5CD5C

Crystal structure of an immature vrc01-class antibody drvia7 from a chinese donor bound to clade a/e hiv-1 gp120 core
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
220
structure length
220
Chain Sequence
QVQLVESGTQFRRPGASVRLSCEASGYTFISSFIHWIRQGPGQGLEWMGWMNPRHGAVNYPRRFQGKVTMTRDTSIDTAYMELRDLRSDDTAMYFCVTSRTKDYDWDFVWGQGTLVVVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Key gp120 Glycans Pose Roadblocks to the Rapid Development of VRC01-Class Antibodies in an HIV-1-Infected Chinese Donor.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
molecule keywords 93TH057 HIV-1 gp120 core
total genus 36
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2015-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cd5C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cd5C01
4PRPA 3MJ7B 2OZ4H 1AQKH 4MNGB 4M1DL 2YRPA 2H32A 3QO0A 2VSCA 1MVUA 5DRNA 3O41B 5HD8C 1IFHH 3T2PA 2N4IA 2P8PA 2V6HA 3DRTA 4LBEA 5BO1L 4DGVL 3DVNA 5E99H 2I9LB 1X9QA 3BDYH 4YEEA 1OAKH 5FO8B 1AGEB 4ZAKC 3C6LA 3TP4A 1MJ7H 3FB6A 3V0WL 2XA3A 3LQAL 4JPVH 1JZ5A 1MCWM 3LQAC 2J8UE 3ET9F 1XIWC 5SX5H 3KLHC 3VFPB 2Y36H 4MQTB 2HAZA 3HA0A 4XRCB 5M95B 1JPFA 4ENED 4FTVD 5FV1L 5FYJL 4PJAB 3ZYZA 2NY3D 3D0VB 5SX4H 1BF2A 3QCTH 3Q1SH 5DDHB 3VMOA 4JAMB 3GIZH 5EU6E 1IAIH 2R56L 4KXZI 5CZKA 1UM6H 1JPSH 4I3SL 1UT9A 3KPQB 3MZTA 3QDGB 2QQNH 4KVCH 4BFBD 1MCRA 5F7KC 2NXZD 3B6SA 5JLZB 3BE1H 3UTSE 4XB7A 1VFUA 4EOWL 5BS0E 4M3JA 1V7MH 2UYLA 3G04B 3SCMD 1BF8A 4NQDE 3HZMA 4XNQB 3CVIL 5IOPA 3BP7A 4OGYH 1MCKA 5T5FL 1NFKA 2GK2A 2ESVA 4CVZB 5DJDB 5EOCJ 4L4VB 4Y88A 3W0WB 3GUTB 1IM9D 1OPGH 2FWOB 5HGHA 3RWJB 3U2SB 2DLTA 4NZRH 2P8LB 1U2CA 5EUKB 4ODSH 4PJ9A 4JFHD 3E2HB 3D0LA 4XP4H 4CRPA 4UT7L 5I66B 2V9QA 2MTPA 3CFCH 3I6GB 1PJ9A 3GMPB 1TDQA 3QEQA 3QAZB 1TJIH 1ND0A 3MCLH 4MXQD 3VU2A 1UENA 2HWZH 3L3KA 5TH2A 3RIFF 4CVXA 1VB9A 3O6LH 3U0TA 1F6AA 4JGJA 3QFJE 3AMLA 4LHUD 3LKNB 4IJ3B 4ZS7H 1RIUH 5F8RC 5LAXB 4FQJH 1LHZA 5D1QD 3UMTA 1LE5B 1KCKA 3VGEA 1NMAL 2OJEA 3SDDD 1O7VA 2CJUL 1LK3L 1AQKL 4L3EA 3TVMA 4XMKL 2MQCA 1AGFB 4QRRB 2CMRL 3TZVC 1I1YA 1P5UA 5I1HL 5KN5A 3D85B 1AP2B 4IHOA 4JPWH 3BDYL 4Y19B 1DUZB 4F7EB 4NN6C 4HW6A 3OV6A 3LCYA 3MSPA 4RZCA 3O3DB 4XWOC 1ZSDB 4TNWK 1O5DT 1MJUH 3DURB 2CLRA 5EU7E 1UZ6F 4OGXL 1I1YB 4DFIA 43CAA 4F7TA 1QEWA 4EN3C 4YAQA 1JIBA 1LE5A 4JFFD 5D2NE 1U93B 2BJMH 3VXME 4TULL 4G42B 5IT2L 3S8WA 3QHFH 3SDCC 4C56D 3RDTD 4OI9A 3FO9A 4LQFL 4OLXH 2B5IB 4P0DA 2YSSA 3R8QA 4N8VG 1MELA 1MLCB 4F9PC 1W8NA 1VFAA 5ICYB 1LDPH 4P3DA 2ENSA 3W0WE 1ND0B 4UIMA 2J6EH 1YJDL 3O8XA 4F9LC 5I6XB 4K7FB 4TTGA 4DKFH 2HLAA 3VRLF 3OKNB 1WVZA 3BRGC 5EIQA 2ILLA 2ITCB 3BFOA 1CLZL 4G6KH 3FTGB 3EYUL 4NO0B 2G60H 5H35B 2VXQL 4KI5E 1KJ2H 5EU7C 3HPJB 4KRNA 2JB5L 3S88L 4NHCL 4MAYB 5JZ7D 3BKJL 4KPHH 3O11A 5ELIA 5FKPB 3BGAA 5E4EB 4EUPA 2OJZL 3L1OH 1WBZB 2PR4L 4M62L 3MBXH 4XVSL 4WFFD 3D87B 3ARTA 1A2YA 3TGXA 4QCIB 3PHQB 3FFCD 4YJZL 2R29H 3AS0A 3FT3B 3TYGL 2C3XA 5C6TH 1IZKA 5EBMA 3V52L 4LEOA 1HDMA 3DSFL 4YX2H 1U2HA 4WEBL 3C8DA 2V7HB 4YXHL 2UVFA 2FL5A 4BQ8A 1G9MH 3GJFA 3MV9E 2F53B 4MNQB 5D6DA 5C0BE 4A6YA 4LIQL 3PGDB 4BYHA 3FQRA 1N3NB 3BKYH 2H6PA 4YFDB 3WUZA 4TQEL 1WITA 2G5BB 3V5KB 3BPLB 1DQTA 3OKLA 4MX7A 3G9VA 3SQOH 1NJ9B 3H6JA 5DRNB 5IFAH 3FQRB 5SWQB 4EQ3A 1RJLB 3GJFB 5ITBL 1ZA6B 1P69B 3OX8A 1NCBH 1HDMB 1XCQB 4U49A 1OP5K 3PXHA 4O58L 4CN1A 4K3EL 4MVBC 5HHVL 3O3EB 1FVEB 4JE4B 4UTBL 4G3YH 5J4MA 3UEZA 3MLWH 5J12C 1KB5L 4JFXB 4KK8D 4TUOB 3O9WC 3WXWH 1BREA 3BOVA 3X3GH 4RISL 4N8PA 1TITA 3OKMB 4MJ5A 1ZS8A 1AGDB 2XZAH 3RWEB 2EEBA 2NY4D 1IC5L 2O5XL 1MCIA 3WFEL 4FQCL 4UB0L 3F6LA 1MFEH 5GSVB 4P5TA 3OHXA 1EXUA 2VXQH 4OCXH 3WFBL 5DFVD 5A3IC 4I18B 1SJXA 2B2XH 3UJJH 2DKUA 2P48B 4IIQA 4KMQA 1B6DA 2AJSL 4LU5L 1OGAB 2AXGB 2NXYB 2VC2H 3S97C 5ID0A 5KSAC 3AREA 1CU4H 3V5HB 1I9IH 5KSVB 1FAIH 3LDBB 2LAAA 3QXAA 32C2B 2VWEC 4Z7VB 2QQLH 5IB5B 3QNZA 3VXSA 3BW9B 2JK5B 3G9AB 3GSXA 2RR3A 3WS6A 1J0YA 2AJZA 1TIUA 4GOSA 2AJUL 5JW4Q 4YDIH 1ROWA 1SMOA 1AGBB 1FGNL 2HYMA 4DGIL 4O4YL 4WEBH 1BHGA 5I6XC 3ZKXC 4HKXA 1A14H 5LGJB 4HHAB 4YDLB 2JCCF 5CBAA 1RI8A 4APQA 1JMXA 1CLCA 2YHGA 3RWHB 3RVWD 4KUZH 1LO5B 1MFDL 1T21B 2R9HD 3PF2A 2F15A 3VCLA 1HSAB 3DURA 5L88H 2DQIL 1T04B 2PTTA 2BC4B 2XTJE 1T22B 1DUZA 4KJPD 2ZCHL 1U8MA 1IQWL 1HWHB 4HGMA 2F53E 3S3PA 1MCCA 4MZ2A 5DO2C 5KN5B 4L3CA 4EVNA 1DQQB 5ITBH 3BH9B 2WLYA 3A6OA 3C2SA 4HUKB 4U1GC 4GQ9L 5GS2D 4PRNA 2IEPA 3IU3B 3SO5A 1LO4H 3BQUA 5F21B 2Q3ZA 1SY6L 2JB6A 4KAQL 4OZHF 2P5WE 3B9VA 3MMEA 1HK6A 4LCCC 3AS3A 5JMRA 3CAFA 5DK2B 4P5MB 3Q3GA 2M8XA 2BMKA 1TVBA 3U9PL 5TH2B 3OKDA 3J8F7 3HE6C 3AFLA 4Q9CA 3NCFB 2BNRD 1U8LA 3AU1B 5ADPH 4PBXA 1RFDH 4YXLL 2AV1B 3FQXA 1DQDL 1FPTL 4X5WB 3VXUA 3EYVA 5DJZB 5DQ9B 1NL0H 2FO4B 3O4LA 1JE6A 3DX8A 1EEZA 3CXHJ 4PJ9B 4TVSa 2DAVA 4JZOB 3FOLA 1VGEL 4Z8FH 2A6DB 1G7LB 4BZ1H 5CKGA 3FB8A 4HQQH 5FUZL 4LPWA 2EKSB 3QIBA 5IJKA 3HMWH 1G7JA 1MCOL 4ZUSA 1RIHH 5I30H 4DTGL 3P9MB 3OWEA 1XFPA 2E27L 1I7TB 2CXKA 4X6FB 3INUL 1B0RB 3MLZH 5D1QC 3ARQA 2XN9D 3UBXB 3KWWA 2VISB 3U0WH 1ACZA 4PJCF 5J57B 3L3HB 1BFOB 1K4DB 4WCYL 1KLGB 4XPHH 2YN5A 5I15L 4PV9B 5D71L 