA 5JCPA 1KGSA 1I0LA 2Q4EA 5HS6A 3GFFA 2G80A 4HH3C 1FQOA 4BNFA 4BNGA 2I6SA 2YHIB 1Z37A 1S3SA 1IJKA 5T4FA 1VMIA 3INRA 2PRKA 4RY9A 2QPAA 1QGUA 4EKYA 1WQ1R 3NT4A 2ZYSA 2DPYA 3N8IA 4ZI2A 5K3EA 1YK1A 3DVAB 3P52A 5EQTA 2HR1A 3P9KA 5K0TA 1G5TA 3L4BC 1UBKS 3A6EA 4BMDA 3ZVRA 2QSJA 5EMJA 2VH5R 4BEWA 1SIUA 1FU8A 1R5NA 1UMCB 3A05A 2VHCA 1NA5A 5AUOB 1PG2A 4MIKA 1PEDA 3FWZA 4UDXX 2NAPA 1XA3A 4JMPA 3TCXB 4BMXA 3FNRA 1OT5A 3AEQA 3FVWA 5FQOA 3ZG6A 1F6WA 4GOXA 1KU6A 3DVQX 4B4WA 3ESZA 5JMWA 4GQBA 3AEUB 4HUTA 1PJCA 4W9MC 1Q7EA 2OO3A 4MRSA 1XKQA 4LJKA 2QM7A 2E6UX 3S29A 3M6LA 5JHGB 1OJ7A 5CT4A 4BUCA 5T4HA 3ESQA 5DN6A 1L7PA 1ZOLA 4KXLA 4PFQA 2BWJA 3EIQA 1N2CA 4YA6A 2YZKA 1V2GA 5DM2A 4U8HA 5MN4A 2JIDA 4HDRA 5DWQA 5HQ3B 1W59A 3QLUA 3B5EA 3L6DA 1EJBA 3N0TA 4EO4A 3CEJA 3QBDA 3TW8B 4KXXA 3K3PA 1S1CA 2BM8A 5MN5A 4BP9A 2FQXA 3LWBA 2FMFA 5FA5A 2IGBA 3W8EA 3WRYA 2IITA 3ENWA 4K86A 4Y2RA 3Q3GE 1U9CA 3AF2A 2QZJA 5CURA 1TL7C 2Y3IA 1E1RA 2D7CA 3QX8A 4GOJA 3H97A 1TUIA 1VHQA 4QWMA 1RRVA 3UATA 5LQKA 1SHJA 1LEHA 1TYBE 3P0JA 1X2BA 1J06A 2PY6A 3GUVA 3EGXA 2CNWA 3H16A 4RSGA 5T8KA 3P96A 3ZK8A 4B82A 6ABPA 2FWPA 3RRZA 3DT9A 3L8EA 2VDWA 4MLDA 4CUKA 2R11A 4HQRA 4DMUB 1SU6A 1TZCA 3VZDA 2NTNA 3Q6NA 3KD3A 1E3DA 5EE0A 1JVNA 1UWCA 3E8SA 3G8AA 4M0UA 2ZIZA 3LMKA 5L7YA 3BS4A 1EGVB 3FCUB 1OZAA 2OECA 3ZDYB 3FNEA 1LFDB 4CPDA 4DZRA 1AGPA 2XR1A 3BRWA 1T8UA 2ZYWX 1ZKDA 3DCYA 4FNMA 2WV7A 4ZPJA 5BVGB 5HBGA 4ZV7A 4UEOA 1HZZC 3UJAA 4AZSA 1YC2A 2REBA 2IP1A 5D3KA 4CNBA 1YCGA 4TKMA 3HLKA 4RPCA 2WJZB 3NRCA 3A4TA 3D5EA 1BCSA 1FVFA 2JJ1A 2Q1DX 3Q2IA 3WB0A 2IY8A 1UDBA 3GJXC 3K8YA 3L4SO 3RIYA 2XRZA 1XNHA 1MJNA 1YQEA 2X15A 3RFUA 4NCBA 1XZMA 4IG4A 4LGYA 1D03A 1KI6A 2HNBA 1Q2XA 4MVJD 4IGEA 5AHKA 1SCJA 2ONJA 