5CD5C

Crystal structure of an immature vrc01-class antibody drvia7 from a chinese donor bound to clade a/e hiv-1 gp120 core
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
220
structure length
220
Chain Sequence
b'QVQLVESGTQFRRPGASVRLSCEASGYTFISSFIHWIRQGPGQGLEWMGWMNPRHGAVNYPRRFQGKVTMTRDTSIDTAYMELRDLRSDDTAMYFCVTSRTKDYDWDFVWGQGTLVVVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 93TH057 HIV-1 gp120 core
molecule tags Immune system
source organism Human immunodeficiency virus 1
publication title Key gp120 Glycans Pose Roadblocks to the Rapid Development of VRC01-Class Antibodies in an HIV-1-Infected Chinese Donor.
pubmed doi rcsb
total genus 36
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2015-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cd5C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cd5C01
1MJJB 3NA9H 1NCUA 1NGQL 4L4TD 2VAAA 4PS4H 2I9TB 3QDMB 2E6PA 3BKJH 5DUMH 2OZ4L 4NQDA 4KGLA 4MB3A 3C6SB 1YECL 3IXTB 4ZSOE 1DJSA 3PIQB 1ZLVK 2HWZL 4CVXB 3C6LD 3BKJL 4HIIA 4NGHL 1JK8A 4XI5D 1UQSB 2W91A 3FT4A 4N0UE 1H8NA 3FMGL 3WD5L 1YEEL 2MKWA 3QUZC 1NQBA 5AZ2H 1BOGA 5FO9A 4PG9B 1HSAA 3UDWC 1U8JA 4MZ3A 4F7MA 2DQFB 1MJ7H 3O4OC 1YJDH 3OGCB 5DJXA 1QKZH 3ULUF 3O4LA 3HE7B 4HBCL 1FVEA 1JN6B 2X05A 1OB1A 5C6TL 3VFOA 3NCCB 5JR1L 1JWMA 2J2ZA 1EGJL 1T20A 4G43B 4WFEE 2BY0A 3ZKXC 1WZ1L 5C6TH 4WRLA 4FQJL 5DK0A 2EEAA 1WT5A 4FQ2H 4Z7VF 1MCFA 3A67L 4C58B 2DQTL 1LD9A 1QA9A 5AYUL 2Z9TA 1JTOA 1XH3A 4QTHB 3RVXD 5FEBA 1UXSB 4PP2B 1LEGB 3EYVA 1SJVA 2V2WB 3G5XA 3HAEG 5IFJB 1TVHA 3V7AE 5KSAA 1CE1L 3EIFA 5E8PB 4GG8B 1A6TA 3KDMA 5B22A 1YEHL 3AS0A 1FHGA 1YEFL 4G6MH 5EZJA 5TPWL 4DZBB 1DEDA 4Z5RA 5F3BB 4OJFL 1FYTE 4UDUB 3T0WA 3NIFF 4Q9QH 4ZUUA 3GSUB 3GMPA 4Y8DC 3CFDA 4PJFB 1E0OB 1I9RL 1R3KB 3MUGB 1Z9MA 3G08A 5F7KC 4RWYL 1FCCA 5C0CB 