5CCXA

Structure of the product complex of trna m1a58 methyltransferase with trna3lys as substrate
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
289
structure length
283
Chain Sequence
MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit
total genus 73
structure length 283
sequence length 289
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5ccxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ccxA02
3T7RA 1ZQ9A 1KR5A 3FRIA 2PX2A 2ZIGA 3LPMA 3R3HA 4YUWA 4RTOA 4OX9Y 3NW9A 2ZBPA 2BH2A 5DT2A 5HIMA 3X0DA 3HVJA 3Q7EA 4GC5A 4FSXA 2G8NA 2YTZA 1JG2A 4O29A 4QVGA 5F2OA 3A27A 4DCGA 1JTEA 2YX1A 2JHPA 1X1CA 3GGDA 3LX6A 5E1OA 2H11A 4QQNA 1JTFA 4AZTA 3SVZA 2QRVA 3TKAA 2ZIEA 2ZVJA 4FP9A 3JWIA 2PGXA 4FT4A 2PXAA 4CTKA 4LWOA 4EQZA 4QDKA 2ZULA 5K0BA 2P3OA 4CTJA 2ZFUA 4MIKA 3DH0A 3HCFA 2FPOA 3HCEA 2YXDA 2GH1A 3R0QA 4PYIA 2HTEA 3DMHA 2HV9A 3JWGA 4C05A 2JH8A 5F2NA 1SQGA 1VLMA 2FRXA 1IY9A 4IWNA 4XUCA 3ER9A 2V7EA 5DXJA 3B3JA 2GB4A 1Q0TA 3E05A 3UJCA 4RSRA 4YUZA 2Z6AA 3UJ8A 1XTPA 4CWAA 3GJYA 3ELYA 3B3GA 3VC1A 2ZZKA 3AJDA 4Y30A 1RI5A 4ATNA 1L3BA 4WXHA 2IH4A 3EVZA 1RI2A 4ER5A 3EVFA 1T43A 4EK9A 2ONYA 3LL7A 4QDJA 1ORIA 3IEIA 4C07A 2I9KA 2FK8A 3LKDA 4P58A 2PKWA 1ORHA 4FZVA 4RTKA 5EIWA 2QM3A 3HA5A 3O7WA 4X63A 5C1IA 3CKKA 5CVJA 5CIYA 4IV0A 2PY6A 3OE5A 2XBMA 2FK7A 2PJDA 1P1CA 3LDFA 4LG1A 1I1NA 4KVZA 2V74B 3LHDA 2XYRA 3NJRA 4C4AA 3OPNA 1BC5A 1QZZA 1YUBA 3FPEA 5EKUA 2F8LA 4POOA 1O9GA 3P9KA 5EMKA 5KS2A 5EC8A 4PINA 5F2KA 3IV6A 2NXNA 5KQRA 1NW6A 4OBWA 1XDSA 5G02A 2CMGA 3VC2A 2G70A 3ELDA 2Y1WA 2PX4A 4C03A 3HP7A 4BLVA 4QTUB 3DP7A 2YXEA 4DKJA 5LQCA 2ZZNA 4RTPA 3KQSA 3FUWA 5FWDA 5DM0A 3KQTA 5LSAA 1EAMA 3OCJA 3SR4A 2HNKA 1SKMA 2H00A 3FRHA 3Q87B 4RV9A 5K0NA 3MQ2A 3UJDA 2BM8A 4AUKA 4C08A 2PWYA 4M36A 4QQKA 4NECA 5DRTA 2GS9A 2I6GA 3DTNA 4IV8A 3T7TA 4BLUA 5LQJA 3CC8A 2PXXA 4GOOD 3THSA 5DWQA 3G8BA 3GRZA 1QYRA 5K8VA 1IM8A 4HG2A 1PJZA 1MJFA 1NW5A 3K0BA 4QPNA 5LQUA 3KPYA 1JQ3A 4X1OA 2VP3A 3LSTA 5DXAA 4BP1A 1EJ6A 1NBIA 1XJ5A 2AOUB 2BR4A 1G8AA 1QAMA 3GO4A 3TM5A 3UJ9A 1NKVA 1N7IA 3G7UA 2O06A 2P1DA 2P8JA 3C3YA 3UBTA 1JG3A 2IH5A 1KPIA 4QPPA 3B89A 1MHTA 3ELWA 3KQPA 3NMUF 3DXZA 5DM1A 2IP2A 5H02A 3EVCA 1L3CA 4HTFB 5C0OE 1EQAA 5K0EA 3GU3A 4PIPA 2PV0A 4RTSA 3MAGA 1M6EX 2B78A 3PT9A 3HVHA 1EIZA 3FPGA 3REOA 1SUIA 5FHRA 3EMDA 3I5UA 4V0QA 3G88A 5FWAA 5GWXA 3BGDA 2PBFA 4XUDA 5EZQA 4YUVA 4C06A 5GIOE 2P7HA 3PFHA 1AQIA 1UWVA 2CKDA 4OA5A 3EVGA 4HGZA 3SSNA 1D2GA 1G55A 3CCFA 3HEMA 3QOXA 3SM3A 4YV0A 4F86A 4YMHA 3KQYA 2XVMA 1WXXA 4C04A 4AZVA 3P9IA 3BUSA 1SQFA 2FHPA 5CCXA 2YXLA 3BGIA 4LWPA 4RWZA 5EHGA 2YVLA 5GIPE 1NT2A 2ZCJA 2BM9A 2VDVE 4OQDA 4R6XA 4MHTA 3CJQA 1VIDA 3VYWA 3HCAA 3GNLA 3EVDA 3IYLW 4X41A 5LQKA 3UFBA 5EEHA 2PSSA 3IHTA 3R9XB 2ORED 3RODA 5CVDA 1AV6A 1P91A 2DULA 1D2HA 3NWBA 3HA3A 5CD1A 4E32A 4KIFA 3O31A 3I53A 3MB5A 5E1BA 1NBHA 3C3PA 3EGEA 2FCAA 5BXYA 2B25A 1X1BA 2GLUA 4BY9E 2LD4A 2FYTA 5T64A 2A14A 2XVAA 3CVOA 5E1DA 2P3LA 1I9GA 3KR0A 5FTWA 1VPTA 2P41A 1UFKA 1R6AA 3OE4A 3TMAA 5HFJA 3KQVA 4DQ0A 3UJAA 4ER0A 3M6WA 3HCBA 4XCXA 3LCVB 5GP1A 4E2YA 1KYZA 4QTTB 3B3FA 4H0NA 3UA3A 2HR1A 2H1RA 1XDUA 3LDUA 5EOVA 2UZ4A 5EVJA 3G2PA 4P7JA 7MHTA 3SSOA 3DOUA 3E8SA 2JJQA 4HGYA 1KP9A 1YZ3A 3FYDA 5C9ZA 1B42A 4GOMD 2AN4A 5ERGB 2AOXA 3UZUA 3UWPA 3AY0A 3LGAA 1JSXA 2B2CA 3HVIA 5LQRA 3FPJA 4V0RA 2EX4A 5DSTA 1HMYA 3RIEA 2Z6UA 3G2MA 3CJRA 4DF3A 3KKZA 5FA8A 1KPHA 3KU1A 4MTLA 2ZWAA 4RVHA 4AX8A 3M4XA 4OBXA 4EVIA 2ZZMA 4ER6A 3C6KA 3T7SA 3FUUA 4HTFA 2ONZA 3P9CA 1F38A 3OFKA 3FTDA 3ID6C 1FP1D 4DA4A 3B7PA 2C7RA 3TRKA 4GUAA 2PT9A 5K0GA 3TFWA 3TLJA 4E31A 2Q41A 3PLAE 3V97A 3JWHA 8MHTA 3GCZA 1G60A 3SGLA 4A6DA 5KYGA 3BXOA 4ISCA 5KVAA 1NV8A 4KDCA 1BOOA 3BZBA 5CUQA 3TPZA 2YQZA 3MTIA 3BWBA 2QY6A 2BZGA 4P7KA 1RJGA 1YZHA 3SXJA 4PYMA 3EEYA 3FUTA 4DM3A 1SG9A 3ANXA 3L8DA 3GXOA 3BWMA 2WA1A 5E8JA 5FADA 3KQQA 4M7RA 5P8WA 2IH2A 3KR9A 1SUSA 2PXCA 10MHA 5BW4A 1ZGAA 3O4FA 1OR8A 1R00A 5KQSA 5EQJB 4E70A 3EEOA 1NW7A 2EJUA 3OU2A 5T67A 4P7GA 3OU6A 5DRYA 5GM1A 3V8VA 3F4KA 2VDWA 3KPJA 4F85A 5K01A 2G71A 2YUIA 4LECA 4A6EA 4B17A 3C6MA 2JH9A 2AOTB 3PFGA 4F84A 5E1MA 3ME5A 5K0CA 1DL5A 3DMGA 2ZIFA 3A7EA 3KPWA 5ICFA 3G5TA 3M6UA 5HOQA 1JG4A 3BT7A 3ER8A 2PT6A 2BR3A 3HM2A 3M70A 3E23A 1ZHFA 2PX8A 5EMJA 3TKYA 5IKMA 3GWZA 2C7QA 1JR4A 1BHJA 4R8RA 2XYVA 2K4MA 3MCZA 1FJXA 5EMLA 2AS0A 1AF7A 2IDJA 4P7FA 4PYQA 1DCTA 1RI1A 3UJ7A 3DUWA 4CKCA 4PYOA 4PIMA 4HC4A 3GRYA 5T6BA 5U4XA 2CMHA 1PRYA 3PX3A 2KW5A 3PS9A 4DCMA 3P2KA 5GM2A 3UJ6A 5HZMA 2UYOA 3DXYA 5BW5A 4PYLA 1D2CA 4ZTBA 1U2ZA 1I4WA 3FUVA 3FPHA 3PB3A 3RW9A 5K03A 3NVKI 2VDUE 3DMFA 3P8ZA 4RTLA 1N2XA 5K0FA 1L9KA 3SMQA 2IBSA 2AR0A 4YV1A 2NXEA 4PYJA 9MHTA 1P39A 1RJFA 1X1DA 3GDHA 3OFJA 4CXMA 1HNNA 3HCCA 5FQNA 5DM2A 2I7CA 2QRVB 5JUWA 2CWWA 4GBED 3SSMA 1BKYA 2GA9A 2OPBA 3A7DA 3M33A 5BP7A 5GOZA 2P40A 1XDZA 1YB2A 4FGZA 2UYHA 5JR3A 2UYCA 5MHTA 3LCUA 2NXJA 1WXWA 5DX0A 1XCLA 2ZWVA 3JWJA 1JG1A 4RVFA 5EMMA 3G2OA 1RJEA 2P7IA 4G56A 5HIJA 1FBNA 3I9FA 1VL5A 4L7VA 3UA4A 4GF5A 2C7PA 2NXCA 4GC9A 4E33A 1TPYA 3EVEA 