5ITWA 3OQ6A 2EL9A 1RXEA 5FLXA 1MQSA 2D4AA 4JVOA 2ZRAA 4CM9A 1I33A 1I13A 4LYDA 4P3YA 4PVCA 2O07A 3BJIC 1G0OA 3ER6A 3LG2A 2QRKA 1WW3A 3A3YA 3KT8A 5AVYA 4JB3A 2FUCA 4R1UA 4ISCA 2Q4OA 2XD4A 1HKUA 4QUAA 3ZW7A 5ECGC 3O3NB 1HQCA 2GF7A 4FINA 2AMVA 1W73A 4MCHA 1VA5A 1USVA 1XT6A 2ERXA 1KSFX 2I29A 2PU5A 4V24A 1OLXB 5AVJA 4B33A 1WPXA 4D8VA 1Z0DA 4HQLA 4K9QA 4RACA 4LDNA 1CULC 3AOEC 1U0TA 1SU4A 2ZLBA 3L2OB 1Z4JA 3P2MA 2XB8A 4DMMA 4F1JA 3WL6A 3ITEA 4F4JA 3ET4A 2RGCA 1L9XA 2VP3A 4DSUA 1C9EA 5PNTA 3WLSA 4NXMB 1K98A 5CK5A 1ZCJA 2Y0EA 2A5GA 1YR7A 4UZSA 3RS9A 1YZFA 3K5WA 4BO6A 4MVJG 2DH5A 2EKZA 4IUCS 1JI3A 1YFKA 2VBFA 2RHTA 4AD8A 3I6BA 3KJFA 5BOSA 3O91A 1WX1A 4HYEA 5E38A 3KUCA 4INAA 1O58A 3UWKA 1XRLA 5CT9A 2L17A 5GJBA 2F1JA 2FPUA 1YQWA 2FX5A 1C3JA 4QOEA 1QAQA 1U04A 3OQIA 1Z6GA 3MERA 2JANA 4IVQA 3SVTA 2XWSA 3OSZA 4NZPA 1OW3B 4B7AA 3IP5A 2Z9DA 3ANTA 1AGRA 3SQNA 1E0KA 1B8VA 1U2EA 4MPTA 4MQ5A 1SC9A 4ANFA 1JA0A 1KYTA 4E7OA 1K9VF 4YT4A 2B4KA 3PNQA 5TF4A 2ZATA 1TGVA 1NVGA 1ZK0A 2OQRA 2IP4A 4D3FA 3QFSA 3F5DA 3NIBA 3BAZA 3NCTA 4IQGA 3IEKA 1P9OA 2PLWA 3GLGE 821PA 4ZTBA 4BU1A 5KKNB 2LZ0A 1KYXA 3HUDA 3U3RA 4OHBA 1PJRA 3CF4A 4ZK6A 1AM4D 1WTCA 1HE5A 2QT0A 2PBLA 3U3JA 3HDVA 4BQSA 2ZBFA 4HTAA 3MN1A 3IBYA 3FPSA 1LLDA 3THXA 2GFAA 2PO7A 4RK7A 2WPDA 2C5SA 4DB4A 1YB6A 3CPEA 3K92A 4F5YA 2JA1A 3QHAA 1TCUA 5DEIA 4KV9A 1W87A 1RCFA 1K7SN 2IPNA 3V8EA 4DYHA 3LHSA 2OTCA 3E7DA 2JPDA 4ZVQA 4IDQA 4YI3A 1JR3A 3UHFA 4C4PA 5IF3A 4V03A 3HB5X 3OSUA 3ETDA 1QH8B 2B1QA 3C87A 5EKDA 5CVVA 3WYNA 3OQMA 3C5WP 1AHPA 4ZTUB 2R1VA 2I2AA 3RIEA 3UJ6A 3KXDA 1K5HA 1DJLA 3W2EA 2VP2A 5J4VA 1FFGA 1J2RA 1E9RA 1SB9A 1E7QA 3BHNA 2P40A 4UATA 4ENPA 4FC6A 4BLTA 2ZBEA 1D2CA 4KLNA 3BL6A 4BLWA 3UB2A 3FRHA 4UKDA 