5IW1A 1C5BH 4ZPTA 4KQ4H 1OAXH 4CU7A 2OR7A 3W11D 3K81A 1MCLA 4RX4D 1CN4A 4WTZG 3ARFA 1J0ZA 2DWEB 4JQVC 4FZ8L 4BA8A 3RDTC 3DRQB 3UYPA 2NY1C 3D39A 3DV6B 5FUOL 2EH7H 1JNLH 1CLYL 2BSTA 3SKJH 1LEIB 3TIDA 3S8WA 1UYWH 1QHPA 4FQ2L 4ODWA 1WBZA 2H32A 3LKRB 2B1HH 3H42H 5DO2C 43CAA 4JREB 3VE0A 1LILA 1G6VK 4QF1A 2PW2B 3JWOC 4JFDB 1CL7I 2NW2A 2QHRH 5C08D 3TFKC 4PREA 4U1KA 4PBXA 5LJYH 2VLJD 4WFHE 3CCHB 3P4OB 4Z0XA 4XCFH 1EO8L 1BQSA 1JF1B 3BT2L 3HI6L 1D5IH 2VLKD 1FFQA 4MNHA 4TULL 2E3VA 5BRZB 1S5HA 3LKPA 3LDBB 5T1MA 3PV6B 5FKPA 4DGVL 1FL6A 4YFEA 2XI9A 4XGZB 4I0PB 1JTTA 1CXLA 1ZHLB 2D03L 1TNNA 2Y5EA 4IS6B 3DETD 5TH2A 4V2BA 1G7QB 3RUGF 5F89B 1V8HA 5LAXB 1VKXB 2OZ4H 3KPLA 3P73B 4F80A 5IT2H 5DD0L 4KVNL 2YMXL 4RBPK 2KDGA 4HQQL 3E1F1 1M6OA 4UILH 1YDPA 5GS2D 1DVFB 4JO3H 2H41A 4ZS7L 5C0RL 3B6SA 4MA8H 3QUZD 3FOLB 4WHTA 1LK3H 2VB5A 4UQ3A 2E27H 4LARL 1OP5H 1AXTH 5SWZD 4U1IB 1HNGA 3RL2B 1OQXA 5ID1B 5CMAA 1KCUH 4CNIB 1PEWA 3CVHH 4J6RH 3KHQA 2NTSP 2DF3A 3TJEL 3JV6B 5E00B 4Q58C 4BSJA 1J86A 2H1PH 4MDJA 3KPSB 3NACH 4FQXC 2EH8L 4PJCF 4Y5XC 1JZ5A 3VA6A 1RIUH 4DVBB 4PRPA 4UQ2B 1VEPA 5CINL 3TO4D 1O5DT 5J1SC 2GKIA 2E7LC 2V2XB 1R24A 3FB7A 3KLAA 4V2CB 2FD6L 1IAII 5KSUA 1RJLA 4DGYL 3GIZL 5KSAC 2HFGL 3SDAA 4P2OC 5E9DD 2CD0A 2GQHA 2HH0L 1I85A 1DANU 4NFBA 1A6UL 2DIAA 3DRTA 4LCUA 1IM3A 3BH9A 1KLGA 4YHLL 1T1ZA 5IBTL 1NCCL 4RMRA 3C5ZD 4NC0B 4MSWA 4YX2L 3TNMB 5I0ZA 2W9EL 5KG9A 1NC2A 5CSZB 1XF1A 4NO0A 4XNYH 4ZXBA 2VR9A 3L9RA 1SJEA 2XN9B 1P4BH 3MYJB 1B0RB 3OXRB 3KLHD 1MJUH 3NCMA 3ZDYE 7CGTA 1X5JA 2R1WB 3SBWA 5JW3L 2IGFH 5B21A 4R7DA 5KZCD 5DT1H 1DQMH 3EO1A 3TV3L 2E8YA 3SDDB 1ADQL 4JCLA 1UQSA 3VGDA 4NKIH 5GIRB 4NM8H 3O3AB 3EDJA 3HFML 1R5VA 2O5ZL 4HKJB 1J0HA 4P3CL 4TUJA 5AUMA 3MRJA 1T6WA 1U42A 5FA4A 1IGTB 1JJUA 3QIBA 1P4IH 2DM2A 2E5EA 4XP5H 2JB5L 4DEPB 1G7LA 1U8KA 4YH6A 