3K6RA 5EKXA 2OKCA 4KW7A 1R8YA 2B9EA 1RI3A 4KRGA 3TR6A 4XUEA 4PGHA 4EMSA 3BWCA 3QOWA 5E9JA 2OO3A 1XVAA 1JQEA 2PWPA 2UYQA 1QAQA 3G5LA 2VZ9A 2AN5A 5IH3A 2OXTA 1NW8A 3R24A 2G1PA 1XCJA 5DTRA 3BKXA 5CVEA 5DX1A 4GEKA 1YFJA 4Y2HA 3TM4A 4CKBA 2O0LA 4E2XA 2P3QA 2HMYB 2ZBRA 5DM4A 4RTRA 3TOSA 3KR1A 3THRA 4KDRA 2IGTA 3DLCA 2AOTA 4EKGA 4PWYA 3FTCA 4E2ZA 4FSDA 3FZGA 5EIFA 2WK1A 1X19A 4R6WA 1Y8CA 4K6MA 1WY7A 1INLA 4U7PB 3P2IA 1DUSA 3UJBA 3CBGA 3HVKA 5E2AA 5B1SA 3EVBA 4FT2A 5LR6A 3G89A 3LBFA 2Y1XA 3NDIA 3B5IA 4GOND 4PGGA 5EZSA 1G6Q1 2ESRA 3KHKA 4DMGA 1N7JA 3QV2A 2OB1A 4HH4A 4CKEA 4R05A 4EKIA 3GRRA 2DPMA 2NYUA 2R6ZA 3FUXA 5FCDA 2B3TA 5GINE 3H2BA 3NTVA 3LCCA 1QAOA 4RTJA 2JG3A 3E7PA 3LDGA 3S68A 3HNRA 1Q0SA 5CVUA 5EHIA 2NNWB 2WA2A 2AVDA 3C0KA 1NV9A 3LECA 5DLYA 1R8XA 3MCTA 2XYQA 4RVDA 1VP9A 3G2QA 4FS8A 5CVVA 5CM2Z 3D2LA 5DTQA 5EG5A 4X60A 3CJTA 2C7OA 3DR5A 3FTEA 3KQWA 1KHHA 4RTNA 1JSZA 2ZSUA 3FYCA 5HEKA 3LBYA 3P71T 2AVNA 2HWKA 3NDJA 1FP2A 1M0EA 1VE3A 3MTEA 4RX1A 5E8RA 4RVGA 2OBFA 2JHCA 2OZVA 4GOLD 5K09A 3GIWA 1AQJA 1L3IA 1O9HA 4M37A 5LQAA 4RTMA 1G38A 5K0LA 2AOVA 4E30A 1ZGJA 5E2BA 1SVUA 1XXLA 5DSXA 5FULA 2JHAA 3KPVA 3OZSA 4QVKA 5HILA 2VS1A 3NVMB 3KR2A 3OZTA 2G72A 3ORHA 4HRAA 5EEGA 1JQDA 2EG5A 3ELUA 1Z3CA 1KXZA 3I58A 1H1DA 1X1AA 2O05A 3DLIA 5EPEA 3U81A 5LQNA 2E5WA 2ZLBA 2ERCA 2Z6QA 1FPQA 1L1EA 3GRUA 3EVAA 3A26A 1YFLA 2YR0A 4PYNA 1UIRA 4PYKA 4E2WA 3EPPA 4PCAA 1R18A 3HTXA 4R8SA 5FQOA 5K0JA 5E9WA 2ZW9A 1KYWA 1G8SA 2AZTA 2EFJA 3P9NA 4IKPA 3SX0A 4OA8A 2O07A 3M6VA 3A4TA 2AOWA 4RTQA 4OQEA 1NW3A 1WG8A 3GRVA 3HCDA 2ZTHA 2PX5A 5CCBA 3BWYA 4AZSA 1VBFA 1IXKA 3AWIA 4BP3A 1WZNA 2GAFA 4DZRA 2IIPA 3AXSA 5FHQA 4KIGA 2GPYA 4U7TB 4BLWA 3I64A 1QANA 1RJDA 5D1NA 4YUYA 3FTFA 2IFTA 1RI4A 3NWEA 2PVCA 3DXXA 3FPFA 3OU7A 3R6TA 1F3LA 1P1BA 4YMGA 4YV2A 3BGVA 1V39A 2BR5A 3TQSA 3DULA 3EMBA 3G8AA 3EGIA 2OB2A 2EJTA 2IPXA 3LKZA 5ICCA 4PNEA 3PVCA 2IDKA 4WVLA 2ADMA 1M6YA 1VQ1A 3KQMA 4X61A 3EGVA 1O54A 4PONA 5D1HA 2AN3A 2NP6A 1NE2A 3P2EA 3MERA 2ZBQA 4RYLA 3A25A 2AOUA 2PLWA 4KWCA 5DTMA 3BKWA 1KIAA 3KQOA 1KPGA 1YF3A 1EJ0A 4UOEA 2OY0A 3HA7A 1TW2A 3OZRA 4JXJA 5E9QA 5FA5A 1WS6A 4AZWA 5HIKA 5DPMA 2P35A 3MGGA 2NP7A 1ZG3A 4ER7A 5DX8A 1EG2A 2O57A 2I62A 4MWZA 3PTAA 1VP3A 3WSTA 4MQ4A 1TW3A 2QYOA 4GQBA 4Z2YA 4ER3A 3M6XA 3ERCA 3AXTA 5EGSA 2OYRA 3CGGA 2QE6A 5FUBA 1R74A 5ICGA 5M5BA 3KPUA 1ZKDA 2CL5A 3T0IA 4YUXA 4FR0A 2R3SA 2N47A 3VSEA 5HIIA 2IBTA 3P97A 4PCLA 3PX2A 4HSGA 3MHTA 5ICEA 4M38A 5K05A
chains in the Genus database with same CATH superfamily
3AUYA 2D54A 3B8HA 1J56A 3IEPA 3PQ6A 3LZ6A 4OX9Y 4MGZR 3ZHCA 1J6UA 4ENWA 1EE9A 1SUBA 3MUNA 2QRLA 1XDBA 4A82A 3EXEA 5F7ZA 3GY0A 1R9MA 2GERA 1ECCA 4DCGA 5KZMB 2GN2A 5REQB 3LX6A 1S01A 1ZMXA 1GZ4A 3DBRA 3H6HA 2QRVA 4L95C 5D87A 5HKOA 2CY0A 2PGXA 2X2OA 1Z8FA 1KMHB 3GEGA 2WJ6A 4BVBA 3BQMB 1ZD3A 4URXR 1XTBA 3AR7A 4MUIA 4X5OA 2EC5A 2HF9A 1I6MA 1EQ2A 2I99A 2FTKE 1C2YA 4RH0A 3FH0A 3UBMA 1AK1A 4P33A 5D6XA 4JEHA 5DXJA 4WA7A 5EVCA 1WA5A 4Z4QA 4OQ4A 1JT9A 2CVHA 3FWKA 3UJCA 4HRXA 3WGVA 2G3YA 1OLUB 3KDAA 2J6IA 4ZCRA 1XTPA 4I0WB 2Z6AA 1PZEA 1US8B 1JUDA 1L4UA 1QONA 4B6GA 3DFFA 1OILA 2YZ2A 4Z1MD 4PZCA 4H7HA 3RKUA 3CSDA 5IJ9B 2ZOSA 3LG2A 3U5TA 2C29D 4FOOA 2XMGA 3COWA 5ECYA 5P21A 2AN1A 2D6FA 4GT1A 2W4MA 4C6TA 4U7FA 4RVSA 3R6WA 1TL7C 1GG8A 3TR0A 1P1CA 4YRQA 4LG1A 3WMFA 4Q48A 1K7FB 2I7DA 5KSOA 1W35A 3FE2A 4UVIA 1OB5A 3LYAA 3VO2A 2VDPB 4PSAA 1M8JA 3OPNA 3FYHA 1YJCA 4MRVA 4KR9A 5GZ3A 3PL1A 1QKIA 1YZGA 2PMKA 4FHGA 4IYJA 2VDKB 1S4MA 2EIXA 1Q0QA 2WBLC 1AB6A 1NW6A 2G25A 4RA9B 3DKPA 4IZ6A 5F4BA 4Z99A 1C4XA 2QTCA 4ZP1A 4A8PA 1ZEMA 2Y1WA 4B32A 3HP7A 5H82A 2YV1A 5J4KA 4LTMA 1PDOA 1UQUA 1EZ4A 2OHIA 4WY8A 2NV2B 1RXVA 2F2TA 5TIIA 2P90A 4PO1A 1OI2A 4ZTUB 4UU1A 4DCOA 5EIBC 2CDRA 4C4YA 3VR3A 4D98A 4CMEA 4E5SA 2BM8A 2VUHB 2PWYA 5BPHA 3F7NA 1I24A 4LYDA 1MFPA 1Q3TA 1HT2E 2NU8A 4MB0A 1KH1A 1PL7A 4K88A 2VT6A 4ZDKA 5JALA 2JZOA 4TTRA 5LYYA 5BWNA 4RQUA 1MO6A 3R0IA 3T1HB 4A0RA 3EEIA 1EFDN 4Z86A 2VHCA 3Q9LA 2CBGA 3VR6H 2QUJA 2UZIR 1E7SA 1LNQA 1XWWA 3VVLA 1M8KA 2XGMA 4NCNA 3WV4A 1YXMA 4F4FA 1LD3A 5HTOA 3L7NA 3TLEA 1RIIA 2P8JA 5CFRA 4WGGA 1U7DA 3CGWA 1G8MA 4JP5A 1FUYB 3QF4A 2Q28A 4YS6A 3HG7A 5BNIA 2LCIA 1E6KA 2JD2A 4BWYA 4CLRB 3T9FA 3JASB 4JFAA 7YASA 3MWDA 5KINB 2F1JA 1EIZA 2FW9A 5KX5B 5KVSA 1LPOA 5H16A 1DCMA 4AJ4A 2O7RA 3SVLA 2YNMC 3DMDA 1PKXA 4Q7LA 4I55B 3FVVA 1B41A 2DX7A 3N6XA 5ES4B 3EAQA 4ZHSA 3B36A 2XKAA 3ZE0B 3QBTA 1NP6A 5AJWA 3T1VA 1F2VA 2JFOA 2J3LA 3SM3A 2FZKA 4F86A 3DD5A 3FFTA 3PSAA 4L6CA 1KDOA 3C5VA 1LVHA 2D2XA 3THYB 1R50A 3QQPA 3GPBA 4C0BA 2WFZA 5BSMA 1ADGA 1BQEA 1SOUA 4CM9D 4QYSA 1Z0SA 4HWKA 1AT1A 1Q0HA 3ZDZB 1Y6QA 3ADBA 4TVSA 2HDHA 3VAYA 1PWHA 4X41A 3V4PB 3P9ZA 3C3MA 2VSQA 2WHPB 4CKWB 1YACA 3DC7A 3RK1A 3HDYA 1UBHS 1QH1A 1VJDA 4BIIA 1PYGA 4BCCA 2BW0A 2DHRA 3VO9A 2JGAA 3C3PA 1FYFA 1CEYA 1NFQA 3R3XA 3RDPA 1SXHA 2QI9C 4BY9E 5JCZA 2BM0A 4BLSA 4BKPA 3E35A 4YJFB 5E1DA 4FFVA 4G1CA 5DEOA 4BCDA 1OH7A 3DDCA 3F8WA 2O3JA 4H0CA 3QKWA 4RPKA 1P2TA 2WU8A 1SQ5A 1VPTA 2P41A 2CK3A 4IQGA 4W1RA 1N6KA 2XRYA 