2BBOA 3OLXA 3AR2A 4A7PA 1ISMA 5CNMA 3AC0A 3E3LA 3SJUA 4G24A 4AY6A 2AG0A 2YWJA 5D1NA 5C7LO 3WOVA 3L6CA 1L8LA 1W8DA 2MR5A 5IT4A 3NUQA 3VR4H 1UDXA 1ILEA 4F5EA 1NTRA 2VQ6A 3ROGA 3RT7A 4LFBB 1RWPA 1THGA 1TAGA 3EC2A 1OR8A 3AESB 1ZJWA 1ST3A 2VIIA 1FJGB 3QU4A 1NPDA 2R5WA 4L76A 1NW9B 5JS6A 3W0LB 3NBQA 1FMJA 3HM2A 1RZVA 3FR8A 5JCOA 1RKVA 4TROA 2C5GA 3JVDA 3NR2A 3S7TA 4DWOA 2OZKA 1W1UA 2QMOA 2BJVA 2W2XA 4CZ2A 1UFRA 3ZZTA 2YOFA 2QROA 2IUTA 3PNBA 1CK4A 3LW7A 5H70A 3UMSA 2ZROA 4NCKA 1TADA 4JOCA 4PS1A 4KDIA 4L95C 1P0FA 2GXUA 3H9BA 4XQGA 4QTYA 1HDCA 1VMDA 4X44A 4TV9B 2VR1A 3NJ4A 2W6CX 4OATA 3WB1A 2B8TA 2HF9A 1ZOOA 3S2SA 1N0HA 5I4KA 3DL0A 3MG9A 1XJ0A 5L3VA 1ULHA 3ZU5A 1J42A 4BZXA 1O94A 3MC1A 5JDIA 3OE5A 1GTVA 1KO5A 3NTQA 1Q7BA 3ZCSA 2CV1A 2NQ8A 4E12A 5JSFA 1P75A 3HXMA 3S81A 2A9JA 5LLTA 5KNCA 3BDAA 3NTRA 4JLJA 3T9EA 1SZDA 2XVAA 4HLUA 3ZHVA 2VPYA 3ZU4A 1NQOA 1XQ1A 1IWBB 1TM2A 4P08A 2CLOB 2QQGA 2XUIA 1J1ZA 4PONA 5LQUA 3QJGA 3WYAA 2DTEA 4MIYA 1BJRE 3TL2A 2MMCA 3LBFA 2JBAA 3D3NA 4L08A 4JR0A 2IZZA 4Y6GB 4AAYA 1KARA 2QL9A 1QZZA 2OG1A 1PZHA 2FE4A 5CNKA 2P6PA 3SE7A 3E58A 5KHOC 1YSCA 1F17A 1E6UA 2QX7A 2ZIFA 1ZR4A 4C5AA 3SIWA 4M1WA 3N5KA 4J1SA 2FW6A 1UEJA 3I72A 2IWRA 3N07A 4MI1A 3JARB 4UQPA 1YJCA 3AETB 1R0BA 3WKDA 4YAGA 1CEXA 1N8TA 5JPIA 3WGKA 4BWYA 4NARA 1ZC1A 2HWXA 4TWAA 4NPCA 1FW8A 1PEKE 4MKXA 3DDUA 5DXFA 3QPUA 4EHHA 1T4DA 1DWOA 3IA7A 4HXFB 2MYUA 3VO8A 1YQQA 2GHIA 5KDLA 3EVBA 3GRAA 3UBMA 2EFYA 1NVMB 1Q6YA 3AYXB 5HS4A 4XM0A 3RS0A 4BQRA 4I1VA 3W7AA 1S2IA 4A8JA 4YR7A 5CGQB 1J8YF 2ZREA 3COVA 1DL5A 1LV8A 2GLXA 3JV7A 4Z9YA 5CLGA 2HHHB 1BEZA 1PAUA 2OFPA 1QYWA 3CE6A 4M54A 1JFVA 1F06A 5LZ9A 4ZV4A 1CJMA 3KQNA 1RXWA 2YMQA 4YFYA 3BXPA 4AWBA 4EGQA 3PF8A 4IJKA 3ED1A 