5CD5C

Crystal structure of an immature vrc01-class antibody drvia7 from a chinese donor bound to clade a/e hiv-1 gp120 core
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
220
structure length
220
Chain Sequence
QVQLVESGTQFRRPGASVRLSCEASGYTFISSFIHWIRQGPGQGLEWMGWMNPRHGAVNYPRRFQGKVTMTRDTSIDTAYMELRDLRSDDTAMYFCVTSRTKDYDWDFVWGQGTLVVVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 93TH057 HIV-1 gp120 core
publication title Key gp120 Glycans Pose Roadblocks to the Rapid Development of VRC01-Class Antibodies in an HIV-1-Infected Chinese Donor.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 36
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2015-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cd5C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cd5C01
5L0QC 1OT1A 4QHMA 5ILTH 5JA9A 3WFBH 3RBSA 1A7PH 5BJTA 4PD4K 2JJVA 1MQKL 3V0AC 1S9KC 3G5VB 4N0RA 5F1OB 4BZ2H 1NGXB 4X98B 1KOAA 4P3DA 3CVIL 5F7NC 4JY4B 5AEAA 4B50A 3ZDYF 3IYLW 3UJTH 5CD5C 4Y16C 2BVQB 3GNML 4HBCH 2YKLH 5BZWA 1RJYB 5C0GA 5MENE 1MHEB 2EDDA 2XKNA 3K2UL 4XNZC 1B9ZA 1MFBH 3L3KB 3LKOB 1LNUA 4L9LB 5GQBA 1A6WH 1Z9OA 5KSAD 2XACC 4LARL 3P9MB 4U49A 7FABH 2A6DB 4ZNCD 3QUXD 1WQVT 4ODXA 1ONQA 4HXBH 4YDKL 4NKQB 4QTIH 5CEXB 3MJ9H 5B39A 3GM8A 4ZYKB 3TT1L 4U1GB 5C2UB 5FO8A 3I75A 1Z6JT 4JM4L 5GRZA 4P2YA 3OKEA 4AQOA 1JGUH 3JV5A 5FUCE 3IS1X 4NNPH 5ACZA 3ARVA 4LAQL 1FCGA 4Z8FH 4PREA 1MCIA 3X14B 4UIKL 3RL2A 2BP3A 1YQVL 4BKLA 5DT1H 1RZFH 2F58H 5DF0A 1FFOB 1QPPA 4LSQL 1DQQB 3P9WB 1QBBA 1RMFL 2CDEB 3B5TA 4S1RL 4YH6A 5CWSB 2ENSA 3O3DA 4F80A 5B38B 2HJFA 2YSSB 2J4WH 1H8NA 3TFKD 3CFIC 3HC0B 2HH0L 3TBTB 4EJ1C 4RISH 1HQ4B 3L9RA 2E9JA 4M6NH 1FH5L 3V7AE 3IDIB 4JFZL 3QNXB 4OQTA 3UDWA 2E7MA 5ACMA 3GHEH 2NR6C 4LCIL 5I1CH 2LFGA 1FGVH 3O6ML 1C7TA 4DEPB 3G5YA 5IVZB 1WBZA 1BFTA 1IAIH 2G2RB 5DJ8B 1EJOH 1R3JA 1MJJB 4OZHB 4C59B 5EA0L 1AC6A 4UQ3B 3ARUA 3NZ8B 1QA9B 5FM4A 3UC0L 1BZ9B 3KPRB 3TT3H 5MEND 3RJDA 3C8HA 4RGMB 4QHLA 2DMCA 2F5BL 2J12B 2OK0H 4K9EL 4MQ7A 3S37X 3CLEL 4HEME 5LBSL 3BZ4A 2DI7A 5ITFB 1FV1B 4OAWA 1U8JA 3CFJA 3SDCC 4HIJA 3MV9B 5DHXB 3S3SA 4D3CL 5HHQB 1HYSD 3DYMA 4FMFA 1DQLH 3RGVD 3O8XA 5BW7A 2COQA 4X80H 3EDKA 3GSWB 4G8EB 2M2DA 4CAGA 1K5NB 4M7LL 4X9FA 2R0WL 3MV7E 4BM7A 2YBRA 2C5DC 4X6FB 5GSVB 2BSSA 4OCNC 4PJCB 3QO0B 4I3SH 4NKDA 3OSKA 1TFHA 3DV4A 3MLXL 1W72H 5DYOA 1M4KA 4ZUUB 4CN6A 5DJDB 5GS0D 4QKXB 3W81A 3KPSE 2P48B 1G7HB 3IU4H 2M26A 3WN5C 4E5XB 5C08B 4LF3B 5C0FB 5F21B 4Z78B 3VI3E 3QIUB 3GGWA 1NANI 3KJ6L 3PE9A 2IPKB 1MWAA 1IGIL 4PJAF 5C0CA 1HILB 5T1MA 2R56H 4F3FA 3TFKC 1HHGA 1I7ZA 1ZHLA 4ISVA 5I1JH 2BNQE 3DSFL 1HINH 3FT3B 3OXRA 3ULUH 3P9LB 5DGRA 3OZ9H 1QO3B 5IJVA 1F8TH 5I75B 1VGKA 4UTAL 3W0WA 3RWJB 4X6CB 4MS8D 4OZFG 1G9EA 4GBXC 5GRVK 4AG4L 4XRCB 3O2WH 4TTDC 2P8MA 3NIDE 5DD1L 3D0VB 1NGQL 3R0NA 4WU7B 1A5FL 2B4CL 4B0MM 1YY8A 5AYUL 3QSKB 4DVBB 1DQTA 2R0KH 4MNGE 4HC1L 3DUSB 3PGDA 2XZQH 1C5DA 1EAJA 1JWSB 3KYNB 1WK0A 5C92A 3BKCL 1NCBL 2JK5A 3LCYA 5HXMA 3MV7D 5E03A 1J1PH 1DLHA 3QDMA 3O9WD 4R3SB 1HDMB 4WFGE 1K6QL 5BJTB 1CLYH 3LMJH 1BAFL 3K8MA 4LQ1A 1SYSA 2XG4A 4MNHA 4P3DB 5CINH 4U0RB 1GGBH 5CS7A 2VLJE 3B2VH 3NPZB 4G7VL 3F7VA 4L29B 5DZLA 4YAQA 3RNQA 3KPSD 4LLUA 5BZWB 5AAMA 5GS0C 2XKNB 4JPWL 4X7FC 1NFDF 3WMSA 2HG5A 5JIIA 1LNUB 4OF3A 4TSCH 3DX8A 5HHXL 4OZGE 3STLB 4CADA 4E41A 4ZDHB 1ORQA 4N0YL 4QF1B 4JRXE 3A6BL 3OX8A 1ONQB 2BNQD 3VW3H 2XICA 3FO0H 3LV3A 4ZTOL 1UZ8A 4EBQH 1I9EA 4U6VL 5B39B 3FKUS 2CRYA 4HGWA 2X4RB 5JW4N 1IAMA 5J1AA 4PLNC 5FO8B 4KJWC 4A2LA 1YC7A 3OKEB 1SM3L 1LD9B 1NCCL 5EUOF 2H2PD 5C2BH 1IQWH 3QXTA 3O45A 3E8UL 2CQVA 3PP4H 1P53A 1WFOA 1F97A 4BKLB 3FO9B 4HFWA 2YC1A 1KB9J 3S4SA 5E56A 5KSBB 1KELL 4QT5A 2HJFB 1U8LB 4FP8L 1OTTD 2IQAA 1MJUH 5HPMA 4XCYA 2GSIA 4LRNH 2V2XA 2PW2A 5CJXC 4ZSOB 3W11D 4WFGD 1WBZB 3RHWF 5KS9B 3IFNH 2OTWA 3BHBA 3S34H 4PGEB 4DUXA 2VLJD 1F3DJ 4NN7C 3SQOL 4YXHH 5EORL 3QA3A 1A7NH 3VFUA 4QHLB 32C2B 3LPWA 1WAAA 1BFVH 4K3JL 4OIBA 2AJUL 1CG9B 2F53E 1EV2E 1MELA 3N0PB 1CZ8H 1CLZH 1FIGH 3BZ4B 1QNZH 4OAWB 1U8JB 2Y6SD 2YD7A 3CFJB 4OCYL 5KSUB 4HIJB 1QSFE 4X5WA 4LVOB 1GGCH 4JRXD 3RGHA 4KGLA 5C0AA 4PJBB 4ZAKD 5F7LB 1FZKB 4CMHC 2FGZA 4HEPG 3WD5H 5E2UH 3ZKND 3QBTB 4HWEH 1NMAL 4MQSB 4PJXF 4EDWL 2YBRB 4HCRA 2R0ZL 5ADOH 2BSSB 4PGBA 1C16B 3VD4A 4LPXA 4S11A 5IB2B 4NKDB 5INCB 2A0LC 3DVGB 2H2PC 2EEDA 3CK0H 1EA9C 2A77H 5JIPA 4MA8H 5DLML 4ZMAT 1T1ZA 5DD0L 3C5SB 5DEZA 4IEFB 5E6ZA 5I15H 1A9EB 3FONB 3QUKA 2R1XA 5I17B 5D9SA 1FPTL 4F3FB 1U92A 1HHGB 4ISVB 5AWNH 3RU8H 3H7LA 1A1OB 4YDLB 1BQLL 1J86A 1DQJA 1G6RB 3ZDXE 3KYMB 1RSFA 4LDEB 3W11C 1VGKB 3W0WB 4WENB 1EFQA 4TSAL 5FYKE 4O2FA 3SE4C 1AP2A 3OAYK 1ZK9A 3LEYL 3BP4B 4F9LC 1YJDC 1ZT7B 5FCSH 2HT3C 4OCMC 3VFNA 2P8MB 2UZXB 5C07E 2VXUH 3WNPA 4G5ZL 5CEYA 2F53D 4IDJH 3F58L 4MJ6A 1L7IL 3CXHJ 2Z31B 5I71B 3MRRA 2IANE 3DURA 1QSFD 4PB9L 4PG2A 3IAPA 1B3JA 2PXYA 4Z0XB 4XNUH 3NZHH 1FLTX 5E1HB 3EDFA 1FNFA 1E4XL 1C5DB 3C6SB 4WW2C 2EYTA 4HMDA 4CW1B 2Y6SC 5JDSA 3S96A 2JCCA 2HRPL 4Y0GA 4QGYA 3KXFE 1TZIA 1UB6A 3V0WL 1IGFH 2J2ZA 4XNMA 5ERWA 2PF6A 4PLJD 2AVGA 3QDMB 3IFLL 3QNZA 5KJRL 5JR1H 