5CCXA

Structure of the product complex of trna m1a58 methyltransferase with trna3lys as substrate
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
289
structure length
283
Chain Sequence
MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit
total genus 73
structure length 283
sequence length 289
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5ccxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ccxA02
3C6KA 4XCXA 2B3TA 4RTSA 1DUSA 3GJYA 5EKXA 4AZVA 2XVAA 5KQRA 3OPNA 3EVFA 1SG9A 3KQWA 2OB2A 4QVGA 2Y1WA 1ZG3A 5CVUA 4GEKA 1SQFA 2IGTA 3KPUA 4RVGA 3UFBA 5KYGA 3H2BA 2C7QA 3SGLA 5K0LA 1KHHA 5EPEA 5LQJA 1SQGA 2PLWA 1M6EX 1N7IA 2I62A 1VPTA 3C6MA 4IV0A 2AS0A 3KR9A 4O29A 3HVKA 4Y30A 3HP7A 5C0OE 3LKDA 3TM4A 1O9GA 3PTAA 2P41A 3FTEA 1NW7A 2LD4A 1VBFA 2YXEA 3CKKA 2PX5A 2YXLA 4RVFA 4YUVA 4PYJA 4QDJA 1Q0SA 4DA4A 4A6DA 1N2XA 1VE3A 1RI3A 3CC8A 3O4FA 4DCMA 3IV6A 5GWXA 5DRTA 1ZGAA 3UJDA 4POOA 3EEOA 2O06A 3G5LA 1YB2A 3TKAA 2O07A 3LL7A 3B3GA 5EIWA 1VQ1A 4PGGA 4QTUB 3PB3A 4PYOA 5K03A 3MB5A 2GAFA 1N7JA 2KW5A 3HEMA 1X19A 1UWVA 2V74B 1F38A 4ATNA 1ZKDA 2OY0A 3LDFA 4YUXA 2IBTA 4MHTA 2G1PA 3UJ6A 3AJDA 3EVZA 3BXOA 2OKCA 3DLIA 4OA5A 3ER8A 1RI1A 2PBFA 2YVLA 3DXZA 2VZ9A 5GINE 2Z6QA 4RTNA 3EVEA 1P39A 1RJDA 2ORED 3M33A 3REOA 1VLMA 2NXJA 4RYLA 4RTLA 3FTCA 5HILA 3TOSA 5EHGA 3OU6A 3UJ9A 4P7KA 3PS9A 4E31A 3V8VA 2JG3A 2FK7A 1L3BA 2PWYA 2AOVA 3UJ8A 5T6BA 3VC1A 3DOUA 4PIPA 4FR0A 2F8LA 2PWPA 3IHTA 3UJCA 5FWAA 2XYRA 4E2YA 3M6VA 1G60A 2EJTA 2ESRA 3ELUA 5CVEA 2FCAA 1R8YA 2ZCJA 1RI2A 2AVNA 2UYQA 4ER0A 3BWYA 5EMMA 2BZGA 3FRIA 3EGVA 2VDVE 1QANA 2OO3A 3KHKA 5FULA 3NW9A 3SM3A 3KR2A 3SSMA 2K4MA 3UA3A 4YV1A 1RJFA 5FA8A 4DZRA 2P3OA 1YFLA 4LECA 2AR0A 3P2KA 2WK1A 5DM4A 3I53A 2ZLBA 3KQYA 2IIPA 3NJRA 1M0EA 1WY7A 5EHIA 3RIEA 1D2CA 2PY6A 3ANXA 3GNLA 3NVKI 1IY9A 4P7JA 4R6XA 4YUYA 2I7CA 3OE5A 3LBFA 1NW6A 5C9ZA 2IH5A 2NP6A 1KYWA 2YUIA 3B3JA 2ZVJA 3WSTA 4RTPA 1OR8A 1FP1D 4P7FA 2BM8A 4CXMA 1KPGA 2PT6A 3O7WA 1H1DA 4HC4A 5E1MA 5HIMA 5CVDA 3DR5A 3HCCA 2YR0A 2OB1A 5GM1A 1AF7A 2OZVA 3BGIA 5EEHA 4M36A 3JWJA 4PYIA 1IM8A 3HVJA 3SXJA 1QZZA 4PCAA 4OBWA 5U4XA 5CCBA 2PX4A 4FGZA 1XXLA 3D2LA 1MHTA 1JQ3A 5B1SA 1I9GA 1NW5A 3UJBA 2NP7A 1EG2A 5K05A 5E9QA 2B2CA 4GC9A 2NXCA 4MQ4A 2ZBPA 3A7DA 3UWPA 5F2NA 5CVJA 2Z6AA 5K0EA 5DM1A 3THSA 3E05A 1WXXA 4PONA 3CVOA 2HMYB 3TPZA 3BGVA 1WXWA 3CBGA 2N47A 3I64A 4PYKA 2NXEA 3G2MA 4KRGA 4YMGA 5BXYA 2JHPA 5LQCA 4V0QA 3UJAA 1KIAA 2JH9A 5FQOA 2DULA 4WVLA 1XDZA 2BM9A 5K0NA 3E7PA 4R8RA 2YTZA 4LWPA 2EG5A 5DM0A 2G8NA 5D1HA 3R9XB 1XVAA 1NT2A 1UFKA 5DLYA 2QE6A 2VP3A 3LBYA 5DX8A 5DT2A 3ORHA 2IPXA 2CWWA 2QYOA 4LG1A 5DTMA 3G89A 5K0FA 2WA2A 3MGGA 5LQNA 1SUIA 4NECA 3AY0A 3KU1A 4FZVA 2PGXA 3FYDA 5HIKA 2AOUB 2I6GA 5DSTA 1BC5A 3HTXA 3P97A 2ZW9A 3PFGA 3MTEA 4PWYA 3HVIA 3X0DA 4HSGA 4ER3A 4V0RA 2ZIEA 2ZTHA 4MIKA 2WA1A 3EGEA 3GU3A 3SVZA 3LGAA 1WS6A 3LSTA 2PX8A 4WXHA 3CCFA 5K09A 4EQZA 1V39A 4KDRA 4YUWA 5HZMA 3EMDA 5E2AA 1XDUA 1R8XA 2GA9A 4CKBA 2O05A 1ZHFA 3FUUA 5DTQA 5E8JA 5ICGA 3FUXA 3KPYA 4RVDA 3HCDA 1INLA 3R0QA 1BHJA 4GQBA 3GGDA 5CIYA 2P7IA 1VL5A 2PKWA 3DMHA 4L7VA 2AOWA 5E1DA 2PXAA 5E9WA 5EZSA 2HWKA 1I1NA 3GXOA 3A7EA 1KP9A 1TW2A 3F4KA 3JWGA 1G8AA 1DCTA 5DWQA 1FJXA 2B78A 3G8BA 3K0BA 4CKCA 2P40A 3LX6A 4IV8A 4AX8A 2IH4A 3MERA 4KW7A 1SVUA 1ORIA 3HA3A 4HGYA 4YMHA 2R6ZA 1KR5A 5GIOE 4HRAA 4HG2A 5EMKA 2P35A 3BWBA 5HIIA 3ELYA 4AUKA 2UYCA 3KR0A 4EVIA 4RTQA 3SR4A 5GIPE 3PX3A 1MJFA 4QQKA 5DXAA 1FP2A 3BUSA 5EG5A 3MHTA 3DMFA 3KQSA 3G5TA 2BR3A 3P2EA 3A27A 3RW9A 2NNWB 4OA8A 2UYHA 4BP1A 3BWMA 2AN3A 3PX2A 4H0NA 1F3LA 3GRVA 2AN4A 4XUEA 3B3FA 5K8VA 1NBIA 3QOXA 2YX1A 4CTJA 2IDJA 4FSXA 4QVKA 3MAGA 3LKZA 1XCLA 3NTVA 4FT2A 3O31A 1NE2A 1YFJA 4E2XA 1X1CA 5G02A 1JQEA 4DCGA 2G70A 4CTKA 2PXXA 1NBHA 4FT4A 4B17A 4YV2A 2GLUA 2P3LA 5K0BA 3SX0A 5JUWA 2PSSA 1NW8A 4BP3A 3P9IA 3TR6A 2NYUA 1Q0TA 3T7SA 4U7PB 3T7TA 3TMAA 2AOTB 2YQZA 4PIMA 3FZGA 3C3YA 5CUQA 2XVMA 9MHTA 3SSNA 3NWBA 3ID6C 3PVCA 3FPGA 3GDHA 3NWEA 5EKUA 3CGGA 3LCCA 4X41A 4M7RA 5EC8A 4RTMA 2VDUE 2R3SA 3GRZA 4XUCA 2P1DA 4RV9A 3A4TA 1KYZA 3KQTA 3OU2A 2BR4A 4DF3A 5HFJA 4GBED 1D2GA 1EAMA 3JWIA 4R8SA 4RTJA 3HCEA 3UA4A 1ZGJA 2FHPA 3EVDA 3KQQA 4X61A 1JR4A 2ONYA 3HA5A 1I4WA 4ZTBA 5FQNA 1JG1A 2HNKA 3HNRA 3TFWA 2V7EA 4AZTA 1PRYA 5E9JA 5F2OA 4A6EA 1X1DA 3HCFA 4GOND 4PGHA 3GO4A 5E1BA 1U2ZA 5KS2A 4F85A 3R24A 1RJEA 2ZIGA 5FCDA 4F86A 4C08A 3VC2A 4MWZA 1QYRA 4RTKA 3SSOA 5K0CA 3DUWA 2FRXA 4UOEA 1AQJA 3DH0A 5DPMA 3M70A 1X1BA 2H11A 2IDKA 4IWNA 5EIFA 4P7GA 2XYVA 1XCJA 2PX2A 5EVJA 2YXDA 3PT9A 2AOXA 3DTNA 2BR5A 2C7OA 3P2IA 5EQJB 2AVDA 1QAOA 4X60A 3C3PA 2HR1A 5ERGB 4PYNA 10MHA 2UYOA 4GOLD 1XTPA 1P91A 3EEYA 3KR1A 5DX0A 1R6AA 4DM3A 5LQKA 3CJQA 4YUZA 1JSZA 4RTRA 1HMYA 1XJ5A 3LECA 8MHTA 5K0GA 1T43A 3R6TA 1WG8A 2O0LA 2GB4A 4X1OA 1P1CA 5D1NA 3LDGA 1JG4A 5DSXA 4OX9Y 3OZSA 4GOMD 3NDIA 4M38A 3NDJA 3E8SA 4R6WA 3TRKA 3NMUF 2ZULA 3OE4A 3P8ZA 4HTFB 4QPNA 4RWZA 1NV8A 2P7HA 2E5WA 3FUWA 2Q41A 5EMLA 5ICFA 3EVGA 3QOWA 5CM2Z 5E8RA 4KWCA 5T67A 2UZ4A 4C05A 4E2WA 2PV0A 3KQMA 5T64A 