1ZM9A 1GO2A 2B0JA 1VOTA 3C2QA 4FE4A 4GWKA 1G4UR 4QFCA 2FU5C 5A7GA 1WXEA 3GLGB 1XEAA 5F2EA 1Z6PA 2O2CA 3DLCA 3EGVA 4HFNA 2PAFA 3QPAA 4L4SA 4CRWB 1A5BB 1RP1A 4IDCA 1KQ3A 1E1CB 1YQ9A 1U31A 1NRWA 3P4YA 1VJ5A 4B75A 4LJRA 1U3WA 5B37A 4RTOA 4WOPA 1UDAA 3PXDA 2NZVG 3IQGX 3ON5A 4RCYA 9ATCA 3R8FA 5K3CA 1ESNA 3L5KA 5L6LB 4C2UA 2AFHA 4RTMA 2PD4A 1NSYA 3ZE1B 4GKKB 2NO4A 1U2ZA 1E2GA 2IZ6A 2IYOA 3CWQA 3IAHA 2D2IA 4NU6A 4O4JA 1J39A 4YLEA 2QUBA 1Q17A 2YASA 3NO4A 4K40A 4S1VA 3ZCUA 3VR6D 1R88A 3ERCA 5HFAA 1G20E 2O7VA 3D2BA 3IJEB 5JSZA 1TQ6A 1ESEA 2GFHA 3AILA 3UJNA 4IFTA 1WZCA 3KWMA 1FTWA 4QXRA 3LPDA 5C46F 3EEIA 4Z6KA 1UBNA 2O2SA 3QFHA 2Q2VA 5CB6A 1ZK3A 3Q5GA 2OWDA 1R9GA 2BGTA 2KQUA 4FZ5A 2DRIA 2ZVQX 5E2AA 1OX4B 4C78A 4B83A 5F78A 3U1VA 3L01A 4GLJA 3RIXA 4ID9A 2NVUB 3FCSB 2QD2A 2WNSA 4RKQA 4KXYA 1L5KA 3A6LA 4EARA 3FAZA 4OYRA 3B8HA 3AFHA 1H2FA 1EINA 1VL6A 1R7RA 1DDGA 5ADHA 5IYZA 3GW8A 5A5VA 4MR7B 3JQFC 2E4UA 5KOIA 5TARA 2CLLB 2JFYA 1QPBA 2XDQA 2NUTB 2WICA 4JLPA 3WQHA 1BOFA 1QH1B 5CW2A 4BMOB 4CT0A 3HRKA 2WVJA 2G06A 4R05A 5CDTA 3G85A 4G0UA 3R09A 3KLPX 1F12A 3OPYA 1EE9A 1M9NA 5L53A 1RFLA 1COWD 1A7AA 1EWQA 1T9CA 3DEAA 4ICIA 2ATEA 2G9UA 1O8CA 1LLCA 3ONVA 5CM9C 1RD4A 2X40A 5FTKA 1MPTA 4F9GA 5B64A 3IO5A 4CQMA 1HOXA 1OLUB 3O75A 4BP3A 2PNFA 3IGFA 1RJDA 2WKSA 1TEZA 3ZDBA 2HSJA 1B15A 1UBOS 4LZNA 1WPRA 1GTZA 3HB7A 4LTMA 1QF6A 4WFJA 4KRGA 2X5JO 4DC9A 4X6UA 1P4RA 3GT7A 1MEEA 3LV8A 2PX4A 1JSZA 2C20A 2J3MA 3S2YA 5DBGA 3ETGA 2J8ZA 3DD5A 5LXTF 4A0FA 4BMYA 4EF5A 1W93A 3CX8A 2AL7A 3U62A 1GFWA 1Q19A 3GCDA 4OA5A 5FWYA 3OMLA 4KWCA 1MMFB 3C14C 1WSDA 1WCIA 1X8KA 2RGNA 1PYDA 3JVEA 3F2VA 4YCNA 4XWOA 5C5DA 3QFCA 4TKZA 4A6PA 4BNTA 4OFWA 2KW5A 3H5AA 1F9EA 3M9WA 3VR4A 3R5XA 2G1JA 3GJ5A 