2BX5A 2F8OA 2AV1B 2NY2C 3HC3H 4JM2A 2ZG2A 2XWBA 3C6LD 4X6BB 5IEHB 1FNLA 4MNHB 5F7FA 3D2UD 5F1NA 3QQ4A 5FGBA 5F88A 4EDXB 3F7VB 3Q1SL 1OPGH 1MRFL 4YAQB 1HQRB 2D4FA 4LLUB 3ZYOA 3BE1L 1WT5C 4K94L 2IQ9L 2HMID 5HGGS 3WNKA 1MUJB 5I18H 1CFNA 1FO0A 2HG5B 5F96L 1A9BB 4PJDE 3DX8B 1C08B 2Z0BA 5TH2A 1G7PB 5E8OB 1E4WL 4CADB 2OTPA 4E41B 1A4JA 1ORQB 1Y0LA 4F57L 5I8OL 3ESVF 3OHXA 3TA3C 2BMKB 4OSUH 1YYMH 2XQYK 5DHVA 2QADD 1U2CA 1OAKL 3RVWC 2NY5H 4HGWB 4Y1AE 3WKML 5J1AB 3LN4A 1OVZA 3O3EB 2NY3B 1YEIL 5DC0A 2RIKA 4QCIB 5C3LD 3NCBB 5FYKD 2VDRH 3O6LL 4KROC 2VC2H 3CZJA 3VFTA 2BJMH 4QXTA 1EEYB 3PDOA 3X11B 1FVDA 5C07D 1RUQH 3UYRL 4TQEL 1H9VA 3N85H 4O00A 4HFWB 1KJ3H 4KTYA 2VQUA 3BAEL 5GRVL 5C0BA 3REWA 3IJSA 1AQKL 2YRPA 2IAND 2R23A 2LU7A 3RTQD 5BS0A 3BKYH 1U95A 2GTWB 2VL5B 1RULL 3TESA 1J0JA 5HPMB 4XCYB 1YNKH 2PYEE 2H32B 3KXFD 4KXZH 4PJEE 2V2XB 2PW2B 1OGAB 4I2XE 1I9JL 4P59H 4YHLH 3WIHH 3D0LB 2VITA 4NFDA 5CIPB 2KUTA 3HUJA 4K3GA 1JI2A 4P4KA 3IJYB 2OTWB 1VADB 5FKAA 1T5WB 1FORH 4S2SA 2XRAH 2XQBH 1MH5B 5D6DA 1ZTXH 1AE6H 2FATL 4NZTL 2FECI 3K4DA 3GUTA 4JDVA 2AQ1A 3TH2T 5I16B 1MLCB 1GIGH 4R4FH 2ADGB 1ZAGA 5HGDB 5KTEH 4FQIH 4Y19A 1DBAL 1G6RL 4X5WB 2FX7L 1D5XA 2DIJA 2CPCA 3IXAA 2WUBL 3GSRA 4Y1AD 2DM4A 1NUGA 4B7LA 4G8IB 5F9WC 1B2WH 1TQCC 3FHAA 4NYLB 3B5HA 3P30H 2CD0A 1N5YH 4HUXA 1IBGH 4F8TA 2O5XH 3QXDA 3PABA 1CGSH 3GI8H 3TYGL 1WEJH 2VQTA 5JTWA 2ED7A 1P5VA 4PY7A 2ZSVB 3BUTA 4M1DH 3CSYB 5TE6H 3QUKB 3T1WA 3DROA 2R1XB 4KVNH 3K8LA 4BJLA 3I02A 5JW4Q 5D9SB 3QIWD 2PYED 3V79C 1U92B 1NCNA 5IB4B 1HIML 4MAYA 5D1ZC 4DKFH 3O3BB 5DJ6B 4P2OB 2I24N 1E0OB 2VZ3A 3BPOB 3U9PL 4EN3B 2ESVB 3LQZA 4UOW1 2XA3A 3DXAA 1SMAA 4GRLD 1DQJB 1H3GA 2OCFD 4J7RA 1JGDB 5D2LF 4P3CL 3P0VL 4O2FB 2JTDA 4XXDA 1KULA 2EXYD 3PIQA 5E70A 1AP2B 3MACH 4BZ1H 2UUDK 3WUWG 3KPOA 2KBGA 4X4MA 2D7TL 3MZGB 4WO4A 1PFCA 3OKLA 5ADPH 2QSCL 1X7QA 1JMZA 4NP4L 4GRMA 3VE0A 1RY7B 3TJEH 1YNTB 2EH7L 4M6OH 3SKJH 2Y5TA 4H1LA 1VCAA 5GJTL 3S96B 1G1CA 5KVMC 4PV9A 5F9OH 1UB6B 3ZKSD 2Q86B 1N6QH 3QNZB 4DN3H 5DK3A 5B8CA 4JM2B 3UTZB 5IQ7H 3MUGA 4JHZA 2XWBB 1P4LA 5F1NB 1H5BA 3QQ4B 2W9DH 1AD0B 1X4ZA 5DRXB 4FFWC 5DMGD 1JYVA 1A3RH 4ZNEE 3QHFL 2FBJH 4DK6A 1FN4A 4Y4KD 2DD8L 1T04A 4OKDA 3ZE1F 4PJIA 1WITA 3EYSH 4X6DF 1BD2B 1FO0B 5EU7E 5DSCA 3VGFA 2DTML 2JKXA 4U1HA 4ZFFB 4D0DA 5C8JA 1JGVL 3RZWA 1A4JB 4MA7H 4ONFL 3S88H 1Y0LB 3OHXB 4NC2B 1N5AB 1BHGA 2VSCA 4R6UA 4OI8A 3B2UD 3GFUA 3M17A 4MSWA 1MCPL 5DHVB 1S7SB 3QXAB 4ENED 3NGBB 1A1MB 2D9QB 4X99B 5TDOA 2YWYA 4QO1A 1CDUA 1KPUB 1FZOB 1EHAA 1TPXC 1BLNB 4TOYL 3RIFF 4JO1L 4JKWA 4NRXA 1F4YH 2G75A 1ZV5A 3FCTB 3VFTB 3QJFB 3WSQH 1FLRL 3HMXL 3NH7H 1FVDB 3CVHB 3ARWA 3G6JF 1W0VA 4G6JH 5C0BB 3U30C 1MIML 2XOTA 4LSUH 3IJSB 3RWHB 2HKFH 2WP3T 2XFXB 1BOGB 3NPSC 3ARBB 2HTLD 5FHBH 1V8HA 3NIFF 2CK0L 4HS8L 1OQOA 1I3VA 4HCRL 2NXYB 1MRDH 4GXVH 3MLZL 1LDSA 2IBGA 4YZFE 1KB5A 1G84A 2PO6A 3WO4C 4RGOH 2XI9A 3MRDB 4BUGA 3ZTNH 2OJEB 4S2SB 4JQIL 2PCPB 3P2TA 1G9NC 1XF1A 2WV3A 4ODHL 4M3KB 4JG1L 4GW5A 1KJ2A 4KQ4L 3MNVB 4XX1G 1S7UB 2W9LA 3GUTB 4G3YH 3IFOA 3WHE1 4X8XA 2ICEA 4JQVA 3WFHA 2E7CA 5IV2B 3NOIA 3HMWL 4WHDA 1MHCA 1W0YT 1D5XB 1YUHB 4WNQA 3RVVC 1MI5A 1P6FA 5IHLB 3BPLB 4UDTA 5EZOH 4LSSL 4Q2ZB 4FFYH 5C0CE 2W0KA 1K2DB 4G42B 4I48A 4ENEC 3IGAA 3QG7H 4ODWA 1N59A 1OP5H 4HUUA 2LU4A 1FCCA 3QXDB 5AZ2L 3MRNA 2WQ8A 1Q94A 1KYOJ 3SJVA 5GGVH 4KK8C 3V6ZA 1EVUA 4PY7B 3VXNA 5ETUB 2BFVL 4YHML 3WFDL 4KRLB 2P44B 2PKDA 1GVIA 3BZFB 1BF2A 1VB9A 4ZODA 4MAYB 5I8KH 1CE6A 5CBAB 3PHQA 1QFWI 2WMPA 1UH4A 4LPUA 1VENA 1N3NA 4N8PA 4L3CB 1CF8H 4L8BB 3O8XD 5D1QB 4M9PA 5I2IA 1UFUA 3MJ8B 3RWCA 3QULB 5DVOA 2YZ1A 1C5BL 3VI4F 5L6YL 3PIQB 2I60H 3C60C 1FO0L 2BVYA 3T2NH 1N2RB 1YEJH 3QCUH 2PTTA 4UT7H 5HHME 2VDKH 3MGOA 4M61B 1D5BB 3UP1A 1S7WA 3OKLB 1ZXQA 4GRMB 4N9OB 1NMCB 2ORBH 3MRMB 1XGUA 4PJHA 4A2MA 2NY7H 4H1LB 2WBJA 1OWRM 1P7QA 4BSJA 1DL7L 1H3PH 1LP9B 1NGZB 1AD9B 4HFUL 5C0CD 4PJ8A 1CDJA 4XMLL 5EG6C 5D4QA 2APVA 1INQB 3CVHL 3GO1H 2ILLA 4G6KH 1BQHB 2L7UA 1I3RA 1P4LB 1H5BB 1IGJA 5DXWA 1FN4B 3GSUA 2J88H 1S7RA 3OR6A 4EI6B 2NY1D 3KDMA 1H3XA 1AKJA 3GIZH 5DSCB 4YHNA 3LN9A 5C0RH 5CCKL 4D0DB 4N9GA 4U1LA 3DV6B 3CFKA 4AENA 2HVJA 5ESQA 1IAOA 4YQXH 4MSWB 2GYSA 3I9GH 2WUCH 4XVTH 2QLVB 5BV7C 2A1WL 5DUMH 2FGWH 4K8RL 2Y07H 1KCRH 8CGTA 4LU5L 4NRXB 5KVGL 5DA0B 1QFWM 1RZIB 4G80A 4ODVH 2P5WE 1Q9KB 5HHMD 4N0FA 4LEXL 1W0VB 1R0AH 25C8L 5MI0B 5FM5M 1CD0A 1DVFD 3KWWA 3VWKA 1XF2A 2DBLL 1DP0A 3QO1B 3UTTA 1MCNA 4I0KA 4UB0L 5HI5C 4D9RE 4RMSA 3WS3B 4UNVA 3CGTA 4Y2DB 5HI4D 3TN0B 2ZOLA 3VGGA 1QFPA 1KB5B 1WBYB 2ATPA 1FVCA 3P4OB 4XP1L 1U8PA 3AB0C 2EO9A 2OP4L 1T1XA 4XP5H 4ODBD 4I18A 2JB5H 3C5JB 4JJ5A 5C0AE 2R8SL 5GPRA 4RIRA 5ID1B 4PJ7E 1A3LL 4TVPH 3T3ME 4Z9KB 4BSVA 1AO7A 1DEEA 1SJHB 1UACL 1A14L 2NYYD 1M05B 2AJYH 5SX5H 3ZTJH 1DZBA 1T2QH 3QI9B 1JHTA 1HXMA 4N8CH 4KUZH 3EDJA 4PRPA 5EU4A 3WFHB 2GAZA 1MHCB 2R2CA 4WNQB 1QTYT 3MLRL 5HHNA 5B3NA 4UDTB 3FRUA 2J3SA 4DVRH 4A6YA 4ZTPL 3GMNA 4HK0A 5CILH 4NSKB 4D94A 3ZHLA 4ODWB 4FQXB 4WW1A 4HUMB 1OP3K 4HIIA 2P5WD 1XR8A 2QV2A 5D7LA 3VXUA 4F7PB 1RHFA 3FB5A 3LDBB 4F37K 3V6ZB 1MREL 3DNKA 3QFJA 4JE4B 1MCKA 1GAFH 1DVFC 