5EG6C 1A7RH 5E4IA 1NMCC 3W11C 2YD8A 3VXRE 3WNNA 5E2UL 5IK3B 3VGAC 5D1ZC 4D9LL 5L0QB 1ZGLM 3SE9H 3TNMB 3PE9A 3O3UN 1U42A 1YMME 4G6MH 3TN0C 4X5XA 4LCYB 3QUMH 2WMPA 5IMKA 1VA9A 1A6TA 2LE9A 1RUKH 1YNLL 2K7QA 4X8JB 3NPSC 1OAKL 4G8IB 3MRJA 4Y2DD 4O5LL 4M48L 3SN6N 1H5BA 1DBKH 4WTZG 5CCKL 5TE4H 4FQIL 1YA5A 3WSQL 1FFPB 3O9WB 4ODXA 2DQDH 1KJ3H 1YMMD 3ZE0F 2IC2A 2JB6B 3T4AA 5J12B 1HEZA 3N06B 3P3YA 3L7FA 4R4FH 3QEGL 1CFNB 1Y6KR 3K4AA 3UC0L 4NQDB 4OZ4B 1EHAA 4DCQB 4X9BA 4GMSH 2ZUWA 5H35A 3BHBA 3F5WB 1MCJA 1U8MB 1YY8A 4OAWB 4LMQI 2NW2B 5SV4A 3K7UA 4QRTA 1NAMH 1NC4B 2IWGA 5AEAA 1LO2H 4IDJH 2I5YH 5J13B 4G7YL 1NL0L 4YHNB 1KNOB 3T77B 3U4EA 4Y1AB 3U30B 5E2VL 3X13B 3TWCL 3QXDA 4WVRA 3D9AL 5T1KB 2GFBB 3IJYA 5J8OA 3MUHL 3NCBB 1JGDA 2R39A 5MHSE 4WV1B 4PJAE 4W4OC 4TNWF 4MQXD 4XI5C 2CR3A 1MRDL 1P7QB 3UPRB 4RMTA 2EXWC 2UWEE 3UBXG 3IFLL 3E3QE 5DJYB 1MI5E 5F9OH 5FUOH 3SGKA 4XCEA 5C6TL 4PJEA 5CIPH 1CT8B 1RVFH 3AXLA 1AD0B 5D6CB 1TFHA 2AK4A 5E1HB 2R0WH 1CFSB 1FLRL 3H9YA 4OF0A 3SCMB 4KK5C 2GEEA 1Z3GL 1MLBA 5FYLD 5ESQB 2A6IB 4KKBD 1QO3A 2X42A 3G5XA 4NNPL 2X44D 1L7IH 1NSNH 1WTGT 4HK3J 5E2UH 1AIFA 1DR9A 1HHHA 4QO1A 1EAPB 4MXVE 4R97B 2DTSA 3ZKQD 5B39A 4Q9RL 3WIHH 3ZTJG 2ZSWA 2OL3B 3WFCL 5IVZA 4U33A 4QRRA 1A6AB 2HRLA 5CEZH 3CMGA 4JRXD 5INCB 1TCRB 3PWNA 1A6VH 5L2KE 3KJ4B 4EXKA 1RZ7L 3EOBB 4PJ7F 2FH6A 4LCUB 2R1XA 3O8XC 4Q74A 3TBSB 4F9LA 4XXDA 3I2CL 1MAML 4QNPE 1QFWI 1U8JA 5GGSB 3NH7L 5TQ0L 5BRZE 3BMVA 3W39B 4L9DA 1FIGL 4JM2A 3DX7B 1T1XB 5FGSA 3PWVA 3MLWL 1YNKL 4PY7B 3EOBA 3C60C 1JHKH 4QT5A 4PBVC 2VLRB 4X4MA 1DL7H 1XF4A 4RISH 3KHOA 3UO1L 4LFHG 5HHOE 2VLRD 4QXGH 1G9NC 4P9ML 3FO1B 4ZO9A 4UQ2B 1VCAA 3FCTB 4U1HB 2X9YA 1JUFA 1AIFB 3HE7C 4MX7B 4PJ9C 5T1MA 1FFOB 3E3QC 4C58B 2OQJB 2X1OA 4M1GL 4D9QE 1PQZB 3W5NA 2VSDA 2NY6D 2O5ZH 5DC4B 5GRVK 1VEOA 5D7JC 1LDSA 3BPNC 5HHNA 4LARH 4HV8B 5I1KH 1S8DA 4QY8A 3I9GL 3KLAA 4JG0L 4M6NH 1EHLL 2AJSH 4LU5H 4NKOB 1CGWA 1JNLH 4KKLC 4LASH 4HAFA 3O0RH 1CLZH 5MEPA 1UCBL 2IH3B 3G6AA 1C12B 2APVA 1SY6A 2XN9A 5H2BA 5ILTL 1ZHLB 4CU8A 4P2CG 1M71B 5D1ZD 4YNYB 3S88H 3TCLB 3DUUB 2XIDA 4TN9A 4LCWA 4ZUTA 4WFEE 4NCDA 4HPOL 1ZOXA 5EO0A 5GHWL 5JMOC 4R4ND 3KPOA 4RFOL 4PB9L 4GXUM 1JRHH 2ZNWA 2BNQB 5T3ZH 3P4LA 3P4NA 5FCUH 3NAAL 3O45A 2IGFH 1V05A 1AI1L 1FDLL 1FIEA 3ORJA 4QXUH 4U0QB 4HKJB 1X4ZA 3SJVD 4OAWA 4JFDB 1MCDA 2FYYB 4NO0A 4YDKH 2VLLA 3TN0B 2BXYA 1VGKA 3WIHL 3DRTB 4JREB 4F7MA 3ZE2F 3MCKB 4HXBH 3RY6A 5EO9B 4ZFZA 5HYFA 4H8WL 5GZND 5CGYC 3PQYE 3GSOA 1YC8A 1QFWH 2BFVH 3CH1A 3RVTC 1CFNA 3ULVE 1BFVH 1N8ZB 2JTDA 4X6BB 4LVNC 5E0QA 2WBJC 2KQMA 5D7LA 4C83B 4CUCA 4YHYB 5MP6L 3MNZB 4Y16D 4KROD 4WO4C 2JELL 1YC7A 4PJFA 1MFBL 2HJLA 4RRPG 4PR5B 5IMLA 3SDAA 5ANMB 2I60H 5GRJH 5LVEA 2HJFA 1NCWL 2XWTA 5EA0H 1NGPL 3QUYB 4KXZH 5HVGB 1KT2A 2IAMD 1HINL 3H9SB 4MD4B 4Y19D 1JHKL 5IMOB 2VNCA 3ARZA 4HUWB 3MJ9A 1BBJB 4AEFA 5DYOA 3T3PF 4YR6B 5GIRB 5DTFA 4U05A 1D5ZB 1H0DB 3U79A 3V0VB 3BP5A 3EYSH 5KW9H 2HT4C 1NGWA 1I8IA 2PKDA 2NY5L 5FHBH 5E6ZA 1I8KB 4Z77B 3GEWB 3I3DA 1HHHB 3WYRA 2XY1A 1FZJA 5ISZB 4WHTB 5GJTL 1VFOA 1YMMA 3S4SA 5L2KA 4NQXA 5HI4D 1NAMA 5JO5A 1S3KH 3UBXA 4FXGA 1P9MA 3IDNA 1P7HL 2WV3A 4RFEA 2P5ED 1D3CA 2OMBA 2I9TB 2BSSA 1BBDH 5EU3A 1BVLB 3RI5K 4M8QA 3R06B 5EBLB 5EOQH 1MQKL 4HBQA 5LAXA 1OSZA 3QIUA 3MRPA 3FRUA 5C09E 5C70A 1GZQA 1FNEB 3I75B 3GI9L 1DDHB 3GRWA 4NYLA 5I74C 4F15B 3HRPA 1KG0A 1Y18A 3NIDF 3WE6B 2GSIB 1P84J 4JRYA 1C5BL 3RHWF 3MLRL 1AO7B 4R2GC 1A8JH 4DUXA 3BPLC 2VLKE 5FIEA 2A2QT 4LQ1A 3FQXB 3IKCB 1XGRB 3VXRA 3BH8A 4NT6B 2YS4A 1YYLH 1YEHH 2EEDA 2LTQC 1IAOB 5KS9A 1QSEA 3EFFB 1DQLL 4AG4H 4QYOA 5H94A 2FWOA 1EMTL 4OLEA 4Y4KD 1UJ3A 1Q1JL 2EZ0D 4OB5L 1TJHH 4WW2F 4GXVL 2W1NA 2EDTA 4BH8B 2BCKB 1HWGB 2GJ6B 3NCJH 4OZGB 1J1XH 4TPRL 4JFHE 4D0BB 1H3XA 3JWOH 4PPTA 2ED9A 3Q1SL 3PWJB 3ZKXB 1I4FB 5CEYA 4OM1L 3DJ9A 5EZIL 3X3FH 5HY9A 4M7KH 3KAAA 4POZC 5TDOA 4XNXH 1SJHB 2DICA 2Z93B 3P30H 4K9EC 4JO3L 2G5RA 1CTNA 4NQVA 1F11A 1JGLH 5E6YA 1HHJA 4YZFE 5J3HC 3RAJH 4ZNEE 5HDBF 3LRSA 3B5HA 1JPST 3GSWB 4GW1A 4NUJB 3SCMC 3O6FA 3GMNB 5HYSB 1TQCB 3P40A 3AVEA 1DEEA 1XCTB 4H25B 1XGQB 2R2BB 4M9PA 3CPLA 1AQDA 3NIFE 1QSEB 3EFFA 3TZVA 2XWJA 4LSSH 1UKTA 3FONB 4HIXH 4KAQH 4B0MM 2CDFB 2NY1C 5HVHB 5B3NA 4LCYA 4M7LT 4P5KA 4UV4L 2ITDB 1FL6B 4Z78B 3QDMA 4DN3L 5CBAB 3Q48A 1BJ1H 3RWFB 4KKNA 1UFUA 5E5MB 2C3VB 3VFTA 3X11B 3WLBB 1URLA 1D5IL 2Z0BA 4DQOH 2FX7L 3W2DL 5I8KH 2ADJB 3RA7L 1DLFL 3T04D 3R06A 3LKRA 4NNYB 1K8IA 5EBLA 3OL2A 1U3YA 3WIIH 2L0DA 1T3FB 3RFZC 5I1GH 3SDDB 2Q76A 4CN6A 3NVQA 3KWWB 1VGEH 4Z8FL 1OAUL 1BBDL 1G6RB 3MOQA 4S0TD 2B5IC 4YE4H 4DGYL 5GJSH 3D5OF 3FN0H 2AXGA 1JTTA 3LZFL 4X6FA 2NY2C 1X6NA 1H15A 1N59B 2XA8H 4MB4A 3TA3B 2NTFA 1CN4A 1A0QH 4NZJA 1IEAA 2HT3C 2NNAA 4LLDB 1J8HE 3GSQA 5HHXH 1G7PA 1ES0B 2IPTH 4MJ6A 4UV7L 5I1HH 4DWHA 5FECA 3HR6A 1AGCB 4AL8H 2NX5B 3FB7A 3CLFH 5EOTA 5H94B 1RJZA 1FNHA 3WHXB 3DROB 2Z92B 3TIDA 1D5ZA 1H0DA 3V0VA 2VLMD 3GJEB 4I0PC 4MD0B 5GS1C 3EYVB 3U7YH 5HI3C 3T4YA 1BIIA 1G0XA 1KEML 4P49A 1IGTA 3UTTA 4CNIB 3VWJA 1AO7E 4PRDA 4KWUA 5IMMA 4GG6B 2CDGA 3EO0B 2JCCE 5DD0L 3EO1B 1MUJB 3NN8B 4L4TD 4NM4H 2NR6C 1Z9MA 1IZJA 5D7LB 