4P35A 3PEYA 4QPPA 1RZRD 1W7AA 2HMUA 4KVZA 1F0YA 4Q34A 5DSTA 1IXSB 4FSDA 1U6JA 3N76A 3AXTA 3MYRA 3O4VA 1G5QA 4KN8A 1JU3A 1S2LA 2BRUA 1VJTA 2ZTVA 3HN2A 3QUCA 3RJ9A 2JFQA 2PX2A 1QHHA 4G5YA 2ZSDA 2OG2A 1GRNA 4LDPA 1DC8A 1II9A 1ECJA 1OTYA 1HMPA 4CHTA 4DXHA 4ZALA 1UOEA 1YZHA 1J0BA 5FIUA 2FWIA 3R6WA 4C4YA 2ZIWB 5JJBA 5ICMA 3C4JA 5I4IA 1IMJA 1OSNA 4YRIA 1GV0A 4WW0A 2PV7A 1DXYA 2G71A 2ZCUA 1L5OA 5IVIA 3TQRA 1B41A 3ZHSA 1XAHA 1N2EA 3D4IA 4NJEA 4Q15A 3A6DA 5GTDA 3V6MA 2QUAA 4HADA 5LB2A 1GU0A 3K0FB 1Z5WA 1LW7A 3HU3A 1XNJA 2VDJA 3PWKA 3CUWA 2O7SA 3OPMA 4QG7A 1Z8FA 3UMGA 5HF9A 2NXEA 3NG1A 3DW3X 2AKAB 2COUA 3VTKA 1E3SA 4EGFA 2BEKA 4R5HA 3OAAD 3SHOA 3OO0A 3ROQA 2J33A 3RYCA 1DV1A 5BR1A 1DO2A 1PT9A 4U6NA 2REXB 4W8GA 3PRJA 4AY4A 5AOCA 2JGMA 3BULA 5JEEA 1QWSA 1D2RA 1DEOA 3SMQA 3TXYA 2XLBA 1LLQA 2HMYB 4CIVA 5SZIA 3TLKA 1WWKA 1U2QA 1Z4LA 1G7CA 4JSYA 4LYJA 2QLLA 4ZXFA 5BT9A 3VV3A 3FOWA 4BCCA 5BORA 2ZUEA 1XU9A 4FKMA 4HJXA 4WQMA 1R8SA 1EX6A 2QXYA 1UAAA 4II2A 3TDMA 3TSWA 3EXHC 4R6WA 2BZ1A 4RESA 5F52A 5BSMA 2O3RA 4PG7A 3N8NA 1ZH0A 3QE2A 4HNHA 2D54A 4PHCA 2HEGA 2WD9A 1ML4A 4FVTA 4TXLA 2SKCA 2Y67A 5HRUA 1NHWA 1XAIA 1DDOA 3GEHA 2QF7A 3IOCA 1X38A 4P98A 1DJQA 5D7NA 3HO6A 1NX6A 1Q0PA 1G20B 2UYQA 2YOGA 3E1SA 3MBKA 4MAAA 4OH1A 3SN6A 5EEHA 3PCTA 4KX5A 1GJRA 1X3SA 4AULA 4IGIA 1LWOA 3FOCA 4LV5B 4DPKA 3TX2A 2B78A 4RXUA 4GOOD 3SC6A 4KO8A 5BURA 4CLEA 2EOAA 3LI2A 3GLTA 4DTCA 4K6FA 1E5QA 3IUJA 3NANA 2PSHA 3RRFA 1ECFA 1GL3A 5CA1A 4RLQA 4X0EA 5K3FB 5JCOC 3A58B 5CFOA 1RXIA 5LP6B 1CDDA 2FZCA 4MV8A 2CCKA 1E77A 3TQIA 3OLQA 1XEXA 4BYGA 3IESA 1AKMA 5DLPA 5AVXA 2CLIB 4QUEA 4E30A 1Y5NA 2ZU6A 1V95A 3X1ZA 3ZY4A 3PEWA 2V7WA 4CMAA 4GR5A 5ILOA 1V3VA 4LTNA 1YFZA 2VLBA 1L5GB 4EA6A 2G3YA 