5T1KA 3T77A 1AC6A 4CL7A 1ZANH 1QFWI 3CUPA 3QQ3A 1BJ1J 2AJYL 2MPAL 4DFHA 3STZB 3RVWD 3X13B 1G7IB 1SBSH 4JQIH 4D3CH 2CUMA 4L9LC 3UAJD 3N9GH 2J88H 3DETC 3E2HB 3NGBB 2J88L 4Y4KA 5DMJB 5CKAA 1G9NC 5F9OL 2FX8H 5IB4B 3V8CA 3ROLB 1MFCH 4L3EA 5T3ZL 4LHJB 1IEAB 2GJ6E 3MV01 3W9DA 2C1OB 2OJEA 1FDLL 2R2BA 3BPOC 4NWTH 4JN2A 5FYKH 4JANA 3OAZH 5GGVY 3U6RB 1ZTXH 3ZYOA 5IB4A 2E8ZA 1JPGB 3RUGA 4PJ5D 2X1PA 1FP5A 1NCTA 4MDIB 4UOW1 2GTZB 2O5YL 4CDGC 4ZAKC 1RQ5A 2X70B 4JLRA 1E28A 5DA0B 4BQ6A 5C9KA 3G6DH 4Y4FB 3MRBA 2ZUQC 5D1QC 2EEDA 2CKBB 3WIFA 2UYLB 4QNPE 1NJ9A 4X7DC 2FX7L 1OWWA 1MJJA 4NZRH 1JNNH 1JWSB 3P0YL 5IB3B 5DJ8A 1FSKC 3QCTL 1HHIA 3U4BH 4MJID 1GGBL 5IMKA 1NBYB 4P3DA 5C9JB 3U7WL 1OTUC 5F6IC 1INDL 2Z8VC 3IDJB 1EO5A 3NN8A 1HXYA 1MRCL 3FQUA 4L8SB 1QSEB 3X12A 5EO9A 1F2QA 3BAEH 2PO6D 2VKXA 5DURD 4OSUL 5CHNA 3Q6FB 2B2XL 1TZHB 1IILE 5B39A 4L5FL 5JZ7C 1MCOH 1AHWA 5IBLC 4HKBB 4N1EA 2JCCA 5F1IB 4Z6AT 1SJEB 2A0LD 2YWYA 2PUQT 4NBZB 2UWEE 1B0RA 1QVOA 3CFKA 3NABL 5L9DL 2HKHL 4HKJA 4R90L 1JHLL 1SQ2N 1AD9A 2YD9A 3CC5A 1SY6H 3P9WB 2ATPA 4LVOB 5HYJA 2BX5A 5HI3D 1I3RA 4FXGB 3D25A 1F4AA 1RZJL 1T04B 5SWSA 4FFZL 3BYTA 4TOYH 2G60L 4WCYH 4N5ED 5SWZA 3ILPA 2JB6A 4DN3H 1RJLB 5BVJB 4MQSB 5ETUB 3V6FB 3NCJH 3DVIA 4K07A 5JOFB 3WEXB 2EYRA 1FN4B 4OKVA 2P8MB 3V9FA 2X89D 4OF3A 1FAKT 3RJDA 2XYCA 1D5MA 4AK1A 3NCJL 1AO7B 2EDNA 4OM1H 2VXSH 1A0QH 5EU3B 4EDXB 4FS0A 4RFOH 3QWRD 4O9HH 4F3FB 1B4JH 4JM4H 5EC2B 3QEHA 3RWCA 1CFSB 1CIDA 5BMFL 3UYOD 1BHGA 4CMHC 2F58L 4QXTA 2X9XA 1KCSH 4X6CE 3S5LA 3UEZA 1A3LL 1KIRA 2Z35B 3V79C 3DSFL 3LQZB 4AEHH 1T83A 3K4DA 3MCLH 4G8IB 5F1KC 2R2HA 1TITA 4P5MB 1KCSL 2ZUXA 3BEWB 3D87B 5IHZB 2DQEL 1DSFL 2AAVA 4UILL 1FZKA 3IDIA 4GH7B 4UQ2A 1H3TA 5KG9B 3FAWA 4F15B 1KENH 1NGXB 5MERB 3BPOB 4JRXE 3MUJA 3RWJA 1T1ZB 1R3HA 5IBUB 5IGXL 4QCIB 4TSBH 4EXPX 4Z7WA 