2NLJB 3QUYC 3DARA 1NMCB 4GAYB 3AS1A 1BVKB 2UWEB 3HC0B 3RAJL 3KPSA 1MEXH 3CH1B 1ZGLB 1BP3B 1MREL 3LD8B 4PFEA 4OF7A 4PJHA 1WICA 1DBKL 2IFGA 4YXKH 4L8CB 3D69B 3EUUA 2B0SH 4NRYB 4X4ME 1NUFA 5BQ7B 3OAYK 1A64A 4OD1L 4XCCL 2B8OT 1WWBX 1NCAL 1I3GH 3DXAD 4R4FL 2CKBB 3MODH 2G60L 5J0BA 4OIBA 2HTKD 2O5ZL 4POYA 2F53A 2VZUA 3IT8D 3BIKA 1WWWX 4NJ9L 5IBLD 4NJAH 1R5WA 2Z4QA 5SX5K 1J8HD 4OGYL 4M6OH 4DK3A 2VAAA 3F7YA 4OZFB 5FYJD 4UTAH 4LF3A 4DVBB 1P9MC 1KPUB 3SE3C 3C8KA 3OAYH 2IMMA 4OZHB 3T08A 2XKNB 3BAEL 5DJAB 5D7SH 4RCAA 5C0NC 1B2WH 2XWTB 6FABH 4M93B 5IW6A 3MRRB 4NQUA 4UZGA 4XMPH 1ETZB 2GITA 4JDZB 2X7LA 5IQ7L 1I7UB 1T7XA 2ZKHL 3B8YA 2XA8L 3IDXH 4PB9H 3Q6FA 3V95A 5E00A 1QBBA 4ISVA 5D7KE 4O9HL 43C9B 4HWBH 2IPTL 4M5YL 1N64H 4LPYA 5TE6H 4HIEA 2NW3A 1PQZA 1U58B 1B9ZA 4KRPC 3BIBX 1NBVL 3FCTA 5CP3A 1WUNT 2RHEA 2HKFL 2Y4SA 2VLLB 3OJDA 3TN0A 1SVCP 2ZG3A 4M43L 2ZG1A 1MHCA 4F8QA 5I17B 2ARJQ 3VGBA 5D70L 4WHYG 1S9YB 1NDGA 1FZKA 3WE6A 2YBRA 3JTSB 2ICWJ 4LLWA 1NGYA 2DJSA 2GUOB 5EUOF 2HMID 1ETZA 5ICYA 4PJIF 5FDYA 12E8L 1E0OB 5TDNA 2W9EH 1ZHNB 2FECL 1ZTXL 4W6XB 3SOBH 2W60A 1F97A 3T0ED 5B4MD 1VENA 1TQBC 3GKWH 4G8FA 3UXFA 1PSKL 2IANA 4JM2D 1PX3A 4HJJL 4K07A 2Z35A 1YECL 1RZ7H 5DUMH 3SKNA 1FO0L 1N5YH 2P5WD 1BJMA 5DD5L 1MAMH 1ZANH 4XP9L 1A1NB 1IGIL 2H41A 4WHTA 2AW2A 4F7EA 4R6UA 2HKHL 3RX5A 3MRDB 1JWMA 1IAIM 5EUOA 4M4PA 5DRWA 4ONHA 2PYED 2Z91A 1M05B 5HYJD 4DKFL 4CADB 4ODVH 1OB1B 2EYSA 4QRPB 4UOW0 3O6KL 1Q0XH 2AJVL 4L29B 2VDQL 4GS7C 1FJ1A 4I9WE 3UROR 4Q58C 4MNQA 4A6YB 3UTTE 4WWKD 3ISWA 1A1OB 2P44B 2EICA 1MUJA 2W07A 3NN8A 4OGZA 1MJJB 5EU6A 1RUPL 3SBWA 4JHAH 3VFMA 1OW0C 1OCWL 4DKEH 2X4TA 5L9DL 1J5OH 5CGTA 3LDBC 4OTXH 4JG0H 2VDNL 4QOKB 4LSVL 3A67H 2D0FA 2YPVL 1SJEA 4GJTB 1RD6A 2E3VA 4HGWA 3HS0B 4ZPVB 4M5YH 5AG9A 5E5RB 2OTWA 5LWYL 2D7NA 4H26A 3S37X 1DE4B 3CDYA 3HPJA 5J1SC 4KUZL 5EOTB 4Z5RA 5DGRA 4BSVB 5LKNA 4WGVB 4HBCH 4LKXB 2OTUB 4BUGA 1MIMH 4HKJA 4Y4KC 3PQYB 1NLBL 1YYMH 4L3ED 4K3GA 3UJTL 4RMSA 4ELMB 4WUKH 2R4SH 2RGSA 3SKJH 3VD4A 5HGGS 4KQ3H 3KPQA 2AK4B 1P2CA 3O6FD 4P3DB 3S34H 4XVTL 4X6DF 3MBEB 1T5XA 3P30L 3SY0A 2BNQD 2X4TB 3VFRB 2M1KA 3QUZC 1R3IH 4M3KB 4GW4B 4HKBB 2FR4A 1MF2H 5I9QB 3SJVE 5BS0A 4HUNB 2C3VA 4L3EE 5MI0B 4ZG1A 5MEPB 4FQLH 4EI5B 1UQSA 2VERN 5I2IA 3QDJA 1ACYH 2ZJSH 5D1XD 3KLAB 1F00I 3BESR 2UY6A 3NPSB 2Z8WC 2JIXA 3GMQA 4JR9L 3V8OA 1XT5A 4PS4H 1JCKA 4Z9KB 4AZ8A 1AP2A 4XWGL 1T2JA 4S2SA 1L9NA 2VITA 5C7XL 1KIPA 3BGMB 2Z93A 1D9KA 5IFJB 5HHQB 2IFFL 2YN3A 3QFJA 5ISZE 3EFDL 3QPQC 3CDGA 2A77L 3MV9D 3UZQA 1FYTB 4OLZL 4LOUC 3H3BC 1CICA 1IGML 2Q86A 4XX1G 2HTLC 3IB4A 4L4TE 4ZOEA 3HC4L 4WTWA 2EDHA 1MY5A 1YEDA 1KGCD 1QFUH 4BSJA 5I15H 3GMMB 5IKCB 3FOMA 4G7VL 1EBPA 4WJ5B 1EGJL 1NLDL 2E6QA 3BSZH 4Y4HC 1J8HA 3T65A 3T4YB 3LEYH 4PJDE 4Q6IA 2X89D 4N5EC 4ZSOA 3D0LB 2Y23A 3L5JA 4JRYB 1MVFA 3OJ2C 2A73B 5B39B 4ZODA 4HIJB 2DQTH 5DJ8B 5HI3D 4J23A 3HCVA 2H2PC 3MR9A 4O51B 2CR6A 3RIAK 2Z31A 4N9GA 2ZP0T 4MNHB 2V7NA 4U3HA 4XPFH 2VXSL 3UTQB 3I6LD 2I25N 3PP3K 4IM8A 4XVJH 5FGBC 2JJVA 1C5DA 3QG7L 1J7VR 5DD0H 5DVMA 1QFOA 4OFDA 3B4NA 2GITB 1ZHKB 4JDZA 1LWRA 1ZMYA 5HPMB 1ZWIB 2RJMA 4G9FE 3UCRA 5E24E 3QDGA 1G6RA 3C8HA 4U6XB 1I9JH 4NQCA 2V5YA 3LKQA 1QA9B 4Q2ZA 1YMMB 1RZJH 4JFPB 2A83A 2LVCA 1IKNC 3UTSA 1JZ2A 4G6AC 5DWUL 1GGIH 2IBGA 3QUMB 2F9BT 1W2KT 3QI9A 3VE0A 4HDIA 3X3FL 1CFBA 2VXVH 5GGQH 1ACYL 4X7TB 3MNVB 3RWHA 2HT4D 5A2LH 2P1YA 1EO5A 1AXIB 2ESVE 2X4SB 4XP4L 2ITDA 4ALAH 3BD5A 3MUGB 4QRTB 1J88A 4P2OB 4JFYA 8CGTA 4KK5D 1OGAD 2DQJL 5K9OB 2FGWL 4R7NB 3F5WA 1QLRA 5C0BB 4FFZL 5AD0A 5CLWA 4Y5VB 3BWAB 4RMRA 1I7RA 2O61B 4PJHB 2PYFA 4X7FC 2H2SC 4RBPH 2IPKA 3BPCA 5D7SL 2XPGB 1HKLH 3BISA 3FQTA 1P6AB 5GPRA 1DQMH 2EDDA 4XMPL 4P48A 1NMAH 3DWTA 1OGAA 2Y9RT 1D5IH 1I3UA 3BPOB 4RSVA 4B50A 5KVDL 3P2TA 3QAZC 4M61A 2XXCB 2ZSVA 1J0ZA 3GHEH 3S6CA 4Y5VA 3I6LE 5C0BA 5D4QA 4F7CB 3EJYC 4HWZB 5D1XC 4QWWD 2CLVB 4U6TA 4IOFD 1E4WH 3MGAA 3U7WH 2R9HC 4XBGB 4RNRB 1QSED 4IS6B 2Z92A 2O93L 2IH1A 3CU7A 5E2TH 5DI8A 1UXSB 4HGWB 1II4E 1J05A 2NMSA 1MRCL 4XH2A 3LD8C 4HDIB 5DA4A 1CG9B 4J3XA 2VZVA 1DVFB 3LEXA 5E2WH 4KDWA 3AUVA 3QHFL 4OCYL 3I75A 2F8VA 1PLGH 5FUCC 3ARDC 4L8SB 1TCMA 5D2NA 4NQCB 2YPLD 3CJJA 1A22B 3CX5K 1FH5H 4HF5L 2Z8SA 3GJFH 5TQ2H 1ZHKA 5GRVL 4Z7VA 1RIUL 1HYSD 3PGCB 2Q76B 1KEMH 2E6JA 3VFVA 4J3VA 3N85L 3OZ9L 3AREB 1LK3H 3P9LA 5GRXG 1LE9B 5DWUH 4PRID 3S4SB 5L2KB 3P0GB 3H42H 3E6HA 4X9HA 2QQNL 2FHCA 3MXVH 4HS6A 4KVCL 3IDYC 4PJ9D 3VXSE 2XICA 4X6DA 3BPNB 3EDFA 3FQWB 3IAPA 1MEXL 5MENB 2F54A 3VGHA 5BRZB 4P2OD 3RVXC 1X7QB 5EZLB 1AHWC 2EE6A 3VDBA 1JF1B 4UQ3A 5D2LB 1Q0XL 3ARBA 3NABL 1G6RL 1BFTA 4KJPC 1CQKA 1EX0A 1VEMA 5T5FH 1AR1D 2EO9A 4PYGA 3EOAA 1M7DB 3FQUA 5IKCA 3RBGA 5IJVB 2YKLL 1U41A 4Y4FA 3O6FB 4ZYKB 1EVTC 1UH2A 1EO8H 5D1QA 2Y06H 3DRQB 2VR5A 3JZ7A 4NJAL 3H9HB 4GBXA 2PW1A 1S7WB 2VDNH 1SM3H 3KXFD 3EYOA 3SDAC 3QFJB 2R2HA 3CSYB 5I71B 3CUPB 4C83A 1JF1A 4UQ3B 3W9EA 4PJ8D 1KIPB 4K71C 2WUCL 2J6EL 5DHVA 2E9IA 2OL3A 1HCVA 4W68A 3QIWD 3HFML 5D7LD 1UADC 3WO4C 4NN5C 3OAUL 3FTGA 4Y4HA 4KKAC 5IB3B 2W0KA 1G9NL 3NZHH 1DN0A 3PL6D 1UJ3B 1ZLSL 4HUMB 3VFWA 3QRGL 1HXMA 4MAYC 2V5RA 3V5KA 