5IEKA 4D9RD 2P8PA 3ARDD 1JNJA 1EO8H 4P23A 3IKCA 4XMKL 5JLZA 2UY6A 3BP7A 3RQ3A 4YIQA 1FFPB 2AABL 1KN2H 1AR2A 5INDB 1QYGL 4U3CA 3PHQB 4LHUA 4KZDH 3F7QA 4MJIA 4QHNB 1KENH 4YUEL 4W68A 4XPBH 1EEZB 3E6FA 5C0AD 4OT1L 4X83A 5IW1A 1BZ7A 5JOFA 2JCCE 3BKJH 3V5KA 2JB6A 1FSKC 5E4EB 3X3GL 3X12A 1QSVA 3CMOL 5DUBB 2R4SL 2BHYA 2PTTB 1T7YA 4HPYH 1RJLA 4JO2H 2J6EL 1BVKA 5D5MA 3WFEH 2NYYC 4ODSL 1R3HA 4KVCH 4Q0XH 3WCYA 4U1MA 2WP3O 4HZLA 4R26H 4OB5L 3T0VA 1DBKL 2VN7A 5F9DC 3UBXB 5EOCL 2GQHA 3MRHA 3DSNA 3G6DL 4HW6A 1CVRA 1I7RA 5E8PA 3W9EB 3CNKA 3V8CA 4K2UH 1AGFA 4N8VB 1I3RB 1IGJB 1EGJA 4ALAL 3FB8B 2VAAA 3IDJA 1D5IH 1MEXH 3FMGH 5E5UB 1S7RB 4YNYA 4ETQB 3CUPA 3HS0B 1VERA 4H0GA 2F8XC 1AXSB 1PJ9A 1T1WB 1F58H 3KYOA 5D2NA 4HPOL 1PG7W 3QIBB 5EU5A 2F5AH 3L3DB 5D70L 4M43H 1UZ6E 4YC2B 3W2DH 3ARDC 5JO5B 2AJVL 2IEPA 1IM3A 5SWZE 1MVUA 1WBXA 3IFPA 4NJ9L 2EO1A 2PXYD 5BS0E 4L5FH 4MCZA 4XNXL 5IFHH 3GI9H 2D3VA 3O2VH 3MOBH 1N8ZA 3PQYE 5GS1A 1HSAA 3KJ4B 3SQBA 3HG1A 3BIAX 5E0QA 3E0GA 1A22B 3ILQD 4P2CG 1M7DA 2HT4D 4P5TC 3TM6A 4P9HC 5DFTA 3HUJE 3QCTH 4GW4A 1X6LA 1UKTA 3U7YH 5ICYB 2BNUA 3KWWB 2PETA 4WW2F 1HOCB 4BH7A 1XF2B 3T0EA 2VRAA 3UTTB 1RVFL 5CP3A 5FO9B 4IIQA 4JB9L 1U3HB 3RVTD 1MNUL 1B88A 2ZOLB 4KJYB 3WJLC 5T3XE 1S7XB 1KIQB 1EIBA 4Y19E 1CLOL 4KK9D 1T7WA 4I18B 4JJ5B 1CL7I 3LHPH 2YN5A 5SX4I 2ZZUT 3RUGE 3QHZL 2D7NA 5E94A 5GRJH 1LQSR 3EKCA 4XPHL 3S36L 4BSVB 1AO7B 5IJKC 1K8IA 3U36B 1FL6A 5KVFL 4RWHA 1G9MH 4DOHE 3VFMB 4BQ6A 4XPTH 3B3IA 1BOYA 3VFSB 3O2DH 1IEHA 3SHSA 4PRPB 5JXED 1CQYA 4WWKA 3V4VH 4MA3A 2HN7B 5GHWL 1OL0A 5HHNB 3Q48A 5ELIA 1G7JA 1O5DT 2YUZA 5SWZD 1S78C 1FHGA 5BS0D 1JV5A 1VFAB 4UNTA 4F8QA 3LD8C 4A6YB 5JW4R 4X9GA 5E4IA 3PWLA 4YWGL 1EHLL 4HK0B 5JQ6L 3OAUH 3QEQE 1FAIL 4JKMA 3PQYD 4M9OA 2J8UB 5DFVD 3EYVA 3DXAE 3KYKH 2QHRH 1XR8B 1MAML 5D7LB 5C09A 3P4NA 5GGSA 3UX9B 4P4KD 2VR5A 4DTGL 3ILQC 1TDQA 1ZHKB 2HT4C 1NCWL 1RHHA 3QFJB 4PRHA 4BK4A 3BX7C 5IEKB 3B43A 2OSLA 4OTXH 3IKCB 4X4ME 2Z35B 3C8DA 3BP7B 4X7TA 2W9EH 4EQ3A 3O6FC 1IGCH 1RZKH 5T3XD 5I0DA 2FX8H 1KBGL 3QWRA 5JHLH 2IMMA 4YX2L 5L7XL 1I8MA 4Y4HB 4Y19D 2VXQL 4ZS6C 3HZMA 3P77B 2HFFB 1AIFA 2BXZA 1BZ7B 5JOFB 1JF1A 4KK9C 2Q3ZA 1HH9B 1CVSC 3NFSH 4UIMA 5FA4A 1JNHA 2ZCHL 3V7AG 3OF6A 1OOAA 3UROR 3D9AL 1UM4L 1GGIH 4TUJA 3HFML 1RJLB 5D5MB 2A9MH 4N1CA 1LEIB 4PLKC 3H7BA 1R3HB 4I4WA 4YDJA 4ONGH 4U1MB 5C0EB 4UQ2A 4EEEA 5K9OB 1TJGH 1EXUA 4PJIE 5CZKA 5GZNC 1ULVA 5E24E 1I7RB 2IGFL 5E8PB 3QEQD 1OAUH 3Q5YA 4LQFH 2VH5H 3MA7A 4U6YB 4HIXH 1R3IH 2EIZA 5HBBA 1NSNH 3TVMA 1NBQA 2UYLA 3K1KC 5ECJE 3S5LA 3UJJL 3DXAD 2NW3A 5A2FA 4ZUSB 1Q0XH 3T3PF 2VAAB 3IDJB 2OI9B 4KAQH 3UZQA 1KNOA 1N4XH 2X05A 5F8RC 2AJSH 4YDIL 3NFNB 3WNNA 5D2NB 4JDTL 5LQBH 1MCWM 1Y6NR 4NC1E 4XNQA 3MXVL 3W9DB 3RIAK 4WO4D 4EZMA 1ZHBA 1IM3B 1MVUB 3IFPB 5L8JB 4MCZB 4CVXB 4G8GA 3MYJA 3IETA 3SDDA 3OG4B 5SWQB 4G6MH 4NKIH 3UCRA 5FYJU 3QNYB 3R06A 2IALB 3G9VA 3HG1B 3RWEA 1NLBH 4UAOB 5F3BA 1JNNH 3O3AB 4GW4B 4O58L 1DUZA 4PJDF 4BFBD 3T0EB 3GBML 3A6CL 1GXEA 3K2UH 3QUYA 4RNRB 4U6TA 4YFDB 4GAJH 5AAWA 3G9AB 5CMAA 1JWMB 1BBJA 2NXZD 4LARH 4WEUD 1CFSA 3SKOA 1YN7B 3UXFA 2VLLA 4ZOCA 3LKPB 1JZ2A 2X4TB 3KVQA 3MXWH 2FEEL 4YDKH 1IC1A 1FZJB 1MI5E 2QQNL 2VXTL 4HKXA 4YBLC 1OTUC 1X5JA 1TTUA 3QQ3B 4RMWA 2QHLA 2Z9TA 4HIEB 3NACL 1FL6B 4UOJA 4LAQH 4TPRL 5C6TL 5C0DA 4UIKH 1I8KA 1YY9C 5IMOB 2XXMB 2AEQH 3U4BH 1LO3L 3B3IB 3GMOA 1WISA 3ULVE 4OZFB 5C0JB 4UV7L 3C08H 2AQ2A 2EDYA 4TUOB 3SJVE 3KPPB 4WEMB 4PJEF 3MA9L 4HUVA 5E99L 4M48L 3QG6B 4OFYA 1JV5B 1FIEA 5IWLC 4JFZH 4KRMB 5T3ZE 4L8SB 4UBDD 3IDXH 4QY8A 4WCYL 4OI7A 4RFNB 1K3ZA 1NAKH 2PO6D 3LSOA 1JYNA 2IAMD 2FZ3A 4KI5E 3KR3L 5GJSL 4YE4H 1L0QA 2ZKHL 2D03H 2HJLB 3LH2H 5C09B 3P4NB 5GGSB 5MP6L 1WZLA 4NNXA 4JZJA 4KGJA 2Y72A 3MODL 1J8KA 4NBYB 4PRHB 4DKEH 4RGNB 2VABA 4PJGF 2C1OB 2BSTB 2FJHA 5F7WC 2X70A 4PJAA 5JUEH 1W72B 4LDOB 4RDQF 5LBSH 3TEUA 5EBMA 1WF5A 2A6KB 5AUMA 3QUZA 3SDAC 4F15B 1EGJL 4MJ5A 4PJHE 3I3BA 3OKYA 3PNWA 3HZMB 5DI8A 1MI5D 5DO2D 1OTSD 3BYTA 1CDHA 2HFGH 3RDTA 3WFBL 1A7PL 1QACA 3BIKB 2R0WH 3P73A 2FO4B 4BZ2L 2RAMA 1HEZA 3EO1A 4UIMB 5FA4B 1ZGLM 3UJTL 1CDYA 4RMQA 1A6TB 4JHWH 4HBCL 1DBMH 4TUJB 3E2HB 5EO1B 2YKLL 2HJKB 1XIWC 3ULVD 3S37H 3QWOA 4YDJB 2ARJA 2GHWB 4PJ5B 4Y5XC 4P46A 4LVNB 3SJVD 2ADJB 5FYKH 3QCVH 4UQ2B 5KN5A 2BSRA 1IGIH 1A64A 4NC1C 7FABL 4S1DD 1U8MA 3WLWC 4HXBL 5H2BB 3SKMA 4QTIL 5GRUH 4MLSA 3MJ9L 5T3ZD 5T1KB 3DSFH 1IKNC 3ROOA 3EJZC 3MA7B 3T4YA 3GSVA 2EIZB 5ENWA 2VQ1B 4UV4H 3L3OA 4KI5D 3TVMB 1T3FB 1WICA 1S9YA 2EIBA 4Z8FL 4TN9A 2IAMC 1X5AA 2EYSB 2Z4QA 1KNOB 1RZFL 3OGCA 2AS5M 4JQXC 1NFDA 1NGQH 4Y4FB 3BMWA 2GY7B 1GGYA 1TTGA 3H8NA 1IL1A 1DJSA 3PGCA 2J4WL 3DVFA 3HPLA 4K7PX 4M6NL 1ZHBB 1UJTA 3GHEL 1F00I 3P4MB 5I1CL 4OCWH 5D72H 3KPNA 1FGVL 3PWJB 3QJHB 3JTSA 3RRQA 2WBJD 2NTFA 4MVBC 4KJQD 1P7QD 1K85A 2DI9A 3EOBA 3QPXH 1JI1A 4HIHA 1OTSC 5DO2C 4PJ8D 3R06B 5EUOA 3A0OA 2EDEA 3RWEB 3FFCE 1P5UA 1RI8A 2CGRH 1WCBA 3IDYC 3ARGA 3TT3L 3QXUA 2D0FA 1DUZB 5EO9A 1HWHB 2OK0L 3V0VA 2IH3A 2OBGA 3QUYB 4RFEB 3U1SH 4ZUVA 1AKJD 4I0PB 1CT8A 1DQLL 1CFSB 2GUOA 1CBVH 1T83A 4GXUN 1CICD 4OCRH 5IW3A 4JGMA 4LLVA 5IROA 1ORSA 1CGXA 