2WM0A 1N6QH 4X6FB 1K2DB 2F5AL 1A2YA 3MRKB 3MREB 1YJDL 4R7DB 3KPPA 1J9CT 4NIKB 3LIZL 1KJ3H 4Q9RL 5F89A 5DS8B 1TVBA 1MSPA 1OP3H 2NW3B 3WL9A 3ULVH 4AEEA 4NJ9L 1UXWB 1M7XA 5BOPA 2AJSH 4R4FL 3B9EA 3VFWA 1WCBA 4DN4L 3CH8A 5TE7L 4QGTA 3SKJL 4AYFA 2VL5A 3BRGC 4NZRL 1D9KC 4YAQA 1CFNB 3TO4A 3DIFA 3VFUB 4OV5B 4NQUA 4PJDE 2PYEE 1D5ZB 5CJBA 1KPRA 4UMGA 5IFAH 1DP0A 5BW7A 3CLFL 5GRXG 1JP5A 2YXFA 2VABB 2Q8BH 4WV1A 1T5WA 1KUMA 4P2RB 5F96H 1RUQL 5IMLA 4TVPD 5GSRB 4Z7OF 1E4KA 4X6DE 5A40E 5GGTL 4GRLC 2IPKB 3D18A 3W11C 1Q1JH 5FGBA 3RI5K 4XHQA 3FO2B 4XAWL 2R0KH 3QDGE 3WNNA 3WIHH 1KIPB 4L4JA 5JDSB 1WICA 1HKLL 3DURB 3SKOA 3TN0A 4K9EC 3JV6A 5JLZA 3TESA 2GCYA 5DO2D 5DJ2A 2WW8A 1XF4A 3MBEC 3CPLA 4Y4HA 3L3GA 5CMAB 2P5EA 2D0GA 5D2NA 3F7RA 5TQ2H 1RVFL 1IBGL 5L2KA 2VLRD 2I26N 4HZLB 1CICD 3JWDH 3BD4A 3JWOL 1HHHB 3I6LE 5CBAA 2HJKB 4YDJB 3MC0A 3GJFA 3OKMA 1A1MA 3ULSB 1GPOH 1CFSA 1DBML 2E27L 1MFBH 3DVFA 3TZVA 3NH7L 1S9XA 5D70H 2BNUB 3S34L 3IU4H 5I66A 1K4CA 4PJ9B 1YMHB 3GB7B 4OCYL 1CG9A 3O6ML 3IDXH 1AI1L 4F7EB 3IJYB 2GHWB 2YPVH 1KCVL 2WQRA 5E8EB 3GUTA 3U9PH 2MWCA 1QFUL 1J11A 1IGCH 2ZP0T 3RNQA 1MHEB 3WFCH 3V95A 1KPUB 3GMOA 5HHMD 5BCAA 2X7LA 2EDHA 4HGMA 3W0WB 4LDLB 1Z2KA 4RGMB 3VD3A 3PABA 2IPTH 2FJFA 4QT5B 1VPOH 5CUSL 4Z78A 3NOIA 4YPGB 5AYUH 3QIWC 4RX4A 5ISZD 3BW9B 1B4RA 3GBNH 3OPZL 4EQ3A 3P77A 4RGMC 1FNHA 2DJSA 1NANH 2QSCL 4U1SB 3VJ6A 5K9QG 3MRIA 5F8RC 3MLZH 3QCUL 1J1PL 3EW3B 5E9DB 3IXTA 5E6IB 4HK3J 5HYSA 4JDZB 5IG7B 4ZTOH 4CVXA 4IDLA 4DWHA 2VLRE 5IVZA 4LCWD 3O4LB 2CR6A 4OCLC 5CEZD 5E70A 2I9LA 5IHBA 2BC4A 2C4FU 1TZIA 2PO6A 3W0WD 3BDXA 1CYGA 1CD1A 2VDOL 1DQDL 1NEZB 3BIAX 5EBMB 5E94A 3WFCL 4MJIE 5B4MD 1YNTB 5E08L 4GO6B 4HIEB 1RI8A 3HNSL 4KI5E 1FGVH 4ZOAA 5D2LB 3RNKB 1MWAL 3QXUA 5TF1H 3U7YL 4YC2C 1FN4A 1P7KB 1P84K 3HRZA 1NCWH 4NQDE 1BD2B 5BVPL 5HYIA 1DZBA 