4R7DA 4JLRB 5DJ2A 2DQUL 3BI9X 3ZHDA 2O5YL 3TN0D 3S5LG 5CMAB 1LO3H 4XCYB 5ICZB 3V6FB 4LVHC 4EI6A 3D3VB 1UJ3C 2YUWA 3CIQA 1QVOB 2YPLE 2Q8AL 1PFCA 1CICD 4WUKL 2NZ9D 4Y4HD 1QRND 1T0MA 4KQ3L 2N7BA 4GKSA 1T0NA 2XNAA 4DOHB 5E08L 2ATPA 5I19H 5B3JF 1CR9H 5BS0B 3HLAA 3VRIA 1OAZH 2XYCA 5T1DH 3OKEA 1H3GA 5T5NF 2E7BA 4PRIE 4WWKB 3HG1D 5D70H 1P1ZA 1PZ5A 2N56A 5EU3B 3QNZB 3VXSB 3F12B 2GYSA 2IH3A 4PJGA 1CI5A 1FV1B 3ZDYE 2W9EL 2DOCA 3WJLC 5C0JB 1P53A 3QNYB 3OR7B 1S8DB 4I9WD 5HHNB 1W0VB 2A6JA 1ZLVH 3OQ3B 4X7SH 3VXUE 4ZAKD 4LIQH 1KEGL 5BRZD 4Y19A 3SKMA 1Z9LA 2VTFA 3LVEA 1YJDH 1LEIB 5IW3A 3OHXB 2CD0A 1Q94A 3KYAA 1JPTH 1JUFB 3QDAA 4YDJB 4OI7A 1LK2A 4JFQA 1KIQA 1HHKB 4W4OA 4PUBL 4NN6B 4FTVB 4BH7A 3ARVA 2W0PA 1EV2E 2NLJA 3CVHH 2F5AH 4JCLA 5B38A 1IGFH 3QH3B 5EC2B 1N2RA 1YQVL 1W8OA 2DWEA 4X5LA 3K4ZA 2RB8A 2LU7A 4XB8A 3NFNA 2XG5A 3S96B 4QRUA 1UH3A 3B9KB 2IQ9L 3WNLA 1XF2B 1I7ZA 4YBQC 4FQQA 5DO2D 4PJ7E 3MJ8A 1CD9B 1OP9A 1FJ1B 2PTVA 2CO7B 4BJLA 1QYGH 3GUTA 4OTXL 3FB7B 2CLRB 5C0DA 3E6HB 3S35H 1LEIA 1PX4A 4ZOBA 4YHLH 3QO1B 3P73A 2UV3A 3BN3B 4PLJC 4U1IB 4PJBA 3T0BA 4WHYH 3G5ZA 3FFCE 3GMRB 3PGDA 1KCRL 2X1XR 3QIUC 2VISA 3EJYD 4PGCA 3CCHB 3JV6B 2J4WL 3ZKNC 3GM0A 4FRWA 5F9AC 4IEFB 5C0BD 4G8FB 2XG4A 3B9EA 3QG6A 2XV6B 5T3XL 3L95B 4I77L 1YYML 1R6VA 5GGSY 3GNMH 2AK1L 2X6MA 4EDXA 3NIDE 1J0HA 4XH2B 4RQQA 4CVXB 3TO4A 5F3BA 1NGYB 1KXTB 2DDQH 4Y0GA 3KS0H 1G7HA 4EI6B 3KHQA 1H3UA 1WK0A 1CGVA 4X5WA 3GBML 2FSEB 4FQHB 4ERSH 3IF1A 1NGZA 5CILH 2R69L 5C0CB 4HUXB 3OKKA 4LSRH 3ZO0A 1KOAA 1ORQB 1DEEB 3HMXH 4OLUL 4UNVA 4L9LB 3REVB 1AY1H 5T33L 1JPGB 2J12B 1RZIA 3MX0A 3KYKH 4PJ8C 5F6HI 1IQWH 5ECJE 43C9A 1MFAH 1WWCA 3O4OC 1XR8A 3OG6B 4XBEL 3SPVB 1ITCA 3KXFA 3AC0A 3T4AB 5HHQA 3ZT7A 1PG7H 4NO2B 3SGJA 1VFAB 3H9HA 5HHOB 4GKNA 3KLHD 2QQKL 3WN5C 4MMXC 3V4UH 1OARL 1FHGA 4UNUA 1CL7L 1HIML 5J9PA 3D2UB 1EJOH 4FTVE 1S9VA 4MXQC 4X6EA 4L9LA 3ROLA 1I9IL 3BP6A 4IRJA 5DZNA 3ARFB 3LIZL 1M7DA 2N1KA 4LF3B 4QYOB 5C0CA 5KS9B 3TV3H 5J13C 5DGQA 1I9RH 2R0LL 3N9GH 1FVCB 4R9HA 3U4AA 4MQ7B 2NX5D 5CUSL 1IJ9A 3B3IA 4YDVA 2KUTA 3OXRA 5I2IB 2WBKA 2H9GA 2YUZA 5E5UB 1IQDB 3BO8A 1QBML 1BQSA 1S9WA 5KSBE 1R0AH 1F4XH 4GSDL 3FRPA 3EZJB 3DETD 4ZXBA 4LBEB 4HUUA 4ZFGL 5E2WL 1LE9A 3C60B 4O5LH 5IW1B 5JOPE 2X4QA 3GSXB 3MBEA 4IMLB 1QG3A 3VFVB 2VXUH 2CIKA 2BHYA 3QPXL 32C2A 3TFKC 3V6ZA 1FFQA 4WY7L 4XNUL 4K23L 4PJEB 3ESUF 2EKJA 4FXGB 4P46D 2F53D 1QQDA 4Z0BL 2AV7A 3I6KA 3EO0A 2EDKA 2W0LA 3PDOA 3UX9B 3KJ4C 5KG9B 5T5NG 1F6AB 2UZXB 2OL3L 4LDEB 4Z7VE 4LVHB 3GIVB 2D7MA 5F71A 3CXDH 1UB6B 4XPTL 1AKJD 1A6WL 1CG9A 2H9GB 4NQED 1RK1B 4FHBD 3MRHA 4KZEH 4OD1H 3L3JB 4BQ6A 4TRPH 4JN1H 4XTRD 1BQLH 2YA0A 1F3DH 1I3VA 3BYTA 3MODL 4MQSB 3UZEA 3RWEA 2Y5TB 1J8HB 1KNOA 3T77A 5K9KB 4XZUA 2MHAA 1F4YL 1RAMA 3BN9D 3LB6D 4R90L 1OL0A 1EUUA 4LK4A 3T1FA 2ORBH 2CIIB 2OSLB 4UI2A 4CMHB 3QIUD 4PD4J 3SDAB 3WDIA 4GW5A 4GKNB 2NNAB 4M02A 1OAQH 3N1PC 4KJWC 3QQ4A 3QH3A 5F89A 1XCQA 1YEKH 2FJGA 3L7FB 5EU5B 3C9NB 2H8PB 1FORH 5JORB 1ZA6A 5F1NB 3S7GA 1SM3L 5IESL 5JUEL 5FUZH 3SGEH 3T0XA 1A6UL 2VIRB 4XHQA 5GRUL 3LIZH 4NPYB 1A02N 4J4PD 1E4KC 3MRJB 2FLRT 1QLFB 5FA4A 1ZA3B 3RWGA 1QPXA 3SKMB 2X1PA 1X6LA 4FQHA 1HH6B 5IMKB 1YY9D 2PF6A 3WLWD 1IQDA 4PJFE 2BC4A 4YK4C 5I74B 1JNHA 1G7HB 4Y4KB 4BA8A 3K8MA 3TYFB 4HWNA 4XP1L 4IRSD 2ADFH 4Y4FC 1OPGL 2IBBA 3TO4B 1P7KA 1NCTA 2V7HA 3VXQA 1UGNA 2K9UA 4F7PA 1X5AA 1U95B 1MFCH 1QKZH 1JZ8A 4R96A 1MJ7L 1GZPA 1WCBB 3MLXL 3CFCL 5ADOH 4EUPG 1MCLA 1AGBA 3RU8L 5H2BB 2EYRA 2NYYD 4QOKD 3HZYB 2XKUA 5TQ0H 1JYNA 1HHJB 1WFUA 3WBDA 3WS6C 2FH8A 3EOTL 3SO3C 1AR2A 2M2DA 2H1PL 3UYPA 4GRWF 3TBVA 1JYXA 5DJ6A 1S9KC 4D0DB 1S9YA 2BVTA 5M94B 1TVHB 1FFNB 5I1DA 4XNZB 5I17A 2OL3H 4NBZB 5DMIH 1EH9A 4HJ0C 1RZIB 2OCFD 3A6BL 5GZOC 2R56H 3QRFM 5D6DC 3VG9C 4LVNB 1Z3GH 5C0DB 5DQDL 4HIIB 4KHTL 5ESAB 2DMCA 2WP3T 1NGZB 1S7TB 1V7ML 2ZOLB 5F3HB 4Q6IB 1HXYB 4M6NL 3VXNB 4PUBH 1I7ZB 3FT2B 1IBGL 1BQHB 3H42L 2XWBB 5CEZL 2AJXH 1FLTX 1JV5B 1JZ6A 5GS0D 4G9FA 5HXMA 4IMKA 3DVGA 1YEDB 5F1IB 3WKML 1NH6A 1U6AH 5IVXE 2MQ3A 1KB9J 5KSUA 1FORL 3HB3D 3MMEB 1V3JA 1U8IA 5JW4R 4R0LB 3RJQB 5KVMC 5AAWA 3NGBB 3MRQA 4XGZA 1WBYB 4FZEH 1LK2B 4OUOA 1DQQA 4ZTOL 4S2SB 1INDL 4YIQA 3IXTA 3Q6GH 2PO6D 3QCTL 3UO1H 4RZCB 2DLHA 3QXTA 2LAGB 3RTQD 3U36A 2FD6H 2Y07L 2D4DA 1I8KA 4I0PA 3SGDH 3T2NH 4Z77A 4NQSA 2NY6B 2G5BA 1FL5B 5HGDA 2JIXB 3X17A 1A4JA 1NBYB 1NLBH 1ZGLA 1WC7B 3VWKA 4WTXA 5E1AB 4WFGE 1AD0A 5D6CA 4PJ5E 1T20B 2PO6A 2YR3A 2R4SL 3SKJL 3TNNB 4U1SA 4HKXB 4LGRB 3MBEC 3RTQA 4XCEB 2XQYK 1JGVH 1T7YA 4UOJA 4KJWD 3MRIB 2HFGL 1T0NB 2XNAB 1GGYA 4QRPE 5D5MA 4JCMA 2R2CA 1NQBA 3PHQA 2AAVA 1BQHA 4I4WB 3I6GA 3KGRA 2VUYA 4JGUA 4UOW1 5F96L 5ICZA 4X6BA 3X13A 4XBGA 4PG9B 5DMIL 1OAZL 4MCZA 3AAZA 1GIGH 3PP4L 4AH2B 3ARUA 4X7EC 3F58L 1OP3K 2OK0L 3TFKD 2ZUXA 4JRXB 2BVPB 1Q94B 1RJYB 4PY8I 3WLWC 1RUMH 2WUBL 2ZOKA 2YUXA 3ZDZF 3VI4F 1CFTA 1F58L 3QDJD 4XNQA 4IRSC 3T2OA 3DI2B 5CLTA 3F8UB 2C4FT 3UTOA 3W9EB 1FCGA 2GW5A 4OF6A 3OKNA 1ZS8B 4WNQA 4KK6C 4R4BA 4ZPVA 3EYOB 1TQCC 4LLUA 2M26A 5F1KC 2OI9B 1ZEAH 1LP9E 3P77B 4PJBF 5HGBB 3GRWH 5MP6H 4ONFH 4LCIH 2MWCA 4JJ5A 2VDRH 4LARL 7CGTA 