1J9CT 2AK4E 4I3SL 3GHBL 3IDNB 2EKSA 1NCAH 1B4RA 4EOWH 2F54A 5K9QI 4MAUH 5TDPB 1W72L 1TVHA 4C83A 1H3UA 3E8UH 1LK3H 2YHGA 2XTJB 4YHPA 4GW1A 4IMKA 3IU4L 2NLJB 3L5WB 2KPNA 3VXUE 3WUWA 4E0RA 3EJYC 2W1NA 1OM3H 4YZFF 2YD8A 1KIRB 1JPFB 3RVUC 4OLXL 3VWKD 4BFEA 1F4AA 2R56L 1KTLA 4GKNB 4K9EC 2APWA 5CJOH 5I1JL 1HINL 4G8FB 5IR1B 1NGWB 1SY6H 4PJXA 5HYQA 4I13B 1I7TB 1R5IA 5FOJA 1J8HB 1SQ2N 1N6VA 3U2SA 5C70A 1F8TL 3LSOB 5ANMA 3QH3A 1X5ZA 2FZ3B 3FFCD 5L2JA 4LSVH 1I1AB 5IKCA 4MJIE 4NCC2 1OGTB 4O51B 5JNYB 4JZJB 2AW2A 3MRGB 3FN3A 2R9HD 2AJUH 2FJHB 3QEGH 5DQJB 2R1YA 4HWBA 1YPZB 2NY4C 3LIZH 5FAAA 2XZQL 4JY5H 3OJDA 5AYQA 5MEPB 1SJXA 3VWJB 1CFVH 3RNKB 1VACB 2VL4A 3MLVH 4MJ5B 3VFVA 3PNWB 5DI8B 1J1PL 3GRWL 3EYQD 4QXWA 1MHHA 3BDYH 1N26A 1Z9LA 1CLYL 3LMJL 3EBAA 1S9WA 1CICC 2AK4D 2GJ6A 3U6RB 1GGBL 1CD8A 3EO1B 3B2VL 4XT1C 2GJZB 1XGTA 1P7KA 5F7UA 3QWOB 4QTHB 3VXUD 2X9WA 3C5ZA 4TSCL 4L9LC 3I6KA 1OF2B 1WTGT 5KN5B 4PP1C 1BM3L 3FO2A 4JPKH 2RFXB 4Z7NE 3TBYA 3FO0L 3SKMB 1E4KA 1JNLL 2B4CC 4HJ0C 4WI9A 4P23D 4EBQL 4TSBH 4MQXD 2BCKA 4OD1H 1ADQA 4WV1C 2GTZB 3O3UN 4PRDB 4U1GC 1U3YA 2C3XA 4RX4A 3I3DA 5ID0A 2OTUB 5EC1B 5ENWB 2C4XA 3L3OB 5T1LA 3L5IA 1F6LL 4LHUD 1KB9K 5SV3A 4MJID 1D5MA 1IQWL 3PV7A 5DZOA 1A6PA 5DVMA 1QEWA 1JGEA 3MRPB 1S9YB 4NHUA 3PP4L 4U7SA 3IS0X 1FJ1A 4E42A 2VWEE 2Z4QB 4P9MH 4GKOA 2GI7A 3HG1E 3H9SA 4KKBD 4G5ZH 1J0ZA 1UC6A 3F58H 4CU6A 2DWEB 1IL1B 3OJVC 4QRSB 5H8DA 5CP7A 2P1YA 2H9GA 2R9HC 5BRZA 2ZCLH 4MDIB 3G04B 3RWFA 3KPNB 3TNMA 4DEPC 3F6LA 2NTFB 4NZUH 4GG6F 2WWMD 3QPQC 4ZOAA 5GGUB 1R3LB 3IFNL 4FG6D 4FQLH 3S34L 3B9KB 4S1QH 3P11H 5DRNA 1WCBB 3TCLB 4YXHL 4RGMC 1A7NL 3AFLA 1IFHH 4U7MA 3Q2CA 4XCFH 5EO9B 4GAGL 1LE9A 2CLRB 4DUVA 1M7IA 4K94H 2IH3B 4YHKH 1CLZL 4OQTH 2IQ9H 1FIGL 1QNZL 2VZUA 4JPIA 3K7UA 4RQQA 5DD6A 3HE7B 1YYLL 1Z9MA 2Y1VA 4Q58C 5GGRB 4IRJA 4KWUA 3AREA 5HGHB 2A74B 5E2UL 4HWEL 5JPNB 2DIAA 4NFBA 1XH3B 4CDGC 1K9TA 4LLVB 1ORSB 5ADOL 1YEIH 5TFSL 4HS6A 4CL7A 4Z5RA 3O6LH 2EKSB 3OBAA 4FFVD 1TVHB 1P69B 5EU3A 3EO9L 2FYYA 3CK0L 2A77L 3HG1D 4GW1B 3TJHD 2X1OA 4MA8L 3DBXB 2FIRT 1U8QA 3MRBB 1AQKH 4C4KT 3WUWB 4KKBC 4WU5B 3GM0A 2P24B 1QSEE 1S7QA 2BOCB 4N1HB 5D1XA 5EIVA 1C7SA 5AWNL 1FFQA 1T4KA 4YHIA 3VXOB 2QQKL 5HGBA 1MCCA 5HYQB 4LNRB 4PJ7F 3OR7A 1R5IB 1A7OH 1I9JH 3U2SB 2FLBT 2WANA 3ZT5A 5I75C 3NTCL 3QH3B 1T66D 3Q3GA 3R1GL 1BIIB 1ZLSH 1HHKA 2LTQB 2OR7A 1MWAH 3BOVA 4DGYL 4HKJA 2VXUL 4FTVE 2NY6D 2FATH 3EZJB 4IDJL 3MLUH 5BO1H 3ZDZE 4GLRI 2AXHA 1H3TA 2C4FU 4XNUL 3NZHL 3H9HA 3BDBA 1CGUA 5CLWA 3PUCA 1GGUA 2ATKA 1DBAH 4Z7OF 3GJFA 2BHUA 5IGXH 3FFDA 1CN4A 2FCBA 1KJVB 4WWKD 5A16B 1IGFL 2V5TA 1MHHB 5GRYA 3QQ9D 1P2CB 5GS3A 2V7HA 5JR1L 5FOBA 2F19H 3HC3L 3BPNB 5D2LA 5LGKA 4Z77A 4JFYA 1MQ8A 3L3HB 2BY3A 2A2QT 4U0RC 3T8XA 3A6OA 1X3DA 4K3HA 1OPGL 4MD5B 4OGXH 5BOZG 1ZA3A 1JHLL 4CNIA 3BKMH 3JWDL 4DZ8B 1F6FB 2X89A 3ARFB 3ZDYE 2FWOB 4XZUA 2ZSWB 1B6UA 3R4DA 4CVZB 2DDQL 3TBYB 5D7JA 4FQPA 4EKXA 1YYML 1KPVA 4LLWA 2BCKB 2NY5L 4IRZH 4OBRA 2G5RA 2ICCA 4BELD 3QWRD 2CUIA 1J1OH 2VDRL 4O2CB 1TZGL 4JREB 5E6IB 5HD8D 2VC2L 1D5MB 1QLFA 2EEAA 2MCPH 2BJML 3MO1A 1JGEB 3P0VH 4G8GE 2AKRA 4NHUB 4XVJH 5HYSG 1RUQL 1X5GA 4FTVD 3VFPA 2JIXA 1QVOA 3N85L 4NQXA 1KJ3L 3AS3A 4NOBA 2AXFA 3QT2A 5A2KH 4WFFE 4X6DA 3OF6D 3M1BB 3EHBC 4X4ZA 3SEPA 3D69A 5DUPL 4WI3A 4ZUTB 1SBSH 4D9LH 2AK1H 5BRZB 1RFDH 3TLRA 1YNKL 4XVUD 1RZJC 4MXVE 3JVGC 4WI4A 4X8JA 3WIHL 1YMHA 5IFAL 1NANH 1FNEA 5FGCB 3CZFA 2ITDA 3AUVA 4KDTC 3R8BB 2XRAL 2E27L 4NT6A 5DRNB 1ZTXL 4LHQB 3QISA 1AE6L 3HNSH 3G6JA 4ORGB 2ADFH 4X0KA 3H0TA 1D6VH 5FUOH 2G60L 1DBJH 3QHFH 1L6XA 2DYPB 4GUPB 4QRQA 3LEVH 1ZEAH 4GRWF 1I8LC 1M7IB 2Z91A 3L3GB 4OD3H 3V6OE 1GIGL 5BCAA 5KTEL 1HH6B 3HZKA 4LHJB 1F4HA 4J1UB 5CLTA 3ZE0E 1MAJA 4RQQB 2DTMH 3KHOA 1PG7L 2V9TA 4ONFH 4OGZA 3OKOB 2AJZA 1JGLH 5TDNA 3HI1A 5KANI 4GG8A 1A6ZB 5L88L 1ZVHA 1D7FA 3Q6GH 2VDQH 3GMQB 4JFPB 4F7MA 1B2WL 4Y16A 5FIEA 3FOLA 3PWVA 4HSQA 1JZ3A 1NAMA 4W6XB 3BH9A 3P30L 2Q8BH 1N5YL 3PHOA 5HYJB 1IBGL 4G8GD 4YGVB 3SDDD 2O5XL 4OGAC 5HD8C 3GI8L 1CTOA 1WEJL 5EU3B 2Z92A 4PYHA 1NQBA 4PRBA 2FYYB 4LEOB 4XHJC 2BHZA 1F90H 3T04D 2V9RA 4WFFD 3BEWA 1U8QB 4WHYG 2DQEH 4PTUA 1I85C 4M1DL 5CGYD 5TE6L 4XBGA 5T5NF 3EGSA 4HS8H 1WIPA 4KVNL 2D7QA 4MA1B 2DMBA 2JJTA 2AP2A 4HCRH 1S7QB 5D1XB 1IC4L 4C56A 4DKFL 2WIIB 4PJAE 4ZUWA 3RUGF 4HUWA 4D0BA 4JLRA 3OR7B 2V5RA 1URLA 2I9LB 1R24B 1TETL 2A6IB 2ADIA 3MLSH 3Q3GB 3CCHA 4ZOBA 3AU1A 3MACL 3S4SG 4NC0B 5DJXB 1HHKB 5I6XB 2P8LA 2Y36L 3OKKA 2VN4A 4APQB 1K8DB 2JJSC 2APBA 2VO5A 5ADPL 1JK8B 4IHOB 4ODHH 4JG1H 5FECA 4FRWA 2FX9H 1HWGB 2Z31C 4KQ4H 5I71C 3TJEL 3MBEB 4M6OL 5HVGB 2AXGA 3SKJL 3H9HB 5I74B 3WIIH 3QDJA 2ATKB 8FABA 1BWMA 2B20A 2I9TA 3FFDB 5F9OL 2EC9T 4FA8A 2XY1A 35C8L 1JPGB 4QRTA 1N6QL 3VH8G 5KZCD 3ELAT 5E00A 2V7HB 4DN3L 5FF6A 5IQ7L 4Z77B 2X4QB 2YD2A 4UT6L 1IMHC 5IB1A 1ZWIB 5SX5K 3DGGA 2C1PB 3LKSB 5DRWA 1A3RL 1T7XA 2FBJL 4MXWH 4CKVX 3IVKA 1E27A 3SDCA 1S7VB 1UXSA 1EZVY 2C9AA 1CGYA 3D5OF 1DBBH 4YDVA 3EYSL 3H3PL 1HXYA 1WGOA 3MCG1 3ZSSA 4XZUB 2BFVH 3QUXA 2P43B 4MA7L 4OCSH 3S88L 2EE9A 2B5IB 4LLDA 1NFDE 5FO7A 3QEUA 4P5KB 3ARXA 1UB5A 5IVXB 4O02H 3MOQA 4EVNA 