3EVAA 2FPOA 3DXXA 2Y1XA 4OQDA 2GH1A 4BY9E 3HCBA 2A14A 4ER5A 2HV9A 3DLCA 4RSRA 3FTFA 1YZHA 3KQVA 4F84A 4EKIA 3OZRA 1TPYA 5M5BA 1EIZA 5CCXA 1Y8CA 3EVCA 3BKWA 3G2OA 5FWDA 5K0JA 2I9KA 3GWZA 3VSEA 4ISCA 3G88A 2PVCA 1AQIA 5DX1A 3ER9A 1YZ3A 1EQAA 3MQ2A 2QRVB 3GRYA 3AWIA 3VYWA 5EOVA 2IFTA 3NVMB 3M6XA 1X1AA 2QY6A 3BGDA 3DP7A 5CD1A 2IP2A 1BKYA 1ZQ9A 2H00A 3U81A 4ER7A 5JR3A 3KPJA 5FUBA 1B42A 4BLWA 2P8JA 4E32A 5GM2A 4RTOA 4R05A 2OXTA 3FRHA 4GC5A 4FS8A 4QQNA 1R00A 2NXNA 2O57A 3T7RA 3IYLW 5HOQA 3ELDA 3KQPA 1EJ0A 4GUAA 2DPMA 3EPPA 3UJ7A 2QRVA 1RI4A 3TLJA 4OBXA 4E30A 2CL5A 3BKXA 3G2QA 1QAQA 3Q87B 1NKVA 3B89A 3M6UA 1M6YA 3THRA 5ICEA 1SKMA 3FPEA 5P8WA 1R18A 3HCAA 3PFHA 3DULA 2ERCA 4GOOD 1KXZA 5CVVA 1P1BA 4IKPA 2ONZA 1VP3A 3GCZA 2ZBQA 5GOZA 4G56A 2HTEA 4E33A 3P9KA 1XDSA 4AZWA 2H1RA 5FTWA 2CMHA 1L3IA 3LCUA 4KIFA 2G72A 5IH3A 3EMBA 2IH2A 5BW5A 3GIWA 3FTDA 1PJZA 3B7PA 1RI5A 4BLVA 3Q7EA 3M4XA 4U7TB 4GF5A 2QM3A 5E2BA 3HM2A 1QAMA 4EK9A 4QDKA 5GP1A 5LR6A 2FK8A 2FYTA 5E1OA 2GS9A 2JJQA 3AXSA 3C0KA 4ER6A 2ZZKA 1BOOA 4PCLA 3QV2A 1G38A 4PYMA 3TM5A 5FHRA 4X63A 5K01A 3GRUA 4M37A 3G8AA 3G7UA 1G55A 3HA7A 2VDWA 2Z6UA 3V97A 4K6MA 3I5UA 4KVZA 3S68A 4AZSA 3HVHA 3LDUA 5DRYA 3PLAE 2C7RA 4BLUA 1L1EA 4Y2HA 1L9KA 3K6RA 4PNEA 2B9EA 3OZTA 4OQEA 2CMGA 5LSAA 2JHCA 5DM2A 3L8DA 4HGZA 5C1IA 2AN5A 1IXKA 5EZQA 3TQSA 3EGIA 3SMQA 2OYRA 3OFKA 2PJDA 1O9HA 3IEIA 2BH2A 3FPFA 3BT7A 1TW3A 5EMJA 1FBNA 2JH8A 1Z3CA 3KPVA 3M6WA 2IBSA 3LHDA 3BZBA 3E23A 1AV6A 5FA5A 3TKYA 3KPWA 3UZUA 1SUSA 3JWHA 3LCVB 5DTRA 4EKGA 3A26A 4HH4A 4FSDA 4RX1A 4C03A 2ADMA 1R74A 1UIRA 2EJUA 3FPHA 1JG3A 2P3QA 1L3CA 4PYQA 4C04A 1WZNA 3KQOA 1RJGA 4FP9A 5HIJA 2ZZMA 1JQDA 4DQ0A 3G2PA 2JHAA 3OU7A 4PINA 2GPYA 3P71T 5FADA 5BW4A 4JXJA 2PT9A 3OFJA 1D2HA 4YV0A 4Z2YA 3FUVA 3FUTA 4KDCA 5LQRA 4QTTB 4C07A 2XYQA 1JTFA 4E70A 5FHQA 3R3HA 2ZIFA 3CJRA 3ME5A 4DMGA 2AOTA 2ZFUA 1G8SA 4XUDA 2ZWAA 1JSXA 1FPQA 5KVAA 2ZWVA 1KPIA 5ICCA 3B5IA 3OCJA 4EMSA 3UBTA 2XBMA 3ELWA 1JG2A 3DMGA 3DXYA 5H02A 5IKMA 5LQUA 1NV9A 2B25A 2ZSUA 3MTIA 5HEKA 3FPJA 1JTEA 1VIDA 2ZBRA 3BWCA 2G71A 1G6Q1 1YUBA 4PYLA 1VP9A 4KIGA 3P9CA 3LPMA 3CJTA 5EGSA 1HNNA 3MCTA 5EEGA 2EX4A 5KQSA 1KPHA 2OBFA 4DKJA 3FYCA 3RODA 2OPBA 2AZTA 1ORHA 3P9NA 1YF3A 2EFJA 3T0IA 2VS1A 1O54A 4CWAA 3I58A 3AXTA 4HTFA 3GRRA 3A25A 4P58A 1NW3A 4RVHA 5F2KA 3EVBA 4LWOA 3ERCA 2AOUA 3MCZA 1EJ6A 4C06A 4C4AA 2C7PA 2CKDA 4QPPA 5BP7A 1DL5A 2ZZNA 4CKEA 4E2ZA 5LQAA 5DXJA 5MHTA 3KKZA 7MHTA 2PXCA 4MTLA 3I9FA
chains in the Genus database with same CATH superfamily
1IY1A 3NANA 3RYHB 4NEQA 1JN0A 1ONSA 2ZPUA 5KQLA 3UAGA 2IF2A 4RTSA 3LYLA 4XB6B 2HADA 2ZT6A 4MGHA 3QPBA 4EMTA 2GUWA 3H5AA 1P0FA 5C5EA 3N28A 3E53A 2AH5A 1ST2A 4MO9A 5KSZA 2W6JD 5LQMA 4HVLA 1DJLA 4AMYA 4FHDA 5ITSA 3PQ5A 1KHHA 1Z83A 4OQZA 1I30A 1QBKC 4G1VA 5FFFA 4B0PA 1WU8A 3FJYA 6REQA 3AKEA 3U7GA 3VR5A 1YRQA 3TOXA 1TE2A 3KHTA 4EF4A 1OX4A 4NJOA 1NW7A 5KTRA 4L1KA 4CKCB 4QM6A 3TSOA 1OH7A 1PNRA 1HF3A 1K7SN 1RI3A 4I4NA 3UAVA 4Z9XA 2BMFA 3HDJA 4I66A 5EJGA 4S1NA 4WY8A 3G5LA 1YB2A 2R6AA 5C1OA 5CEEA 3NC0C 2GKGA 4MEAA 4F7DA 2HKIA 2VNAA 4RXTA 3OLCX 4HH0A 3IL2A 4XRRA 2GAFA 1U0JA 1N7JA 4KV7A 3T4XA 2PS0A 1CRLA 5LZ9A 1QQ5A 1UP4A 2KE5A 5IG2A 3C6BA 3OPQA 3O4IA 3PEVA 4B8WA 2ZANA 1VMIA 3I72A 3G6WA 4BJ1A 1MX5A 2PTGA 4KO8A 2O19A 3PX7A 3JR3A 3FMVA 5U4QA 1E59A 1Z28A 4ZRNA 2PWZA 2VHTA 5AVKA 1IJKA 2JLAA 5J59A 5LZ4A 2QL9A 3DXZA 2M98A 4IQ8A 3WDLA 2Z6QA 2XGJA 1N1MA 2PZFA 2ORED 4ND7A 1HFWA 2G5TA 1PHRA 2J3JA 3D6HA 4RH3A 3GUYA 3G9QA 5IVKA 3M9LA 4L6IA 4P7KA 4F5ZA 3OQHA 1AKVA 4G86A 3V8VA 1ZD4A 4Y6PA 3U4HA 3VO8A 1R0RE 2PKEA 1S4MA 5FH9A 5JSHA 5JZOA 4G36A 2C9YA 4I9NA 4P3OA 4NCHA 5C1DA 1TT5B 1Y6FA 3VKHA 1QE0A 3QMMA 4O08A 1N34B 1LEHA 2OFPA 3DWGA 3O26A 4FFNA 4X3CA 2JFXA 3ZGZA 3EF1A 2FSGA 3BPSA 1CUSA 5C4IA 3RS9A 4MQEB 1VMAA 4LGYA 2GN0A 1TVCA 2AG1A 1IAQA 5EMMA 1RFGE 5BNWA 5ERYA 4Y6SA 2QUHA 1B43A 3SSMA 5BW4A 3KR2A 1O2DA 1QOQB 2AMFA 4ZAZA 5FA8A 2JIZA 5TQ0A 4BO8A 1JFVA 1ZH6A 3R75A 2ZLBA 1NC3A 1Y37A 4UZSA 3T5CA 5JASA 3BB1A 4FHFA 1Z75A 3IKMB 2HIHA 3QNWA 5FUYA 4QT0A 2WTUA 1IB0A 3AT1A 3WYAA 3LT1A 3M5PA 2IEGA 1G1MA 1JB9A 2ZUWA 1H9BA 4KODA 5T4HA 4F92B 1CP3A 4NCBA 2AI2A 5ECGC 3B1JA 3PUJA 3QW2A 4JLOA 4EHAA 4FMPA 1QRDA 4BQIA 4V0LA 4YIKA 4HNUA 3SF0A 1IMJA 3P9SA 2DPLA 3DAGA 4EUKA 2PVSA 3VA7A 2CXXA 3HCCA 1MEJA 4HAWA 3H83A 5HRUA 1NXVA 2X8BA 3U39A 1W5BA 3E70C 3MWJA 4X7MA 1UEIA 3OO0A 1DEXA 5BSKA 2H0QA 2IDZA 3R0IA 2DJIA 1VKJA 4NBUA 4WNAB 4ESEA 4F8EA 1J23A 1PI3A 4WV3A 2F9LA 3SYRA 3K9NA 2CB0A 1KETA 2RJNA 3UC5A 2GCGA 4ZT6A 5E4TA 1I9GA 4BDSA 3UJBA 3IEMA 3S8EA 5IRCD 3OWHA 3WGYA 3F96A 3L4BC 1H2BA 1C2YA 1UPUA 2Q4EA 3G9XA 1TIPA 2WBLC 3MELA 3NWJA 4HNQA 4UXHA 4IJQA 3INRA 5DXFA 2UVDA 1MZPA 4G89A 3UWSA 3B85A 1ZI8A 2ZQYA 4AYXA 1P6QA 4ZEVA 1YQEA 2C88A 4PS0A 4WK4B 5ALGA 1N8SA 4TUYB 5F78A 5FF9A 1U0OC 1UJCA 3VVLA 1HWYA 2BM9A 2B8WA 4DHWA 1Q3TA 4LJYA 1UBKS 1U28A 1NT2A 4WKBA 1ZONA 3GR6A 5JD4A 2V3CC 2I9PA 2MIIA 3C7TA 3GCXA 3UJPA 5EKDA 3ZVLA 4LI0A 1KY2A 3LY8A 5ECYA 3BTOA 3PXDA 3MJEA 1R7RA 2X5OA 1KJQA 1PZHA 2OBNA 1RXYA 2Y6UA 2YHIA 