1FYWA 3NDRA 1KI7A 5FH9A 3USCS 3H1TA 3ZGOA 1XL1A 5GGYA 2YBEA 3V1KA 1UJMA 1XZKA 3ZGLA 1KPIA 1IRXA 1RC0A 2O5EA 3Q2OA 5EUBA 4KHZA 5DBIA 4BX2A 3AR3A 2WJJA 1XZJA 3RVRA 5SY4A 5IN4A 1A8PA 4V02A 3V1MA 2WILA 1RTKA 1Y8CA 3EG9A 4N5DA 1CU1A 3N87A 3TVDA 3L4KA 1YB1A 1HY3A 2QMHA 4QASA 2CE7A 1P1RA 3G0GA 2UZ4A 2G76A 2RHOA 1ABEA 2YW9A 3NT2A 3BMOB 4FYXA 5C51B 1RM3A 3ZY6A 4ZHQA 2AH5A 1Q2UA 2R79A 1G16A 4QOSA 1MGPA 1VLZA 1LZKA 5LKRA 3JAKB 5LZ5A 1KS9A 3UWDA 3WP0A 4JNKA 1E69A 1J9EA 4E4YA 3TH5A 2PGIA 3AV3A 3E9RA 1RW4A 3GB9A 3DKKA 3QPDA 1W5AA 2G4LA 4MKZA 1EFLA 3ZZMA 5JQGA 4ARZA 4KLRA 1CIPA 1ZO8A 1QE5A 3KZNA 5ED4A 4JVSB 3WL3A 2AQIA 2PH7A 2VNIA 3PYLA 1DAIA 4XQEA 1I01A 2ZRBA 4B79A 5GY7A 2M1XA 3WZMA 2BMEA 2Q3EA 3TLZA 4MW1A 2R7AA 4JLKA 1G55A 2FPXA 2P4QA 2QQ5A 2OOKA 3ANSA 4LXHA 1FOEB 3CX6A 4C1BA 4DADA 2NT3A 4PZPA 1U3DA 5FOXA 5HKOA 3B3FA 1TKCA 5CBPA 3NV9A 5LP1A 2DR0A 1B2RA 1F2DA 1ZM7A 3R6GA 3SKXA 3VGPA 3E0XA 2VSXA 2P79A 3NATA 3UMJA 3IP9A 4JLUA 4KGDA 3NHMA 5FV7A 1EX1A 1NN3A 4A8JC 2LW7A 3GPIA 1GN9A 2I1LA 5BOVA 3HE3A 5JADA 1HDGO 4DW8A 2FPGB 2XOXA 2YVQA 5A4KA 3GA7A 1I6LA 3TQCA 3QIAA 2CFTA 3ND7A 2UXDB 2VTBB 3HC7A 2PX6A 3D6AA 5CNIA 4UHBA 1S3GA 3VVMA 3KQHA 1Q44A 5C9ZA 1VSVA 5TVGA 1N3IA 3LKDA 3Q7RA 2IV2X 1T9HA 2Z1MA 3W6ZA 5HZHA 3UOAB 2IS2A 4CF6A 3RO7A 5JEDA 1WKVA 1NRJB 1VB5A 1UZMA 2GETA 4MICA 4QDTA 4QDUA 4X20B 3UXEA 4W7HA 1U7OA 2GF9A 2XI4A 4Y1RB 1UP4A 4DBLE 4QO7A 5F76A 4PLWA 3WDLA 3WLQA 1QO0D 4FBMA 3DVSX 1DC6A 6ADHA 3G8YA 3W6PA 1BROA 3I05A 7GPBA 5AVWA 2UUAB 3OFNA 5AUQA 1NE2A 2GJSA 3FD8A 4PSCA 4KPFC 5L4NA 2Y99A 1U7PA 3UWMA 4WCFB 3UKOA 5KZMB 2VK2A 1DTWB 2I78A 4ITRC 3G9XA 4JL6A 4XVQA 1SVIA 2RH8A 4N7MA 2XECA 5H0IA 2CL7X 1IPHA 3SE0A 2F3UA 4Y6QA 3FOBA 4KDCA 4OOEA 4U2FA 4QU9A 