4P57B 3OG4B 4Q6YA 1INDH 3TCLA 2N7AA 1W72B 4PJHF 1NSNL 4YDVA 4RISH 1EIBA 1UCTA 2FSEB 5DWUL 4WW2C 4Z9KB 4X4XB 1LNUB 5JA9A 4NP4L 4CGTA 3V6OC 1UM6H 1GGIH 4M3JA 4WHYH 2G60H 4WCYL 4WNQA 4OFVA 3GKZA 3QEGH 3ARPA 4JFPB 5D4QA 1IRAY 1N7ML 1X9QA 1KTKE 3E2HC 3PXHA 3KLHC 5DEFA 2J6EL 1C5CL 1AGDB 3LRSB 3ZHKA 3SE8H 1T2JA 4M62H 5FFLA 3SJVB 2AJVL 1BWMA 4YZFE 1FE8L 4IRSA 3KPNA 1W0VB 1F3JB 4MHHI 4ODUB 2LU4A 4PJ9A 1GOFA 5DQDL 3RWJB 4L4TA 1CICC 3NIFE 1KN2L 2DM7A 2OL3L 3QIUD 3LKQA 2XZAL 4X4MA 3SDCB 3QDJB 2YD4A 3QHFH 1MFCL 1Q9WB 3N85H 4M4PA 4JFFE 4UAOC 4MA1C 3S9DB 1A7BA 1QBML 1Q9KB 5DMYA 3MRRB 1Z9OA 2CDGB 4KJQC 5LXGH 3F12B 3O2VL 5KVDH 4UTAH 3SDDC 4C56B 3PP3K 4QXWA 3O11B 4P5MA 4NQEA 5DUPL 3DX7A 1VGKB 4OGZA 5IVOA 4UTAL 1P2CB 1TXKA 1UWEH 4JHZA 5I71B 4D3CL 4N8VB 1Q94B 5F9AC 3ZSSA 2NXZD 1ED3A 3VWKD 3BKCH 3MJ9A 1C12A 4RGNB 1K9TA 5C7XL 4WENB 3VXSA 2APXA 3D85D 3DJ9A 1YQ2A 4OGAC 1YY9D 2I27N 1Y18A 3P11H 3V0VA 4F2MA 2P49B 2CXGA 4OLUH 5L88L 3SGDI 3VXNB 4ZFFA 1DQJA 2IWGA 3UTZA 2X4SA 3OKYA 4MS8C 1FBIH 3QAZC 4OCNC 3ZT5A 2WLYA 4MNQB 3GI8H 5I8KH 1A9BB 4W68A 3V6ZB 5HHXH 2V2TA 1KJVB 2YMXH 5GGRY 2OTUB 4LLUB 2BVPA 3MACH 3VXNA 1O7SA 4QYOA 2OS7A 1MOEA 5JA8B 1JHKL 4XCCL 1H3WM 5JOEA 5DEGA 2BJML 2P5WE 2H6PA 4P3WA 3D3VA 5BZWA 4PGDA 4E9LA 2E7HA 1WV7T 2MCPH 3QFJE 1DN2A 2D31B 4GLRI 3IYLW 3ARYA 4MHHG 4LEXL 5C0CE 1V3JA 5J06A 1SJXA 4YX2H 4XMKL 1UM4L 3QISA 4Z7UE 4GUPB 4LPCA 2VXUH 3CMOH 2DB8A 3PWVA 5TDOA 3AXLA 5CIPB 1OAUL 3GIVB 1HH9B 2ZCLH 1Q38A 2GSIB 2VC2L 2EE6A 5I15L 4MZ2A 4XP4L 1OAUH 4NQSB 2XQYK 4LDOB 2Y72A 4YEEA 5DMGC 1T1WB 2AQ2A 2EECA 3ZZ1A 1U91A 1CQYA 4YQXH 1OVZA 2B1HL 5FGSA 4PYHA 4LCWE 1F5WA 3B4NA 4KK9D 4QTIL 1BZ7A 3RDTD 2IAMB 6FABH 2VLLB 2YD3A 4XVJH 4DUXA 1A1OB 1M05A 4CBPA 2BVQB 4HFUH 1N3NB 5E99L 2IANB 5EU7E 1YEKL 1UEYA 3QIUA 4WJ5A 5D1ZB 1I1CA 3TJEH 3MO1B 1PVHA 1TDQA 5F1NA 