4Z8YA 3E7DA 3OE4A 5FP0A 1L5LA 1VM6A 3GJ6A 1FXWA 1TCAA 3UJAA 4AYWA 1ZC1A 3I0MA 4XX0B 1BEEA 5EIAA 4N65A 2ZU6A 5TPZD 2DBRA 4L0CA 2W0MA 2E1RA 2XT6A 3L1IA 3LY8A 4HF7A 4QTTB 1HDRA 5F9HA 3AKYA 2JAXA 5E0OA 2FQQA 2FX3A 2FA9A 3GRCA 1Y1RA 2JKYA 3R77A 4FXOA 4JLWA 2IT1A 1TA4A 1FRVA 4HLQB 2CW5A 2G1UA 2EZ8A 3IXMA 2C7VA 4JGBA 3K05A 3FD8A 3LXRA 1N6IA 3OQHA 4KG7A 4ZALA 1A9TA 1JSXA 2BKXA 3FUCA 3LY7A 1B8PA 4XGQA 1V9SA 3DEKA 1EFRD 1VPVA 3JYLA 1XLWA 4H7PA 1R4ZA 4I5FA 5DSTA 4BNDA 3QY9A 3N2KA 2LKDA 3O83A 3RTAA 4JLNA 1F60A 3WYBA 2VRBA 5LU8A 1NURA 4FBMA 4RVHA 3M4XA 3OCCA 1P7ZA 3N70A 4ZRMA 3W2GA 1A50B 1J07A 4KQ6A 3SCZA 4ER6A 4AM8A 1YS2X 3KS9A 4KBFA 1ZM3A 1A4IA 3AQ4A 3NNNA 4WSOA 1JDZA 4IIFA 4WQMA 2X8JB 1RQXA 3EDMA 1V8ZA 2X1VA 3WAGA 1CS4C 4RKEA 3I6YA 2ZSEA 5K8UA 4I36A 1KDTA 1R15A 1WKBA 2P4UA 2FGJA 2QN9A 1Q22A 3N9IA 1DX9A 3OFNA 2H2WA 1QGYA 3K0AB 4GM4A 3RVOA 3TPZA 3FWHA 1C3EA 1NR7A 1XQXA 3QVUA 2CJFA 5HKLA 3BWBA 1TMGE 2CLMB 4G25A 4K3VA 4CPDA 2ZK7A 1D5WA 2QM8A 2BSAA 4IDBA 3EISA 4ASUD 1UH5A 4HX9A 1B4DA 5EQJB 2BZ1A 4CVNA 2EJUA 5CFNA 2ZAGA 4PXAA 5K3FA 5EKSA 3J7AC 4ZAYA 3FNEA 4MK4A 1YDEA 2DWQA 1SQ6A 4D79A 2GAOA 2QTTA 1V2HE 5K0CA 2X1HA 3V8PA 1QOPB 4JC0A 1OFUX 4CBVA 4KO8A 1PNQA 2PSJA 4MVJM 1WXHA 2GNOA 2VHYA 1J90A 4HWOA 4Q7EA 4ZZIA 1PVOA 5A3QA 2B0CA 2CXNA 2V7PA 4PS1A 1L5QA 4ZCQA 3ZCRA 4JYMA 3TLMA 4RVCA 4EZBA 3JARA 2VRCD 1TM5E 5LJLA 2GN0A 3BZWA 1YE8A 4M0KA 1X87A 2J31A 3OZWA 3R7WA 3LAWA 3B1VA 5KOJB 3NONA 2IWRA 2JJ8A 1D2CA 2OHHA 4ZJYA 1KZHA 3N8KA 3RUDA 4F2DA 5ITZB 4NZYA 2GXQA 4PXYA 4PLVA 2WABA 3I76A 5CBKA 4KUHA 1DAHA 2JLZA 1P72A 2AR0A 3LFTA 3HLTA 3L77A 3SC6A 2OESA 2GXSA 2PVPA 3IIKA 3F0TA 4KE6A 4JXZA 1UBGA 1MB3A 3PD1A 4NOLA 5DM2A 4C1NA 1RHKA 2B4YA 4TS9A 2QVYX 2Q2OA 4GBED 1OXUA 4X1YA 5G1NA 3CMMA 3C7TA 4ROSA 4WUVA 1QV7A 2TMDA 4RCVA 5CJ2A 5EZ5A 5TS3A 5BORA 1VJ0A 3EGXB 3I2KA 4IICA 4I9NA 3CH6A 4NICA 1JKFA 2VDMB 5TQ0B 1OXTA 2WJJA 1RJ9A 3JWJA 2GJ9A 2VTKA 4L5JA 4RIFA 3BWVA 5IXJA 4TYWA 2BCGY 4WESB 4TKLA 3DTVD 2F4NA 3IJRA 3IT3A 2ZVQX 1DVRA 4B4WA 4YY3B 2QUKA 2IDMA 1GKYA 4MUXA 1OI4A 1WSBA 2WJGA 3PKIA 4R8LA 13PKA 1N5OX 4RXMA 4DNFA 4GZ5A 3PZBA 4L4SA 2FDRA 4D80A 3GQVA 4JVSB 2FJPA 2O23A 3IVCA 4GYYA 2XGGA 4P4TA 4PGHA 3R5KA 2NO0A 5FEMA 4YP5A 4CMKA 1G3IA 1JQEA 3T15A 1KYQA 1Z22A 2VZ9A 1MENA 3M83A 4CHTA 4EARA 3L8YA 2OM2A 1IXSB 4DCUA 2KX7A 4BQFA 5BVGA 5MN6A 4ESHA 4P31A 2IXAA 1MTZA 1WMEA 2PHZA 3TL6A 2HX1A 4CDGA 4L8VA 1TF5A 3A9CA 3CUEF 4DJTA 5JAUA 1ANKA 2EQBA 3VC3A 4BZZA 1E7WA 4CM5A 3GGJA 3R3ZA 1IN8A 1C1XA 3EIHA 2BGLA 4H16A 4YDQA 2CSUA 4CU2A 4B3TB 1NMZA 5EIFA 5CW2A 2XT0A 3UMJA 1ZJJA 1I3OA 1OFUA 3HBFA 4HOYA 4L3VA 4K6MA 4OGLA 3ROEA 3QE0A 5CT9A 3N5KA 3VDXA 2G5CA 4GSKA 3H2GA 2C04A 2J41A 4G89A 1XIVA 1BA2A 4JR0A 5EMHA 1Z9BA 5EKTA 4EKYA 4UM7A 1G6Q1 4G26A 1P7VA 2ZKIA 4I5EA 4QO7A 1Y9DA 1NATA 1Z0JA 1W29A 1WCV1 1T3TA 2Y2VA 3OQBA 3KKEA 2Q0HA 2VAWA 5DJ5A 3WK6A 4D9NA 2YWXA 4GX1A 2FZLA 1MAWA 4UPDA 3KHUA 1PQWA 2GNPA 4HDRB 4WK0B 3S68A 4W6QA 1SHJA 4HEQA 1Q1NA 1MC1A 4AS1A 4DT1B 3WBKA 2L69A 3PNSA 1E1NA 1MJGA 2QUHA 2DH5A 4MQUA 1CFZA 4RCYA 2IEGA 1SXJE 2X23A 4ML3A 3U7QA 3WX0A 3WYNA 4D4IA 5JASA 3E3OA 5JSFA 1P5JA 3HJGA 3U0VA 3TUIC 1B14A 3NDJA 2GCGA 4DCVA 1Q0LA 2Q8NA 2GZMA 4HQNA 4NZZA 3E1KA 4J7AA 2PH7A 2IV3A 2DH6A 2L42A 5JECA 3CIOA 2HCRA 1FQKA 1WF3A 4COKA 2CLOB 2HI0A 2O0MA 2PDAA 4A16A 3V2UA 2ASVA 2EL7A 4ZKDA 3AMVA 1QGOA 4LPKA 4NMHA 4I50B 2JCSA 1RPAA 1WX1A 3MJVA 2NTJA 2XOEA 3BFJA 3R1IA 3R0ZA 4Q12A 4BKMA 5B6JA 1RMTA 3PD0A 1QG0A 1JDSA 1A9YA 3CNEA 4MPRA 5E2IA 4CKCB 4RENA 1RIFA 2BFEB 1JB1A 1ECPA 2CLEB 3LT1A 4RH1A 5AFSA 1MO2A 2YWCA 2J4CA 4RD0A 4JBYA 1K97A 4FYPA 3H6GA 1SEPA 5C1BA 1W52X 4G9BA 1G7CA 4Q3BA 4EPXA 1WNFA 3J81k 3T7EA 2B1IA 3I34X 4OA8A 3TTYA 3Q2IA 1XA4A 1FYWA 3AX6A 3FMVA 4PG6A 4RTQA 3BHMA 1G42A 4MUHA 3GRVA 1J0AA 1E5XA 2GK4A 3Q8XB 4IGEA 2O1EA 4ALMA 2QL6A 1QB8A 3TJZA 4B3CA 3MXOA 4GKAA 2VUSA 3T99A 1HDYA 1NUPA 5IK2A 4MW2A 3DXXA 3WLFA 1IBMB 1W8DA 5AT1A 3FHOA 5ISMA 3W5UA 4H6PA 4QZVA 4GMHA 4D0LB 3EMBA 3CEMA 1PYDA 1ZHOA 5CBPA 3PNOA 2XAAA 3NV7A 4DN6A 2OXIA 2WJ4A 3H2KA 1XZFA 1OX4A 4JN6B 3UMYA 4UVEA 5F1OA 5HJEA 2A5JA 2OL4A 5CDFE 1FBTA 121PA 1JHZA 1KYYA 4PGAA 3BRSA 1FLAA 1JEEA 3NAMA 1ISFA 1Y4UA 4GHWA 2CLHB 5L7TA 5EWJA 4ON9A 2IZOA 1HYGA 2QYTA 1LS1A 2W2MA 2WILA 3IJ5A 1TQ2A 4IWXA 3AV0B 4OUKX 5ILGA 2JJ2D 5HCNA 3UG6A 4EPVA 1E9VA 2XWPA 3BK7A 4DDWA 5EPOA 2W93A 1SZPA 2HFKA 4NCKA 3VU9B 4E14A 3H2SA 4JWTA 2O57A 4B3FX 2BIFA 4MWZA 5E6RB 1XT6A 2Q6LA 4ED9A 3Q7IA 2VNSA 4JBWA 1GRNA 2J7PA 2LE0A 3NJ8A 1L5HB 2WZCA 3R75A 2EX1A 3B2QA 5JAQA 3NBMA 3DBRB 5FPKA 5DXFA 3WLPA 2WUDA 4EL5A 1Z56C 3CLUC 2H18A 2X0EA 4X7MA 4A1OA 3RF6A 1OKKD 1VSTA 2R3SA 2QVZX 2KE5A 1BJRE 3VMMA 5L9AA 2X9GA 3FLMA 4YLGA 4C5CA 5DHSA 1NR5A 4Y2UA 3O9MA 2HPHA 4JD5A 1JQLB 4KMSA 2W6OA 2GAJA 3UUWA 2HW8A 2XH8A 3L02A 1Z2DA 1Z73A 2HIAA 3KLNA 1XWFA 5HRUA 3U4DA 4DR2B 5CDUA 3U7FB 2JCYA 3CX6A 1TM2A 4Q21A 3SKXA 1ML4A 3S2YA 3RS5A 3BK1A 4KYUA 5E1OA 3D3QA 5J2TF 3C85A 2R4UA 2V6IA 3O8OB 3JQ9C 4NQRA 5EFOA 4CW7A 4EQZA 3BVPA 1IBKB 1TEVA 1ODSA 1U7PA 3ABZA 3HCEA 3FMFA 1ZI6A 1NJ5A 3NKVA 1KFEB 