1E0JA 3KU1A 2FR0A 5KSPA 5DBFA 1P5RA 5HE8A 3P97A 1G8PA 1UWKA 4BHTA 1A7UA 2VHYA 1G19A 2GUGA 4O5OA 2R66A 2FPGA 4V0RA 2B61A 3AR9A 4R2JA 1Y80A 4RM3A 3WYBA 4OO3A 5J40A 3FSRA 1YSCA 2H8KA 4A6PA 2PX8A 4FM9A 1NTRA 4O1MA 2Z2IA 4PNZA 2RGRA 1PGNA 5HZMA 2A8YA 2HLPA 4YMWA 1R8XA 2G36A 2OAGA 2YVAA 4E5VA 1XCBA 4MS1B 3G2HA 2HU7A 1JSLA 3K70D 1MF7A 4JYPA 1L7XA 4U63A 1D5CA 1ZEMA 3KPYA 2A9PA 3WQBA 3HCDA 4K6KA 5T4FA 1INLA 3ZHXA 4DA6A 5BSEA 1XALA 3BE8A 3H1EA 3JD4A 5ENDA 1DTWB 1TKBA 1KP9A 2W2TA 5IF3A 4BVLA 5C37A 3HWX1 4YALA 1BX3A 1RM0A 1UBMS 3K73O 1I24A 4KVAA 5BSMA 1PZXA 5AVUA 4P3XA 4FU0A 4HRAA 3QVXA 1UXJA 4HADA 4W1RA 5FLKA 4BFXA 1L0BA 4HNVA 5JAIA 4AG5A 2W2XA 3KR0A 1VKNA 1RQ2A 2CNBA 5DXAA 1AX9A 3QXCA 3EUWA 1U2DC 1TUIA 1W9MA 5FUXA 2XNHA 2JLBA 2ZIXB 3BZUA 2JAQA 1EGHA 5CJ2A 5LZ2A 3EH2A 2VRCD 4FJ0A 3NV9A 3IP9A 4KH1A 5ITZA 1KAHA 2QEQA 1TA9A 3NI2A 4XR9A 5AXDA 3SC4A 2CNWA 1WKCA 3S8MA 3TSZA 3U9SA 5C81A 1C7RA 1JRLA 2CLDX 1ZO8A 5BR7A 2WSBA 4BGDA 3K1YA 1CETA 2PCLA 2PLAA 1OROA 3V2HA 2OA0A 1SCUA 1Q83A 3OETA 4A1OA 1NBHA 2HF8A 1P18A 2QROA 2GR9A 1YJ8A 2JH3A 1CJCA 1JDNA 1LWOA 1NRWA 1TKCA 2XW6A 3EG9A 3ZXXA 4E7OA 4ZJZA 2PPVA 1U2SA 3IAUA 3AETA 3DAOA 3TR6A 4LSGA 5A0FA 2WSSD 3B8HA 4UOQA 5FB3A 3AJ8A 1AQNA 3FZGA 1U3TA 3KUCA 1E92A 5LUBA 2JANA 3ETJA 5IAEA 4C21A 1UKBA 3IQFA 5AIBA 4W1SA 4X41A 1GGHA 2JBWA 1FTYA 2EKLA 2J45A 4HQ6A 3SC2A 1MIHA 1QF9A 3LVQE 5LMCA 2BEUB 3L3BA 4WFJA 5CHYA 1C3OA 1BQ4A 1RD4A 1A69A 3OT5A 1V25A 1CUCA 3L0CA 4FYJA 3UA4A 1SKYB 3EZ9A 3KQQA 3S2YA 3VJKA 3THWA 2CFSA 5IEBA 4JLNA 3W5JA 2JARA 3DE2X 1B6SA 4GWLA 2WTEA 1OI2A 3WA7A 4RBNA 4G0UA 1MFZA 3D3QA 2DJ5A 3A9RA 4C7MA 4F3RA 1ISPA 2L0XA 3CH4B 3IALA 3KK0A 5H83A 3T1NA 2BBSA 4JL5A 3T41A 4AU1A 4AX4A 1JQBA 4EGAA 4MR7B 3EXEB 2D8MA 2PX2A 3NIGB 1E1DA 5D2CA 2LIPA 1DRJA 4DLTA 1ZK4A 2BI8A 2ZYDA 3HI6A 1CKEA 3QUBA 1WA5A 3L8YA 3FAZA 4DMKA 4B4DA 2ZBGA 4A27A 4OAQA 4J2HA 1XZBA 2QSYA 3FWZA 4GOLD 4IUYA 1J2JA 3FSGA 4PRZA 5B53A 2RH9B 1I8TA 1P45A 1MC4A 1LI4A 1T1JA 2VC2B 5KHOC 4B84A 4GICA 4ND1A 5KNBA 2PNJA 2R4QA 4EI8A 3ENKA 2GBPA 3B3QA 1ONBA 5BSTA 2VWGA 3AL2A 3WL3A 3W8RA 4RMNA 1QX4A 2Y0BA 4JJIA 4TKUB 3WIBA 4BDTA 4B2YA 4RWZA 3O8CA 1C3XA 1OYVA 3M4JA 2NTEA 4MVXA 3OPYA 4RPGA 4CNBA 5LP1A 1P1KA 5HHTA 1XCMA 1NYQA 5GONA 1DX4A 1WULS 1MPTA 4F0JA 2QM8A 5E7MA 2CV0A 5LPNA 3GVCA 1W4ZA 1T2FA 4CCWA 4H0FA 4PAMA 4N54A 1MO5A 2VWPA 3NEAA 4UUMA 1GUDA 1LVUA 1M33A 1Z17A 1XRSB 4OQDA 4R2IA 4DTIA 4AZ3B 1T26A 1AUXA 3MA0A 4HGOA 1ENYA 3STWA 4B74A 4JJ7A 5M5BA 1NY5A 1TPYA 1M8GA 2BGUA 4DUPA 1ONNA 3FDXA 3MM4A 4EKDA 1WO8A 4U5QA 2B21A 1GPH1 1V5FA 2CD7A 2I4TA 4IZ6A 5DX1A 2OORC 3S0JA 4HFJA 1ZUD1 5AJYA 1M1YE 1PX0A 1UK9A 4G0QA 2EZUA 3H18A 4CT4B 5J23A 1KDTA 3GF4A 1W5EA 1P5JA 3BXFA 3KPJA 5KTSA 4JP2A 5DGXA 4KPUA 4UNIA 5MGNA 1LKZA 1XN1A 1IHXA 1X13A 1Y9DA 3GMTA 2MYTA 2HW8A 3A3PA 3MIIA 3GUCA 1R00A 4TYMA 3RQIA 5D3KA 3WB9A 1IBRA 3WSVA 1JEYB 1QYDA 2NNLD 1Z36A 2CZQA 3TTSA 5KJCA 1KMHB 1FUKA 4LSWA 3BB3A 2HUPA 3QMWA 5M2QA 4F60A 2NO5A 4FQ5A 1PNOA 3FPEA 4PXYA 1Z62A 1NVTA 1RYYA 4K6FA 5T57A 5TB5A 1SUBA 3ONEA 2D74A 4D3ZA 4GOOD 1QMGA 5F7ZA 4C20A 4HZIA 1XZCA 1N32B 4OD0A 4HAYA 1YNOA 4NC9A 2XMRA 1VP3A 1KMCA 4QRDA 2HTEA 4MW1A 5FL3A 3N05A 4JBWA 4OKNA 1KDPA 3N76A 3C3BA 4TL8A 2PRZA 3R3JA 1BDIA 2R97A 1SD1A 1OC4A 1H4QA 3F5DA 2H48A 4U7DA 3D6JA 3KC2A 5TV2A 5DBGA 1QHFA 4TMWA 4AW9A 3WFZA 3EISA 4E5YA 1F1BA 5CGQB 3AB7A 1MAAA 1QZXA 3R3WA 1M8FA 2OZEA 1IQUA 2HH9A 2JJQA 1P4SA 4MP6A 2YINC 2IHTA 3DAFA 3KOUA 4ER6A 5KDDA 4HL6A 5G2OA 5JXGA 4L0MA 3FPLA 1X2EA 3K2QA 2R8YA 4LWZA 2QZSA 4DR4B 3VR5D 3K5IA 3FFBA 2VDWA 1OILA 4MKRA 2CHEA 3EMVA 3S68A 1YRYE 3QYPA 4MZDA 5BMVA 4NYJR 3COVA 4AF8A 1OFVA 3CN7A 4YJ2F 2WIAA 1CNFA 3I5AA 3PFBA 4MHSA 3UHOA 3EIHA 3ZV3A 4U1RA 3M3DA 3O03A 5J4VA 1KEWA 3EGIA 3SMQA 1VECA 1GNSA 1E4EA 4J2TA 4OHUA 4PLHA 1JLLB 3VYTB 2ZSIA 3NM6B 3TXYA 2A9OA 1FBNA 4DJEC 1XZMA 3FFTA 3R44A 3SX2A 1N3BA 1Z7BA 2CHVA 4FKZA 2VKTA 4G67A 1AV6A 2I67A 1Z4QA 1JZSA 3UZUA 1L7MA 2ODAA 4UU8A 5LA6B 2NAPA 2ATXA 1QIDA 1Y89A 2HQOA 1OYOA 1R0WA 2WUFA 5KO2A 1ZC1A 3FW1A 5BRJA 2ORWA 1UIRA 3D6MA 4P08A 2LNDA 4OHZA 1ZLYA 3Q4GA 1GZHB 4BUZA 3NAGA 1T6ZA 4NV0A 1XTKA 2H1CA 3R6GA 3ZGYA 4FOLA 2ATVA 3WISA 1E2IA 1XYVA 2R0QC 3IDSA 1BXZA 1PJQA 2HRBA 3TB4A 5EPPA 3AONB 3FUVA 3KUXA 4ZI7A 2Y0CA 3A6FA 4K88A 3ZK9A 3OCUA 4ZJPA 2OGUA 2I78A 2B1QA 3QMVA 4FYHA 2RGWA 2FF7A 1G9TA 4WE3A 5C4GB 3IIEA 2P9CA 2VQDA 3OZIA 3R77A 4QREA 3QVOA 5C5CA 2JIZD 3PHJA 4HJXA 5TEVA 3ELWA 3GLIA 3C1TA 2E49A 4QJ4A 5HEKA 4KE8A 2O54A 1T15A 1CP2A 3H13A 2XVZA 3HRKA 1V41E 2ZR9A 3ZPXA 1QB8A 4W5WA 2AE2A 3L7CA 4R0MA 1BJRE 2W2LA 4CM7A 4BMXA 4RGVA 4D82A 4PTLA 1XB2A 1XWIA 3U7JA 3ZE9A 1CRPA 4TLCA 4E3WA 2J33A 1R0SA 4DDTA 1GA4A 4TLBA 2EZ4A 4C0XA 3MMPA 1V1RA 3HVRA 1ZBQA 3JZFA 4C0JA 5KTKA 4P22A 4F71A 3LDAA 4RKFA 3BMNA 4QOEA 3FPAA 1XWWA 3REFA 1RC8A 4HGPA 1Y5LA 4BZZA 4KZPA 1BXGA 5D86A 4EKEA 1P4JA 3W78A 3VHLB 3WLPA 1HL7A 3FYTA 2Q2OA 2QSZA 2VWHA 3IUEA 3QQ8A 1TCBA 3JALA 2XMZA 3W3AD 4CKEA 4O8ZA 4YJ2B 2IU6A 4DAEA 4QXQA 4QWWA 3I9FA 2GCIA 3MYYA 4FD3A 5DBOA 1JHXA 2B30A 2QRJA 4CG3A 5GV8A 2BSAA 3O8OA 3SM9A 