3LN5B 3FQUB 1Y6NR 4QHLA 3JWDH 4DVBA 4OV6F 2NXZC 4OZFA 1C5CH 1U95A 3O3BA 5HHVH 3QZWB 4PTUA 2NTSP 3ARBB 3MGOB 3WNKA 4EDWH 1T0MB 1VACB 1P7KB 2AABL 4E5XB 2AQ1A 4R97C 5I8CB 4ZTOH 4DN4L 3ULVF 1T1YA 3D3VA 2R0ZL 4Z78A 1OCWH 43CAB 4P5KB 2IAMB 1A4JB 4LQFH 1LEKA 3ARXA 1IC5H 2O5XH 3ULUL 1YYLL 3UZVB 5DRWB 2KZ1B 1FFOA 4RGND 3UYRL 3RWIA 3WEXA 2HN7B 3BJLA 1HHGA 3KPSE 4NCC2 2VIRA 5K9JL 2E6PA 5KANG 5IB3A 4LPTA 3ZYJA 3QFDA 5CP7A 4YBHA 5F9JB 4ZAKB 3K8KA 3NCJL 2DIAA 3GDBA 1DBBH 4F33A 3TVMB 4QRSB 4ZOCA 4E42A 4LPXA 1FSKB 2BY2A 2EE3A 5TF1L 4V1DA 5HVWA 4FN0A 4U1MA 2EYTA 4DEPC 1NCCL 4GBXB 1WAAE 4RAUA 4LVOC 1AXTH 1Q72L 1R3JA 3K4DA 1WBXA 5GGSA 3HI6L 3B2UC 3RIFK 2RIKA 1E4JA 5E9DB 1G7LA 1FNGA 3CXDL 3IXAA 4G43B 1BX2B 4O4YH 5GGRB 4MD0A 4RBPK 1N7MH 1XGRA 1IC4H 4HPYH 4OFVA 5E9DD 4AYFA 5JW4N 5GSRB 2F5BL 4I77H 3R4DA 1NGPH 3VFGH 4NO5A 2ZSWB 3AREC 3FAWA 1YPZB 1QR4A 4JKPL 5E6ID 1Y18B 1NDMA 5IEHB 3U2SA 4PJIE 5JDJA 1J11A 1WFTA 5ESAA 3CFBA 4FQLL 2QHLA 2ZCLL 3SKOB 4R90H 2V9TA 1I85C 1AHWA 1RHHB 4R0LC 2FGWH 4KROB 2PYEB 2D03L 1EMTH 2ZJSL 3R1GH 3UYOD 2FX9L 1CICB 2Q86B 4HZLA 4ISVB 1TVHA 4PGEA 4U2YA 1LNUB 3CZFB 3GO1L 1IKNA 1Q9KA 2H3NA 1DSFL 2EDOA 3CFIC 1DLHA 4UIMB 3SDDA 3GRWL 2CIKB 3LKSA 3B43A 3KPNA 3MV7B 3IDNB 1U8HA 4J7RA 1D9KB 3LEVH 3TT1H 4HFUH 2AGJL 1DP0A 4PS4L 2VDRL 2IBZX 3ULSB 3PV6A 4PREB 4M7KL 1QLRB 5AD0B 4OF5A 1KCUL 3BT2L 1MFAL 1FZJB 5D7IA 1ZE3C 5BOPA 2YD5A 4WV1A 1T04A 2PTTB 4KI5D 2Y25A 2YK1L 3B3IB 2ZCKH 2CKNA 2QQQA 4UU9B 5DD6B 3EYFB 4LLQB 3V4UL 1IGYA 5BVJB 3BP5B 4Y4KA 3VXMB 1FPTH 1XF1A 4G5ZH 4PD4K 1F8TL 4LHUG 1AQDB 4DKDC 4O02H 5CJQH 5IFHH 3C6LB 1QR1B 3H9SA 2DQGH 5ID1A 5LXGH 3WXWL 5CGYD 3RVTD 3BZEB 2DMKA 4QHUA 1GJIA 3MLXH 1NANI 2YD6A 4JVUA 4U6XA 3MA9L 4TSAH 3W2DH 3RTQC 3MRFB 2FX8H 3PWPD 4AG4L 4UB0H 1MWAH 3NOIA 3O2DA 1DQJB 5DD3H 3CC5B 5C3LD 2B1AH 3KPPB 1CF8L 5ID0B 4ELMA 3DUSB 1UB5B 1NGXB 2GJ6A 4OZGA 3SDYH 5C0AD 5IR1A 2KDGA 4ODTH 3C87A 4OIAA 1IM9A 5AYQA 3CFBB 5FB8A 2VZ1A 4LKXA 4M9OA 3P4MB 3QPXH 4JFYB 4HPYL 2R0KH 4LCCA 4Z7QE 1Q8MA 1NCAH 1ZVSB 4EI5D 1FVDB 2XQBH 4X5XB 5K9KA 4JM2F 1OLLA 1RZJL 2P8LA 1A3LL 3KPLB 2JJUA 4YFLI 5KSBF 3KPOB 1FYTE 1H9VA 1U8PB 2BNUA 4Y1AD 5SX4I 1UM4L 4U4BA 1IBGH 2NX5A 3KPRE 4E9LA 4GLRH 4PJ8A 1MH5B 2Y36L 3MV9A 3FRUB 1CZ8L 3QWRA 1S7XB 1FVEA 1T2QL 3HG1B 4U1MB 3UTTD 1QA9A 3P11L 4HFWA 3WKMH 1N26A 3G6AB 1JGEB 1J9CT 3WN5A 4XP5H 2FJFA 4BELD 3RZCD 3FRPG 1ITBB 4E42B 4N8VA 1M6OB 5TE4L 3SKUD 4FQ1L 2DQJH 5BZDB 1NAMB 4F33B 3VD3A 5D1ZA 4NM4L 3TJEH 2IALA 3QIBD 4QRPA 5DFTA 4GG8B 4HGKC 4HV8A 4Z7OE 5DDHA 4O9HH 4D3CH 2VZTA 4TUJB 3UTQA 3KLSA 3QIWC 4X6CB 3X12A 1L0QA 1KCSH 1INEH 4LSQH 3VFTB 1M7XA 3FB8B 1PAMA 4G9DB 4IRZL 1U8PA 4XRCA 5FHAH 1NBVH 2C1OA 4XMLL 3LZFH 1A4KA 5KVDH 2ICWB 3MOAH 3HUJE 3RL1A 3SJVA 4OQTL 5GGTH 4NHUB 4CU6A 3LRHA 4XNZC 1HOCA 1T7WA 1IGCH 1D6VH 4U1NA 4GW4A 3OKDB 4HKBA 1CTOA 3QA3A 3NTCH 3QUXC 4JM2B 4GRLA 5A16B 3D2UA 1U3ZA 1MRDH 1X5GA 4OZFG 5KANI 4X4XB 4BK4A 3TO2A 3K0WA 3MREB 3E0GA 2XKSA 1D5XB 4PY8J 3OPZH 3QQ9D 4ZFFA 1MFCL 1N6VA 1TCRA 3AB0C 4M6MH 3MRFA 3GSOB 2GSGB 3HE6A 3IGAB 2PW2B 1FLRH 3SE4A 1ZANL 4LRIC 1MCWW 3L5WA 3F58H 5I1JL 2YC1B 1HN1A 1ORQA 2BVPA 5DRXA 3OF6D 3KPRD 4EI5C 1FP5A 3UJIL 4H26B 5HDLA 1CDIA 3HG1E 2Z8VC 3UC0H 3OZ9H 3H3PL 1IGYB 5E56A 1U3HD 4M43H 3HE7B 5EZJB 4H0HB 3ZE1F 4I4WA 1ORSA 3F12A 1G0YR 4I2XE 5IROC 2DD8H 2P8MB 1ZEAL 3OGCA 3BIAX 3U4BL 2C26A 4PJDA 1A7BA 2WWMD 4ZNCD 5EN2B 3C8KB 4ZUVA 1P7QA 3UPRA 1JL8A 2V2WB 1U3HA 3JWDL 1E4XI 3NABH 3FHAA 4U1SB 4G6FB 1YN6B 2VAAB 2ZUQB 1WTLA 3ARGB 4XPAH 4P3CH 1KN2L 1J87A 2VDKL 1YNKH 1B4JL 3RIAF 4HJJH 2Q7NA 1KF9B 4HKZA 5DVOA 5CINL 3RUGE 5JW5B 4HH8A 4NNXB 3K3QA 4HLJA 1J1PH 5EUOB 1NFIB 5DRXB 5LG1A 3S36X 5BQ7A 5FO7B 3ULUH 3QBTB 3FO1A 1QBLH 1BJ8A 1UC6A 3GFUA 1BZ9A 4NQCE 3BP4A 3TIEB 1UKQA 1CIUA 2AEQL 3QEGH 3IJSA 4GG6E 3C5SB 3IDIA 4OQTH 2DJ4A 1MWAB 4NNPH 1L7IL 1NSNL 4PJXB 1IGCL 1AXSA 2WSKA 1D6VL 3SEPA 1VSCA 3LHPH 3BUYB 4RWHA 5EBGA 4FQQB 3U46B 3WXVH 3VG0L 2DKMA 2AEIT 4MAUH 5ERWB 4X99A 1CBVL 4ZDHA 3WFCH 3TBSA 5IBUB 1WZ1H 4K7PY 1T03L 4G8IA 1C16B 3HAEB 1CE1L 2VLJA 3FT2A 2NY2D 1S5HB 2VWEE 4WFFE 1A6AA 2ZOLA 2ICWA 1X5JA 1YZZA 2BNRB 2DDQL 4LSUL 3H9SD 1UA6L 1Y6MR 1JRHL 2A0LD 1AFVH 3W11D 4JFQB 1ZAGA 1HHGB 2HN7A 5FUOL 4JY6B 3WL9A 3UJIH 4JY4A 4C56E 1EEYA 3P9LB 2Y6SD 2ZCLH 2Z9TA 3GSQB 4Z95H 3O2DL 1MIML 4F15C 4IRJD 3GSUB 4Q0XH 3R1GL 2BHZA 1U8NB 4P9MH 4HXBL 4MA3B 5ALBH 1IGIH 2X7LB 4H5SB 4LRNH 3ESVF 4FFYL 5DVLA 4XI5D 1B0RA 2GAZB 2VH5L 4HFWB 4MD5B 4ODUA 3RWCB 2V5SA 1XMWA 4UNTA 1A6PA 2EDWA 4MA8L 4MXVF 4NO3A 3O6KH 4A2MA 3QIBB 1EIBA 3CMOH 5F9WC 2EZ0C 2YA1A 4PJ8B 4WUUE 1WT5A 4MS8D 5EORH 5JOEA 5DI8B 2IH1B 5DURB 4B53A 4P4KC 4MCYB 1U8NA 4JHAL 3U4EB 3O11B 4FFVD 2ZCKL 1CXFA 5DQ9A 5L9DH 2YWYA 1J5OL 2ZG2A 5DJ2B 1MHCB 4AM0B 1U8LB 4OUUB 5HHPA 4G5ZL 5IM7A 4LCWD 2YPVH 3QB7C 2P47B 5DMKB 5HYJB 2X70A 1S7VB 1P4BL 4M61B 4Y4HB 5IR1B 4NC1C 5H8DA 4PRPE 4WENB 3CGTA 4XP6H 3H9SE 3KPPA 2VZOA 5TDOB 3U9UA 1GAFH 4ODXB 3S36H 3TEUA 2C7UB 1N6UA 1SMAA 3HAEA 5HVFB 4IOFC 5C0GA 2CDGB 4PLNC 2MOVA 4EZMA 1H5BB 5IW6B 5F70A 3R0MA 1IGTB 3UTTB 5D1QB 3T1FB 1JK8A 3BGFC 5DMJB 4ODTL 2X4NB 4CN4A 2C4XA 4YPGB 2RAMA 