2NY3C 1JMXA 1KIPA 3O4LB 3QUZD 5JORA 3LKNA 1YEEH 1QLFB 2VUOA 3WN5A 4HUNB 5J06A 3MO1B 3RDTD 2AKRB 4G43A 1IAII 3NH7L 3HI5H 1FO0H 2JIXB 2CLZA 1QVOB 2UZYB 4K7FA 5EUOE 3U0PA 1PY4A 1BZQK 2HKFL 5DVKA 1NUNB 3FAXA 4O2EA 4X6DB 5FHBL 5FA3A 2MMXA 1Q9LA 2DQCL 5DHVH 4XWGH 3V6OC 3D69B 1MRDL 1GRWA 3GB7A 4GXVL 4IRSB 4ODTL 4C4KO 3VGAB 3I6LE 4P46D 4F2MA 3BP6A 4GBXA 4RGOL 4X8JB 3WDHA 4OFDA 5HDLA 1VFBA 5A3ID 1FNEB 3VRLF 1PX3A 4MWFB 3ZSTA 3MC0A 4M00A 1A2YB 3VFGL 1T5XA 3ZTNL 4FQQB 4V1DB 5KG9A 1G7IA 5LG1A 4K71B 4DQOH 1PEWA 3FQRA 4OQ1A 1HNGA 1T0MA 4HH9B 3G6JB 5CZVH 1A3QA 4CJ0A 2Z8RA 3H0TB 1G0XA 4LPCA 4R2GD 2NY0B 5I1LA 1ZMYA 1RQ5A 1GJIA 4OLWH 4J12A 4JANA 4KFZC 5EZIL 2CRIA 2F54E 2Z91B 4G3YL 5JOPE 1I9RL 4DCQA 5J4MA 3HZKB 3HPJA 4LCCA 1BBDH 1DANT 2BY2A 1WWCA 3ILPA 5DD3L 5EZOL 4DFIA 2AJZB 4TULH 5TDNB 3V4UH 3HI1B 2G9HA 4NHCH 4GG8B 3K4AA 4OLUH 4U1IB 4ORZC 3N1QC 4F7MB 1KYOK 1NAMB 1PZ5A 3BH9B 3PHOB 3L5HA 3FAWA 5FV2A 4PJXE 4AM0A 4UILH 4ONHA 2NX5E 4H25A 5T3XH 2Z92B 4PRBB 5ANME 4Q6IB 5GGVL 3GJEA 3MUJA 4LEXH 4BK5A 25C8H 3BEWB 2UUDH 1IAIM 3ARGD 3GMRB 2WINB 4LCUB 3L3JA 4XBGB 5D7IB 1DE4A 1RIVH 3EGSB 2P7TB 4P4RA 3TBVB 1I9IL 3BD4A 3I6LD 1XGRA 4ZS7H 1WZ1H 1OARH 4ZQKB 4MNQA 4P2OC 4ZUWB 2MPAL 2ICWI 4HUWB 4D0BB 1RK0A 4EN3C 4O4YH 1QG3A 1CF8L 2E8ZA 2D7MA 1O7VA 2OP4H 3RY6C 2R2BA 2D0GA 1Q0YH 4UUJB 5JW5A 2DLHA 3CCHB 4WGWB 2I60L 2LQRA 4PJ9D 1A3LH 1ITCA 4RZCA 1YEJL 3QCUL 4UT7L 2VDKL 4OUUA 2GJ6E 2F54D 5JOPD 4RAVB 3LS4H 1FE8L 2YK1H 1Q9WA 2ORBL 3HZVA 3BQUB 5CJXA 4TUKL 4LVHB 3QDJB 2HTKC 1QQDA 5FYJE 2Q6WA 1AGBA 5LGJB 3RPKA 1WUNT 3STZB 2R2HA 5EBWA 4WHTA 2APFA 1JZ5A 4QRTB 3GO1L 2NZ9C 4QEGA 4JM2C 5FF6B 3WXVL 2RCSH 2WW8A 1DTUA 3MNWA 4K8RD 2NX5D 4Q9RH 3GZKA 2CRMA 3U7WL 1ES0A 3IVKB 2J88L 4H1LH 3MUZ1 4KJPD 5KSAB 4YDVB 3GIZL 1U8NB 4D2NA 2RR3A 1HXYB 3DMMD 2V2TB 3QUXB 2BNQA 4LLDB 3IF1A 3H9SE 2PTVA 3QEUB 3I9GL 3EOAB 2XNAB 3NGBC 1UB5B 1T0NA 2WUCL 4XVTL 4N0UA 3G5ZA 5DUML 2FGWL 2DLEA 3LKNB 1Z9SA 3C9NA 1D6EA 4PGCA 1T20B 2VZSA 3VXSE 4ODVL 5DMKA 3N06B 4PJ9C 3RJQB 2GJ6D 4NPYA 1R0AL 4K7FB 1H8OA 5IMMA 3ARBC 4O2EB 2J6EH 5FA3B 2XPGA 1Q9LB 1RJZA 2A73A 3MLTA 2NXYC 5FYJD 3O4OC 1P9MC 2QKIA 5MERB 4OB5H 1NKRA 3C5ZD 4F2MB 2A83A 1QR1A 3BP6B 4GBXB 4JFDE 3SE4A 3G6DH 3MR9B 3VFRA 3PWPA 4F9LA 5IM7A 2JB5L 3DI2B 5GIRB 3ECBB 1FYTA 2DQFA 3AAZB 5GS2D 3W82A 5GSRB 1T5XB 3VRIA 2Q7NA 4TVPL 5MENB 1G7IB 3DJ9A 3H3KA 3MCKA 4YPJA 4F33B 4RAUA 3F7PC 4K8RC 4YBQC 5T1LD 2BK8A 5FYLE 2AJYL 2ZP0T 1LMKA 1F6AB 4WW2A 3T65A 4XC1H 3FQTB 4KUZL 3LZFH 4DCQB 1KB5H 2P45B 2R2EB 4HPOH 3BW9B 4KK5D 4PRNA 4LCCB 1CFTA 3DMMC 1U8KA 3H9SD 4KQ3L 43CAA 5K33A 1MLBA 4DVRL 1YMMA 1H3WM 3CAFA 5TE4H 1R5VB 1V05A 4U7KA 1C8PA 2VDOH 3ES6B 1NJ9A 4KMTH 4EUPG 1PZ5B 5DS8A 1SYVB 5J57B 1WT5A 4XPAL 3TV3L 1HKFA 4PY8I 3VXSD 4Z76B 1KJ2H 2X4UA 3HE6D 1I4FB 2WIMA 4HS3A 1QRNA 5CBEB 4HV8A 4PYGA 3MFFA 5HHOE 4H25B 5E8DH 1NBZA 5FDWB 1G7LA 2BVPA 3TA3A 2JE8A 1T2XA 1ZT1A 3L6FB 5DC9B 1EO8L 2FO1A 1SBBA 1TXKA 4Q7DA 3FOMB 1XGRB 1TITA 5I30H 4NNYA 4U1JA 5LXGH 4IM8A 1KN2L 3D3VA 1H15A 3U0WH 4JFDD 4P57A 2MTPA 4KZDL 1RK0B 3ULVH 4XPBL 2HLFD 3PWNB 4IRJD 1CLOH 4Y2OA 3ARED 3SO3B 5D1QC 3VXTA 3BKJL 5JW5B 2E6PA 1NC2A 2EE2A 4RZCB 3UTQB 5FYLD 5EH1A 4MCYA 5DEFA 5D2LE 4HPYL 4EIGB 2PUQT 5TF1H 3U46A 4JO2L 12E8L 4ZXBD 3WFEL 5T3ZH 3BUYA 3GSNA 4Q0XL 1NMCC 1VDGA 1Q9WB 3EYUH 3HZVB 3NFPA 1LE5A 3PJSB 5F97E 5CGMA 1JPTH 1NFIA 1ETZB 5E6YA 4R26L 2N7BA 4IOFC 4JZNA 3DETD 4RMTA 5C1MB 3ZLQC 2IG2L 5D8JH 2Q6WB 3MV7B 5DJCA 2EDNA 3O9WB 1IAKB 1X5KA 2X42A 2DJ4A 2OYPA 5B3JE 1G7QA 4PRAA 2H26B 4RRPG 3ARZA 1W0WA 5F72S 1ZLVH 4K2UL 1FAIH 3VD5A 3HB3C 4KRPD 4WUKL 3KPSB 2Z93A 43C9A 3WFZA 5HHOD 1D5IL 3FMGL 1ES0B 3HE6C 4OF6A 1MAMH 2HVKA 1XF3A 3LKQB 4DTGH 5ESAB 1F58L 1NEZA 4XP9H 5BVJB 1BFOB 1KT2A 2R29H 2B0SH 4M43L 4NCC1 2BNQB 3W2DL 1NDGB 5E1AA 3V6FA 3IF1B 2OQJB 3MJ7B 4X6CF 1XF4A 4L5FL 5HY9B 1AGCB 5IFHL 4JRWA 5EIIA 3GI9L 2DLTA 5L7XH 3WEXA 2VXQH 3TPUA 1TTFA 3O2VL 1U36A 3RKDD 4QXGH 1RIUH 4KXZI 1IE5A 2XWJA 3DX9B 3CDYA 4JFXA 5C07A 3WE6B 5J13C 1IC7H 1KN4L 1MFCH 5J6HA 3C87A 3OKNA 4LMQI 5J3HD 3QCTL 2ZCHH 5MEOB 4GT7A 2XA8H 5MI0C 1Y6MR 3D9AH 1P4BL 4N0CD 2HT2D 4PGJA 3FT4A 5IHUH 2XPGB 5D1ZA 4ZXBC 4YEEA 1JHKH 4XXCC 2X4SA 1GOHA 2A73B 3MLTB 2ZPKH 1FFRA 1RUMH 4Y2DC 2QKIB 2X89D 3TN0C 4L8CB 3UTSA 4MZ2A 3NIFE 2A83B 4KHXH 4OZIE 2A9NL 2XY2A 5DJAB 1BF8A 3GSOA 4NQUA 3VFRB 2EE3A 4NQEE 2IPTH 3LHPL 3IDMA 1U0QA 5D7JD 4YHYB 2VLJB 2DQFB 1FL3B 3VRIB 1BVLB 3MCKB 3NBNA 1CDCA 3OB8A 4XPFL 1OCWH 1WJ3A 4HBQA 4RAUB 1R3KA 1G9ML 1BEYH 1DSFH 2FJFA 3MREA 5J12B 3CFEA 4EXPX 4XPTL 4PJDA 4WW2B 4W4OC 4OZGB 3O2DL 3QI9C 3T65B 4OI9A 4JRXB 4ELKB 4OM0H 2KDGA 1I1RA 3V4VL 5IFJA 5JZ7D 4ZAKB 7CGTA 1RZ7L 1S5IL 1KJMA 1OP9A 1U8KB 3BZDA 4Y1AA 1LILA 4R4ND 1BQUA 4HQQH 1T03H 1YDPA 3UPRA 4R4BB 5FDYA 3OAUL 2WQRA 3AMKA 4FQXC 4C56E 5DMIH 5DS8B 1U2HA 2KZ1B 2XN9E 1J87A 3FN9A 3HZYB 5E08L 4HS3B 1FNAA 3NAAL 1QRNB 2QHRL 3KYKL 5KSBF 4HV8B 5DQDL 3O81A 4GFTB 4X7SH 1NBZB 3LDBC 4P49A 3ULSB 1AGDB 2BVPB 2YPKA 1VEMA 3LKRB 5IHBA 5JW4M 5EOTB 1QSZA 4F58H 2UVEA 4N0CC 4OTXL 3GBMH 2PYEA 4HMCA 5DHYA 1GC1H 3A6CH 4A6YH 4PJEA 3E6HA 4I3RL 1MCQA 4NNYB 3BSZH 5KS9F 