1WM1A 4ENSA 2FOXA 1SG9A 5L6MB 2JI4A 1B14A 1PFQA 3Q8MA 5DLEA 3A9UA 4RVGA 3ZWOA 5CIYA 3VU9A 2C7QA 5I7UA 3GBVA 4Q3NA 1QIGA 1YU6A 4Q37A 1JR2A 4JT2A 3I2GA 4RK1A 2X19A 3BG5A 4C0KA 1X0VA 1T36A 4A0SA 3UG7A 1M6NA 1FFDA 2CMDA 2EX1A 2ZSBA 4I4TA 4RK6A 1BN7A 3H87A 1VTKA 2JFPA 4UVGA 4JY7A 4QODA 4AJLA 4DA4A 3RC8A 3GJ8A 2FEMA 2Q28A 3O4FA 1J2TA 3FZNA 2WWWA 3CRRA 1XLWA 2QVXX 4ZVVA 3HK2A 2GEVA 3BSWA 3H5IA 4JOQA 3FAKA 4IKEA 3KSAC 1J0AA 2O07A 4QNNA 1LW6E 1J8VA 2BKUA 2FLKA 3AR7A 1TQHA 2CT8A 2XA2A 1YVEI 3GW8A 3RADC 2QIOA 4B4UA 5KOJA 4DV1B 2TRSB 4KQ6A 2V9ZA 1GR1A 4QWMA 3VZRA 4ZD6A 2ILVA 2PGJA 3AU8A 4MIEA 4PQGA 3IEKA 3ZWQA 1KVQA 2WVJA 3DWFA 2WG0A 1IOVA 1LV8A 3QKTA 1MABB 2A0UA 4RTNA 1TU3A 5FI3A 2VF4X 2O2HA 3H1TA 1IL0A 4YXWA 4LJ8A 1CY7A 4OQNA 5HILA 3B1KA 2XCLA 4I4CA 2BUCA 1KU6A 4PZEA 5B4VA 5IH7A 2JG3A 4FHCA 4K6CA 3THXB 2O8NA 3C8UA 4LTDA 4DMRA 4BO0A 1EGQA 2P0EA 2JDID 2XCIA 2FW9A 4PIPA 2NZ2A 3PUHA 1KZ9A 2FDRA 1YHYA 2CDNA 3AF2A 2ZYRA 1WW2A 2IEIA 5E6UA 3CEPB 2HRRA 3WLIA 4DQUA 3RD5A 1RM4A 3LIPA 2UYQA 3HJCA 1JHYA 3C5VA 1ACJA 2E4ZA 3GFOA 3ZE7A 1ZM4A 3DDUA 5JJKA 3EGVA 3L4EA 2OO3A 2XCRB 1B0ZA 2Q3LA 2BAGA 4CM4B 3CEHA 2IPMA 4JX8A 1F7VA 1IIRA 1YBAA 2DQKA 4K6GA 1ZM9A 1YULA 1L5HA 3ONNA 4D41A 5IBPA 3U7EB 4CI0B 1AZLA 1RWQA 1V5IA 1IY9A 3KX2A 4YUYA 3OE5A 3Q1LA 4GW3A 4YQZA 4RGBA 3AVOA 3MGKA 3RVKA 4DLZA 1E2DA 5ECDA 1MLDA 4G1MB 3IKVA 1J21A 2FN8A 4NMXB 3G2KA 4MYCA 2A1UA 4OFWA 4MUXA 5HSGA 4NE9A 5KNDD 5FBWB 2QD5A 3UH1A 5EWMB 2N46A 4XSHA 1B41A 1WNTA 4G1CA 1YDMA 3PPVA 4N6OA 5AHXA 4A2QA 3KYDA 4Z6KA 1JZTA 4ERNA 3VVCA 1JL3A 2HK7A 3FOWA 4MDYA 4CTMA 2XRFA 2IXTA 5TVGA 3V34A 4PICA 2W2OA 3PWKA 4OBWA 3UUEA 3IMEA 1T5DX 4RA9B 2Q27A 2BGLA 1GCGA 4J0FA 1PBTA 2Q2WA 1JQ3A 1N5MA 4Y1RB 5MDHA 4B83A 1WHTB 2MSDB 2UZ3A 3MBOA 3RC9A 4LIPD 3USZA 4YJGA 1CUAA 4LJAA 3EY4A 3P0RA 3DYIA 3V80A 4N5NA 1T25A 2YYYA 2IZ6A 1T29A 3KVNA 2VPQA 3F1LA 4MGEA 3TPZA 1YBFA 3N53A 2G77B 3KU4A 1SCNE 3L1IA 3QIAA 4P86A 4PYKA 4R4JA 4LMRA 3RROA 3RVDA 2JH9A 3ZXUB 1K66A 1K5DA 1PF7E 1HR0B 4R8RA 4C1BA 3LT5A 1A7AA 4ZC8A 1SIBE 3I2IA 1L4YA 3FPBA 4PBTA 2DWQA 4TKLA 2OCGA 5JMWA 3HMQA 1AUVA 1RMTA 5TT1A 2XA9A 3SNKA 3ORHA 2FZEA 1FNDA 2D2IA 3IKLA 3H6GA 1Y1TA 4QGAA 5TPZA 4BZWA 1G41A 1Y63A 1S1MA 1K2VN 4WLNA 3K71B 2EBUA 2AOUB 1HE8B 2DPGA 3AH8A 2WUVA 2XJ4A 3R0ZA 4HAUA 2QVZX 1KVSA 1DXYA 4HSGA 4QUAA 2WKRA 5K6RA 3C8DA 1GRRA 4HAVA 3EC7A 3ETGA 1W88A 2NMVA 4EQZA 3HUDA 4YPOA 5AVVA 4MLCA 2AI1A 1DXOA 2H2IA 5B1EA 4R31A 2WFZA 3ET5A 3H4IA 3WHPA 2YFHA 5DNWA 1SBYA 5G0SA 3U4DA 4HNSA 3NRJA 4CQLB 1YV9A 3I42A 3L9WA 4EJ0A 5CTAA 3PC4A 1JJBA 4B7AA 2JLSA 2PKWA 2ICAA 4O59O 1EX6A 5IP5A 4E2XA 4F9TA 2RGYA 1Z39A 1G8AA 4N5HX 2CMFA 3K0BA 4IFIA 3JY6A 1KK1A 5AUOB 4FFDA 1RXEA 2XKJE 2E4YA 3CZ9A 1M1XB 2C9BA 4ZVMA 4BVGA 3EHEA 3CX6A 5IVDA 4JC4A 1M6HA 2X5JO 3FIJA 4TSKA 2CLKB 5DGDA 3ELYA 3SZGA 5CXQA 4MWDA 3SE7A 3BCRA 3UGTA 1FTSA 1NGSA 1G20E 4N5DA 4MNTA 2J4DA 3DMYA 3I30X 4ZQFA 4M8SA 2C2ZA 4LVCA 3HABA 4IR7A 4UXJA 3HB0A 1XZHA 2QQ5A 3BORA 4GNKA 1MN6A 1X15A 4PQRA 3ZDXB 1VIVA 3QKIA 4D42A 1YQXA 3AVPA 3W7VA 4RPLA 3GZNA 1NASA 5SICE 1N8KA 4ENPA 3LFTA 5ALQA 2JJ2A 3OM8A 4MQBA 1YXMA 4JJ4A 3ZS9A 4B0OA 4CTJA 5IKPA 3GEGA 3O82A 2C2BA 4ILEA 3HYNA 1OVMA 1NHWA 1V8BA 3P45A 2F67A 4NEGA 3QWBA 3EEIA 1ZHHA 2NU8B 8ABPA 1I01A 3JZIA 3RTGA 1HYQA 5DKFA 4N12A 3D6NB 1JLKA 1SM4A 1VI5A 2PSSA 3A36A 3EXG2 1JPNA 4KXQA 4MS1A 4AQDA 4BP3A 3VC3A 3M4NA 1NBME 1GSHA 3IAAA 3OLXA 3ONDA 3PGXA 4M8LA 4PZPA 4RK7A 4BB9A 4C6RA 2AUTA 4K1XA 5H9WA 3AUUA 4UE6A 4OQLA 1I7NA 4YIHA 4WZBB 2V7PA 2DFPA 3LUCA 1Q1GA 4E4TA 4OQXA 5ED4A 5DIFA 5EKUA 2GWHA 1FDIA 1S3SA 3WGJA 4BO6A 6YASA 4MYSA 1YTLA 5IJWA 2FQQA 1T5IA 4KO3S 2WYIA 1XRMA 4N47A 2OZKA 3FZQA 1QVZA 2GN8A 3MWYW 4Y1FA 5BV8A 1NONA 2ORYA 2QAGA 5CM8B 3JQBA 5REQB 3A1NA 1FMCA 3TFWA 1COWD 3AF1A 4QU9A 2FG5A 5E9JA 5F2OA 1AHPA 5F7JA 5LQDA 3LOQA 1T4CA 3ZC3A 3HB7A 3UGKA 1XMVA 1DKQA 2Q6KA 3F90A 1L4EA 4TM8A 1GQQA 4F86A 1VYUA 1CXZA 4WESA 1OKKD 1V95A 1XQ9A 1KOGA 1RLJA 1U0EA 3H9JA 3SXUB 2HSJA 3X1DA 4F1KA 1Z6AA 4IMRA 5JTUA 2OFWA 4XD7D 2XYVA 3AHCA 1G59A 5TLSA 4GPIB 4P31A 1PV4A 2FN7A 1JDTA 2NU7B 1ZD9A 3L8GA 4IX9A 4Q1DA 3C3PA 2YNMC 4UHEA 4AY6A 1IM2A 2HR1A 1YNSA 2ASVA 4RV4A 1SHKA 3EEYA 3DZGA 1U1GA 2V9PA 3C5EA 4MCJA 3T7DA 5K6AC 4OHYA 2X8WA 4QQ8A 2HBZA 2W6NA 1F2TB 5HBGA 1QB7A 1SD2A 1EE2A 4PPNA 4OXRA 1ZIPA 5SZIA 1ML3A 2QL6A 4CT5A 1HE2A 1KI4A 3GRFA 5CYGA 3ZD9A 4EG7A 5DLQC 1U6JA 3E6AA 3WAGA 3PUYA 3W2TA 2PUEA 1K5HA 3ADBA 2IXBA 3Q8XB 4FBLA 3F46A 3NONA 3OE4A 3BSFA 4LZJA 1ZZEA 1QTRA 4QUEA 3N8IA 3QNMA 4RADA 2E6UX 4LW8A 3ESAA 2WIGA 3FUWA 1M1NB 4NJEA 5FPHA 4NECA 7YASA 3ZLUA 3ECCA 4I2NA 2NT3A 1ODJA 5IVIA 1R0XA 2ZBUA 1O0CA 1DZ3A 5EZYF 1M7HA 2IC5A 3F9IA 2IOFA 5AK3A 2WVHA 1NX9A 3FNRA 4I1YA 3PL5A 3CW9A 4FOTA 2P2SA 4RZXA 5EP1A 3IUMA 1ADFA 4JFAA 4V3CA 3X1XA 1UODA 1SCAA 3OZRA 4MWCA 5M29A 1RZRD 1OTXA 1CS0B 1YQQA 2V4UA 2BRUA 3RC1A 3KZXA 3C16C 4ACBA 4HEJA 4ZVSA 3ZW9A 4ISCA 4OJQA 3ER9A 2JLCA 1PFUA 3R3UA 1PQYA 2WJ4A 4JDPA 2C96A 3PKZA 4QPCA 4W1QA 2WJ3A 4GZMA 1IXYA 2QRVB 4EPYA 5HS6A 2B8NA 4MS4B 4UMVA 3O95A 3KJQA 4XX0A 5CVTA 3G5AA 