1BIIB 1H3WM 5IB2A 1FZMB 5E8NA 1WEJH 5A1AA 4KZEL 3ULUF 3KR3H 1WC7A 3VWKB 3CX5J 4QKXB 2R1WA 3BP4B 2VDLH 3TIEA 1VFBB 2BVEA 1FL5A 4KHXH 5HGDB 4HMDA 4ESKA 4F3FA 3QI9B 3VE0B 4MDJA 1ONQB 4F58H 2F54E 2UUDH 1K5NA 4XC1H 4PLOB 3BKMH 4FNLL 1YEHL 4H20H 4OKDA 4NRYA 5CIPA 4Z95L 4Z6AT 1U8QB 1N7ML 4U7KA 1I8MA 2ORBL 2XACC 1H15B 1N59A 3TA3A 2I26N 5JW4M 1CICC 1UJTA 4OB5H 1OHQA 4GXVH 1HILB 4XPFL 4HJGA 3VFGL 4Z7WE 1ZWIA 3KPNB 1BD2E 1J1XL 2X4PB 2VB5A 5CILL 4JKPH 1C5DB 1CT8A 1XH3B 5FOBA 5GGUA 1I3RA 2C4FU 5GJTH 2JJTA 3EO1A 4MA8H 3WNMA 3A6CL 3SQOL 1XIWB 4C4KO 5AZ2H 4C54A 4U2ZA 2Z31B 4O2CA 5IUSA 3GSNA 4ETQA 3ULVD 1UWEL 3MJ9H 3FOLB 1INEL 1NCNA 1BGXH 2ADIA 4YWGL 5I8EB 1KSRA 1UXSA 4MQ7A 3GHBL 5FHAL 1MQKH 4G8GD 1IGMH 4HX1A 2FJHA 1X5ZA 4UIKH 4YHIB 4I3RL 1J1OL 2R2BA 3FOMB 1CVRA 4ZFOB 2AK4E 2VR4A 4MSWB 4EBQH 2Y6SC 2P42B 3QEUA 5ETUB 1J0IA 1HYRC 5DK2A 2YK1H 1W0YT 3PNWA 1A7PL 5DJXA 3NTCL 4X4YA 4XAKE 1QTYT 5I1IL 3ARDB 4JG1L 4WWID 4E41A 5HY9B 1B6UA 2XT1B 4NIKB 5DLMH 4ZD3L 2B39A 2J1KA 3JTTA 1SEQL 3QWOA 4DTGH 1FE8L 5AZEL 3MV7D 2NY5H 4RA3A 3K46A 4L8BB 5FHBL 5GRZA 1OF2A 4K2UH 5EO1A 1I8LA 2DQHL 1ZT7A 3K8LA 4PJGE 1XF5B 2QSTA 1UM5H 5EO9A 3RGVD 4XVJL 2XTJD 4MQXC 3GMQB 3RWIB 3PHSA 4GT7A 4LNRB 2C9AA 2FYYA 4F7PB 5D71H 1WEJL 4RGNB 5D93B 3VCLB 3VXQB 1T21A 5E5MA 4HEME 4ONOA 5JOFB 4AQOA 1I9JL 1IKFL 4J12A 5DUPL 3QIWB 3BVNA 1FZOA 5H37G 3MCG1 4XNYH 3CLFL 2CDEB 1A4KB 3LS5H 5LGJA 5T1KD 3TH2T 5F3BB 1FNFA 1NPUA 1F4WL 4APQD 2DYPD 1HKFA 2ZUTA 4MYWB 2YMXH 1DBML 2AJXL 2QSVA 3EHBD 4YO0A 2H26A 4V1DE 4TRPL 2R4RL 2DTML 2PO6C 4YFEA 4YBLB 3T0EB 3BZDA 3KDMA 1XGYH 2Y06L 4XCFH 3NCEB 5C08A 1LEGA 1BOGB 3ETBF 3PWUB 1DQLH 2GTZA 2DQDL 3A6CH 1GVIA 3JVGA 3GMRA 3O9WD 1BFSA 2OX5A 1JZ3A 1WT5C 4Y8AA 3WDHA 2V7NB 4UMGA 4K9EL 4QRQA 1CQYA 5DK0A 4YE4L 5BMFL 4ODWB 4FQ2L 2JJSC 2A73A 1T1ZB 4GKZA 1WSST 5I16A 1A0QL 2Y5TA 3DX8B 2BNRA 4X6CE 1PVHA 1A7QL 1A6UH 1TVDA 1T6WA 2CUHA 4B7LA 1A3RH 3L3JA 2DL9A 4JFOA 1SJEB 4F9PA 4NJ9H 3F7VB 5FFLA 5I1LA 2BVOA 1T1WA 3QUYA 1UZ8A 3S96A 3NFNB 1KG0B 1MY7A 1TPXB 4NYLB 1RMFL 2YPLA 1TZHB 3MRKB 5IVXF 3RKDC 2HJLB 2HFFB 4HIXL 1E4WL 3U7WL 4KFZC 3PABA 1YN7A 3BQUD 3DUSA 4UV4H 4M93C 2EDLA 1DBJH 2BY3A 1KTRL 1R5IA 4XPBH 3ARSA 4N0YL 5J06A 2JE8A 4KTYA 1EFXA 2DQHH 5INCA 1EK3A 2FZ3B 4F7TB 2SEBA 1R3KA 1I9EA 1NUNB 4UUJB 4JKLA 1GGUA 4HG4J 5I18L 4P9HC 4HUUB 2EDFA 1BZQK 4FG6D 3ARPA 3AGVA 3KXFE 3E2HC 2W9LA 4PGDB 5FGCB 4LSDA 4MVBD 3V7AG 2MJWA 1H3PH 1IAKB 3OPZL 3L7EA 4OCSL 5TE7H 3SE3A 1G9NH 3NZHL 3T0EE 5C0JA 4CKVX 3HRZA 1AGFA 1CE6A 1EA9C 1CK0L 2G75A 3CDFA 3N0PB 2MKLC 3O6MH 5FYLE 2XQYG 3LB6C 1WGOA 1NFDE 4UV7H 3T0DA 1UACH 3GK8H 4L1DA 1ZXQA 1ZHNA 3D6GA 1KT2B 4ZO6A 2GCYA 2IG2L 1GCFA 5HGAA 4TULH 5IT2H 1YMHB 3V4PL 5ANMA 5KSAB 4QEGA 3ZSSA 1ERNA 2F19H 2LQRA 1U8HB 1KTLB 1IM3B 3WS3A 2YBRB 4P46C 1TJGH 3HN3A 1FIGH 2VZSA 3GMPA 3VMNA 1FBIH 4JREC 3AROA 2EH8L 2R1YB 3TLRA 5FDWA 3H3KA 3QXDB 3WV0A 2YKLH 4KY1L 1DFBL 3LS4H 2JCCA 1JI1A 3V6OE 4R7DB 1A1MA 1U6AL 2CGRH 3JWDC 4WFHE 5GS1B 15C8H 1KUMA 2AERT 5JHDE 4I18A 4KRLB 4HIIA 2AVGA 1JN6A 2NW2A 1KPRA 3NFPA 1YY8B 4IDLA 1BOYA 2WBJA 3DV6A 4M03A 4XPAL 4JFDA 4BSVA 5BCAA 3UTSD 1B4RA 2APTA 2WLZA 5C6WH 1NEZB 2C1PB 5CD3A 3FL7A 2CSPA 4RGOH 3JSSA 1JGUL 4UILL 1MHHB 3B6SB 4BKLA 2XRAL 4K55A 3KJ6H 2DLIA 3G6DH 4RRPA 1PYWB 3IFNH 2X09A 4GRLD 1S5IL 2J8UA 3QRGH 5JHDD 1AD9B 2VXTH 4Z7WA 5HDOA 5KTEH 1J8KA 3MXWL 1IGFL 3L95A 7FABL 5CSGA 4UINH 3QA3B 4R96B 5HYIA 3LMJL 4YUEH 1X4XA 1ZT4B 3OJMB 3DMMB 4NHUA 5J56B 2HLFC 3DYPA 3PIQB 4TOYH 4H1LG 5I75C 4QRSA 1KFAH 1T4KA 5I19L 3M8OL 4JZJC 4F37K 4ZOAA 5K33A 4JRYD 4ZAKA 1G7QB 4PJCE 3L7EB 1OB1A 4OSUL 1AE6L 2MSPA 2WM0A 4BSWB 3FB6B 2J88H 4PJBB 1EEYB 4X0KA 2YZ1A 2Z91B 5HYQB 5F7DB 4O2FA 4FQJL 1ZLWK 3TVMC 5J3HD 5DMGD 3TCXA 4XC1L 3W0WD 1MLBB 1S7QB 2BY0A 4ZNEA 1EGJA 4U1HA 2P5WA 1KLGA 1OW0A 1MJ8H 1F90L 4LHQB 3HC0A 4NZUH 1K9TA 1QLEH 3RNKB 3WJJA 4H8WH 5TE6L 1F6LL 1INQA 3FO0H 5JORA 3ILQD 2BSRB 4R3SA 4M1CC 5DJYA 4S1SL 1FN4A 4L8SA 3R8BB 4PY7A 1WQVT 3IFPB 2HFFA 4LPVA 5J89A 2YPLB 3U0TB 3W39A 1CGTA 2VDML 1BEYL 1KTDA 1CL7H 3QEQE 4K3JL 2VDQH 1VFMA 5DEGA 4ZDHB 3QQ9C 1UWEH 3MJ9L 3B5GA 5I66A 5T1KA 2GUOA 4XZUB 5C0FB 3BMWA 3JTSA 5C0CD 1DFBH 4FTVA 4BH7B 5EUKA 3LN4B 1TETH 3TIDB 1A9BA 5GZOD 4X9IA 5DHYA 4LKCB 3VXUB 4ODWA 4XAWL 4L4VA 1IGJB 4LSPH 4OM0H 5F6IC 1DANT 1OT2A 4NSKA 4OIIL 4JB9H 3OR6B 3RL2B 5FB8B 2D31A 1EVUA 3L3OA 2W92A 4GSDH 1YECH 4QXWA 4W6WB 2J7LA 3SDXB 4JR9H 1KJVA 4ZFGH 4IRSB 4PP1D 3EKCA 4HKZB 1I1FA 3SCMA 4OZHE 4NKQB 3MBED 1ZV5A 4DW2H 3DUHA 1OD9A 4WDIB 5GS0C 3BZFA 3X14A 1W72L 4PRNB 1K3ZA 5F8QC 5IF0B 3ZE0E 4A6YL 1E6OL 3LKRB 2F58H 4PJCB 3FKUS 3HPLA 4JZJB 1YMHA 2WQ8A 3F6IA 1TLKA 3K1KC 3BZEA 3X11A 5ID1B 1G7MB 2APBA 4NWUL 1X3DA 2NY0B 3LPGA 3STLB 1RU9L 1KIRA 1QFUL 1JWUB 5D96C 1ORSB 5HYJE 5DA0B 4G7VH 4WI9A 3NA4A 4WEMB 5JOFA 4KKAD 2QHRH 4JEGB 5BV7C 1LGVA 4OGAC 1EUTA 3TZVB 3O3DA 4MAYD 5HYEA 2ICCA 1Z0MA 3U36B 3ME0A 3O41A 4P23D 5L88L 2KKQA 2BVQA 3GMNA 1MJ8L 1F90H 4MLIA 3ULSA 4PRPB 4NQVB 4Z7NE 4NKDA 3HR5B 4XC3H 3FQNB 5IGXL 1UZ6E 2FZ3A 4GFTB 4L8BA 5JXEA 1J12A 1TZIB 4K3DL 4L9LC 3QUXB 1FDLH 2R69H 2ICES 5SWSE 4E41B 5FYKU 3VXTB 4NFBA 2VLJE 