4W6ZA 1YOVA 2I4OA 3QKWA 3IA2A 4GX5A 5CFNA 2EZUA 1JEQA 1WZEA 2YOHA 3PPVA 2DT5A 4JQYA 3RWMB 5EWJA 3ENQA 2WZDA 4NBLA 2BUCA 3D43A 5JV5A 5KOYA 1AOXA 1CHDA 3FYUC 1H85A 4FMCB 4PS0A 2AFRA 1YK0A 1LF5A 2WU1A 4Q00A 4YJFA 2GWRA 3K9QO 1PTJC 2GA8A 4I4IA 2BL4A 1PKXA 1NQTA 4XVCA 1TU0A 2JVJA 3DXXA 1NVTA 1YQXA 3DW1X 1WHSA 3EASA 1BHJA 3GVXA 2PKRA 4IQ0A 5FTJA 4NI5A 5DCLA 3ZDQA 3WBFA 3F98A 5KYXB 2Q4DA 2VRCD 1EFTA 4HVLA 1V7QA 2Y1KA 1NVVR 3H42B 3GY0A 3GAMA 5EIFA 3S2IA 3GLVA 5IANA 3NFYA 1QDUA 1E94E 1QTIA 2QQ0A 3D7KA 4KUGA 1NKSA 3THWA 1QTQA 2QZPA 4BV9A 3AF0A 5FFFA 3P0RA 3X44A 3P4UA 1WP9A 3E70C 5EEGA 4Z7NB 5JXGA 2FG5A 2YJNA 1OTXA 4HYQA 1JHAA 2EFJA 1PGQA 2CLEB 5AW4A 2NV2B 5E1DA 1G17A 4MP3A 4FKBA 3I3OA 3QELB 1N5OX 2GHQA 2OZLA 4P3OA 2DPHA 4MQ4A 3H7AA 3RFTA 3KELA 3AIIA 2XVXA 2ZKIA 3M2TA 3MT9A 4AKEA 1KDTA 3DJFA 2ZBPA 1JALA 1V1MB 4Y0NA 1T13A 2XE6A 1A82A 3AEKB 4ZEOA 4BNLA 3K16A 1E2JA 3PCRB 1DOZA 1SQ6A 1KJ8A 3SOPA 4QC2A 4EY4A 3W1VA 1GRCA 4R2WA 1QYIA 4ECAA 1K5GA 4JI7B 2F1IA 4PTZA 4I99A 3ITKA 3VR5D 3ZD7A 3AI7A 5KQGA 2EL7A 1L2TA 3UYKA 5EJGA 1KQFA 2CK3A 4QUKA 4WFQA 4QAQA 4MJ7A 2OBLA 4MHSA 4C4XA 3TDNA 1VPVA 4MQFA 4Q4HB 1H4VB 4V0ME 3S40A 3KUUA 1S2GA 4MGHA 3K35A 3U4GA 5G3ZA 3VPDA 1I1NA 1KVQA 2B2XA 2OGSA 2RBGA 2X5XA 3CWZA 3L8YA 3QEOA 4LTDA 4YMWA 3UZUA 3SYRA 1ZJ5A 2CDBA 3VOTA 2F64A 1BHSA 1LTQA 1D09A 3FPBA 2GBCA 3HB0A 4TQAA 4K3VA 4E21A 4HAOA 1XCMA 2NO7A 3WB2A 2MOKA 1QDEA 5KVSA 1CEYA 1LS1A 3BFXA 1XUOA 5I45A 2V6BA 2WHYA 3A6ZA 4GM0A 4OK5A 1TECE 1SCUA 3AUSA 3GI1A 5COBA 4YCDA 2PNJA 2IA5A 3SVZA 3S68A 4IHKA 2NIPA 5IG2A 1UZAA 5LJIA 3LFTA 5FPHA 1UZNA 2VYNA 2D74A 1RBQA 3HWX1 3BREA 1RRMA 1RM4A 2EX1A 1XTIA 1ORRA 4NMXB 1C3LA 1BMQA 4C0KA 3F73A 3BE5A 4G9EA 3TINA 3VPHA 1L4LA 1RHUA 1UOPA 1VDZA 