3PHBE 1ORRA 4J7CA 2C42A 3L3BA 4YEDA 2YV5A 3LA8A 3QIAA 5AW5A 4DDHA 2ZPTX 4IWNA 2XUPA 4FFNA 4LYGA 2HCJB 4RD6A 5KJCA 4DR3B 1V35A 3H9GA 3KJFA 1JEJA 5J2TA 3CKLA 3KUCA 3G8CA 4DLAA 3A6EA 4NBLA 2EFYA 4EO4A 2PVSA 4AKIA 3SY8A 2CUKA 4QYWA 5ELMA 1J1IA 1CSEE 1COWA 2GARA 1W44A 1CQIB 1DRJA 5EQTA 5FJIA 3FNGA 1O5IA 2BONA 3OIYA 4IOMA 1GPAA 3OD5A 3OZAA 5FPPA 3LKDA 2QVLA 3L04A 2FR1A 4HZUA 4HLDA 4TTPA 4O4JB 3RBAA 1FQOA 2E49A 2WMYA 4HUTA 3P94A 1MB0A 2PA0A 3ENQA 4DADA 2FWMX 3HR8A 2XYRA 5TPWA 3A2LA 1KC1A 5DCLA 4IH4A 4C4AA 2YASA 2AYZA 1JEDA 2RCNA 5TMEA 4M98A 1K7YA 1XDWA 2MR6A 4P6VF 5T4HA 2C82A 3TLXA 3ETDA 4BVFA 1L7MA 3WLEA 1SELA 4MS4A 3AL2A 4NXNB 4IMIB 5FA6A 2O5EA 1E1YA 3FCYA 2C9CA 3AG6A 1LBEA 3V9PA 3KB2A 2FPPB 4DVJA 1WCIA 1V1JA 3R44A 5B6PA 5JDCA 3IHLA 2WB4A 2YKGA 2OLEA 1E2QA 2YXEA 4M0FA 3BMOB 2DR3A 4RMHA 4WI1A 3CR3C 1M5UA 3EODA 5H68A 1VPWA 1WPRA 1YVUA 3ZZUA 2A9PA 1BD4A 3IULA 1CC1S 1M6VB 4MYSA 4CF7A 3PUIA 2D2VA 1PEDA 2E3JA 1KO1A 2I3DA 2DGDA 1DRVA 2IPAB 2FUG1 1HFEL 2WUWE 3CWQA 4R68A 4P32A 2YV2A 4RPCA 1I6KA 3NANA 3T3DA 4CM6A 4Q4JB 5AVVA 2CHQA 1PV4A 5IYZA 3CZ4A 1VFPA 3ENKA 2W8BB 1XL0A 3AV3A 3GRZA 3LUPA 4I4TF 1PGOA 1UODA 2VDLB 4HG2A 5B7GA 1M0SA 4WCFC 2ZETA 3ZG6A 1H8ED 2E6KA 3PR1A 1VI6A 2RGWA 3JR3A 1BDHA 4AY2A 3T7AA 1EJ6A 3NBKA 1Y4DE 1ZK2A 3ULKA 3GFBA 3GLFA 3O1IC 1ZXLA 4NI5A 2JGIA 2R1VB 2YC2C 1KU0A 2XTMA 2FR0A 1XNJA 3ZDEA 2P79A 4KN5A 1EE2A 2BJWA 1JMVA 3KUKA 1CR2A 4DLWA 4GRDA 2XECA 3BEDA 2FMHA 5TEVA 3L7JA 3S28A 1NXWA 3LX4A 2BMFA 3UUEA 1QFJA 4D8YA 3O94A 2DQKA 1RQPA 1JIXA 3L0BA 4R84A 2HLDA 3QE4A 4PSCA 2GK3A 4KAJA 3LKVA 3GAMA 2BVNA 2ST1A 1F1JA 1AXEA 1K06A 4W5HA 4D4JA 1XZBA 3QEJA 5AJVB 2PBFA 3CIFA 3NH9A 3NTUA 5F5NA 3I0ZA 1AQIA 3H18A 2CHUA 4FK8A 4WZAA 1EJBA 4ARZA 5JAIA 4MW7A 4ZOLB 3HU2A 3IS3A 5KDOA 2XBLA 5C4IA 2D7CA 1O03A 4PYRA 4YV0A 4P3YA 5E3IA 4LJ9A 4MV0A 4UMVA 2QG6A 5JFGA 4W9MC 1USVA 1YS7A 4FYXA 1CQIA 2EGUA 2PWBA 5DW3A 3C39A 2RAPA 4BX2A 1I7QB 1NT2A 4OQDA 4PIVA 3D5QA 2ZUEA 3OPVA 2FRDC 2MYTA 1TT5B 1IZYA 2V0GA 4K05A 2RI6A 3DE0X 3LX5A 4D9IA 3UTDA 3O8LA 4N6GA 2QDXA 3I32A 4L4YA 5BVHB 3HRHA 3QG5A 5JMWA 2AC4A 3HZRA 4RHYA 3OF3A 4QT4A 5B6CA 1WLFA 3VTAA 1MPTA 4EY7A 2W2VA 2W00A 4C4RA 1HG0A 4XW2A 4ZYWA 5JO9A 1G21E 1Z4MA 1KJ8A 4P3XA 4LNAA 2Y1KA 5C4MA 3T38A 2JGDB 4LF6B 3PCTA 1QRUA 1L2TA 2EKLA 2LGJA 2ZUDA 3IRVA 1Z47A 2VIIA 4DQUA 2LD4A 4WOCA 2AYYA 3Q3HA 2A14A 5DYWA 4J4TA 4ALJA 2XQGA 4ZU6X 2HRCA 1QDLB 1CG6A 3WJ2A 1U7OA 4F4UA 4E51A 5CCEA 2O14A 5JCJA 2DFKB 4Q39A 5HFJA 2XD9A 3R76A 3RSGA 1OJLA 1VECA 2P75A 3LCVB 1GGHA 2CZQA 2Y0EA 3LQ1A 4J0KA 4KACA 3GLQA 4CDRA 2Q9UA 4IGKA 4DSUA 4TWBA 4Z5XA 1GG2A 1ODKA 4LRXA 4LHSA 4CTOA 4IXMA 3ZE8A 4F0JA 2QX9A 2A88A 2C3UA 5C53B 4GR5A 2OBMA 4QJBA 3BH0A 1TYCA 4D9JA 1YQWA 1O94C 5IMSA 1KMIY 1WHSB 2HK9A 5K3FB 3C24A 4B7CA 4R01A 4MR8A 4UDYX 3IQDB 1URPA 3UWPA 5CLQA 3EZ2A 3L41A 1U0LA 2QXYA 4DMMA 3BHNA 4XWTA 4ETMA 2P6RA 4GPEA 2XWJI 5JE8A 3M9XA 3N05A 4HDNA 3VR4A 5CD9A 4KQ1A 1E1LA 5BT8A 1W1WA 5DMXA 3V1UA 3URKA 4F9EA 3VNVA 3N6VA 5H81A 4IUDS 3WOHA 3WGUA 2JW5A 3MJ4A 4CFSA 1RAHA 4F3KA 2EQAA 4HS4A 2NZXA 3C6KA 3RB8A 4RBNA 3DD1A 2H4JA 2VF7A 3ZUGA 1VYTA 5LOVA 1X7ZA 1W30A 2BKLA 3MS7A 1VHDA 2F8TA 1GOTA 1U04A 4HATA 4LY6A 4QXPA 5L3QB 1TPZA 3A1VA 3HE3A 1RZVA 1PJLA 4ARUA 3KFLA 4AD8A 1SO8A 3RV3A 3HC7A 4GMXA 1Q0TA 3OEEA 1N8KA 5LC1A 1UP6A 4PCUA 1GUBA 1TMYA 2P11A 3TW6A 2GDZA 5ARBA 2Q4EA 5HRCA 5DKFA 2P9BA 4PPQA 4DQXA 1ZMRA 2HA2A 3P9PA 4IP0A 2VP6A 3MPUA 4U1RA 3UN1A 3O93A 4DXAA 10MHA 2WSYB 2WSIA 3LLUA 3NIBA 2UZ1B 1GNQA 4GECA 1FOEB 4ANFA 1DZIA 1W5AA 1FVOA 3DZDA 3IAM1 5ESXA 1HRKA 1YI1A 4QBTA 2IYXA 3QUAA 4C6SA 2RHBA 1JU9A 2C4MA 1PR6A 4C5BA 3DONA 3IVMA 4AF7A 4J03A 1F8YA 4DCTA 4MVJE 4E1VA 2BBSA 1P19A 3NU1A 1LDGA 5TARA 2F1OA 5KTSA 3IIMA 1ZYUA 1J23A 1JR4A 1NLUA 3FPSA 1ZM2A 2RH5A 3LPAA 3WMXA 2B8EA 2QN3A 3O38A 2AL7A 3BWEA 3E4DA 2EOAA 2PMDA 2NQ2C 3EIWA 3ZKAA 2BMAA 1QZTA 2QSUA 1R88A 1U7UA 4K3UA 3HNPA 5DGXA 1B0PA 1HTBA 1PL6A 1EYZA 2C98A 5DSZA 2DHCA 4JUCA 1UR5A 2FPIB 3LMKA 1GCUA 1ZFNA 1NIPA 4NJOA 3BBPA 5JBIA 1OWMA 2FR8A 1L9KA 1BX0A 2WWTA 3AY7A 2EBUA 1L6IA 3ORQA 3F5DA 3ESAA 3C6BA 4QOSA 4XR4A 2NUTA 4GL2A 4C78A 3LY9A 4EFDA 5KKAA 2OK7A 4FI3C 3V4OA 1BXGA 1Y6JA 5JATA 1GPNA 5JZ9A 5KBYA 4YMIA 1Z6YA 3MGBA 3QXXA 2CJYA 5CT8A 3BCSA 1F7VA 2JIDA 5JARA 5C35A 4L8WB 1LPSA 3ZHYA 4RESA 5LIRA 2JNWA 3G2OA 2B9VA 3HR7A 3O8BA 3V1MA 4YT2A 1EUCB 3TQFA 3HXTA 5A02A 2EW8A 4LYYA 3MWFA 4EO7A 1UL1X 3FNQA 4GC9A 4HWSA 4IS2A 2R68A 2RHLA 3EVEA 4N8SA 3RYIA 3TN7A 3UC9A 3G2HA 4Z53A 2Q46A 3GROA 4OYHA 2H7CA 3KQHA 1TUBB 2O4UX 4KRGA 4H18A 5WRFA 5LLTA 2HLPA 1XVAA 4RJJA 2OZLA 3OT5A 4DZTA 2RC5A 1GAWA 2I6QA 3QPBA 4QAQA 3BFVA 5K3DA 3ZDAA 5B1HA 1XCJA 4J0EA 3TQHA 5JMOA 1ADYA 2YVUA 3REFA 2VLBA 3RYHA 3TEMA 2E85A 2QRHA 4IHJF 4WJKB 1HNXB 3TSAA 2H1IA 3JQ6A 2GASA 1EGMB 1K7SN 4J9UE 4JLUA 1P81A 1G7TA 2XSZD 1F51E 1KAHA 1U5AA 2Y1OA 1FTSA 1DTEA 3F74A 1IBLB 1TKAA 2R8EA 3TIXB 4QBHA 2FP3A 4GYWA 3ZHQA 1Y7PA 1E2LA 4DHEA 2AW5A 1MQSA 1S3FA 1SBTA 2G5TA 3MUFA 4UMEA 2LCFA 1BXRA 4P38A 4MV6A 2X58A 1JR3D 5FNZA 5DV9A 3LY5A 1XPRA 3O2NA 2JIZD 2WJAA 1C1DB 