3RVXD 5KVGL 1C8PA 5CEZD 4IIQB 5CJ8A 4GAJH 2X2YA 4Z0BH 5IFAL 5HHMB 5FUCE 4CNIA 5GS0L 3OKKB 1I1CA 1JV5A 4LPCA 1DSFH 5CWSB 3NACL 4LP4A 1WIUA 2FEEI 2W38A 4QXTA 4ELMF 4J1UB 4Z0XB 1HE7A 2FO4A 4ZXBC 1F42A 5DD1H 2QEJA 1EPFA 1I1AC 5GSRA 2VMFA 2FBJH 3S34L 1VDGA 1DQDH 1LP9B 4ZO8A 1XR9A 4DAGL 4WO4B 3V7AE 4DVRH 5C2UB 1YEJH 3HNSH 5EZOL 5H37H 1IMHC 4YGAB 3GMMA 1U8KB 5KVEH 2R0LH 4NBYB 5IBTH 3BP7B 2ZUSA 4KKBC 1WISA 1FC1A 5GS3A 3SDCD 3O2VL 4OCLC 1TMCB 5JPMA 1NFDA 1WIPA 1ZT1A 1L7TL 3HMWL 3EYSL 4WTZA 4Y16C 2AQ3A 3OX8B 1PBYA 3RVVC 2IANE 2PXYC 1N4XH 5FYKH 2AXHA 3C5JA 3LSOB 4XAKD 3D2UD 4N68A 4NNYA 1DJSA 2LU4A 2YEZA 4G8EA 4NWUH 1NJ9A 3JUZA 4LEXL 4UDTB 1P5VA 1RJCA 5DLML 3MV01 4XNUH 1VFBA 2YRLA 4WGWB 2BNUB 2KL6A 2WWMC 3PWPE 3ROOA 5A2IH 2W9DH 5DZLA 3M1BB 3T09A 3N1QC 1G0DA 5C86A 3WIFB 1SBBA 5DTFB 5JOPD 1KBGH 1TPXC 2DQCH 1IL1A 5I76A 5HPOA 5EOQL 5E8NB 1JWUA 1LVEA 3WUWB 4HUWA 2CDFA 1F4AA 2VJXA 1F3RB 4YPGA 4G6ML 2R0KL 5CAYB 1KN4H 5DUPH 2VE6B 3E8UL 4MNGA 4WI4A 4NFDA 5C92A 1F11B 5CEXB 4WIQA 1C08A 4OF3A 1AKJB 1X5YA 5C08D 2VDOH 4J6RH 1XGUB 1F2QA 1KJVB 4UT9H 2XPGA 5ANME 2ZZUT 3FFDB 4P3CL 1JHTA 4KKLD 4QHNB 1ADQL 3KG5A 4MNQE 3LH2L 1OP3H 2BJML 2PTUA 3EW3B 5CHNB 2QADB 5K9OA 1OY3B 4NQEB 2APWA 5BXFB 4OLXL 5JPNB 1YEEH 5EZIH 1G9EA 1IAOA 4YBLC 3T0EC 1HSAA 3DBXA 1Z5LB 4U1JA 4MCYA 2A6KB 1I3GL 3HKFA 5GRUH 3MROA 5ITFA 4DVRL 1YEJL 2J6EA 3MNVA 4WI2A 5I8EA 3MRCA 2QTEA 4KMLB 5E2VH 4UILH 4BQ9A 4YHKL 2A74A 3FN9A 5EB9A 4LCWE 2VLKB 2WW8A 5LBSL 1ED3B 3TCLA 2AKRA 5MEQA 4KRMB 1XIWA 5CJOL 1P6FA 2E7LA 5DJCB 3OTTA 2GAZA 5GGUB 1WZ1L 1A1OA 4LRIA 1V3MA 4ZUWA 2DWDB 1TENA 3BD4A 4KZDH 4RFEB 4Y8DC 3DXAE 4L29A 4HUVB 3LQMA 5JPMB 4TOYL 3B9KD 3WO4B 2X4QB 3AM8A 2E8ZA 4QHKJ 4LSUH 3K74B 2FDBP 4FFZH 3IDXL 3ZYOA 4YGVA 3KPMB 4K3HA 4I0PB 5E94B 4NGHH 1INDH 1OGAE 4FQXB 4UQ2A 3D85A 1Q9LA 2YWZA 3EYQC 3N85H 4J8RA 4ZS6D 2XZCL 3DSFH 5JHDB 1GPOL 1BQUA 4KJQD 1SEBB 3TH3T 3H7BA 4KV5E 5GGRA 2K3TA 2JJSA 3HAEH 1S7WA 3TA3C 4H0GA 4BK5A 3AY4A 4FMFA 2DBLL 4HK0B 5I8OH 1TZGH 2X9XA 4KJYB 1YUHB 3LQAH 1R3JB 3ARWA 4XXDB 3SE9L 4BKLB 3L5HA 5C0GB 1C5CL 3FMGL 3QQ3B 4C56B 4OZGF 3QUML 4JVPA 1XR8B 2VKWA 1OAXL 4LSTL 3U9UB 4EXPX 1NC2B 3LY6A 4NKDB 2RFXB 1X7QA 3ECBA 4HULB 3LH2H 1BZ9B 4HWBA 2YD9A 2R0ZH 4HEPG 5FO7A 1A5FL 3MCKA 5TDPA 5DSCB 5LQBL 3O4OB 2ESVB 3ZLQC 1QPPA 1CFVH 3PL6B 2FSEA 1A6ZA 3HZMB 4NC2B 2IAMA 2F8OA 4QRPD 2VLKD 2DIBA 3N1GC 2NX5E 3ULVC 1MREH 1GL4B 3OAUH 1UQSB 3TPUA 5FYKD 4YHKH 2BNQA 1MCSA 3VGGA 1ZLSH 4G80A 3BRDA 3WFEH 5TF1H 1SBSL 2E7MA 4LEOB 2FCBA 3FO9B 4XCCH 3OAZH 4OZHA 2BDNH 4IDJL 4DZ8A 1VKXB 5TFSH 2VLKA 4PJAA 2BERA 3KPRA 1BMGA 3DGGA 3F7RA 5IHLB 4Y2OA 3VG0H 3VFPA 4H5SA 5KSAD 4Y1AA 4EDWL 3SDXA 5HI5D 4U6VH 3BKCL 2LTQB 5T3ZL 3VMPA 4P23A 5JHLH 2I27N 4KTDL 4CVWA 4U1IA 5FO8A 4NQEA 1AI1H 4IHOB 6FABL 3OXSA 1QLFA 5FA4B 3RWGB 2W0FB 1H8NA 5ICXA 3GM8A 3FHQA 2J8UF 4Z7NF 1A9BB 2DI9A 3M8OH 3GMLB 1NBQA 2BVYA 1MQ8A 1XZ0B 1RURH 3QYCA 4AQ1B 4CGTA 1YEGH 5EFIA 1KCRH 4Z7UB 1IC7H 2AK4D 2G9HB 1YN7B 4N8CL 2YXMA 2UWEF 4HFUL 2J4WH 1CD8A 4V1DD 3VWJB 4EN3A 2H45A 3HI1B 1QFWM 2CIIA 1LMKA 4OZIF 2ZCHH 4P9HH 1NUGA 4OZIB 4YPJA 4QHKI 5F9WB 3QHZL 3WUWA 1MFNA 1XZ0A 5EBWA 4O2EA 3QISA 1HHKA 3TM6A 4JFZL 2UVEA 4OLVL 3OG4B 12E8H 3DROA 1CR9L 3AMKA 3RZCC 3VDAA 2VDMH 1CIDA 4I2XB 2D2OA 1IC4L 4QRQB 5DK0B 1H3VA 5T3ZD 3CMOL 5DJDA 3VFNB 3RPIA 1JWMB 4MWFB 4KK9C 5F6HJ 5FGRA 4ZS6C 3VW3L 3HUJA 4JY5L 1NFIA 2CRZA 1QUNA 1X44A 2XZQL 2DRUA 3EZ8A 4NM8H 5ACMA 3L3HA 3LKQB 4K94L 5JNYB 2VL5A 3I50H 3MLUL 4EEEA 1KYOK 3A0OA 4JGMA 3MLVL 3KYKL 4U1KB 2FJFB 1CXLA 2MCPH 3C6SA 4JB9L 1SHMA 4PBWD 2X5PA 1SEQH 5TF0A 3KDMB 5CBEA 3I84A 3H9ZA 1CF8H 5KSUB 4K2UL 3DX9A 4XNMB 4JHBA 3EFDH 4HXAL 5D8JH 5F1IA 4XP6L 3DX6A 4H1LH 5CD5D 5EU6D 4ZXBB 4JVWA 4MNHA 3WHE0 3T0VA 4E41D 4GKSB 2AS5M 4PLKD 4M7ZC 3L3KB 4JO2H 3GI8L 1FNSH 1MHEA 3VA6A 3RGVB 4WWKC 3B2VH 4JN2B 1Z6JT 3O4LB 5TPWL 1B88A 1KXVC 5INDB 1AXTL 1Q72H 3MRGA 4MDIB 4AMKH 3QCUH 2NPLX 4PRHA 3W9DA 1OTSC 3GNML 1HXMB 1HSBA 4GLRI 2CUIA 1F4WH 3W0WA 4M1DH 3MOBL 1IEBB 4NRXB 4YX2L 3Q3GB 5HYSA 5GHWH 1EERB 5CZVL 4O02L 4ZQKA 1QBMH 4HIEB 2PW2A 5FK9B 2GJJA 5LXGL 1NC2A 3T2QA 1XGPB 3VXPA 1DBAH 4P2QB 4JPVL 4QXUL 4M1CD 3M17B 4HS8H 5E8DH 3PWJA 3FQNA 3BKML 4Z7WF 5IEKA 2WP3O 4ONGL 1OM3L 4Y5YB 1RZ8B 4F57H 3QEHB 2WINA 4LHUA 4RWYL 4JAMA 4JO3H 1E27B 4QTHB 5KAQG 4FXKA 1U91B 3C5ZC 4Y1AE 4YHIA 4MA7H 5IHUL 2EXWD 2L7JA 2NY0C 5AYUL 1IE5A 5HYSG 4BZYA 4RAHA 3RL1B 3SJVB 4MDIA 3WSQH 5B8CA 5F93C 1V7NH 3PJSB 4NZTL 1HIMH 2HRPL 3B9AA 5AZ2L 4LAQL 1IAKA 2I60L 2YPKA 2DBJA 3MV8E 5FA3B 2X4UA 1JNJA 2WANA 4Y16A 5E94A 4EDXB 3IETB 2I9LA 1A3LH 3LKPB 4KVNH 5JZ7C 5T1LD 3X12B 3N9GL 3X3GL 3GHBH 1YNTB 2NY7H 4UUJA 5D96B 2B4CH 5JQ6H 3HZVA 2JK5A 1KPVA 1BVLA 3MQIA 4HUVA 3SDCA 1DLFH 5BZDA 2Z31C 5EULV 2R8SH 3QXAB 4H88L 3TBTB 3VH8B 1DVFC 1NCDL 2CO6B 4XXCA 4EBQL 3RDTA 2FJGB 4HXAH 3PABB 1T83C 3CU1A 1U8QA 5GJSL 4GW5B 3G5ZB 2ENYA 4XVUC 1RZKL 3TJEL 3QP3A 3LEXB 3V4VH 3MV9B 2EDXA 3OR6A 5HVHC 4HAGA 2A74B 5HHXL 5L0QC 1MWAL 4ODBD 1N0XH 4TTDD 3ZTJH 3HE7D 1J05B 3VGAB 2DQFA 1I8IB 3F7QA 2OZ4A 1RK0A 4AEHH 2IF7A 1UM5L 3UTZB 3RY6C 5IB2B 4LEXH 3ALXA 2C3WA 2HTLD 2AV1A 8FABB 