5C7IO 5JBNA 1ZQ9A 2GSDA 3MUFA 3H2YA 3UOAB 5FOWA 3SF8A 4MH0R 4FFPA 1II8B 4XWWA 5EJEA 2DGDA 1VJ1A 4HDQB 4IS2A 3AZPA 3ZIAA 4F8YA 3DC2A 1ZJ6A 2Q2NA 3CX3A 3TI9A 5HOQA 2DPHA 4TMYA 1TVKA 3TIGA 4ZT2A 1R4MB 4LSMA 5JYBA 2EFGA 3IAXA 3UJ7A 4JI7B 4UEKA 2IXAA 1B3BA 4WKPA 3DEHA 1AKQA 3BKXA 4BMYA 1K5PA 4EB8A 1N1GA 2INGX 3IUJA 1CTQA 5AVOA 2WU3A 4IXDA 4PN7A 3SQMA 3P9XA 1HSZA 3NKFA 3FOAA 2Z1NA 3BH7A 3DULA 1OY1A 2BBOA 4J1QA 4CMHA 3EAGA 1JR3E 1OV4A 1GPUA 1LDMA 1TF2A 1TXGA 3KEQA 1Q84A 3MLBA 1SUCA 4OSPA 1D9ZA 2DBRA 2EKDA 3CLTD 1MJGA 4HRXA 2REOA 1IN6A 2JFYA 2VZ8A 4IG9A 3SHVA 1P1IA 1I51A 1EX9A 4BBZA 4RIEA 4HLUA 3G0CA 4I55F 4B9EA 3U44B 5JS7A 2WSSA 1I5OA 3WDKA 1XPJA 3GQVA 3QENA 4Q7MB 1L5GB 2B35A 1K92A 1SBCA 2I76A 3OEHD 3Q5GA 5DO9A 5DW0A 1U0TA 2H5EA 3TO5A 3TJZA 3A1DA 2B4KA 1JIJA 4OM8A 3KKMA 3L7JA 5L7WA 4DQXA 5JAUA 4JHXA 5EJ8A 1ZEJA 3ZNNA 2CJYA 1PJRA 3IP6A 4G5GA 1PYGA 4LK2A 4PEVA 5HIAA 5KYYB 1D4ZA 1DBPA 4I50B 4QUHA 3FHTA 1DC3A 2YHSA 2VRCA 3MTDA 3Q7TA 4P8RA 2DETA 2X86A 4L5AA 4D3SA 1XCOA 4D5EA 1KU0A 1QR2A 1RKVA 2PYZA 3HG7A 2IU4A 5C7OO 1BA2A 4G5QA 5F4ZA 2ATEA 3D3NA 3NHZA 3O38A 1PKEA 2CLEB 2Q0HA 3U3XA 3ABRB 1EXMA 2XCTB 3JASB 1H6CA 4PLCA 5EMJA 1H4VB 1PT6A 2HA2A 2X40A 2YICA 3CW2A 1JT2A 4TTIA 2BEWB 3LHDA 1FPMA 2I80A 3EDQA 3CPSA 3HU5A 3BZBA 3L6RA 4UBOA 4ZOLB 1Z6GA 2OYCA 1A5TA 1Z3IX 2YHBA 5AOVA 4FB5A 1A4XA 5DTRA 2CL6X 3RCBA 3ZD7A 5A2QA 1W9HA 4H6PA 4FSDA 2A9RA 4C4PA 2G0AA 1WV1A 1B4DA 3ZV6A 3ZH2A 1WB4A 4TTVA 1MO6A 3CTMA 1TM1E 4EITA 1MENA 4GI2A 4NKRA 4PQYA 1ZY2A 3S2FA 4DIMA 2XMBA 3KTFA 2CNKA 4HXFB 5KUTA 5LQRA 3K1AB 1MO2A 1SEVA 2OMEA 4PSVA 1QQ6A 4UCWA 2BRUC 3GP3A 1KJZA 2PH5A 1ZA1A 1I1OA 5EJ9A 2YRXA 2ZWAA 4UEJA 2EJBA 2MT9A 4C7OB 4LVNA 1RPAA 2XKAA 1GZVA 1CUWA 2FWNA 4UATA 4QTZA 2ZWIA 3UCEA 4PN3A 5BMVB 3MTIA 3WLKX 1GNQA 5HRCA 5EY5B 3WV5A 4EFDA 3BWCA 4PAWA 4K0RA 2G71A 2XB2A 4RV0A 3V4RA 2OQVA 4AICA 1KIMA 2R6CA 3P9CA 1JFFB 4BE7B 5ALVA 5EEGA 1JWBB 3O2NA 1D04A 1UBFA 3ROEA 3FYCA 1P1JA 4GOKA 1QS0A 4B34A 1E7RA 2NSLA 3ASZA 1E3TA 2JA1A 4IIHA 3OEED 3ZEIA 4AO7A 4O4LF 5DHRA 1T3LA 4KDEA 1ZRMA 2VS1A 2ZRIA 1JMVA 1JYFA 2AXNA 5J5AA 3OE1A 4HBGA 1NWHA 4GVPA 4WERA 2O7RA 4HUQB 3SG0A 4FHEA 1J6UA 1OJ7A 4D25A 6Q21A 1JKFA 4EH1A 1FOEB 2XOKD 5E7JA 4Q4CA 4U9HS 1VGRA 3K0SA 1BHQ1 1JFFA 5EP3A 1TIBA 1QG6A 1E1QD 2AA3A 2OV2A 4IVQA 1YVRA 3HR8A 3IDZA 3LCMA 4PPQA 5LQAA 2QN6A 4INZA 5E1BA 7MHTA 2LRHA 1T0IA 3ES9A 3OQIA 5BR8B 4KR7A 2RHTA 4QFBA 2GJ4A 3KZVA 1K5GA 1Z5ZA 3NLLA 2CLOB 2NO4A 2WHQA 3T1OA 3U4MA 1AKWA 1ZK1A 3ORRA 4NYJQ 4RF4A 4YB8A 4QG3A 3G85A 3CVJA 3VRHA 3KQWA 5CU7A 3JQFC 2XB9A 4QOGA 4GSKA 4ZOAA 5EXSA 1P6UA 1LVHA 1IY8A 1Z4KA 1TU0A 2QX4A 2VAXA 2Y1WA 1U1EA 1N0VC 2ZU0C 5EIHA 1BS1A 1GSIA 1OBCA 4C3OB 1H2RS 4AMZA 1TRKA 1IB6A 4RHUA 3GLIB 3E61A 4KK4A 3TVTA 4K6HA 4DLXA 3V8MA 4ZCIA 1CDDA 2VQ3A 1JEAA 2Q3JA 3U48A 2QE7D 2V6GA 3JYLA 4I81A 2XT9A 1TGYA 2YXLA 5K3FB 3IVRA 2LV8A 4JVLA 3BVPA 3CLTC 1C7ZA 1DCFA 2YVUA 1VE3A 3TSYA 4Z3OA 4DWOA 1BE6A 3T3IA 1MOPA 4QATA 3KSMA 4WKGA 1DDOA 4JU9A 2NPOA 2F48A 3Q3IA 3KWFA 4K9MA 4YRMA 3OJEA 4AKIA 1XTJA 1A04A 1CVRA 4IGAA 2SBTA 1L4MA 2JEOA 1RVDA 1WCIB 3CWZA 4J07A 5EQTA 5FBHA 3FPSA 5BWBA 4BMVA 2V6IA 3F5FA 4AJ1A 1C3LA 4QL3A 2VP0A 1P0QA 5KEIA 3QLTA 3P0IA 4Y1EA 5CFQA 4ARBA 1LC0A 1E4OA 3BX1A 1RJDA 2QRLA 3R5TA 1H2AS 4NY1A 5KQPA 2JLQA 1H6BA 3C8ZA 2RIRA 3EZGA 3R0XA 3VPFA 3AEQB 3KLMX 3PS9A 2R5FA 2AOVA 3UJ8A 2Q2VA 3E1KA 2QPOA 1WLSA 3GVPA 3LHSA 2HJ9A 4IDQA 2H52A 4OF4A 3SJAA 4ITUA 4P3NA 2WNSA 1RLOA 4YJ3B 5G3ZA 1X9IA 1WB5A 3T3OA 5HNKA 1XFAA 3VU0A 3PQ3A 4XFKA 2MINA 4ZMBA 8ADHA 2BZGA 2PXHA 2BKVA 4ZALA 4CIXA 1LTHR 2DYKA 2QN8A 4NS4A 1RJFA 1E0AA 3L6CA 1M2OB 5FUQA 2ABWA 3P2KA 2WK1A 3JRXA 1C9MA 4O4LA 1M2KA 4GRAA 4B31A 3AVYA 4DR7B 1F4LA 3F8WA 3OX2A 3WGIA 3LI2A 5H81A 1DDIA 2A2ZA 4ZRDA 4G0ZA 2HPAA 5E4FA 4J0CA 2VJMA 3V8BA 3DL2A 2AR7A 2GPWA 2DAPA 3GH1A 3J7TA 5U1PA 3EGWA 1UM9A 2AFHB 1YJQA 4EYOA 3E0XA 1HX7A 4H6VA 4J90A 3L43A 3GDOA 2PT6A 1VG0B 1C7EA 1H1DA 1EK6A 2FW8A 2QTNA 3LV8A 3REQA 3UK1A 4DSZA 1HDXA 4YP7A 3HU3A 2PJRA 4AROA 1U2TA 2ZJ3A 3R0VA 1VHJA 1YZTA 1YZUA 2DUJA 4W6QA 4MARA 3T9EA 3WJ2A 4E5NA 1A2BA 3PE3A 5C3UA 2I03A 2YC4C 3SJ7A 1JJAA 3UOWA 2YWGA 5IASA 4JMLA 4Q6BA 4JI2B 1QBGA 2C2MA 3I52A 3DP9A 4FX2A 4R7TA 2Q9AA 3DDWA 2AK2A 3URKA 2H4XA 4NENA 2B4RO 5E9AA 1QNLA 3HKEB 3IXMA 4K28A 4Q03A 4GC9A 2WJPA 4U2CA 1DBQA 1U5AA 2FSHA 2R48A 4EPWA 4D5GA 5DM1A 4UHKA 3UWOA 2O1XA 2YWXA 4JODA 2HMYB 4F7WA 4KN9S 4OUDB 3DB1A 3CCBA 2ETVA 3AOEA 5AM5A 3UB4A 1NQAO 4YMGA 2G6TA 2DERA 1X7WB 2HBQA 4NFLA 2RBEA 4C14A 3N7UA 2YBDA 5A5VA 2VDKB 3BZWA 1QP7A 3C87A 1EXDA 2HXGA 1OIXA 4MKGA 1XKTA 2DBYA 1WY5A 1CUFA 2LVBA 2G40A 3L6EA 1NG1A 1R0BA 3DL7A 5K3SA 1OLSA 1RAIA 2CUTA 1ITZA 4L3VA 1QVRA 5JAHA 2B83A 3QWHA 1M2VA 4OXYA 4I1SA 1NUHA 4EGCB 2MSKA 3FYDA 1XK7A 3EARA 3JW8A 4WTOA 3RUFA 2EFHB 1IG0A 2WAXA 2A1UB 2GKOA 2ZW9A 1I4EB 4JR1A 4AKSA 4HNGA 3QA3E 1ODKA 4ER3A 4JNCA 4GP9A 2QLNA 4RLHA 5F2EA 4A0FA 4EDFA 4KGXA 4U2FA 5KNCA 2WA1A 3BSYA 3EGEA 1N5DA 1L1RA 4FFOA 4WA8A 5CNJA 4LV8B 1CQJB 3T1QA 4CR6A 821PA 2P6RA 1GZ4A 4JJGA 3HUUA 2LBPA 4P53A 1USUA 3ZWVA 4JCCA 