1WB6A 4R2WA 3HBLA 3IR5A 2CL7X 3CVVA 3RC7A 3UAZA 1KDZA 2QTWB 3DHYA 6CHYA 4KQHA 2ZWOA 4RJLA 4UHKA 5C8YF 1SCJA 3OFSA 4DUGD 3AUXA 5CM9C 3TW8B 2C2MA 3QWZA 2O0JA 1TM1E 4NCXA 4V0MA 4EG0A 3V48A 1I32A 1YV9A 3V2GA 1DKPA 5CLGA 5JNRA 5KDLA 5AESA 5EG5A 4DR7B 4FD3A 1FTWA 1RYEA 5BSEA 2WWRA 1PL8A 4RANA 4XCQA 3MCUA 3P71T 5G3YA 4WLNA 3JRNA 1QNLA 4XFDA 4LDRA 2OEPA 3GMIA 5E8RA 4AJNA 4B87A 3OOJA 4CR8A 4EYGA 2A5YB 3SDZA 4ZYXA 5AR1A 3OIGA 4XRRA 1UEJA 1NP7A 2IHYA 2I8CA 1X8XA 3H65A 5DBHX 5G0UA 2LR0A 2IYTA 2HNBA 3RWBA 2WUEA 2B5OA 1QE5A 1WXQA 3HY4A 3OZTA 1JALA 4KK4A 3A4NA 3JR7A 1HC7A 3VU0A 1UAYA 1XP5A 1N5IA 4L3WA 2GX6A 1HL3A 1Z2AA 1THZA 1W0JA 3E1GA 2BFWA 4PQFA 1Z38A 3SZOA 4LMPA 1LEHA 4MICA 4QVIA 1G16A 1M6NA 1W85A 2VF4X 4AF8A 4OHYA 3EVAA 4R3WA 4CQJA 3E8XA 1YFLA 1QHHA 5DM70 3RTGA 3O2JA 1LPAB 2ENWA 5KMGB 1JH8A 3LQYA 3IAHA 3I9JA 4DM7A 4JJFA 1DAKA 2CYBA 3PIRA 3X44A 1NQUA 3CRRA 3F49S 2N3ZA 1G8SA 4HN4B 2O8DA 4LKOA 3UMGA 2OCGA 3Q9SA 2FPLA 4EUSA 3UFXB 5BNZA 1GFIA 2NZ8A 1C3JA 1GTRA 4YP0A 4LCBA 2IEZA 4CGZA 1A5AB 3A0UA 4EB8A 2NX2A 1T0PA 2GPYA 2I7VA 3MT0A 3CVXA 3OHSX 4B73A 2ZRJA 1IQUA 5AUQA 1V7ZA 1RI4A 2IFTA 3FPFA 3WLSA 1OBFO 2ZRMA 3MTBA 1DFGA 1QC5A 1WIWA 2J5KA 2X0NA 4TKVA 4HJXA 1V39A 4NBUA 1BFKA 1SN7A 1T0BA 2AX3A 3MUOA 5DLDA 5G1PA 1KDYA 1FFHA 1J00A 3C8ZA 1SQSA 2QNRA 2Z3WA 2ACWA 2VN8A 1EWYA 3G9XA 2FUCA 3GA5A 1M33A 1N33B 2K7FA 2WLTA 3AEUB 3YASA 3O26A 1U8XX 3DE1X 1SBQA 2ZT5A 1YQGA 2VHTA 4GRAA 3USZA 2F9FA 2ZRGA 3P2EA 4LDNA 1LNSA 3UGQA 3WQRA 2ZBQA 1NVVR 2ALJA 1Y8QB 4I3GA 2E89A 3QHPA 4MKFA 5I7AA 4N5MA 16PKA 4F60A 3SNKA 4DT1A 2FWIA 4UREA 5J43A 3HA7A 1U80A 2DMRA 3OZ7A 2J0UA 4FYHA 4UNIA 1JPUA 3ABRB 3MGGA 1DAPA 1FSGA 1DEXA 2BH9A 2VF8A 3SXUB 3D1JA 4RMGA 4ZMBA 4KREA 3CS3A 3QYAA 1WVMA 5L4NA 2XUHA 1MPXA 3IUBA 2H4XA 3ZUPA 4GQBA 2FSGA 2NZJA 1N8NA 1N2BA 4G23A 4ER3A 2CV1A 4U5QA 5JXGA 3HXOA 2CXRA 1I14A 1ECFA 2PKRA 3ZCQA 2V8BA 3GFQA 4U00A 3TI7A 3EC7A 3ZPXA 3NXKA 2BOVA 3H0EA 2HYDA 4RVUA 4ZVNA 1HTTA 5C7IO 1YR7A 4BFSA 4AK9A 4KV9A 5HRAA 1I2BA 2VWHA 3ND6A 4DA0A 4UCWA 1P4JA 3P5SA 1ZAYA 1TMKA 4N3BA 3I6BA 3LK6A 3SHVA 4XSVA 4N5HX 2LW7A 4CQMA 5I01A 2ATEA 2RCYA 1PO7A 2RGYA 1TX4B 2FEPA 1FNSA 2WSLA 3R5TA 2CEKA 3AM5A 4XYMA 2W2KB 3ZVMA 2I3ZA 4TV8F 3VZSA 2J3EA 4LWOA 2YJ6A 3ZTWA 5AVSA 5K0BA 1YR8A 3WZ2A 4OQNA 1XTKA 2B4AA 2VEDA 3HCFA 3I1FA 4EYEA 1MO5A 2GH1A 2ZCUA 3HKBA 2QPOA 1MT3A 3S2IA 1L7RA 2Z56A 3V34A 4UXHA 1ZIOA 4ZT3A 5CEFA 1TJYA 4IH9A 3GLGA 4K9QA 1N34B 3WLOA 4MLCA 1E69A 3AM3A 3L7CA 1YQDA 1R6BX 4DPKA 1NSTA 1VLHA 2OAQ1 2DHDA 1OBCA 1DMSA 2EGHA 2VOEA 4M8LA 1AG9A 2BI8A 1GDDA 2VT3A 4PG5A 1UC8A 4YI3A 2XTAA 3VYRB 4C22A 3DT6A 3R3UA 1DSSG 2C20A 3DMYA 1OZGA 2FU5C 2WKWA 3QH4A 3RNOA 5AW4A 4EGFA 2OC4A 2Z2ZA 1TKRA 2QD5A 3EY4A 3LS2A 3FLEA 4K8RB 1T5DX 2QZJA 4OKSA 1XROA 3SE7A 3U62A 3CY6A 3JPYA 2P5YA 1NI5A 2WVHA 4ZI3A 1NJSA 4FFMA 2QM3A 4JI0B 1HY3A 1WMSA 1YA8A 4BN5A 4R71A 5I8ZA 1NXXA 4B2PA 4N0QA 4TVKA 1R0KA 4N8DA 5HGXA 3NUQA 4KVZA 3X1ZA 5AYVA 4QGAA 5FI0B 3ESBA 3LLCA 3B13B 2AW3A 4FGJA 5CTJA 3FPEA 3VDRA 3H4TA 5TSDA 3AOEA 3G0CA 4LBYA 5H4GA 2HBRA 5CP8A 5EC8A 1C4KA 4Y3UA 2K2QB 2XMRA 1Y5NA 2Z3ZA 4DOMA 3ZZ1A 2PUCA 4YJ2F 5JO0A 2P4SA 4OXNA 1JIVA 2D1YA 5FLYA 1H6CA 3JAKA 4RIGA 2VYND 5DNAA 4AL4A 1E2PA 5ESWA 4C0WA 5CH8A 3VAZA 2C58A 3C8MA 3MJEA 5EHQA 3PIIA 1TT7A 1R64A 5FWDA 2ZJBA 4C3VA 5FOSA 3HR4A 4Q3AA 1N57A 2EWMA 3EW7A 2HNKA 1OXMA 1TAHA 2ZJOA 2VCEA 3MT7A 2FFHA 2QAIA 2ZVPX 4ND5A 3UJDA 4G5OA 4M36A 3PLAE 1PV1A 3C3AA 4BAUA 5C7OO 2PXXA 4GOOD 5T8KC 3R9KA 4JC5A 1O96A 3V1KA 1SBIA 1KRWA 3C1UA 2OORA 5KTYA 1IN6A 1EH5A 1X7DA 2Q99A 4R2MA 5EWLB 1CIJA 3A6LA 2CXHA 3LSTA 1I7DA 5IAKA 2EDAA 1RRGA 1CJUC 1X8JA 3MWGA 4CHGA 1PKEA 4U39A 3AL3A 1T1RA 1JEYB 5AI0A 1XQVA 3RAJA 2QV0A 4PSKA 3LZCA 3OO0A 4N6OA 1W0CA 4AKSA 1KMCA 4EA8A 1GQOA 2Q2VA 4V24A 2X0RA 1UBTS 4NAHA 3NH6A 3E58A 3HJRA 4OAPA 2IZ5A 2QL9A 2VZ8A 3P2YA 3NHMA 4B48A 4G97A 3P9QA 4GZ3A 1X3SA 2Z83A 3U39A 2R00C 4EFLA 2H52A 3V8QA 1LQTA 5EJMA 5ANRB 3LSYA 4HP8A 2FP4B 4W5TA 2X0KA 4U2CA 5GWXA 3SIPA 3ST7A 4R1UA 3O2SB 4C06A 5HM6A 3AUJB 5K6AC 1YZQA 1HORA 4JR1A 3TRFA 3N8HA 3ODGA 3VH1A 1TYEB 3RTEA 4BCBA 3T35A 3A2KA 4TS4A 4MQFA 3MGCA 5A1JA 3RRMA 1GFZA 3P19A 1DEOA 3M2PA 5H4HA 3CXRA 2O6HA 5K5EA 3IDAA 3NBQA 4QWMA 4AZVA 4RQBA 2W6IA 2C8KA 2CL0X 4XDYA 1DCKA 3E15A 1H4TA 2WHRA 5IG2A 2QX6A 1C3OB 1M1YE 3CJQA 1MP0A 2OE2A 3TIGA 4PF1A 2REQA 3UMRA 5J23A 1SCAA 4YT4A 2H6EA 3D3JA 1PD1A 1UJ5A 1HURA 4FFSA 4D3YA 2PMWB 3GEDA 3I23A 5IDXA 3MWEB 3BX1A 3CRVA 3RODA 3ZHBA 3V7WA 4TSFD 3RU9A 5AVYA 1W4CA 4LDJA 3PPWA 5CIQA 2XMBA 2H3EA 3UTCA 4KVAA 4DM4A 1JU3A 3UW1A 5KWJA 4IWYA 5LM3A 3AESA 3AM1A 2DP4E 3EBLA 2WKPA 1Q16A 4BBJA 3C45A 2IHNA 3MOSA 1R4NA 2XXAA 1LY1A 1T2DA 4BP8A 4F11A 1N5MA 5T64A 4UQLA 4BFLA 1H9BA 4FDUA 2CE7A 1FSPA 2HF2A 4G8DA 1AGYA 5JNWA 2AMFA 2WAAA 3COPA 4I1PA 4BEVA 3WGZA 2F8MA 2ECOA 3C48A 3VJKA 1ZVKA 4MV8A 4FQ8A 4I4TA 3TMAA 3KQVA 1Y37A 1QR2A 3PC8A 5EWMB 5JXHA 4MI6A 1Z4KA 1VL6A 3BE5A 4NEGA 1E64A 3WYGA 2G1KA 1HE2A 2PUWA 3G5UA 2IYAA 4URUR 1K5GA 4J1QA 3W2HA 4BV3A 4P3OA 4HVCA 4D26A 1U2PA 3M4ZA 5K3EA 1ZH4A 2BDUA 3DOHA 1NQTA 