4KKCD 1IGCL 1VKXA 1RZKL 1MAKA 2BNRA 1H15B 5JHLL 4P57B 3MRFA 4NQED 2OL3A 5DTFB 1JRHH 4FQHB 3HRZB 5DVNA 3DVNB 4LKXA 1F11A 2QQNH 1TQBB 3NFSL 1U6AH 2YA1A 2FSEA 3HNTL 4Y16D 2F53B 4QRRE 4MCYB 3LS5H 4Y8DC 1GGIL 3NACH 1S8DB 4JO4L 3VI4E 4TPRH 1QSFB 1XZ0A 4Q9QH 2H45A 4PJGA 2CDFA 4PJBF 5I9QB 3NFPB 3QEHB 4ONGL 2VDLH 1MY5A 4NUJB 2YMXH 5K93A 4JZNB 1DUYA 1MJ8H 2YA0A 2IC2A 5JHDA 1LEGB 3P0GB 3A67H 3C6LB 1OAUL 4NZDA 2VH5L 3D2UB 4HIXL 4PRAB 4C56D 1GPOL 5T33H 1R3IL 1W0WB 1UENA 3FQXA 1NSNL 2X40A 4HXAH 2XN9D 4L4VA 4JRYA 4H20H 2XWTA 4X5LA 4M7KH 3I6GA 1U93B 1Q0XL 1LGVA 5IB3B 5D96B 2YD6A 4FABH 2ZKHH 1U58A 3ZDZF 4ZFZA 4EIZC 4WI6A 4MD0B 4PBWD 2HVKB 3RX7A 3QFDA 1WC7B 5F1IB 4KDWA 3F7RA 3T77A 1GHFH 3QIBC 1TJIL 2Y23A 4H8WH 1FNGB 1NC4D 1TZHB 1PGRB 4YC2C 3MRKA 4G6FD 3RI5F 4WFHE 2QADB 5E1AB 4KUCD 4X4XB 3SN6N 2I07B 4KKCC 3H42H 1EGJH 5EIIB 1PEZA 3WEXB 4G6ML 4NKIL 4AZ8A 1NGPH 3F5WA 1OAXH 3V52H 5LKNA 4H26A 2XWJB 3KJ4C 5C07B 1NLBL 5HVFB 1EEQA 4QLRA 5DQ9A 4QRRD 3MRLB 5EZLA 5J6HB 3HR6A 1JNNL 1F2QA 4WRLA 2IANB 3E1F1 1INEL 4HJJH 4P48A 3RTQB 1A4KB 3CD4A 4OZ4B 4NQVA 3SDCD 3HR5A 4GAJL 5C86A 2VXVL 4LHUG 3EJJX 3KXFB 4F9PC 1U3HC 4HAGA 2OR8A 3X13B 3UZEA 4YO0B 4UOW0 2H3NA 5IP4A 4R7NA 3MXWL 1T1YA 3C60A 1SMOA 4X5XA 3GBLA 2GK2A 2L0DA 3NA4A 4JHAL 2GJJA 3ARQA 1CFQA 4M3JA 4ZNEA 2ERJC 1J05B 2DQJH 1ZA6A 4R0LA 4U31A 2FD6H 1IEAA 4JO3H 4IMLA 3SDXE 3ARPA 1W2KT 2FJFB 5CP3H 4K3DH 3CFEB 3T0DA 3CX2A 2W92A 3GIVB 2AEQL 1AQDA 4PJDB 3TO2B 3U4BL 3BZEB 1AI1L 1CLCA 1ZLUK 3C08L 1S9XA 4OV6F 4WFHD 3SCMD 5IFJB 4MXVF 1QOKA 4QOKA 1VESA 4Y1AB 2R4RH 4NKMB 3B8SA 1QFUH 3MGTA 3IDXL 4CMMB 2CRZA 4M1CD 1NAKL 1K4DA 3O41B 4M5YL 3G08A 4GBXD 2X6MA 4MNQE 5F6IC 3Q6FB 4YE4L 3MX0A 4YHOH 2D03L 2LABA 4OZFH 3LH2L 2O5ZH 4TTDD 3S3JA 3VFOA 1KV3A 2YPKB 4DKEL 3ZE0F 3PL6C 5BMFH 1BMGA 2AI0H 5JUEL 3QIWB 2DL2A 2PYEB 4DZBB 4PJEB 4K7PH 4J3SA 3E6HB 2EDBA 4I2XB 4XC3H 2WWKT 4H0IA 2X4OA 4GRLB 1JJUA 3TZVD 4Y4HC 5I1IL 1ACZA 3M8OL 3LRSB 3MRFB 2OL3B 1YEHH 2QEJA 2HFGL 5IG7A 3OKDB 4BYHA 4LKXB 4KTEL 4KPHL 5IF0A 4XVSL 1I8IB 1DR9A 2M8XA 3GHBH 4I77H 1PZUB 4JHWL 1DBML 1EBPA 4PGDA 3S37L 1XZ0B 1CGVA 1GZPA 2EDHA 2MWCA 2WLZA 4NN6B 1OHQA 1NL0L 3WO4B 1G7MA 5HYSA 5FYKL 3QCVL 4NZRH 4L3AA 5LVEA 1V7NH 3KPMB 1DUYB 3SCMC 4OLXH 3JV6B 5F9JA 3OAZK 5EC2A 5GRUL 1VHPA 4KY1H 3T09A 3ESUF 5A43C 4CGTA 4KJWD 1PYWB 9CGTA 3ROLB 4WTXA 4L3EA 2GFBA 5DVLA 4MB5A 4MNQD 2CIIA 4UV4L 4RBPH 1F5WA 1TCRB 1MCSA 3ULUE 2XWTB 5L9DL 3TYFB 4M1CC 3ARRA 4N0UE 1X5IA 3K2MC 4Y4KB 5IBUG 5I1AA 3OWEA 3DECA 1U58B 3U4EB 1V7MH 3ARYA 4ZFZB 4D0CB 4XH2A 4OD2A 1TNNA 3QFDB 4P2RA 1SVZA 1RZ8A 3L95A 3WHE0 4MX7A 1CL7H 5IOPA 1NDMA 2FBOJ 5SX4H 1UQSB 3T77B 2X4PA 5ISZA 2VE6A 2GSGB 5EUKA 3FQWB 3MRKB 3MZTA 2E5EA 5J11C 5C3TA 2MSPA 1XCTB 1E28B 4OCWL 5D72L 1EBAA 5GXBB 4QHMB 1PKOA 5HDQH 3TZVC 3GSXA 3V8OA 3GRWH 3MBXH 3AS2A 3NA9H 3QPXL 5HJ3A 4PS4H 4UT9H 4LLQA 2Y25A 5DJZA 1VEOA 3FL7A 5TGBA 4TNVK 1JUFA 4UAOC 2CGRL 3PWPE 5IQ9A 2VLKA 1DVFA 1FYTE 3BI9X 3EOYG 3P40A 4PUBH 5TQ2L 3VMOA 5C0GB 4F7TA 1Z0MA 2E9WA 2V2WA 5I19H 2YUWA 2PR4H 3U1SL 4QRUA 5K59F 3EFFA 1BM3H 3IRZA 4GQ9H 1UCTA 4ODXB 1XR9A 2ZUTA 1FQ9C 1CBVL 1LHZA 1JNLH 4FQJH 4X5XB 4S0TD 4GG6A 4OCRL 2VDPH 5DJYA 3I75B 3ULUD 5F7HA 1YMME 3N9GL 2KQMA 4R0LB 4LSRH 1RURH 1OD7A 2A0LD 3BVNA 1NCAL 1LDPH 2VR4A 5E5MA 4BH8A 4MAUL 4EOWL 4IMLB 1D9KC 1NKOA 5ACZB 1LK3L 4PREB 5CHNA 2AJ3A 3RL2B 2HKHH 3KLHC 4LOUD 1QRNE 2V7NA 3F12A 2X7LA 1OM3L 2VKWA 3ZZ1A 3O3DB 4J6RL 4JFEA 1X5HA 4PP2A 4RA0C 1FL5A 4NRYA 5CJOL 3L9RB 4XGZA 3W5NA 5DA4A 3S5LG 1HCFX 3NCMA 2N4IA 1SY6L 4L8SC 2DQIL 3WS6C 3G5YB 1K4DB 3CXDH 2P5WA 3FN0H 1VEPA 1MIEL 1WZMA 3D3VE 3BPCA 4PRIA 4KTDH 3RZCC 1R3JB 4LSVL 1YN6A 3PWPD 4HF5H 4M1GH 4OCXH 2HT3D 1FYTD 3ZYIA 1Q8MA 4ZPVA 3VH8A 3VFOB 1U91A 3VGDA 5ICXA 3ARDA 1DEDA 2FJGA 4RGNC 3LPFA 3QEGL 4GAGH 3SE3C 5I1DA 4MQ7B 1TJHH 5I8CA 5IB5A 2FH8A 5BV7B 3LIZL 2WAHA 4JY5L 3K46A 5LJYH 2I5YH 1CFVL 6CGTA 1YYLH 2EH8L 1SEQH 3MLVL 1FZMA 3JV0A 4OFPA 3O8XB 4PJ7A 4P5TA 1JWUA 3BDYL 4YXLH 2NY2D 4U6HA 3FHQA 1YMMD 1BVZA 2VMFA 4LK4A 1HSBA 1EZVX 2D0HA 5TFSH 3ULUC 4KMLB 2CKBA 4FOMA 4U6XA 5D93B 5DJ0A 4AY0A 3DV4B 5CKGA 2EDTA 3E2HC 1LK2A 1UJ3C 5DYOB 2XKUA 3EO9H 3BH8A 1QRND 2OZ4A 3WIFA 4J3UA 5F44A 5H37G 3WJLA 2YPLA 4FFZH 4LOUC 5HYSB 1OT2A 1QRKA 1GOGA 3GGWB 1MWAB 4JPKL 3TA3D 5C0CB 2DJSA 5E8EA 4GJTB 4KU1A 2ZUXA 1KFAH 4JGJA 5T1MB 5EC2B 4TSBL 3ALXA 1CS6A 1I7ZB 1ZHLB 3RVWD 4OD1L 1LO5A 5IJKA 3MUY1 3OXRB 1P84K 1P1ZA 3MYZA 3MPCA 2QQKH 1ERNA 2X1PA 3D3VD 2GFBB 3QP3A 5IJVB 3TVMC 4KROD 2W38A 3NTCH 5DK2A 4OFIA 4FQ1H 3EFDH 3GKZA 2NY1B 5I1AB 4P9ML 3R1GH 5HSFA 4FHBD 3QUMA 2J7LA 4X4YA 3PP3H 4DGYH 3L95B 2D2OA 4Y4FC 5IOPB 1NC2D 3T3PE 4L8DA 4JY6A 2X4PB 5EWIH 2LVEA 1L7TL 3MCLH 5EOCJ 1F3JA 4CU8A 4QRPE 1YECH 1YY8B 3DUUA 5EUKB 1DFBL 1MJ7L 3WFCL 2X4NA 2ZCLL 2IBBA 3PGDB 4ZPTA 1R5WA 3ZO0A 1ZVYA 3KYAA 4HWUA 2JK5B 4NZUL 1WTLA 1I1YA 3GSXB 4DKDC 3C2AH 4GOSA 1DLHB 5HJ3B 3UTSE 1JF6A 1AXTH 3NIGF 1OSZA 4FQLL 5HHMB 4CUCA 1SYSB 4S1QL 3T0AA 3WLBA 3P11L 3BN9C 1DVFB 4U1NA 5A40E 1IFHL 2VTFA 2EXWD 4XCFL 2DKMA 2JLLA 5FKPA 3RNQB 1JHLH 3JWDH 3FB6A 4YHKL 1LP9F 4OQTL 4LCYA 3QUYC 1BJ1J 4ELME 2V2WB 3CFBA 3CFDA 