2RHRA 3ILHA 3JTMA 4IJVA 3KJHA 5DTQA 5DNVA 1GPJA 5HTOA 2EKQA 3QOFA 5I4BA 4EG3A 1ZWLA 1DAEA 2Y93A 2V3VA 5FXMA 5JZ9A 2PJHB 1WSAA 2F9MA 2X9VA 3R3SA 1HETA 1E5QA 3A37A 1XN4A 1WXFA 5SZKB 3KAQA 1Y7IA 4WFIA 2Z04A 1T0PA 4W8GA 1KYTA 1J00A 4MW2A 4N9QA 5P21A 1PW7A 1HC7A 3PJEA 3TL6A 3N3AC 2QAIA 3O4JA 4AUKA 4Y2UA 2HCTA 4IXNA 4PC3A 3MWDB 3IMKA 3O4RA 1VKZA 3B6JA 2BR3A 3ITKA 4WJLA 3ND8A 5C80A 4F21A 1U7WA 3X1JA 3I6ZA 4FUQA 4IJKA 4RV5A 1WQ3A 3NBXX 4N48A 4ENTA 4NIMA 2AN3A 1X8JA 2LPMA 4WOCA 3UMYA 1JT9A 1U9CA 1ZMRA 2BEVB 4H4DA 5AMXA 4LYDA 5EUMA 4DLSA 2C99A 2GAIA 1E7YA 3L7MA 3ZZUA 1E79D 3BDAA 3MJCA 3NUQA 3S2SA 2J9FB 3IUNA 1VSQA 4B5KA 3MD0A 4BUCA 4KO1S 2F1KA 4EHDA 2VIIA 4RZQA 2PBLA 1Z06A 4CF4A 1TEHA 2YBEA 4YR7A 1XDGA 3JU3A 2IUYA 2PXXA 1SN7A 4H0CA 1O94A 3I1JA 1ULZA 1XAGA 2P3LA 3QXSA 2HSGA 2JGEA 2VYCA 3SX0A 3UENA 3R8FA 3T15A 4LC9A 1BWSA 4O25A 4J4BA 2Z5GA 5A4KA 2ODPA 1ENOA 4FMCB 4XYEA 1NJ2A 3H7IA 3IX7A 4Q16A 3VXKA 2V8OA 4QUJA 3CU5A 4UHJA 5JAQA 3BIWA 4UNPA 3IOMA 5BQXA 1CUBA 1V3TA 1BMDA 3VM6A 5AW0A 2DZDA 2PR7A 3OC0A 1B8UA 4EF6A 1XZDA 2Z43A 2PLFA 3ZNQA 3VBEA 2IYLD 3U7QA 1H85A 3SQNA 3QJ5A 2QGFA 3PDIB 1DHRA 1U7XA 1CLUA 2BR4A 3OZDA 4EUEA 5IXJA 4MUGA 1JDBC 4V2UA 1Y4AE 5DT9A 4CMEA 2Y4NA 3LFHA 4HI0E 1JAYA 1LU9A 2RMKA 2P4SA 2XYHA 4XXHA 1KZHA 1JR4A 3S1SA 4CEJA 1I4WA 3RREA 3A9SA 1CHNA 2VPPA 1XZIA 3H75A 5KREA 4RQAA 3KS9A 5K8LA 3IUYA 1BJTA 1SRQA 1E1KA 4Y0VA 4YEDA 3ZBQA 4Q4LA 4EZEA 3OY2A 4KWEA 4FGUA 4Z8XA 4I9HA 3SSOA 3UMJA 5JNTA 1KAEA 1RMQA 2WWFA 3RS8A 2WU8A 4YAJA 5DPMA 4JXKA 3A31A 4IWNA 2IZZA 3D81A 2A94A 2FRVA 3AILA 3OCXA 1XCJA 2REQB 1DEKA 4P7GA 5FWXA 5T4EA 2FPUA 4OKSA 4CQLA 4HUTA 2BR5A 1B73A 2YZ7A 4FDVA 5C18A 1H2XA 2Q5FA 2XBLA 1IHUA 3BHJA 3L01A 1M5UA 3N7TA 4I8XA 4LV5B 5JSYA 2AQHA 4CMEC 10MHA 4JMPA 5BT8A 2RAFA 5DX0A 2P27A 4INAA 4LDPA 2I2BA 4BWYA 2VPWA 4PLVA 4BFCA 1KC1A 2DQSA 2O1SA 3D3JA 2G9VA 1GDDA 2CJFA 3RARA 5CLFA 1FDWA 1LRLA 3HB5X 4MRPA 4QSHA 5JG7A 1THMA 2J0QA 1GGFA 4S24A 2EWVA 1U8UA 5KI6A 3MB8A 3WLMA 2J4FA 4GOMD 3V1YA 2C2HA 1N5LA 3QEMB 4GO1A 1NVWQ 1NBEA 2ZULA 2X0DA 1ZCJA 4JDUA 4C4XA 4UCFA 3NC1C 3RRFA 2O3UA 3FBTA 1ZJZA 4X1IA 4JD5A 4L3WA 4X65B 1LW7A 3TW8A 1L1FA 2ONCA 4KOAA 4A6XA 1RQPA 2J9FA 2WMDA 3WKEA 2HA6A 2JL1A 2XYPA 3VSAA 5BW6B 3UHAA 4BB5A 5C4MA 1G6KA 5JISA 2VJKA 1F8XA 3THWB 1ZH2A 3HJGA 5CAEB 5KWEA 4C76A 2WHRA 1KDYA 1H0SA 2VA9A 2WV7A 2FOLA 2QAJA 3D8BA 3DLCA 4IRMA 4OI2A 4QIHA 4Z4QA 1OB5A 2GSWA 3WTBA 1U0NA 3L5KA 1RZ3A 3G2OA 1Z0JA 1FX1A 3P0EA 3LS2A 3C4JA 1PR5A 5ALRA 3WMXA 5AW7A 2BGMA 1IOZA 2NSJA 1P4RA 2ROQA 2SKDA 1WEKA 3Q3JB 1BEZA 3DVRX 3WP1B 3WQHA 4HB2A 1X92A 1U63A 3H11A 2IZOA 4NDAA 5I5GA 4N76A 1VHDA 3ML1A 1Q50A 4MIOA 1EDZA 1JAZA 2JVKA 4QPJC 5TF4A 3IR5A 1IUNA 1OPXA 3I39X 2HBRA 4QQNA 1WXDA 3CB2A 1EJ0A 4MV5A 3VYRB 2QNRA 3LO5A 3VOAA 3FKJA 2CV1A 2FJ0A 3CNEA 1PKXA 4PHHA 1KJJA 2OT3B 5AKZA 1SKMA 2GETA 5L7YA 4BTVA 4PC7A 4EKYA 1KEVA 2XV1A 4NBLA 4JYZA 5DZSA 3HCAA 1GAQA 1IH8A 2GZ2A 1LV7A 3UMCA 3FHCB 1FFSA 1XTQA 3BE4A 2XEXA 4I7EA 3GLFA 1WOYA 3MXOA 4RPIA 3WIEA 4BXOA 2YMPA 2VPZA 1Z2EA 3DWIA 3PSHA 3C3WA 2W4MA 2Q4DA 4AZ0A 3RAGA 4J7UA 2EEPA 2XUJA 3WFIA 2ZTUA 1TAGA 2X42A 4MROA 4OGLA 3N8KA 3OJLA 1MOZA 3ZNOA 1P1FA 3M4XA 3CO5A 2XXBA 3OOYA 3HM2A 1QAMA 3PC8C 4GZ3A 1BQEA 1RHJA 1D2MA 2ZSJA 4QDKA 1PWXA 4WN3A 4XJVA 5GP1A 4FYKA 4KFRA 3A4VA 2W83A 3ZCPA 2VF2A 3C0KA 4XM2A 3CW8X 4IDAA 4H3KB 4NV3A 3U1BA 5IDWA 1L7DA 2BMDA 1PK7A 1Y1LA 2J5KA 3P9PA 4AJ9A 4FKBA 3DZBA 3N2GA 4M37A 5GVSA 4IO0A 3QVTA 1H23A 1O95D 3H8SA 4UD2A 3KQUA 4N6NA 4LGMA 4ZICA 5JAPA 2Q5LA 2BFEA 2DX7A 2J0EA 2O4CA 4LOAA 1P1RA 3P7MA 1VKHA 1B15A 2HMAA 4IIGA 4IPTA 4QDOA 5LSAA 4P3YA 4G5XA 1ISIA 3WBBA 1AN9A 4GUDA 3RKSA 5GZ1A 3QH4A 3KZNA 2F3QA 4KYVA 3WYGA 4HNAA 3ZHSA 4BJ5A 2BEJA 2W71A 4M1EA 2VHQA 5AVYA 1DLJA 2HI0A 2YOGA 5BUZA 3JWHA 4OXXA 1NI4A 3VR4A 4F6RA 4KIUA 3WNZA 3RVSA 1P9LA 4C0HA 2YYZA 3MWLA 2VWQA 4N0QA 1JG3A 3FCYA 4H7EA 1ACMA 2R6FA 1LSUA 1HEYA 4JBNA 5HJ7A 3HJFA 1M2JA 3FYUB 1BMQA 3L4SO 3PC2A 3PICA 4AJJA 5K3EA 2VLBA 3P71T 1KAOA 2V96A 4JLWA 1SHJA 3QLVC 3UOGA 4EI9A 3IH5A 2Q5CA 3GEEA 4PLTA 4DWWA 1AHNA 3FKSD 1I3CA 1YS9A 4X6LA 1KJWA 2C92A 2CDRA 1E1YA 2RGCA 4HFRA 1UBEA 3JAKB 2ZIFA 1TVKB 3CWCA 5AKEA 1SXHA 4GQAA 3RVQA 1L5YA 4L5IA 3AZOA 4PAGA 1QRUA 4XASA 1I2ZA 1QS0B 2DU8A 1MV5A 5IT9A 1EUQA 1IC6A 1JP7A 1O94C 3MYRA 1RKBA 4RNCA 2QMYA 1E1NA 4RDXA 1P9OA 4ID9A 4IFEA 5IKMA 2XUAA 3E4CA 4AQ7A 1GZ6A 2CMKA 2O3QA 3H16A 4QNRA 3GQBA 4KK3A 4PYLA 1YUBA 3P4UA 4HS4A 5ELXA 3KZOA 2AFRA 3AHEA 4GR5A 3HYCA 4MI9A 4K0KB 1CUDA 3OTQA 1YRWA 4J94A 2XDYA 2WVAA 2WAYA 3HDHA 2QD2A 4A03A 3MGBA 3OT1A 1BCRA 4C4YA 4CM8A 4DV0B 2VSOA 1OTYA 3OO1A 2RK6A 2OL4A 2ONKA 1YK0A 3NUGA 2CXHA 2FMHA 3TS1A 3KEGA 4ZZ0A 2QX7A 1KJ9A 3ERCA 3K9GA 5FUVA 1EJ6A 3A8TA 4OI4A 3A58B 2A58A 3C5CA 3UJ3X 1KJYA 2VUSA 2QI9C 3AP2A 3BFPA 3HC7A 1AU9A 2GAAA 4WXYB 1DL5A 4QYIA 4K9KA 1G4UR 3KQKA 1A96A 3LJKA 1QVVA 1E4VA 3DW1X 3NS7A 4MP3A 5F7OA 2J31A 3NXKA 4R1OA 1SAYA 3O90A 4YPFA 3NM5A 4F56A 1CFZA 1DUSA 1FVOA 3R4CA 3PV0A 5FNVB 5SV2A 3OWXA 3KOXA 4AUMA 3TRIA 3DLPX 1VFNA 3TIWA 4OHPA 4C88A 1XF9A 5GOTA 3CRMA 1L5RA 