2DZDA 3GNSA 1KVSA 2CLSA 1C9NA 2BN4A 1B42A 2Z2KA 2ZRLA 4JK3A 5ERGB 1CUVA 1TVEA 1RHUA 2AWOA 4M1YA 5JEDA 3O4RA 4IIHA 3HFSA 3TKLA 3QVJA 1KI9A 4NEHB 4GL4A 1V5FA 4XFJA 4XQCA 4YRGA 4EGAA 4B6RA 2FQWA 5LQRA 3FPJA 3DWFA 1MABA 1VLZA 4Z8XA 1QWOA 4B47A 1OHHA 1KJJA 1NSYA 3SQWA 9ATCA 4C1BA 1S2DA 4BNFA 4QPJC 5EFZA 5PGMA 4AJHA 4DJAA 3LXMA 1UDBA 3L0PA 3B3QA 4OBXA 2X3UA 2QJWA 2Z8YM 2QY9A 2XZTA 4WFQA 3KJIA 4MAMA 1H4QA 4IS3A 1XTZA 2Q6VA 1F38A 4B6FA 1CUIA 3BXXA 3FTDA 4H08A 3MMSA 2YMQA 4JJZA 1GAXA 1JILA 1VIVA 2HQOA 4LXGA 3UPUA 2DUMA 3H2ZA 3E2IA 2Y2UA 2H1HA 3GLIB 4MVJH 1FNNA 3SJUA 3V97A 4BJ5A 2H0AA 2KS6A 3PX7A 4EM6A 3FN4A 5DCUA 4TYNA 1FDSA 1HX7A 5HF9A 3WLMA 3F73A 1W88B 2B4QA 5L4SA 1SUAA 1ZH8A 5IULC 2NQ8A 1NVEA 4XUGB 4Y6QA 3TFQA 3W2IA 4IDQA 3BWMA 1OT5A 1F6WA 3KQQA 4M53A 3GFSA 3J81A 1M1NB 5F23A 1W0KA 1YI8A 1NFFA 5AKKA 2D7JA 2XYPA 4HEA1 2VDWA 4DIEA 5DB4A 4C2AA 4A6EA 3W34A 4A4DA 2AOTB 2YN2A 4UHEA 1USUA 5FI5A 1KOJA 3HZHA 4UUAA 1V3UA 3I9V6 5L7WA 2F59A 1T13A 2WG2A 1SIUA 1H0SA 3QXJA 1SMKA 2XVXA 4EJ6A 5JSUA 3M70A 2V6JA 3AOEC 1M2OB 3PC2A 4M83A 4BE4A 3ZD6A 5BR7A 1RWMA 3R5FA 4I1VA 4F71A 1JDTA 2IDJA 4XOIA 4AROA 4RPHA 1TQ8A 5EJ8A 3GRYA 1ZBDA 4DR6B 3DFKA 1Y6FA 3ZLBA 6AT1A 3FF1A 2AXEA 3AVYA 1PRYA 2JGJA 2WJ3A 4TL6A 3P2KA 2Q3LA 3EH2A 1SG6A 1KE1A 3T5MA 5AUOB 1BXKA 4X6LA 3M1YA 2Z0MA 4QUGA 5CXQA 3U60B 4CKBB 4LJ6A 1D09A 4XGKA 1AU9A 4M7OA 3N2IA 4TV9B 1I01A 1N2XA 4IDOA 3ZQ6A 4B7XA 4BZWA 4ZHQA 3A4VA 3ET4A 1OFTA 3UB3A 4JS0A 1H2HA 1NUTA 3BD6A 1GCOA 4URZR 1C8VB 5TMDA 1R4AA 4HAYA 2E55A 3STYA 1TOAA 2CWWA 5AW1A 5FWYA 3WG9A 4JHXA 3WK9A 4A0FA 1BKYA 3KYIB 2YFYA 1G1AA 4S35A 1RQRA 4W8OA 3P2MA 3ZKWB 2GUWA 3NI2A 3C4VA 3K9QO 4JENA 3SD7A 4NPCA 4NPAA 3GLGE 4PAOA 4WV3A 1EDOA 5LKRA 3KZMA 1LLCA 1X94A 2YHSA 1V7QA 5DNUA 2N75A 1SK8A 2ZWIA 3UA4A 1PSDA 3DAOA 3DNPA 4ENQA 4E09A 1OLUA 1Z8NA 1Y7IA 4Q18A 4WZAE 4QEKA 2AEFA 4WK6A 4Y67A 1B26A 4JX8A 4MAFA 5F7OA 2FPKA 4WZBA 4NMLA 4F5YA 2B9EA 1EBBA 3P20A 1RYBA 2QB5A 3T34A 3CZCA 4HAUA 3IUSA 2HK6A 5AKEA 4M6WB 4OD0A 1NVXQ 3O2QB 1IWBB 1KY2A 4RABA 3PGJA 3KWFA 2D06A 4L4RA 1Q92A 1COZA 2IPLA 4BVAA 4G36A 3T3GA 1YVRA 2H4YA 3PFWO 4PZPA 3R74A 4CMHA 1VHTA 2M1XA 2ORIA 3ETLA 1I5RA 1X9IA 2YOHA 5I9SA 4BATA 3F6PA 3TSYA 4GX5A 3DZBA 3HUFA 3BWDD 3KC2A 4M1WA 4Y6OA 4KC0A 1Y7TA 1BE8A 2P3QA 3CKYA 5DGIA 2BFCA 4LSMA 1VMAA 1Z68A 2ZANA 3JQFC 2OK8A 1XZMA 2IGTA 1LBTA 3IKMB 2R5WA 6GPBA 4XQGA 2A30A 1RS0A 2QN1A 3H5NA 1SOMA 4FSDA 3LGSA 3OF2A 4UULA 1E5TA 1UDXA 1ECJA 1JFVA 3ZZMA 1GDHA 5A4MS 2P5TB 2Z30A 1B8NA 1C7RA 4MKIA 1XRQA 3WDLA 2FAXA 1YMVA 1FFGA 3QHQA 4EPTA 2J46A 4QE3A 2X14A 1PTJC 1RHQA 2GD0A 3X1DA 2IW3A 4ENVA 1VCHA 5HMLA 4BO2A 3I3OA 5CAEB 2O2HA 1A77A 4EJ0A 3NDIA 2YFKA 2ESRA 2DT5A 3Q1LA 4IAOA 4FUQA 2VDRB 3LQRA 2AG0A 1T4BA 2WU3A 2AZDA 4R05A 2C5AA 2C78A 1ORDA 3L6UA 1XRSB 4HUQB 1ORTA 3HXKA 3G0OA 5IBRA 2PRZA 3LDGA 1I3NA 2N9UA 4WKNA 3MM4A 2NNWB 1YBAA 2XMZA 3LFUA 1CUAA 1HDIA 3LECA 1SHKA 4FMCB 2XYQA 4I99A 4RNCA 3G2QA 5DISB 3K2QA 3SQOA 5MN5A 4N48A 1VSQA 1E3EA 5LIPA 4HBZA 2C7OA 3QLTA 3L6OO 1BGWA 2ANCA 1N25A 1C0LA 5COAA 3FA2A 5TF0A 1UBNA 1ACJA 1PK9A 3I9LA 3F9IA 2W43A 3RH0A 2BLLA 3IUPA 1SOWA 3UT5A 1QHHB 4RGVA 3VYVA 1BEZA 1RHRA 3RG8A 5BWOA 1GTZA 2DM6A 1V1RB 4GW3A 2FPMA 2EW1A 2AOVA 1QHYA 2XCOA 3IEMA 3CXUA 3DKRA 3NWPA 1II9A 2BHTA 3TTTA 4P2GA 1K3UB 3QM1A 2UUCB 4AKHA 1A3CA 1I7SB 3B52X 1L5NA 3AGPA 1OC2A 2PAAA 4HFNA 4ENUA 5EXTA 3GN2A 4CLRA 3K09C 4BBZA 2GEVA 3NYIA 1G8YA 3LXUX 4Z54A 1T26A 4P5PA 3V6MA 1CPYA 4IDHA 4D9BA 1R9NA 2KHZA 1UFOA 3E3LA 1H1LB 2D4HA 4H7DA 5EMNA 5AVXA 4J0QA 3MBKA 3OQPA 3O73A 3HTXA 3ZE7A 2BTOA 3ITNA 4EJ2A 3G82C 3S2UA 3AHFA 3SX0A 1XOIA 1XNHA 5JVDF 1AUPA 2G0AA 4EIWA 1G2OA 2ID8A 2JFNA 2QMEA 4D97A 1YQ9A 1YQXA 1O77A 1J0EA 4F1JA 1IK6A 1TTPB 2GLXA 1SBNE 2NU9A 1JIJA 1N32B 1J70A 1KJWA 3U3RA 3LE8A 2CFOA 5IKMA 1U3UA 3WZMA 3N53A 3KT8A 3H8SA 3T0GA 1ONNA 2XA9A 5BWBA 1U9JA 2CCGA 2DPYA 2JGFA 3EUWA 2BR5A 3FWNA 3N5CA 4KDIA 1Z2NX 1T0JB 2CE2X 2VT2A 1G2IA 2E4UA 3IUMA 3NHAA 4Z51A 1TIBA 3N0WA 4ZYLA 5KNDA 2XEXA 2BY4A 4EG5A 3IKVA 4DV7B 5JSYA 1YNSA 3WLHA 2WAXA 5AKHA 3G2JA 3B82A 3CEJA 4KAXA 5KAMA 1DJOA 1L9XA 3DUFA 4LZOA 3K7EA 2WPNA 721PA 5KTTA 1FU8A 1SKBA 1CJSA 4JBGA 2GAIA 4RYLA 3UMMA 1E94E 1OWPA 1EM8B 1S8FA 1HQYE 3OUZA 3ZWNA 4YCNA 2AC2A 2HMSA 4TT3D 1FNDA 4MWBA 2OCDA 3K70C 1T1IA 4AY6A 4ZZ2A 2ETVA 3QE9Y 3KLOA 1R0ZA 4F5ZA 4YPOA 1SOVA 1CFJA 1EVKA 1HPLA 4HKTA 3AI2A 1VDZA 1SK9A 4U9UA 5COQA 1GLGA 4I3HA 5JCOC 1KE2A 3H97A 4BRSA 1IJBA 2DR2A 4EFKA 2O7QA 1SZJG 4AI6A 2FPSA 4NCBA 4PX2A 4FW9A 4DDKA 3I04M 2CXXA 3CLKA 3UMVA 3Q6MA 5CT6A 4ZYZA 4D8XA 4YT5A 2VNIA 3VOTA 4C21A 1R74A 4LVCA 1L8LA 1FYXA 2Q8QA 3G2LA 3WHLA 2BUCA 4DRYA 2RKWA 3VSEA 2C4HA 4DEVA 1NQOA 3SJ7A 4EHJA 5LZ2A 4LSZA 3K8QA 3MHTA 4MR7A 1DCFA 3PVSA 5AO9A 1YOBA 1R7RA 1Z4QA 4A2CA 3CYFA 1NF8A 3HCOA 1GG9A 1PQUA 3W3ZB 2E2WA 5AVTA 3X0DA 2I6FA 3NG1A 2RGXA 1U9IA 3I39X 2WHQA 1USKA 5A4AA 1SJ9A 2CC2A 3W4JA 2O50A 4YMTA 1JTEA 3VNBA 1G98A 1VE6A 2HU5A 4I4LA 5ALJA 3KJZA 3T9DA 1V8BA 4OUDA 1XGKA 4FT4A 1TKCA 4DFDA 3WYEA 1L8XA 2GBPA 2PR7A 2QI9F 3SC3A 2WRZA 3SEQA 5JD4A 1ETHA 1O8CA 