3WNOA 5BXFA 1NKRA 2ADFL 2FGZA 3MFFA 2X4NA 4QRUB 1QRKA 4K7PX 4S1RL 5FKAA 5I1AB 1G7PB 5KG9A 2DWEB 1ZHBB 3FAXA 4PRBB 4XNYL 1QSEE 3ZKND 1UB5A 3MNZA 2BSRA 4R3SB 5GS2H 4OCYH 4QF1B 4UT6H 1A7NL 3CC5A 2EIZB 5HTSA 2BP3A 4A2LA 4CDHA 1RULL 1FH5L 4HF5H 2CKBH 4DGVH 3NMEA 2QJDA 4WUUA 1KC5H 3BH9A 4FABH 3LAFA 1S7VA 2ADJA 1W72A 3B9DA 5DRZA 3V0WH 1M05A 4I5BA 4ONHB 2Q8BL 1YEKL 4P4KA 4NBXB 3DXAB 4XP5L 4MA7L 1I1AA 4OUUA 15C8L 2AJ3B 4X0KB 3BUTA 5IHUH 3ARFD 2XN9E 3WFZA 2X89A 4Y5XB 3OR7A 1FZOB 4XCNB 3RQ3A 5C2BL 4LFHD 5BVJA 1T4KB 5AWNL 4U6HA 5I73B 1OVZA 4YBQD 1R3HA 4R4NC 3KPRB 3KYMA 3Q0HA 1DL7L 2ICEA 4GRMB 5FYLL 5HDQL 4JO1L 4LCWB 2VN4A 4TSBH 3RZCB 1X5KA 5GRYA 4NO3B 1KELL 2YA2A 3ARFA 1ZVHA 5SWSA 3BP6B 4FQ2H 3FT3A 4PRPD 3VH8G 5J9PB 5KS9E 3HLAB 3BE1L 5TDNB 4KU1A 1RQ5A 3EYUH 3P77A 2NY6C 1PYWA 4ELKB 4LLWB 1B2WL 1X5XA 2IADA 3QXVA 1HQ4B 4WNQB 1DLHB 1L4IA 3VWJC 1F4YH 2H3NB 4BQCA 3V6FA 1ZK9A 3G5VA 3ZHKA 5ADOL 1VHPA 2Q1EA 2BRQA 4DQOL 5JXAL 1KN2H 1ZKAA 3BXNB 2BCKA 1BD2B 5T1MB 4CVUA 2HP4A 3NGBC 3WIIL 4CW1B 4O00A 4HUXA 1JFQL 1U58A 1OSPL 2R15A 3IVKA 4PB0L 5ENWA 5K9QG 1F3DJ 4P5TC 4NT6A 2JCCB 3IKCA 4R26L 2FD6L 1PEWA 2YUVA 1SYSA 2Y07H 2HLAB 1PD6A 3KNBB 1H3TA 3P4OA 4YXHH 1Y0LA 3PDDA 4QT5B 4WCYH 4XPHL 3BN9C 5DQJA 1I7UA 3RGVA 5ALBL 5C09B 4MA1C 1BX2A 1GGCH 4KQ4H 3IXAB 4WU5A 4Y2DB 2PW1B 4O2CB 3C5ZD 5K59F 3MRIA 1WWAX 2UZYB 1RIVL 3ARED 3QIUB 2VUOA 4YDKL 2NXYC 3U83A 3O3EA 2ICWI 1KPUA 3H0TB 1NAKH 4RGNE 4YLQT 4V2CB 1DVFD 5E8PB 5F7EH 4P23C 4XMKH 4I0PD 1TZIA 2DYPA 1HZHL 1MSPA 2XZZA 3GKWL 3DVIA 3GSRB 4P3WA 5EZLA 3RNQA 3C5ZA 4WEUD 4OJFL 1TZGL 3UBXI 4HS3B 5F9JA 4JFZH 3VJ6B 2L4OA 3MRMA 2J5LB 5CIPB 4XAWH 3G6JB 4M7LH 4O58H 1MFBH 4HSQA 4FQIH 4MDJB 3VFNA 4YIQB 3KPMA 4Y7MA 2A6IA 2H1PH 3I02A 2EH8H 2P24B 5I0DA 2E7CA 3GJFK 3HZKA 4GAGH 1RZFL 3ULVL 2W59A 2FATH 2SEBB 4J3SA 2LV4A 3QUZB 1CLYL 4GUPA 5C07A 4L4TA 3RX8A 5CGMA 3I50L 4P2YA 5LJYH 2OJEB 3E6FB 4GMSL 3H0TA 4N0CC 5F7HA 4LLVA 3MGOA 5GGTA 3ELAT 2QBWA 1WZMA 2MCPL 3TO4C 4N0FA 3DVGB 4QHLB 3C2AH 4JQVC 3V7MA 4MGXA 1JZ7A 3SY0B 4F80A 4U1GB 1T5XB 4DKAA 4PJFB 1T1WB 1RUQH 4MNQD 4RFNC 3AY4C 3LHPL 5JIHA 3SHSA 1MPAL 4TUKH 1D7FA 1MCPH 2LU3A 1BLNA 1J10A 4WFGD 4NKMA 1I1FB 4MAUL 1BZ7B 1CU4L 4U1JB 5I16B 5ENWB 5TPWH 3IVKB 5T1LA 5LGHH 5KTEL 1R5VB 2GY7B 4YDJA 1T03H 4PRAB 4JQXC 5ICXB 2BSTB 4KHXL 2R23B 2ZOKB 4FQPA 2K7PA 3NIFF 4AM0A 5FECB 2EDJA 3MOBH 4Z5RB 2BOBA 2XFXA 3TBWB 3IGAA 4TNVF 4YDLC 4FNLH 1W0VA 3R0NA 1VESA 5DHYB 5T1LB 1IEAB 5L7XH 2OTWB 2GTZB 1I1RA 4MCZB 2ERJC 2DB8A 3TBVB 1SYVB 3EDJA 3CH8A 2R29L 1FFPA 3O9WA 3EDKA 4JDTL 1QNZL 2P5EB 3D3VD 1F58H 5C08E 2BX5A 4ONGH 1OM3H 4P46A 1K6QH 3D0VA 3BWAA 4YQXL 1OLZA 1D9KD 2NY1B 4DZBA 3RZCA 5K59E 1JPFB 3T0AA 2VYRE 4DUWA 1R3IL 1R3HB 1T20A 2PO6B 5J1TC 2X4SA 3GSUA 2AQ2A 1OTUC 3OB8A 4OFKA 4PGBB 4NN5B 4OM1H 2ZNXA 2MKWA 5FEBA 4S10A 2F74A 1SY6H 1T5WB 4JLRA 4LMQE 3TT3L 4K7PL 4O2FB 4WU7B 1ZTXH 3HNTH 2BNRE 4X6CA 4DFHA 5CEZE 5C0AE 5KZCD 3L3DB 1DN2A 3NIGE 4X9GA 3EOYG 3ZDZE 1TQBB 3MJ7A 4HLZH 2HVKB 3AS2A 5CJ5A 1T7ZA 2XTLA 2RQ8A 5I71C 4PV8B 4DJMA 2DYPB 5IV2B 1HHIB 5EU5A 1PG7W 2OK0H 2Z31D 5D7JA 2X10A 2MCG1 1MAJA 2XTJB 3IDGB 2P7TA 1JYVA 4MJID 5I1EH 2A38A 1G7JB 1QACA 2WUBH 5J6GA 3DYMA 1DBBL 5DEZA 2AGJH 1OAYH 4D94A 5B3JE 2J8UB 4QLRA 4N9GB 3DMMC 3U46A 1CVSC 4LCUA 4HLZG 5CSBA 3GB7B 1JNLL 4EN3D 4Z76A 3U6RB 3CLEH 1XAUA 5EDXA 1CWVA 3PWNB 4TTDC 2F5AL 4ZSOB 2YRZA 4ZUUA 5JHDA 2AXFA 4N0UB 1I9RL 2OYPA 5IVZB 5BRZA 5ILTH 1CDJA 5BJTA 5I1CL 2B2XL 3CSGA 3QJHA 4G8GA 5CWSA 3U0WL 5DT1L 2WWKO 4L8DB 2P5EE 5CUSH 1CD1B 1JN6B 2FIRT 3BEVB 1RU9H 1IM9B 4KGLA 4P5MA 1S7UB 5J7CC 2KBGA 2J8HA 4LP5A 5IFHL 5JW5A 1NGXA 5BO1H 3FT4A 2AI0H 1I3RB 2NZ9C 2ZUYA 5HJ3B 2BOCB 3LPFA 1CLOL 4AMKL 5J6HB 3G5VB 3MLPA 3FFCB 4QWWC 3PGCA 2I07A 4GRLC 1F5WA 3WS3B 5B38G 4YDIL 3Q2CA 4Y5YC 4B41A 5GRWA 2CKBL 3F62A 5IQ9A 3VD9A 1TNMA 2AKRB 1MAKA 5MEQB 1FYHB 1K5NB 1T22A 4D9RD 3DSNA 1BFVL 3W82A 4TVPE 4KRPD 2DMBA 4NZDA 5CCKH 3GBNH 5BMFH 2GFBA 4UBDC 5KVGH 3BX7C 3JV0A 2PETA 1UVQB 5CSZA 4RAVB 2FLBT 2FRGP 1C7SA 3BPOC 3CSPA 3HNTL 3P0YL 3QUZD 1HH6A 5EC1A 5FYLH 5HDQH 5JIIA 3KS0J 3QDHA 4FZ8L 4K94C 5CHNA 3D18A 1BGXL 1KELH 4PJ5A 1SVZA 4PR5A 4QHNA 3GMOB 4UDUA 1WF5A 3STZB 2KQNA 4WW2A 1UKSA 1F8TH 3ARGD 4MB5A 2BHUA 3MV11 5F1NA 2GTWB 5KSVA 4IIQC 3P11H 4N0YH 1NUDA 4KVNL 4N1EA 4ZQKB 1DQML 2VABB 1D9KC 1ZHBA 2PYEA 1A9EB 4FQ1H 1M7IB 4RMUA 2FIKB 2P49B 4N0RA 2DM7A 3RWDA 1NDMB 5IEHA 1S3KL 5DS8B 1RPQA 1FE8H 5AZEH 5C07D 4PIRF 1KCSL 4XBEH 4P99A 3ZDXF 4ZS7L 1OWRM 1QFHA 4DUVA 1S7RA 3CZJA 4RA0C 1AGDA 5ALCL 4JM4L 3MJ6A 4MJ5B 4KGJA 1EAJA 1AC6A 3HC4H 5EO0B 1EJOL 1F3JB 2CUMA 1RIHL 5DEGB 4I48B 3QUMA 1A3RL 3DUUA 3KPTA 5JXEC 4G6JH 2A0LC 5C8JB 1PKQB 5SWZB 4PV9A 2A83B 2VZ3A 4JHZA 2DLFH 4B5EA 4AEHL 5ACZA 1BAFL 1OTUD 1RIVH 3I6KB 4GXUN 2Q20A 1QQDB 1LD9B 5IV2A 1M6OA 1TXKA 1WIOA 3V6ZB 5KOVC 4ACPA 3STBA 3V6BR 1GC1L 2X1QA 1OAXH 3CFJB 1J0JA 4LSTH 5CJQL 4K8RC 2LFGA 3HUJF 3WO3B 2YXFA 1HI6A 3HUJB 2QKIB 3P73B 4M6ML 1NGQL 1PG7X 2HFEB 1D6EA 3IETA 3RDTC 3HCVB 2WIIB 1XR9B 2YPKB 4UBDD 4X98A 5AAMA 1S7SA 4JDVB 4HIHB 4DK6A 2ARWA 3TBYA 1LDPL 1J86A 3MLSL 1RUKL 1YNLH 4D3CL 4N0UA 4ODHL 3VFSA 3T3M