1E6OH 4PJ9D 2IPTL 3QQ9D 3HAEA 4M93B 1IQDA 5HI3C 4R0LA 4KKNA 4JVWA 1KG0A 2NY6C 1RUPH 4AQOA 4MSWB 1U41A 1QBLH 2NTFB 4NKDB 1DDHB 3QUYD 5TQ2L 5JORB 2P5WD 1PGRB 2QSTA 1MRDH 5D2LF 4RMUA 5AZEH 1B2WL 1YYLH 5FYKD 1ND0A 4PJDB 4PV9B 3F7PC 3Q6GL 4MA7H 4ERSL 4O51A 4PLOB 1RK0A 5L0QC 3B43A 4KHXH 2VUYA 4R4ND 1FL3A 3MUHL 3VFPB 4AG4H 2H3NA 1L0XA 4UBDD 5GRVK 2ZUQB 1UWEL 4PJXE 1ZS8A 1INQB 3HE6D 3RHWF 3RTQD 5C08A 1E4WH 3QPXH 2WMPA 4NN7B 4NNPL 1JUFA 1RUKH 3VXMD 3RPIA 4GQPH 1RY7B 2P5EE 5GRWA 3C08H 2L7UA 3VXQA 3HB3D 3BJ91 4AEHL 3HMWH 3BKCL 2H26A 5GGRB 1NUGA 3PWPA 4JB9L 4PYGA 1BLNA 3ARRA 4XBEH 3GJFK 2JJTA 2EDDA 5EU5A 4M7ZB 5EA0L 1JVKA 1MEXH 2QV2A 1S3KH 3BGMA 4PRAB 1W0WB 4NDMB 4UU9B 2BY3A 4YNYA 3U4EA 3SKMA 1VHPA 2CLRB 1YNTA 3B9AA 2J8UA 2PW1A 3SDYL 1S3KL 4ZNEE 1DUZA 1PG7H 1EEYB 4LDEB 2R0ZL 2C3HA 3EFDH 4H26A 12E8H 4XC1L 3FO0H 1T4KA 2JCCF 2A77L 1I85C 4I3SL 3LIZH 2JIXD 1FYTB 4PJBE 5TGBA 3CFBA 3RRQA 2CKNA 5AAMA 5CZVL 5ISZA 5GGQH 1JI2A 2DMCA 2J8HA 1IMHC 3BN3B 2X4NA 5AG8A 4WGVB 5KSAD 2ZUUA 4HIHA 4K55A 3SJVA 1XIWD 4XMPL 2VSDA 3CK0H 3VXOA 4XVTH 4BQCA 4GW1B 1YMHA 1DFBH 4F37F 3K0WA 1JRHI 3QULB 5J9PA 4RIRA 2NY0B 1N59A 3FQXA 4GMSH 3QZWB 1NKOA 4ZD3L 1G7PA 1P2CA 3MX0A 4Y5VA 3SBWC 1WVZA 4ODUA 4ZD3H 1HYRC 3GBLA 4HUVA 2BOBA 1QR1A 3KXFE 4YWGH 2GT9A 3GM8A 5JNYA 1TJIL 3O11A 5DMIL 3T3MF 4WUKL 4YHPB 5TDNA 3ARTA 4EXKA 4G9FB 3K8KA 1Q9WA 4TUJB 4PRIA 4I0CC 4YWGL 1GH7A 2AEQL 1WFOA 3LN4B 4OLWL 3LH2L 2PCPA 1GGTA 5D9SA 3CSYB 4O2CA 4HXBH 1FL5B 4BH8B 4JRYD 2BC4B 5E6ID 1MH5B 1NFKA 1E6OL 4OZFB 2Z93A 1CD1B 4PRIB 4YPJA 5I73B 2VDKH 2JE8A 3A67H 4WFFD 1G7QA 4NCC1 1DFBL 1FO0A 1IGTA 1R3IH 2XT1B 4TNVF 2GK2A 4HX1A 2X4SB 2LTQC 5EZJB 3RNKA 2FJGA 3ARED 1IBGH 2HA1A 5GIRA 1SY6L 1BVKB 2VXQH 2AK1H 3AC0A 2D3VA 4OIIL 3HG1D 1KGCD 4LSSH 5ECJE 2UWEA 1NCBL 2BNRB 4J3WA 4BM7A 3SQOL 3D0VB 1DBAH 2VXQL 