4EMTA 1U99A 1QS0A 2H06A 2WZBA 3FI9A 3OQPA 4FW9A 1YHYA 3RRXA 1HSZA 4IILA 2OV8A 3COZA 5KSPA 4LJ5A 3W5DA 4GVXA 4HEJA 4U63A 4A8PA 3K70B 1BIFA 5DYYA 1CY4A 1C41A 1ZH8A 2I1WA 3DVLA 2ZZNA 4MCIA 2GO7A 3T7SA 5FF9A 2IUEA 2IGTA 4DRZA 3PENA 2IYRA 3EEOA 3DEKA 1E1DA 3JQ8B 3TOSA 3IT1A 1P7YA 1QR2A 4J4HA 5JAOA 4MWSA 2PQMA 3N7TA 3GU3A 1RP7A 4K0RA 3ZV5A 3FVVA 3GAFA 2E21A 2PRIA 3PRKE 1A4UA 3HFJA 4L4RA 4DM7A 1K75A 2EW1A 3GZ4A 4OJMX 4EVQA 4MVJI 1RT9A 2QRGA 2XHEA 3KYDA 4CKXA 2CLSA 2OP1A 2Z2IA 3QJYA 4Q01A 1X1EA 1NBWB 3E2IA 5I8WA 1KXZA 3HO1A 4XVRA 1B0AA 3AV0B 2O0KA 1HI9A 1ECPA 1QONA 3BJRA 3EIFA 2AEEA 3OOHA 4UZFA 5E7JA 1KK2A 3PUXA 4YUVA 5JZ9A 2IYYA 1L1EA 1XZCA 1VKHA 4EX7A 4PYMA 1QO7A 4G97A 2PVPA 3BRCA 3RARA 2PSSA 4M1QA 1IBSA 1V16A 2GZHA 1RPNA 2PWAA 3D9QX 3IHLA 3N2EA 5E6RA 5KYVA 1V35A 5HX7A 1C4KA 3LQYA 4OKIA 3OZBA 1EA7A 1XDBA 1XV5A 2R8OA 4LS3A 4Q1AA 2H8KA 3GFPA 4F2HA 4XD2A 2CVQA 2VK8A 1GEGA 1CF9A 4WI1A 2Q4RA 4HDMB 1NPYA 1HTWA 3FA2A 3QOYA 4X97A 2ISCA 2NTEA 1VP3A 3HI6A 4FFBB 1ADGA 5FWNA 4HNTA 4G01B 2HC9A 4L9SA 3QMVA 1AQIA 1H2ZA 1VM6A 2BMWA 2BMAA 4FFPA 2Q5QA 5JYEA 3OZ7A 4NYIQ 4ZMRA 4CDRA 1ATIA 4JOSA 3QHPA 4NG5A 4R0VA 4DV7B 2D1YA 5CB4B 2O06A 4MMXB 2WWHA 3N0VA 1RLIA 4DLTA 4PICA 1E2MA 3FYSA 3HCRA 4OV6B 1EKXA 1FPQA 3MRTA 1CZ4A 2JZOA 5BYAA 4TV8B 5BSTA 1NBHA 1Y5LA 3SS8A 3OHSX 4RHEA 1XOIA 1Y3HA 1TVKB 2FN7A 3IP7A 1SUBA 4BLOA 4CKWB 2GZDA 2OXEA 1E64A 3B1JA 3PA8A 2CJWA 4RPHA 3WNVA 1I36A 3AF1A 5A4AA 1L5QA 3HR8A 3VZPA 3TEMA 2R8EA 1J00A 4B6FA 5HVNA 1Z82A 2ZAGA 2ZPUA 3BZBA 4MYUA 1NNSA 3LYUA 2L0XA 2OLKA 4GGPA 1KJQA 2Q3CA 3EA4A 4L3WA 4LF7B 3KJGA 1QLHA 5A0TA 3R3WA 2FW8A 4IVPA 2YUJA 2A58A 3C3PA 1CB0A 2C4WA 1B1AA 3R0VA 1VE7A 3VHQA 4Q7QA 5IDWA 3D59A 4ROSA 4C4RA 2QR5A 2FDCA 4HNGA