1ZVQA 1XRNA 2ZBDA 3GOHA 2AYXA 2JBHA 3OE7D 2I2DA 3QRWA 4BZQA 5K6AA 5JLAA 5EJ5A 4CGZA 5CA0A 4OG2A 5H59A 1Z5WA 4BATA 5ALMA 5JSZA 2AL7A 1VG9B 2PD4A 3HVKA 4V1CI 5C0OE 1QE5A 4E5MA 3QKRB 3DNFA 1CDEA 3TRDA 5HKBA 1E2BA 3RT9A 1EEHA 4FYMA 2PX5A 3UHFA 2VQEB 2VT6A 1KKMA 1CPYA 2OCYC 2HDHA 1M2NA 4B82A 1RHQA 2VBGA 4TS3A 1R64A 1JKXA 1FU8A 4DCMA 4UTNA 1XPOA 1ZGAA 4DL9A 2CEAA 1DMRA 4MUKA 4ARUA 4G5YA 3LL7A 3ZWWA 5AVXA 3RTDA 3D0QA 2Q50A 4CIVA 4O0LA 4G26A 3UKJA 4EHNA 1OAKA 4J76A 1WUJS 2YFYA 1FFGA 4JKOA 4OXQA 4UAGA 5EFZA 3DKRA 3LF1A 1F38A 3CR7A 1PV2A 2EYQA 4B43A 2H51A 2OFFA 1XCGB 3W5HA 4YUXA 3QKUA 1UH5A 3RRZA 5IYZA 2OKCA 3VO9A 2DB3A 5JRJA 4GL2A 1OZHA 2DTDA 3IJRA 5EN4A 2HJHA 2FSVA 4DLYA 3EFEA 4GLFA 1YZFA 1H8ED 4NFSA 1GYRA 1TOAA 2FEXA 1C4WA 1UBHS 4MUFA 4E31A 1K7XB 1P73A 1KRXA 1H8EA 3J7AC 2BDEA 4CLOA 4FEEA 5T6BA 1MRZA 2PKXA 2UXBB 1K3TA 3ZHTA 3S7ZA 3EFHA 2Z8YA 1R5BA 3DLTA 1G60A 3R76A 4DB2A 3W7BA 2Q1AX 1G5RA 1W47A 2WI8A 3ELUA 4KX3A 1J1ZA 5DNDA 4ZRMA 4FCVA 4XB2A 2ZCJA 1T5LA 1GXSA 1FUIA 2RBKA 3OQOA 3KG2A 4Y7CA 1I7PA 5JSQA 3WGVA 5GJWC 3SM3A 5CFRA 1EB8A 2ACEA 1JIUA 3O0TA 4IHKA 3IDAA 3VH2A 1YK1A 1U7PA 1KQNA 2X3YA 4ROSA 4TQUS 3OD1A 1L6RA 5BWOA 1G20A 2V0CA 1G42A 4EY7A 2OBMA 1XEXA 2GVDC 2XAUA 1LI5A 2GD2A 4AS3A 2CF6A 3WTCA 1NW6A 3O9VA 4YI3A 2FJUA 3FSEA 4NU8X 3NNNA 3R4VA 2ZVJA 3PQ6A 3KT8A 2YUJA 1URPA 5TS2A 1YB6A 4W9MC 1D1PA 5F1YA 2R85A 1O94D 2FA9A 2GFQA 1WTAA 2PFSA 4OJKA 5CVDA 1UMDB 4EHJA 4BWGA 1K6JA 2CL0X 2YR0A 3GGJA 1C3JA 2UV8A 4RMIA 1VLJA 2QU7A 3H0KA 2C4TA 3FF1A 4YRIA 3RYCA 1M34E 3MLEA 4DLKA 1U2RA 3DBLA 3LTEA 3JWJA 2X7XA 3R9IA 4E12A 3DA8A 4GDFA 1EM6A 1C14A 1QWOA 4UCQA 3JALB 1TJ4A 2R5WA 3GT0A 2EHDA 3THYA 1K9SA 1NVVR 4AY4A 2J85A 1K06A 3MUOA 1WVIA 3WHIA 3K20A 2B2CA 4UU1A 3T3EA 4CMAA 4CV2A 4D3XA 2Z58A 5D5PA 2JGFA 1Q0UA 4P35A 4P7BA 1KBZA 2PYIA 1M8KA 2AFVA 1WXXA 3EIQA 2P78A 2XHEA 4PTZA 3BGVA 3F1KA 3F3KA 3ZXYA 1LDEA 2BMWA 3LXUX 4KE9A 4CE6A 3G2MA 4KRGA 4Q4HA 5TMDA 2JHPA 2POCA 4O2BF 2GM5A 2DKNA 1T8YA 3GPCA 5JZVA 2XB4A 5LN1A 1R6VA 4KFTA 4LWPA 1NJSA 2YXBA 3H9UA 1M3SA 2TMYA 2XNJA 2R7NA 1GQ2A 4FONA 1L5HB 3FWKA 4H3SA 3WLTA 4WI1A 4DCNA 3K30A 4G85A 4AN1A 5JI3E 4NZOA 5CDFE 1J8YF 5DTMA 4Q21A 2FQWA 1SKQA 1X7YA 2BGRA 1DELA 1T1GA 2UUPA 1TK2A 1NE7A 4IF4A 2CWDA 3UO8B 5DSTA 1BC5A 3B82A 3KAPA 1GL7A 4EI2A 1E2HA 4CI9A 3CNNA 1LLUA 3ZY6A 1QYVA 2CLSA 5KB3A 1P19A 1RYFA 1W2GA 4LCEA 1O1YA 2ZTHA 2R1UA 3DKKA 3O75A 1P2GA 2H4YA 1F5SA 3GU3A 2VHXA 4J1NA 1Q20A 3CXUA 4RKEA 4I1RA 4DS3A 3GGPA 4X20B 2DWUA 3N2IA 1Z2DA 1SVWA 3ASYA 2R79A 1T2CA 1U4SA 1USIA 2QK4A 3I61A 3A1CA 2G7ZA 4U7WA 1P2DA 2JFFA 3GY0A 1ABEA 3L8FA 3DAYA 4JZKA 1AKYA 5JAOA 3QX3A 4RVDA 2ZTLA 4AVYA 5L4NA 2CK3A 1G64A 2GBGA 2P7IA 3M3HA 4BN5A 5E9WA 4I0WB 3UIEA 4YO7A 3F4KA 3RSQA 2I4NA 1X7DA 2X22A 3SQOA 1RYZA 4Z9AA 3G8BA 1JEEA 2C5AA 2AEJA 1IZZA 4X20A 4DREA 2R6R1 3PNVA 4V39A 2SECE 4PG7A 4EO7A 2R6ZA 4GYJA 4HZGA 4KLRA 5E95A 2ZWMA 1LX6A 4IOKA 2BFAA 4DWVA 2YS6A 2EERA 3AC0A 1AA6A 1ZR2A 3WLFA 1BMFA 3QUTA 3PD7A 1B8NA 2XLBA 4RTQA 5JWOA 1FU4A 1NF3A 3MWGA 2FF5A 4KAFA 5F3DA 5HCIA 4B3DA 3UHPA 2FLVA 1X1EA 2DH5A 4EYGA 3HBAA 4OA8A 4R2WA 4QPZA 4WW0A 2VEOA 2A3RA 1ZM2A 2XBUA 4CBVA 3LPDA 5HKAA 4DG9A 4PFSA 1YI0A 3BMCB 1E3LA 5D84A 1FS6A 2YXNA 1U99A 2E18A 4RCYA 5LB2A 3MPOA 2JNWA 4FT2A 4AN0A 1R15A 2VPIA 3VOBA 5F5NA 4XGRA 5IBCA 3ND6A 2YV2A 2AG0A 4I5EA 1IZ9A 4ZGWA 2Z2ZA 1D6NA 2IEBA 4XGIA 2K7ZA 1UZLA 4K5QA 1TJ5A 2O2DA 4BNWA 1UZMA 5J4KA 5JZBA 2IS4A 2QNIA 4YT8A 1Q15A 3AI7A 4KBYA 5KDLA 1DARA 1Y4ZA 2YDYA 3WLSA 5BWLA 3H3FA 1C8BA 1SXPA 1GWNA 1KJNA 1WZEA 2H9YA 2RAPA 1NVKA 4TYWA 2PMFA 1QK3A 5T8KC 3HLTA 4MK4A 3S28A 4D8XA 2PMEA 1XVLA 3PVCA 1Z37A 2REBA 3GHHA 3INTA 1ZI9A 3CGGA 3LD9A 1NA5A 2XKBA 4K9NA 4KXNA 3QVSA 4KL8S 1OGIA 1M72A 2B34A 4XUCA 4KOEC 4CETA 4HYYA 3LXXA 4JYCA 2N9UA 1QFZA 2O5VA 3PGA1 3W6OA 5B55A 1M1YA 4JSRA 1EFPB 3IB6A 3ND7A 4H3HB 2JEYA 2WU1A 4MULA 2VNKA 3HA5A 4IXTA 1KK0A 4F3CA 2NUTA 4ZDJA 4KO4S 1EBUA 4EG5A 5B4UA 1HNZB 3FYHA 4F85A 5FL7D 2H2DA 1NOIA 2EOAA 3PXUA 2QGZA 1USWA 4RCZA 2R6HA 4JCOA 4N40A 5DU2A 2X0JA 3B7WA 4IIBA 4KRXA 3WGUA 2V8BA 5ES3A 5MFPA 3EDCA 2IX3A 1WZIA 1UM9B 3U1TA 1CHDA 4M8KA 4MPPA 2RHWA 2A1TS 4ZVOA 1I7DA 1AKRA 2AN9A 3U3KA 5I47A 2NO0A 1Q7EA 3DTNA 4FHGA 4MKIA 3VISA 2HX1A 5FUWA 4DCTA 4CMKA 1TF7A 4X60A 1KZ6A 2E3JA 4HVTA 1HL3A 3PHGA 3USES 5C5DA 3RHFA 2D1SA 1CIVA 3MRTA 4J8PA 4J0EA 5EIBC 4BNXA 3CJQA 5DE3A 4I3HA 1JSZA 2OVBA 2IYUA 4KR3A 4L5CA 4S1VA 8MHTA 3HB4X 3D59A 4IJMA 8ATCA 1O4VA 4NARA 1PR9A 2DHCA 3H6HA 2O0LA 3RSGA 1WSWA 3Q0EA 2HPVA 3U56A 1N75A 2WIDA 1O0BA 2IE8A 1QVWA 5JQWA 2HIGA 1FK8A 1Q1ZA 2PL1A 1Q7GA 3CG0A 1YJBA 2ES4A 5JIBA 3B53X 1F2UA 1V1MB 3TIIA 4LWQA 4NCNA 3SHOA 3WJ1A 1Z12A 3MUEA 1XHLA 1W2HA 2ODWA 4EJ2A 3HYTA 1C8VB 5T64A 3N59A 1PS9A 1Q0QA 1LPAB 1V8ZA 1PT8A 3CKYA 3EVAA 3LA8A 3QF4B 4FMDB 3FNHA 4IIDA 4WXEA 3KQLA 1PAUA 4CM9D 4ER5A 3CVXA 2HLDA 4OYYA 4MVJG 4QJ3A 1J33A 4D26A 3ESRA 1YZVA 3BKWA 1T8RA 2I9KA 4L16A 4ZI7F 1VYVA 1I4TD 2PVCA 1N36B 3A05A 1IEWA 3BK7A 3QI2A 4B2LA 2DC1A 1Z6XA 1OCEA 4R9NA 4D0GA 3W2EA 4TZKA 3U81A 3RFCA 3QF4A 2H00A 3Q6IA 4R1MA 4RA6A 