1BFSA 1FAKT 2LE9A 1XAUA 1ED3A 5DZNA 1AGEA 4QRUB 2FH6A 4I0PC 3FJTA 3NCYP 4Z7WE 5FM8A 2DDQH 2YRZA 1S5HA 3OX8B 3KHQA 1FSKB 3C8KA 3LV3B 2HAZA 3VD9A 1UZ8B 2WWKO 3FQUA 4ZFOA 2ICES 2ARJQ 3TO4D 5IBTH 1G6VK 2UWEE 5DJYB 4GKZA 1TZGH 3BVNB 1ZT4A 4BH8B 3O45B 5C9JA 2B8OT 5CHNB 1U41A 5JXEA 2YC1B 4OGYL 2AQ3A 3S4SB 1J18A 5SWSE 5HDBE 4QRPD 4POZC 2X7LB 1JN6A 4QT5B 5SWZA 1CE1H 1TVBA 3DX6A 3L3IA 1A8JH 2VIRA 3CDGA 4AMKH 2IQAB 5D1ZD 5DUPH 2RJMA 1JFQH 4XGZB 2BRRH 3PQYA 1T22A 2V6HA 2GSIB 1N64L 3VXMA 5HGAA 3UTSD 1A7OL 2AEPH 2P5WB 4XMPH 5IFAH 1CGWA 2BNRE 4WI7A 3BPCB 2P42B 5KW9H 1I1AC 1YN6B 3LB6C 3BHBB 2SEBA 1ZLSL 4LMQE 2E27H 4OV5A 4ZD3H 4ZPVB 1CI5A 1MWAL 3VH8B 2GCYA 2I25N 3P0YH 1U91B 4U2ZA 2Q3AA 4AEFA 5D71H 1XGYH 3ARDB 1BWWA 3QA3B 3MLUL 5BO1L 3VFUB 2G60H 3HTLX 2MHAA 2IJ0C 4MLIA 5ALBH 2EXWC 2BC4A 5I8CB 1T7ZA 3KS0J 1LO4H 3VWJC 3KLAA 1RIHH 4PJGE 2UV3A 5IGXL 4JVWA 4BZYA 1G1YA 5C0AB 1PG7H 3RUGA 4LLYA 4GH7B 4PJ7B 5L88H 4P5TB 3UMTA 2F19L 4U6HB 2F15A 1EUTA 4AH2A 3TO4C 5JHDE 4PGBB 4FFWD 2OMBA 2KZWA 2CKBB 5L8LB 1VSCA 4U6XB 4OGXL 4QNPF 5E2VL 3SGDI 1IRAY 4HWBH 4LPYA 4L4VE 4XPGH 5F6HJ 4JRYE 4XTRC 3BKML 3QAZC 5EFIA 2EC8A 1F4XH 5SWSD 1T1ZB 4R96A 4FXLA 2V9QA 3MOAL 3GMMA 3QEQA 3QR2A 2BOBA 1IC4H 4LVEA 1ACYH 3EDDA 4IRZL 1LO5B 5I76A 1P1ZB 2QTEA 2CO7B 2BNRD 5J8OA 1MPAH 1J1OL 5DK2B 1TETH 3MROA 4P2QA 2MCPL 1F3DH 3S7GA 5FYJH 4HZAA 1KLGA 4XVJL 1EH9A 1YEGL 3ZL4H 3SDYH 3VXRE 3L7FA 3PGFH 3VFNB 5ALCL 4X4YB 2Y36H 3REVA 4QYOA 1OQXA 5CEYB 3EO0A 5JW3H 4MJ6B 5IWLA 3LD8B 5GS2H 3MRRB 3DURB 1SBSL 4D9LL 2AK1L 3DO7A 1RFDL 3VA2C 2PXYB 1C5CH 2NPLX 4ZPTB 5IIEA 5B3JF 4FZ8H 2EYTB 1MCOH 3LAFA 5JDSB 1EJ6A 3T08A 2JCCB 1TZIB 4XNYH 2X44D 4XNMB 1CCZA 35C8H 5ERWB 1QBLH 3SOBL 4X7CC 4MMXC 5JHDD 1OSZB 3B9KC 4X9IA 2V17H 3AROA 4NQCA 2NY5C 4UT6H 3QZWG 3JV4A 3HNSL 5F88B 5D7KE 4L4VD 4JRYD 2ADFL 4KHTH 1D6VL 4U1NB 5E95B 1DBJL 5FUOL 4EUPA 3LEVL 1ZEAL 3JTTA 4OD3L 3SDAA 5BXFA 3NCEB 3CFBB 4JKPH 4PB0H 1CFNB 5E7BA 4RSVA 1H0DA 3H3PH 1AGEB 3QWQB 3HE7C 3RVVD 5TH2B 1NMBH 1CWVA 2DQUH 3CU1A 4LLAA 3ET9F 1JGLL 1S5HB 3Q6GL 4K55A 3C8KB 1T89C 3DX7A 2VDQL 4JKLA 4QOKE 3CFCH 4XAKE 1XF5A 3LN4B 4FXGA 1WIOA 4GS7B 4MXQD 2Q8BL 1XIWA 1IT9L 1PKQE 3UYPA 3I2CH 4HLJA 1ZT4B 5GISH 1B90A 4Y5XA 5EU6A 4QXTB 3TWCL 3CPLA 3PDOB 3VXRD 1MCBA 4KK8D 1F90L 1R6VA 3REWB 1YEDA 4NRZA 1U3ZA 2DQEL 3SPVA 1HHHA 1MHPL 5SWZB 5FB8A 2R23B 1IKNA 5BS0B 2DQCH 2P47B 5K9QG 2VIRB 4OZIF 1P4IL 1U95B 3IAQA 4DAGH 4ODTH 5IBLC 5FYLH 4RWYL 3SBWC 3LN5A 3PQYB 1T22B 5M94B 5LGHL 2IAMA 4M7ZC 2VITB 3TCXA 4HMEA 1L0XA 3HUJB 3MLSL 3C60D 3VGBA 4P4KB 4JQXA 3VFGH 5JXAH 1GCFA 4U2YA 5FKAB 4MJ4A 4I5BA 5ICZA 5D7KD 4OV5B 4RRPA 4CVWA 3TNNA 1AH1A 2XTLA 2FX9L 1BQHG 2MHAB 5HHPA 4HT1H 5EZIH 4NWUH 3GDBA 2BC4B 4YK4B 4JDVB 4MHHI 1I9RH 4F37F 3WIIL 2VISA 3G6AA 1NUDA 3GK8L 4Y19B 3KLAB 3LQMA 1CIUA 4JDZA 3BRDA 5DD3H 2W65A 3RUGB 1OW0C 2QSVA 5DURD 1NGYA 3IXAB 4QOKD 5E9DE 3GSRB 2FHBA 4XAKD 5GZOD 5I8EA 1WV7T 3NCCB 5CEZE 4DOHB 1J0YA 3UTOA 3EUUA 1IGTA 4MXQC 4HUXB 2XZCH 3RWIA 3ZKMC 1E6JL 4MXWL 4L3EE 3PABB 4JFQA 2MKWA 4M6ML 2CR6A 5EFIB 1DBBL 1X4XA 4OIAA 1MCWW 3ARFC 2OR9L 3GJFH 5H94A 3VMPA 4HX1A 2YD9A 4JFFA 3U9UA 4KUCF 4P2RE 4OCSL 4HGMA 2PTUA 3QDGA 5F7EH 4YR6A 3DROB 1I9IH 4M8QA 2BVOA 3I02B 2J8UF 3GMMB 3QEQB 4FNLH 5ISZE 2Y5EA 4F7CA 5JQHC 4O02L 2MPAH 5I76B 3KLDA 3LQZB 3DXAB 1KLFA 1ZVSA 4JREC 5E6IC 4V2CB 1YEEL 3WNOA 3MROB 4WI5A 1OSPH 4XXDB 1UM6L 3HI5L 1FBIH 2GT9A 2JELH 1CD1A 3KPOB 1VFUA 1EHXA 2NZIA 4WO4B 1SEBA 3EO0B 1X7QB 2VLKE 5HI5D 4KK6C 4ODUA 2YWZA 4XWGL 1FE8H 3VE0B 4HLZG 2EKJA 1ODAA 3DO7B 3UEZA 2Y5TB 4TUKH 1J7VR 2KKQA 3S35X 1HHIA 2H41A 2X2YA 5E9DD 3D85D 4PV9B 1OD9A 2VJXA 4M8VA 4D8PA 4WUUA 5CEZD 5B8CB 5GZOC 3WXVH 3MUGB 5IMKA 4DQOL 3BWUC 4GG6E 1EFXD 4L3ED 5DEGA 5CZVL 5IT2H 1CQKA 1U3JA 3G5XA 3U7WH 4PJFE 4EUPB 3SGKC 4OLWL 4NBZB 4NQDA 1T04B 2UZIH 2IFGA 4PJIB 4P2RD 2NXZB 1DLFH 1BBDL 4U1HB 5C8JB 1A0QL 1AXIB 5ISZD 2D7OA 4TULL 3V4UL 1CICA 1V5JA 1NGXA 3JBG7 4NHCL 1ZLVK 3M17B 4HWNA 4OLUL 4JFEE 3SO5A 5CUSL 4LPTA 3TC9A 3H6JA 5TDOB 4LP5A 1MHEA 2X9XA 3RA7L 3HCVA 3UJIH 4AL8H 2G75B 4UILL 2DQHL 3LKOA 4MJ2A 2VERN 3CPLB 3JSSA 4L9LA 5T3XL 2L4OA 2DQGH 4PRIE 3OJ2C 2A6DA 5I1KH 1OAYH 1KCSH 1KUMA 3MLYL 2VLKD 2QQLL 2IWGA 1FRGL 1HHHB 5CEXA 1RIVL 3BD5A 4LRIC 4ZYKA 4WV1A 4MA1C 4HC1A 1EHNA 3E3QC 3ZE2F 4ZS7L 1WZ1L 1OARL 1NAMH 1EEUA 3Q5OA 2X10A 1INDH 2PO6B 4O4YL 3ME0A 3X14A 2IAMB 4XBPA 3FRPA 3FFCA 2E7BA 3WL9A 3DLQR 1Q0YL 3SDXF 4H0HB 4LIQH 4M62H 4TNWK 2XZZA 3CX5K 3V7MA 5ICZB 1KGCE 3BGMA 4APQC 4W70A 5DDHA 3HC0A 3NABL 3QDHA 2PN5A 3TNNB 5DMJB 4GW5B 2YS4A 3IDIA 5HHPB 1KJ2B 3SGJC 3LS4L 4K3EH 2YK1L 1AHWC 4OUOA 3MBEC 3MV11 3IFOB 5C9KA 2ICEB 5I74C 2G2RA 3DARA 3WV0A 5JMRA 4OLEA 5DJ8A 1J5OH 4HAFA 1MI5B 4KQ3H 1MJJA 2YPLE 4Q9BA 4JFED 1IM9D 1CYGA 1Z3GH 1NBVH 1QA9A 2AK4A 4C54A 3KPRA 3MV01 4I48B 4Z7OE 5E2WH 2CJUH 2P46B 5I8EB 2RCSL 3IGAB 3LRGA 1N59B 3RWIB 4HUUB 4UMGA 4XPAH 3TV3H 4Q9RL 3NMEA 1L9NA 1FV1A 4PRID 3MRNB 4JFQB 3MV9A 5HHQA 1Q94B 3SJVB 4L4TE 2ICWJ 1ZE3C 3ETBF 4X7EC 2QR0A 3VXNB 4HX1B 4WTWA 4JFFB 3GSWA 4G8EA 3JUZA 1N7MH 4OM1H 2B5IC 4YR6B 4M8QB 1U42A 5GSVA 2C26A 2EICA 2XZAH 2EZ0C 3F6IA 