3CSSA 3TD6A 3KJHA 2QOEA 2XB4A 4HH3C 4I5GA 2JLVA 3JWGA 5K0JA 1IXRC 3OZIA 5A0TA 5FR2A 4YJ2B 1FK8A 2QN7A 2OZEA 4PXSA 4TXHA 5JDCC 4RKYA 4CUJA 1N5RA 3M3DA 1RW4A 1E96A 3JYNA 2ZUFA 4FDMA 4WZAB 2ILTA 2F3RA 4HI0E 2CXQA 5F51A 3GJ5A 1QHFA 4N01A 2UZAA 2FX5A 1SC1A 4G09A 3QOFA 1TECE 4XR9A 2PJRA 1KBOA 2JANA 3G3EA 1IUNA 4BV9A 1NN1A 1PJBA 3PNQA 4Y0VA 2IX3A 5LB4A 3KAQA 3A1TA 4OI0A 4Q15A 2CUNA 2FK8A 1E3SA 4OU4A 1EP1B 1ORHA 3JAKB 4BFZA 2XYHA 3O7WA 3BRWA 4R9VA 5CVJA 4D25A 2PL1A 1JVNA 3QBJA 4RU1A 1KXJA 3RSHA 3VPXA 3S2GA 1VRWA 2WG0A 1ZGCA 2V74B 3INNA 4Y6SA 3RS0A 3AR9A 3HBMA 4FYWA 3MAAC 4RCZA 4UE6A 4AMGA 5JAOA 4LGCA 5EMKA 2R60A 5C1DA 4ZGBA 2C9YA 4OB6A 4JJ6A 2ID4A 2J0UB 3ROQA 3NBAA 1WOMA 5KQRA 1RSZA 3PGLA 4QBFA 5IF3A 1JBQA 3VC2A 2G70A 2SECE 4HV4A 2PLRA 1J20A 4LISA 1XZDA 2ZM5A 4M46A 5EUCA 2AX4A 2VP0A 2JFBA 1R3DA 4TLAA 1FMJA 4RPIA 3ACDA 3V2HA 3S29A 3SYLA 2ZZNA 2Z1MA 2BGIA 3ED5A 5B2EA 3QUCA 2ZRAA 4IEIA 4IZHA 2H1FA 4LRYA 3T3NA 1F0NA 1M2JA 1ONBA 2JBWA 4GBMA 1TLLA 1E4YA 1M66A 1E2GA 2CFTA 5B3JA 1SKMA 4EB6B 1M2FA 4RV9A 4D6PA 1O7JA 3A37A 4D4GA 2WB2A 2CF5A 4BLUA 4JBXA 2GKGA 2CSXA 3UAYA 3JQGA 1NXSA 4UAVA 4NF2A 2DY0A 2TMYA 3CA8A 3GPDG 1JXMA 4JQOA 4LOAA 4P4SB 4RLFA 2GKSA 1SUEA 1KP3A 5AICA 4CI9A 2TMKA 5K8VA 3NASA 1U3GA 5E4TA 1GHTA 1K5DA 2J9ZB 2XUFA 1M2VA 4ALIA 1EG7A 4BFCA 2A6PA 3E7XA 3KYCA 1ZD8A 4LJ8A 3RAPR 1G8AA 2E5FA 2X5KO 4LZWA 4ZARA 4X20B 3UJ9A 5D85A 1IB6A 2QTBA 2O06A 3ACCA 1RXUA 3A70A 4INAA 1I4LD 1JG3A 2JLCA 2WHYA 1E0JA 3D8HA 3DOCA 4PZYA 2JCGA 3CF6R 5KJFA 4JFRA 4BB0A 2W6MA 2YIDA 3PIDA 4O2AA 2ZI7A 2HUPA 3BB4A 4PW0A 1O94D 1S7CA 4HTFB 3ZDXB 2ADOA 4PTLA 4ND6A 4C7OA 3LYUA 5BV2P 1NNI1 1AM4D 2H1VA 1OMOA 4PHTA 4R81A 4UC4A 1QVZA 2GD1O 3P0FA 1NTRA 1SUIA 3PFFA 3WKBA 1IEXA 2RGNA 4HO1X 4ZANA 5EWMA 3PRJA 1VRVA 2VYNA 2D1RA 3QXGA 4XZ3A 4CLOB 4OVKA 2A59A 2I4OA 3LBHA 3ZY6A 4WUTA 3SOZA 2Q2QA 3C43A 1D2GA 1ZCAA 1Y1TA 4D56A 3VVCA 1VTKA 3B1FA 2E4VA 2P2NA 3AWDA 1I33A 1OE0A 1WXXA 1Z7WA 2VSYA 3DCJA 4KTTE 4ZCSA 3WHKA 1RWVA 5GGYA 2V58A 4IDEA 4MV4A 1LK5A 1MNQA 4MHTA 5EHZA 1NXTA 4IHQA 2XCRB 4OB7A 1SCDA 3GNLA 2K7ZA 4IZOA 3VR5D 1YDWA 1U0EA 1XWIA 3ZLVA 1U0GA 1S3GA 2PSSA 1QO0D 3IHTA 4ZZ1A 3KHTA 3M5WA 1EX7A 2DBVO 1OGIA 4NBTA 4A8TA 4AP9A 4REOA 2B35A 3FDFA 3L6RA 4G65A 1I0LA 2IYOA 5KO2A 1OASA 4PHHA 4OGFA 1WBDA 2FCAA 4I8IA 1VGVA 4QO8A 4Y2RA 4ARSA 2ZJFA 2P0YA 3KHSA 1LPPA 2FYTA 3OOEA 4DJDC 3HM9A 5DMHA 3PYMA 1JQ5A 1H8HA 1DWQA 3E7WA 5GZ6A 3AYZB 1ZCZA 2MINA 1ONPA 4KSBA 2A86A 1MB4A 2POQX 1AKTA 5JNLA 4B3SB 1UFKA 1ISIA 3T1YB 2DBZA 2B1GA 1UZAA 2A9FA 2CCKA 5JBNA 2DPGA 4RADA 2AN9A 3PPIA 1FFSA 3G2PA 4B81A 1JH9A 2J45A 4QUAA 4IDCA 1L5KA 4D8TA 1IHXA 2AWNA 5TPWB 1C4OA 1EXMA 2RIPA 4H7IA 4YROA 1BVYF 1F2DA 3SLGA 1I6LA 4WH0A 4NE9A 1RCTE 2L0XA 1CZNA 3FW1A 3OLVA 4UQPA 1Y9ZA 3MWYW 1XB2A 5A7HA 3U3KA 1JEYA 1ZD9A 3N3BC 4LRSB 1Z0IA 4O5AA 3RABA 1BDMA 3ZD8A 5M7EA 1C9YA 1C7FA 4E2FA 2J4FA 4G84A 4LC1A 5L3QA 3K20A 1P33A 4KU4A 4MRNA 1NMQA 2XUKA 3EH1A 5LWQA 4BBPA 2WYHA 1SEVA 2PZLA 5LQMA 3ASYA 4E5KA 1TJ5A 5B2FA 1ODFA 1YR3A 1HT3A 2C2KA 3RYFA 3DV2A 5B3LA 2P2CA 2ISQA 5LKAA 2BFAA 1M2EA 3LF2A 4WESA 3OX1A 5EJGA 3DBHB 3ZLTA 4G0XA 4TQUS 4AG5A 3B6ZA 4ZMRA 1ABBA 1JQJC 2X2FA 4F8EA 3Q40A 3TFWA 4UHHA 1ND5A 3W4IA 5AUPB 1XFDA 2GA8A 5DBFA 1IVSA 2GQ0A 2D5AA 4M1KA 3F5FA 2P2SA 2PKYX 3CNOA 4Q47A 3WQBA 5IUJC 4US1R 5L95A 1P2DA 3W5CA 2PZEA 4MVXA 4PYMA 3OFVA 4DM3A 3L6DA 1X7ZB 4KP7A 2MOKA 2MIIA 4D9CA 2MSLA 2W7TA 4LXQA 4XARA 5CITA 4BO8A 2DFLA 3I01A 3OLCX 1JMYA 1OAKA 1DEAA 5JC8A 3KPJA 1Y3FE 4EJSA 1A9QA 2ORYA 4HQ6A 2EXXA 1U6KA 4A0HA 4ZGWA 1C9DB 5FOTA 3G5TA 1H2YA 1XZJA 1Y48E 2Q3MA 4LJ7A 4EHHA 3D7NA 4ADSG 2V7QA 1VIMA 1K6JA 1NOKA 1U6JA 1QHNA 1ZVJA 1IN7A 1DXQA 4F8JA 3PRKE 3PXBA 5JCPA 4QG7A 2NTVA 4NJEA 3DBOB 3W9SA 4PYQA 3PGKA 1RI1A 3INGA 4MRSA 3FRJA 4UNRA 4COOA 3R7NA 4DRXB 4ZYUA 4DXHA 4PN7A 1WBBA 1F8FA 2I55A 5JU6A 2DFVA 2XF2A 1REQA 5CM8B 2ID9A 4B85A 4W1QA 2QD4A 3BXZA 3F1KA 3IKLA 1DC6A 1QGAA 4NK4A 5ITVA 4ARVA 3TNDA 2W11A 4FGLA 2NM0A 2IIVA 5K03A 5CLIA 5IF9A 4LOKA 1XVTA 3RFTA 1IQ0A 4EDFA 1W48A 3KX2A 4XJVA 1FTYA 4NYIR 3ZYCA 1HE8B 1NQVA 3NXSA 3LC0A 4K6OA 4YNBA 2P9JA 1XP8A 1MABB 3GG9A 4UNPA 2WJYA 3STXA 4BQSA 4CN9A 4MI1A 1KNQA 4DLZA 2VUIB 2O1SA 2A4KA 4FGZA 2NU7A 4NWIA 2JGDA 3KB8A 1W4BA 2FPIA 3ESCA 2Q19X 1XCLA 2ZWVA 4L75A 5CVCA 5B1EA 1Y3AA 3EXFA 1C4WA 3ZGNA 1L7VC 4PG8A 2EG9A 2I2BA 1JZTA 3VC7A 1JHPA 4EAQA 3I9FA 2C7PA 3LOQA 2GYVA 2I78A 3HB9A 1Q12A 3C41J 1L8QA 1M34E 5ALGA 5MGNA 1PD0A 5B5SA 2ANBA 1VLQA 4TVBA 1EEXB 1Z6GA 1ZN7A 2O8DB 3FNHA 1O0SA 1JYSA 3DCNA 3SZRA 4EMSA 1M1XB 3NJ4A 3KSUA 3LT0A 1EVZA 3IQXA 3OLWA 4FDLA 2AQHA 2GAAA 4K9DA 3DW1X 3WK7A 3IVGA 1RR6A 5JXIA 3RLIA 4YXWA 1NW8A 4P54A 1SD2A 3I2FA 4JMPA 2DHEA 1BXRB 1SWWA 2CDBA 1ZZGA 1ZH0A 1UFQA 1NJ1A 5FTNA 1U7WA 1PYOA 4JLJA 4RZ3A 5I7EA 4KGVA 4LK3A 2WD7B 1NULA 4OXQA 4U0KA 3IE1A 3O91A 3QU5A 4YR7A 4O3FA 1Z0UA 3N2GB 3ND9A 2JRLA 2CHGA 4PS0A 3U37A 2JBAB 4L6AA 2WFAA 4CIAA 4EUHA 1YHNA 4GNKA 1BFDA 4TUYB 1AS2A 1XA3A 3SQMA 3EGXA 3W5JA 2HHJA 1NZJA 1F5SA 2H2AA 3BMOA 1DPGA 1HA3A 2G63A 2X5OA 3EZNA 2M6LA 3VR2A 2D1FA 1F0PA 1A9PA 