4F2DA 4F1WA 2YXPX 2AZMA 3K9WA 3WB0A 4P98A 2QRMA 1FUYB 4B2IA 1QQBA 2A9VA 4UMFA 2QTAA 2GJ8A 2ZIZA 2A35A 5H82A 5EE1A 5L3SA 3T7CA 1R5NA 3A6PC 3EPPA 2HMUA 4LXXA 2PUFA 1T91A 3ST7A 4XIIA 2NTVA 5LD2B 2GTPA 1AHHA 1D7AA 1PS0A 1JVNA 1Z5VA 3M4YA 3RS4A 4EL0A 1EFDN 4CL8A 3O5AA 1NXSA 1Z16A 2WWIA 3EE6A 3LK6A 4MKFA 5AUPB 5CW1A 1KXZA 2V1XA 5FR1A 3I73A 1QDUA 1IM5A 4NHOA 3T94A 4KXVA 4QFDA 3VPAA 1YJAA 2FUCA 5HW0A 3GUZA 3P9KA 2PE5A 1JF8A 2IE0A 2RHGB 4KR0A 4EB0A 3T7JA 1K4MA 1EP2B 1SXQA 3ZHZA 2PUDA 3V8PA 3GIWA 1L7VC 4BLVA 1JJ7A 3EQ6A 3QU2A 4BEWA 3E18A 1OPRA 4B73A 4D3DA 3RF7A 1NMQA 4JVNA 4AJ2A 4LHEA 3GEBA 1JVBA 2QRNA 3H86A 4MOWA 1DU4A 4BQNA 1D3AA 3ZN2A 1ZCBA 3KT0A 5IW8A 4ZVPA 1T13A 1ARZA 1E2QA 2B7CA 2C4MA 3HCPA 5DSZA 5HQJA 4M46A 3LQYA 5EYPA 2I7XA 1T9HA 1IN5A 3IP3A 1BNCA 2QRPA 5DP2A 1LX7A 5AW1A 3CZQA 1NUQA 1IRIA 3WRWA 3WXMA 3K6RA 3QWFA 5DOVA 5K3OA 4ZODA 1CK4A 4CDNA 2CMGA 4HT3B 3I28A 2AD1A 4BO3A 2ZR7A 4QEZA 1YDFA 1T3SA 2HQ1A 3SZOA 1QGYA 5DNEA 2R4TA 2X2OA 3LC0A 4Q4JA 5DMXA 2F2TA 1DG1G 1N2ZA 2AJCA 3BT7A 3IJPA 1WLFA 3CUKA 2VUHB 4TLLB 2ORIA 1C9JA 4C5CA 4URVR 1D1QA 2O2CA 5K3CA 1ZGHA 3E3MA 4WX2B 4R1LA 2PH3A 1FYFA 1YVDA 4I4IA 3TKYA 4EKGA 1KERA 3EGCA 3OOHA 2EYUA 3A2NA 4FWTA 4ZCRA 2EKBA 1QKKA 2Z09A 3HGTA 2PX6A 1MNAA 3DKPA 4G4SP 1QH8B 1YB1A 3IIMA 4ML3A 4R01A 3SBDA 1ICIA 1L5MA 3G2PA 1W52X 3FVQA 3O74A 2ZB2A 1H4TA 1N8NA 1NWCA 1B0AA 2QLLA 2YJ4A 3HFSA 3K0CC 4L57A 4FDAA 4BCBA 2IRWA 1JU9A 2GK4A 2OLEA 2OM2A 4Z2YA 2JJMA 2VZEA 4QOFA 1OLUA 4E03A 1UPAA 3CKMA 3GZJA 2A9FA 2BP7A 2ZFUA 4H15A 4Q9IA 4XE5A 4XUDA 5IWCA 1XMJA 2FU5C 4M2LA 3KE8A 4M1TA 1F8UA 3B5IA 4F4JA 2P4HX 2WYWA 5THQA 2LP4Y 3NVAA 3CX7A 1E77A 1KS2A 1KYQA 1O96A 3DMGA 4FYYA 3Q3CA 4UVIA 5H02A 3T5TA 3U7HB 2AMLA 3GZNB 4QA9A 3P5BA 4E5DA 1XHFA 1EDEA 2YZGA 4WXRA 3GLFB 1YA8A 4KIGA 5K4AA 3U3ZA 3SIWA 4ZOCA 4M1ZA 4A8JC 1EAYA 2ZSAA 1DWUA 3AM4A 4ITVA 3BJEA 1VI2A 4GE0A 3ZBTA 1SMKA 2AZTA 4G9GA 4NYMR 3EVTA 5CB0A 4JLVA 1QGAA 1Z2PX 3OKCA 5AXCA 1O54A 4JQZA 1H8HA 3UMRA 5L7TA 4M0FA 1T0HB 2GXUA 3V3TA 4TTPA 4BU0A 3UAZA 5E6SB 3NBAA 5EZ5A 3WLOA 4D0NA 2FSVC 3H5WA 1WNFA 1TF5A 2XXAB 1E20A 1X8KA 1SC4A 5ERXA 3RC3A 4Q9DA 4UQLA 1FC0A 3D5QA 5CT8A 3ZD8A 3OX3A 1ZUHA 3PWTA 4FQ8A 3ANMA 3VJLA 1CVIA 4CV3A 1V3VA 4Z7JA 3DXFA 3HCOA 4IGFA 5HF8A 1JNYA 2DLCX 4ZTZB 4Z3KA 2V65A 1TC1A 2GVNA 2VHWA 4QYMA 5CEFA 2D1YA 5LMZA 5JO9A 3RHZA 5J58A 1QO9A 3I9OA 3KPUA 3UC9A 1R3DA 3U61B 1ZC3A 4YRGA 2O3SA 3HB9A 4CQNA 1BWRA 1NAIA 1SOMA 2QL5A 1U2QA 3O1HB 5B37A 1T4MA 2VHEA 4N0DA 3RH0A 1E8MA 2VP6A 2CJPA 4CLEA 5CR9A 4E14A 2P41A 3PTAA 5EIXA 2QBYB 4J1TA 1PFWA 1A1SA 1VBFA 2A0YA 1WCYA 2IYXA 1PR6A 2QX9A 2Z9CA 3D1JA 4FDUA 4UFNA 5ER9A 3AVVA 2YJ6A 3FY4A 4M3NA 1M6VA 3R20A 5AKLA 3RFTA 5GWXA 4G8JA 4DSAA 2WDPA 1O03A 3ENQA 3BHIA 2Q29A 2XDAA 1VLZA 2ZIXA 3G6KA 4V38A 3T52A 5TR9A 4HMQA 1N6OA 3HSKA 3PR3A 3FYUA 2QLBA 4HZUB 4RDIA 5EESA 5JDIC 2XR1A 2PUBA 1KRWA 3IAFA 1NM5C 4HBZA 3HEMA 1WL8A 3TPFA 2DP4E 4RVCA 1RQNA 2BFOA 3I37X 4ATNA 4D9CA 3RVOA 1AHIA 3AF5A 3BIJA 4FFSA 2QQ0A 3C8MA 4I50F 4IEIA 5FTJA 3SU8A 1Y81A 2P4UA 4H1WA 5K3BA 1J0EA 3BXOA 4M1SA 3RI3A 5LLDA 4DR1B 3DLHA 4Y3UA 2YVLA 4IIEA 1PVDA 2OG1A 2VZ9A 2G0NA 2IJGX 1MX3A 4N3AA 1XVIA 3PJDA 4DDUA 1Z0AA 2XF2A 1LNZA 2HIAA 1CBUA 4OLHA 1UMKA 4IIYA 4O8CA 4EY8A 4KDLA 4L75A 4OOEA 5DLDA 3AUXA 3PITA 5BYAA 3JQ9C 1J4AA 5LA6A 3ZY2A 1ZX1A 2BMAA 4G97A 5IARA 3TL2A 1FJHA 3AERA 2B7BA 5HZGA 2D6FA 1IEQA 5FJJA 3DDCA 1DKPA 4W7IA 1GP2A 4CQMA 2F8LA 4IDCA 5NULA 2BHLA 2PJZA 5JD3A 2YQ5A 4KIJA 1AE1A 5JFOA 1OLXA 2PN1A 2FMIA 2HQRA 4ZVKA 3WYNA 1VLVA 2HMVA 1XZ8A 2BGKA 4GE3A 2CBZA 2BMVA 3VR3D 3QBVA 4F97A 4Q9HA 2ZM5A 1EWRA 1OBHA 1ZIXA 4U6NA 4ZT5A 2ZGVA 4IMIB 2QWXA 4KQMA 5BMOA 1V7CA 2NOAA 3NW9A 4GXNA 5AWFC 4EGJA 2JD1A 2PL9A 2P3OA 4LOHA 1X8XA 3TKLA 1DINA 3V3KA 4ZZ1A 1ODIA 4FBMA 1D2CA 2Z5VA 2WT8A 3OE7A 4I2VA 2CV2A 4P7JA 5KX5B 4NBTA 2FV8A 3P2MA 4F6LA 2ANBA 1ZOLA 2P68A 1A2QA 2WFAA 3AU9A 3EXHC 1ATIA 4HH3C 2OVFA 1XELA 4WK2B 5EINA 1KDRA 3S1AA 2O5EA 1H1TA 2VCHA 4HDMB 4EJFA 4JZYA 3EXEA 5ALKA 1QH1A 4KR9A 1QP0A 1ZL0A 2ZITA 4TWAA 3ZKAA 1WP4A 1Z8FA 2H1VA 5EJMA 4B3IA 1RKXA 2XE7A 2XUOA 4Q9NA 4MVJH 2I1LA 3OFNA 2CGEA 5IM4A 3KE9A 2HJSA 1ONOA 3UFXB 4BO2A 1KSHA 1KGSA 3OHSX 4HUQA 3UXHA 5J3JA 3LMKA 2ET6A 3NTLA 4G8DA 4KLZA 5D7BA 3U4CA 1DFGA 5H3CA 2ACVA 2JATA 4AB1A 4ITRC 4CCYB 4GECA 1Z0SA 5CCBA 1WKBA 4RKYA 5EFOA 1TUEA 4FCWA 5EPUA 4FGZA 4DMLA 3HN7A 3H4TA 1U2EA 5LKAA 1VHTA 3EBPA 1ZUWA 3CPHA 3OP4A 4TRRA 4XWGA 2CE2X 1CY4A 4Y7DA 5K05A 3D02A 1P29A 4MDHA 4P2GA 4I4TF 5K0EA 3GLIE 3GBSA 2JGKA 1E64A 1WSDA 4IIFA 3E2PA 3NKVA 4IUDS 4MRNA 3WWDA 1E3IA 4YCSA 5HMMA 2J6BA 4NG5A 3WK5A 3MGAA 2JLZA 4HXGA 3TTYA 1C1XB 1FDSA 2A3NA 2H2HA 1RADA 4IIXA 3TNLA 4DWJA 1PG2A 2BFMA 4OOFA 5F21A 2ERXA 4UPEA 3LTNC 2BF7A 2W6ZA 3RRBA 3OJXA 3CZ4A 2YH2A 3FGNA 4MUMA 4Q7JB 3UV7A 5K3FA 4ZYZA 1HORA 1JDZA 4TXNA 1AUOA 2X7HA 2NN3C 3AY0A 4YVFA 3ZGLA 5C1PA 2C83A 1F4PA 3AFHA 4CEHB 2JVJA 5CLQA 5JVDF 4OFBA 1OH6A 3VKFA 5A3JA 1QHYA 5FNVF 1MXHA 1UBCA 3JATA 4MRAA 3AJ9A 3H65A 1WXEA 4CIWA 4I1UA 4ZEXA 1ZITA 4F5YA 5FLEX 1U7TA 5HFNA 4L22A 3UW3A 5IKEA 2OCKA 3TTUA