3K3QA 4LASH 3QO0A 2LV4A 1CE6B 4ONOA 4JVPA 5JA8B 2XT1B 5DJDA 4G9FE 3TH3T 1E4XI 1N3NB 5CSGA 2WM0A 1G7HA 4E5XA 1UWXK 4HK3J 5GRWA 5C08A 5I2IB 5C0FA 3RWCB 4P5TD 1KGCD 1V3LA 4LSTH 3C09B 2VUYA 1TMCB 4G6AC 1BPVA 1CFBA 1HILA 2EIEA 3MGOB 12E8H 1S7WB 2DQDH 1WLHA 2BY0A 4ODUB 3FT3A 3P9LA 3WJJA 1XGUB 2E6JA 2ZNXA 4PJHB 4IRSC 3VGAC 2J5LB 3AS0A 2WBJB 2YPLD 3M45A 5J1TC 5JIKA 1HHIB 4X6CA 1P7QB 2IG2H 2W0PA 5BOPA 4XRCA 3ULUF 4PJ8B 4HK3N 3D0VA 1MCLA 3X17A 1KF9B 4FN0A 4J4PC 4WU7A 2W0FA 4JCMA 5IMKB 3HAEG 4WUKH 3VMNA 5DEGB 4DVBA 1XCQA 4L4TD 2NY0C 3DUSA 3GSUB 3OR6B 1JWSA 1QZ1A 3KDMB 1NUFA 4XC1L 2E7LA 2WSKA 3KYNA 3LZFL 1KB5L 1AKJB 4LCWE 1RJCA 1A6UL 4G7YH 4YHNB 1PVHA 4BA8A 4R3SA 1HDMA 1S78D 4N9GB 2AV7A 4GRWE 1YC8A 3IJHA 4U1LB 1ZGLP 3CFKB 4AENB 2HVJB 1CICB 5ESQB 1IAOB 5TE4L 4S10A 2HA1A 2LAAA 1FNSH 2ZG1A 3GBNH 2VDOL 4L29A 4G9FD 4KMTL 1I3GH 1M7XA 3WXWH 3HCVB 1KJ2L 1ZOXA 3VXME 5KANG 4GAFB 4G80B 5E8DL 1KN4H 4Q6IC 3STLA 4N0FB 4ZDHA 1YEKL 4QF1A 3VD3A 1P4BH 4JG0H 2YPVH 4Z0BH 3VWKB 3T1FA 4L9DA 1KXVC 4WV1B 2X4RA 2JJTC 4NN5B 3O6FD 5I30L 4QWWC 5LXGL 1B4JH 1MCEA 3U7AA 1LD9A 3U0WL 4ZS6D 3PV6A 2XYCA 1MY7A 1VFMA 1FVCB 2ATPB 3D39A 5GS0H 3ULVL 4XBPB 1U8PB 2A9NH 3B6SA 2EDKA 3FFCB 4GSDL 4LPVA 4YGAB 1U8OA 3WL9B 1T1XB 4F7EA 3FO9A 2MQ3A 4RIRB 4NWTH 5KSBA 1EDQA 1BECA 2H1PH 3BGMB 1U8LA 4XPFH 5DDHB 1UVQA 3MV8E 5DD5H 1IKFH 1DEEB 5TF1L 4AIXA 4PLKD 5T3ZL 4X6EA 2X5PA 1KACB 1JCKA 1VPOH 5IUSA 3EYUL 4LCWD 1OAQH 1JHTB 3BQUC 3JVGA 1HXMB 1JPTL 4ZSOA 5EU4B 4LVHC 2GAZB 4PY8J 5KS9A 5GZND 5D8JL 1LO0H 1RZ7H 1S5IH 2AGJL 3DO3A 2OMNA 2VXSH 4PGEA 4KDTA 3FRUB 3ARSA 4UI2A 2AK4B 4ERSH 4X9HA 3GMNB 1V3KA 5IESH 1I1CA 3UAJD 32C2A 2C3WA 4WW1B 3NCFB 2B2XH 2CSPA 1CG9A 2R39A 3VXMD 1I8LA 3J7HA 3L5JA 5JOEA 5E08H 4HIIB 2QBWA 3NAAH 2E7HA 2I26N 5KSUA 3L5XH 5GGQL 5DQDH 4PV8A 3VXUB 1PSKL 3R8QA 4P2QE 3FB5B 4XP9L 5KSAC 2J8OA 5H35A 4GXUM 2DL9A 2QR0B 5K9JH 4PJBA 1FZKA 1QSEA 2R29L 2CIKA 2B0SL 3QUXC 3CDFA 2E8YA 2P8PB 4P23B 1AJ7H 5JLZB 3K8KA 1C16A 4I3RH 4YIQB 3BFOA 2PYFA 2Y06H 5IB2A 4M4RA 5INCA 1KG0A 3DVGA 4LHUB 3KAAA 4MJIB 3U82B 3E6FB 4QXGL 1RIUL 5IW1B 4BQCA 4FTVA 4OJFH 3V5KB 1IC7L 2JB6B 1MFCL 3C5SA 1DN0A 1G0DA 1I85A 3X12B 1NCDL 3MV8D 3HNTH 1A9EA 3FONA 1KC5H 1YPZF 2XA8L 3RX8A 4FQ2L 5I17A 3F65A 1WSST 5TQ0L 4NQCE 4JO4H 1JTTA 5IHUL 1BVKB 1JHKL 5EBLA 3RKPA 4WY7H 2DICA 4M93B 1A1OA 2ZPKL 3PHSA 2ID5A 1KCUH 1RUML 5TPWL 1G6RA 4HZLB 4NQTA 3KYMA 4KHXL 1FVEA 3MRHB 2P5EA 4M7JH 1EAPA 3BP4A 3EOTH 2IPTL 1YEFH 1ZT7A 2YUXA 1OTUD 1MSPA 2JJSA 1GPOH 2VZ1A 4UDUA 3VA6A 2CMRH 2W0FB 3BN3B 1AGFB 3VG9C 3UAJC 3RWDA 1OCWL 1A7RH 2Z31A 3VRLE 1YY9D 1BEYL 1DSFL 1QFWL 4CN4A 1QP1A 4Z0XA 1XCQB 4YEFA 4P2QD 3C6SA 4CW1A 4YNYB 2ARWA 1AFVL 3CUPB 3VU2A 1HYSC 2JJWA 3MTRA 1WFTA 4NM8H 5EU6E 3ZKXB 3KYOB 4OM0L 2W07A 1TJIH 3RGVC 4LCCC 5EU5B 2M1KA 2AV7B 1YJDH 2ZUYA 3IJHB 2AV1A 3HC4H 4X6BA 5IEHA 4HQQL 1NCTA 1KTDA 2GY5A 1T03L 1WBXB 4RBPK 1P6AB 5FUCC 4EDXA 2Q7YA 1RK1A 1HQRA 4Y5YC 1VGEH 5DMIL 4TRPL 1MRCH 3RI5K 1N8ZB 5GS1B 1HSAB 1MUJA 2BERA 5L8KB 3BRFA 2DQTH 4HGKC 1A9BA 1M7DB 3MJ6A 4X7SL 1C08A 1G7PA 5E8OA 4ELMF 3ISWA 4NQCD 4LP4A 4EI5D 2BNUB 2BMKA 1INEH 4F58L 1UM5H 4BH7B 3DWTA 4NDMA 3T1FB 1GC1L 4Z7WF 4A6YL 4NO0D 1G9MC 3O3EA 2VXVH 4IIQB 3BSZL 3SDAD 4QCIA 3VD7A 4OIIH 3SE9H 2UWEF 2NQCA 3PV6B 3B9VA 3D39B 4GO6B 1EEYA 1EMTH 3X11A 4MS8C 1JRHL 1OY3B 3B6SB 1U8OB 2MNUA 3SO3C 4F7EB 4JHAH 3I84A 4R9HA 4PGZA 1U6AL 3SGEH 2NY6B 5E94B 4LGPB 5F7YC 4BQBA 3LS5L 1K8IB 1XIWD 1UVQB 3V6OA 4MDJA 2GTWA 5HDBF 2VL5A 4Z7VE 2ZUVA 1HKLH 2VLME 4X6EB 4Q9QL 4Z7UE 1A02N 1A1NA 5DGQA 2H32A 5EU6D 1AI1H 2VDLL 5IBUB 4HJGA 2YMXL 4CN1A 1OGAA 1C1EH 3D0LA 4WWKB 4MA3B 5CIPA 3WLWD 2A38A 3IXTA 4EQ2A 1G7JB 3IJYA 1MJ8L 3O9WC 3V6BR 1VADA 4JFFE 1T5WA 4WJ5A 5TJWK 3EJZD 4OF5A 3A67L 1MH5A 3QDGE 4UZGA 3PDDA 3PWLB 1V3MA 3AY4A 5T33L 3FTGA 1RZKC 4HXAL 4H20L 1JPST 4M7KL 4M5YH 3EYVB 3GSNH 4PBXA 4FABL 5I16A 1MLCA 2ADGA 3M07A 3HMXA 5HGDA 2P4AB 1JTOA 2K7QA 4PV8B 4PIRF 1HNFA 1EUUA 4XP4L 3UPCA 2C3GA 5H35B 1GHFL 1RHHB 1ZANL 1DQMH 1QSEB 4H8WL 2CIKB 3T4AA 4EI5C 4M4PA 5DR5L 1DQDH 2OSLB 5J7CC 1RPQA 4G8IA 3I50H 1S3KL 1PLGL 4NYLA 4X7TB 2PYFB 3OPZH 4JEGB 3H42L 3KNBA 4MVBD 1KG0B 1I8MB 5I1IH 3M8OH 3THML 2K7PA 1AIFB 1CDIA 4IJ3C 1NGPL 1OAXL 3LEXA 3V52L 2Q1EA 2DJUA 1JF1B 2ZSVA 4FTVB 4KTEH 4KPHH 2ZJSH 4WUUE 3FO1A 2EE6A 1DN0B 4XVSH 3CSYA 1JNHB 1RAMA 3U48A 2VLMD 4OKVA 4HJJL 2VDMH 1IGML 2AXJA 3VG0H 4O9HH 1K3IA 1OTTC 5IB4A 1ZS8A 3KG5A 3O3BA 3H7BB 5EN2A 4I4WB 5DJ6A 5EBLB 4N5UA 2KH2B 4P2OA 4EN3A 2ESVA 2VLRE 1NL0H 4V2BA 1ZGLA 3OGOE 4NQDE 4BQ9A 3RY6A 1JGDA 4JFFD 1EXUB 1FVEB 2P5EB 3QDGD 1EAPB 3S97C 4URTB 4KDVA 3V4PH 4YHYC 1CU4H 3RP1A 1VA9A 4UDUB 2DQJL 1TLKA 2UYLB 2FD6L 5L9DH 3S5LB 1RU9H 3RWDB 4JO3L 2NW3B 1YNTA 1J11A 4K3DL 5J12C 5EBGA 3EJYD 3N1PC 3BT2H 2EEBA 4U1KA 4Y5VC 2ED8A 2GW5A 3RVUD 4ZAKC 2Q86A 4XNQB 3EDEA 2R4RL 3ZKNC 5B4MD 3UTZA 3C2SA 4BUHA 1KTDB 1AD0A 1IC5H 1QFUL 5DRXA 5EIQA 2PW1A 1RK1B 2Q7YB 3AMLA 4G8GB 3MYJB 3IETB 3SDDB 4NBXB 1PD6A 1A6AA 1O0VA 2D4DA 3TPKA 4WUUD 4YHOL 1NEZG 1RZJL 3PP3K 1BD2A 2O5ZL 1HZHH 2HYMA 4QXUH 3S98A 4ZFFA 2ITCA 5F3BB 2DRUA 4QGTA 4HD9A 1I3UA 1OLZA 3AM8C 1N5AA 5TE7H