2JAWA 4GOND 4Q9IA 2CF6A 4N0MA 3RRZA 2AGVA 3PGXA 3T94A 5JVDA 5GINE 5TGDA 4NFLA 5DU2A 4FDVA 4AIRA 4IQ4A 5E7IA 3UV7A 4RLHA 2O8EB 2WAOA 3NX4A 4RY8A 4NX2A 4CEIB 4HDMA 1GZSA 2W8BA 4KO4S 4RVDA 2VZEA 2P6PA 2WM3A 3J7TA 4IVRA 1DAIA 4R16A 4TL8A 2G9QA 3HB7A 4ETIA 3LBNA 4DSAA 1PVVA 1XX6A 2OWEA 5CX1B 2V1UA 2CJXA 1WZ2A 3K0FB 3QV1A 4XYGA 4C89A 1UMCB 3I83A 4KQ9A 2VRNA 3T9CA 4NFSA 5JI3E 1OIXA 4RVGA 2B5VA 4P3NA 1FE8A 1AIPA 1Z07A 2G0TA 2JHCA 5FXMA 2ZDGA 3BFPA 2CFCA 4JLBA 2IXFA 2D0PB 4DLSA 1KNXA 3EZYA 2GTPA 1R3UA 3GGPA 2YRXA 2QQFA 4UHCA 4C5AA 4E08A 4RZIA 4TVOA 2X8LA 2VS1A 2ONJA 1AKNA 3OKAA 1ECLA 2FE4A 2CNWD 4HRYA 3ECAA 2HTFA 4DL9A 3DLIA 3THXA 4Y9TA 3M6FA 1M7BA 3TG8A 3DTVB 3Q9NA 1YJXA 2B2NA 4C0SA 1P3JA 3GP3A 8ADHA 4J0HA 3GBPA 4ITVA 3Q72A 3EPPA 2J48A 2Q5LA 1NVDA 4K9PA 4E88A 1R18A 4QJ3A 3NQ41 4RHFA 2VP9A 1UJMA 3CUKA 3FI9A 3WLJA 2J5QA 2OXCA 4OXXA 1O4VA 5A3VA 2QRKA 4ZO4A 4J3NA 3ITEA 3NC4A 3S99A 3HV2A 5C4GB 4X1KA 1SNYA 4RIHA 3ZCPA 3OF5A 1XN1A 2AOWA 4RC9A 1FJHA 2X6TA 1I3MA 1YFKA 2PGOA 3E82A 4G8CA 3ZXYA 4FYYA 5T7BA 4QRHA 3K9HA 4BLQA 4DC0A 4EJSC 3QMWA 2WIJA 1O6GA 2C8LA 4EYOA 1SCNE 2QRZA 2FOIA 2HZ7A 3FBWA 4LXYA 2FSPA 3R6TA 3CVJA 5AHXA 3S44A 3V8RA 1CZ4A 2C77A 4B4KA 3EG9A 2QLBA 5LMCA 2KQUA 4LXIA 4TXNA 4QUEA 1QGUA 2C5SA 3HPQA 2XJ4A 3N86A 4YLYA 2XDAA 4G1BA 2LCQA 3VI3B 3O8RA 1BWPA 1EK0A 2P68A 3JVDA 4Y6GB 5GVSA 5HX7A 3U09A 3BWXA 2FF5A 4QUKA 4TMZA 1K9SA 2X9VA 1E92A 3C3EA 3QK7A 4L5CA 3F7OA 3OMWA 4HEA6 4OM8A 4BZXA 5L3RA 2TMGA 2DLCX 2E37A 3BREA 5DBEX 4C0HA 4CTNA 2AKYA 2PUHA 1A0OA 3KD3A 3KOMA 4P4NA 4ZO6A 3S1AA 3C6QA 4D3ZA 2DT8A 3VOSA 3W1WA 1I8TA 4DIOA 1S9HA 4EFNA 1A9XB 3O0DA 4OXKA 4BQIA 2NP7A 5KKNB 2QD3A 1C7JA 1AUQA 2WD8A 3KYDA 2W90A 3MILA 1HO3A 3N3AC 5F64A 4R7GA 4UTPA 5BOSA 2EFGA 4XYEA 4Z2YA 3G8YA 5IXSA 1QRAA 2GBIA 1G8PA 2GLTA 2PGJA 2RJ3A 1FS5A 2HMTA 2IXTA 4OUDB 2CFRA 1F06A 4CIVA 2EKDA 4OO3A 1J4AA 4N8EA 3AF4A 1FLVA 4F5DA 4AJPA 1M74A 4PCLA 3DZIA 3PXCX 5FOVA 2PS1A 4C6HA 1Z5GA 3Q7SA 2IUEA 1UKEA 3VU9A 5AOBA 1X86B 1Z16A 1E8MA 4FFRA 5JJCA 3M5PA 2PKQP 2XUDA 4GWKA 4BO6A 5HIMA 1G4HA 3UW3A 1QR6A 3TL2A 3FYTA 2YFHA 3KSAC 3FLAA 3W6NA 3DLAA 3ZWAA 1W49A 3HBAA 2CNDA 1J8MF 1DIOB 3OWHA 3AO0B 4J4HA 1X1CA 1ZX1A 3K4PA 4OF4A 2FMUA 1NLYA 4U9IS 3L7DA 2JVJA 5JANA 1W9HA 2HEGA 3A1DA 3G0DA 3MXTA 1EFUA 4MULA 3ZI4A 3EWSA 2XRMA 2NNLD 1ZMTA 4YRFA 5A3SA 3V7UA 1VKNA 2OGTA 2V6GA 4KNWA 3UIEA 3OHMA 2JH8A 5FTKA 1E0KA 1SQGA 1YB6A 2EF1A 3HFRA 3JD2A 1F4LA 2XB8A 3NC1C 3TBKA 1NHWA 2GB4A 3VR6D 2P4EA 1PQ4A 1YMUA 1ZNYA 4F38A 4INOA 2RARA 2QLNA 2ZIUB 2AZMA 4PGMA 3QJ5A 2FZGA 1YJ8A 3U7GA 3C2QA 3CT6A 1GDTA 2W6NA 1P77A 1GTG1 3SK0A 4KN9S 4FONA 4UBMA 2XCTB 2ONYA 4P98A 4BIMA 5I9NA 3OIVA 3TSOA 5JSKA 1MA3A 2I7TA 3S2EA 5MGBA 1FDUA 2V3CC 1IUOA 5A05A 4E3WA 2PY6A 2GFHA 4UUOA 4UTRA 3GJSA 4QUDA 3OOSA 3VPBA 1I10A 1GAQA 1XMXA 3UENA 2QMOA 1G8FA 4P92A 3UAOA 3RC3A 4JJ8A 5C80A 4PINA 5F2KA 1OX5A 2VNAA 2OCIA 1PZMA 2ZATA 3B6MA 5A06A 3PUHA 3H4VA 3ZV7A 4Z4EA 2PA3A 2Q07A 5KYWB 1JAYA 1S4QA 1XTRA 1SA0B 1USIA 2ENUA 3MWLA 1KQNA 1G5TA 4OP1A 5KNCD 3DMPA 4TQGA 4RTPA 3LLVA 3B9QA 4JQZA 5CXSA 2OCKA 5EXSA 5J4VA 2BP7B 2O2SA 1W85B 2FQXA 2FB9A 1LDEA 3PJDA 4NU5A 5A3RA 3O90A 4BZPA 2QGZA 3IDZA 1I13A 4ECAA 4D99A 1IN1A 4DLUA 4E33A 4QQKA 4NECA 5DRTA 2GS9A 2C4TA 2OQIA 1KI8A 3DTNA 3T7TA 3AJ9A 4BGEA 3HJNA 4HB0A 3UT6A 1TU0A 2LP4Y 2Y1DA 3THSA 1T5IA 4KQCA 1KR2A 3G8BA 4Q66C 3W7BA 5C1PA 3ZHZA 2IEBA 1IM8A 4C7OB 4W1SA 1UOPA 4F6RB 2IHJA 1OXBB 1RMQA 2IUSA 2NV0A 2ZROA 2YH2A 3D4NA 4WOBA 4F6LA 3KL4A 2A1UB 4S1VA 1Y8QA 2Y1GA 5JROA 3CX3A 1Z7EA 3GO4A 5KNBD 2B7LA 5ED4A 1U0RA 5F2EA 2E6UX 2HJHA 4MVWA 3KBBA 1YTUA 4XI9A 1R9JA 4GPZA 1ZCBA 5BSKA 5CYGA 2Y9PB 2YZNA 4N82A 3DXZA 3TLCA 5C5CA 4V03A 3E3NA 5D6WA 1UPFA 1Q20A 3IAXA 5TEWA 4GG1A 4QUIA 3MJDA 4Z4IA 3K73O 3SLRA 1K68A 2GM4A 3ORFA 1TJPB 4JEIA 2PZFA 2DE0X 3NFYA 3EMDA 3OM1A 1CZUA 2FF7A 4KHZA 3R7SA 5JYBA 2GBLA 4OFBA 1T1SA 1XVUA 4XKJA 1HEUA 3O4GA 1N9ZA 2P7HA 2OM6A 2QYHA 1U28C 2HMUA 3GVXA 3IAFA 1K7XB 1W88A 3ELBA 3TDKA 3FFWA 4WNIA 4BZQA 1J5EB 1H2AS 1ZNXA 3ANNA 4MI9A 3OZEA 1M0WA 4DB4A 2J9RA 3RJ9A 1JHAA 1GA4A 1SQFA 1Q50A 4NQZA 3RC2A 4EHDA 4ONEA 1YVPA 4WACA 1MH9A 2IY7A 1MT0A 1ZRHA 1W0KD 3I5XA 5IVIA 3JW8A 4MPJA 3DBLB 3T41A 1PHPA 1TO1E 5DLQC 2DFPA 3T1QA 3GG2A 4D6YA 3E9YA 3DL0A 2DSNA 3IODA 1ST2A 1YTLA 5CB8A 1KQFA 3NEYA 3OTWA 4Q19A 3K1AB 2WE7A 3GNQA 5G0WA 3KOZA 3THOA 4EGCB 1GQQA 5F3WB 3WMWA 5CD1A 2YXPX 1J22A 2DWPA 4AJ2A 2F64A 3R8CA 3GLUA 2C9ZA 4KRXA 4DSTA 3U6BA 2H7VA 3ER6A 3G5MA 1WETA 1UIMA 1X1BA 2PFGA 3ED1A 4YUAA 4PLGA 4O4LA 1ZK0A 2I2CA 4MWTA 5SZKB 3Q3VA 3VV3A 2YXBA 2DPLA 2X2EA 3WBBA 2ZYSA 1UP7A 4X3OA 4EBFA 5BQXA 3C7KA 1TQHA 3KB1A 4RYDA 4QGBA 3TYXA 4U0JA 3P1JA 3ZGXA 4R9NA 2CNKA 1M1ZA 5AJXA 3ILHA 3VKHA 1LJUA 5LUAA 2WV7A 1E1CB 1SKQA 1Y4AE 5EXEA 1W7AA 4Z9YA 4RY2A 3RTCA 3RKSA 4F2GA 2FMFA 4LE0A 3D7LA 3ZE2B 3D6JA 4PLHA 3SSOA 4LJRA 1JHVA 1L5OA 2QRMA 2WKQA 4CIWA 1QPBA 4R2KA 3AT1A 1PLLA 1QYDA 1TAGA 1YZ3A 3MC1A 5ER9A 4P35A 2A9QA 4EGSA 2IP4A 2AOXA 2I29A 3GGCA 3UZUA 4CKEB 4XEHA 1S9DA 2ERXA 3LVRE 4LYFA 4QQRA 3TF5A 2Y05A 1FP6A 1IHUA 2VTVA 3QSGA