5E8DH 1NGYA 3QUMA 3I75B 4JPKH 4KUCF 2W1NA 2QADB 3O3UN 4Y5XB 4PRDB 4QHNA 5C92A 5AZ2L 2OSLA 3GSNA 1LVEA 3C6LC 4OCYH 4KXZI 4Z7QE 3O6KH 2V6HA 5GZOD 3GMPB 2CRYA 4DOHB 4Q9RH 5IROA 2HYMA 1HHJB 3ARQA 1S7XB 4U31A 1JRHH 4FTVA 5SX4H 4XCCH 1YY8A 3IJHB 1QFUH 5GZND 5CILL 1BIHA 5DVMA 3EJZC 2MHAB 5E8EA 3GUTB 1YNKH 3D5OF 3O9WC 4KH2A 3T65A 1OGTA 3ULVF 4X6EB 1CCZA 4H88H 2NMSA 4JO4H 4MQXC 1ES0B 5EZOL 5HPOA 4MAUH 1DQLH 1OP3K 5FCUL 4JFDE 1QNZL 3L3HA 4RMTA 2EKJA 3TBWB 5CCKL 1NGPL 3MOAH 3VXOB 3MA7A 1K3IA 1IAOA 4KK6C 1YEHH 1DEEA 4JPVH 1KC5H 4PRNB 3SDXA 1I1AA 3U2SA 3GMLA 4WFFE 2Y23A 5LWYL 5BRZA 4UB0H 3RUGE 2VIRA 4CUCA 1KC5L 4M7LT 2FECI 4KMQA 3GSVB 3MRKA 4LOUD 1A7RH 4YEFA 4P46D 1UGNA 5BV7H 5E8NA 5CP7A 4GMTH 2A6IA 4PLKD 4MD4A 1MFAL 4L8DA 3TT3H 3CK0L 4L3EE 5HPMB 1E4XL 4NT6B 5E4EB 1N59B 1IL1B 1CXIA 4Z76B 2FZ3A 2NLJB 1A1NA 1DQML 1GXEA 4D9QE 3MODH 4U1NB 2NXYD 1QD0A 4NQVA 2Q8AH 3NABH 4P59L 4M7LH 3ZKNC 1HSBB 4WHTB 2J7LA 3BZ4B 1T7ZA 3I6LD 3MLUH 2OM5A 4Q6IB 4RGND 2NLJA 2C4FT 2DLEA 4NUJA 4FXGA 4EIGB 1ZHKB 3L7EB 3DO7A 4GQ9H 4WI8A 3JVGC 1V7MH 1A6VH 1U8JB 1NDMA 5ICXB 4XH2A 3TO2A 3V5KA 1CGVA 1YZZA 5IVNA 1D5ZA 3QNYA 2VZTA 5HGBB 2D7PA 2JELL 4HJ0D 5CKGA 4XB7A 4HEPG 1MFEH 5J3HC 2J6EA 3KYNB 4J3VA 2IBZX 4ZDHB 3FN9A 3I02B 1J12A 3VXRE 3C9NA 4XXDA 3G04B 2OP4H 2WBJC 43C9B 1MCCA 4G43A 1JPST 3MV8A 4C83B 3QIUC 3PL6A 3DYMA 5DJ2B 4OUOA 1OM3L 1AC0A 4HXBL 2AXGB 4X7FC 2XWTB 1KN4L 3HI1B 5JDSA 2FBOJ 5CIPH 5J6GB 5GGSA 5FECB 1LDPH 3IGAA 4YFLI 5IHLB 2ZWLT 4RZCB 5KOVC 1FNGB 5EU7C 4WWKD 4EN3A 4G8GA 3WEXA 3D48R 1LDPL 3VWKC 4S1RL 4G80B 5A2KH 4N0CD 2Z4QA 5KSBE 2FECL 4FQLL 2VISA 3NH7H 3ARDD 1ITCA 3FQXB 3UYRL 4OGAD 3I85A 2VQ1A 4MJIA 4P9HL 1ETZA 1ZXQA 3EOYG 4LL9A 2X70A 4JLRB 5DJCB 4GKZB 5SX4I 4A6YL 1MIEL 1B0WA 1DQDH 1G6RL 1U8NA 5CEZL 5E1AB 4GKSA 3L3KB 5BS0A 5JW3H 4IHOA 4HT1H 4UUJA 5I0DA 1IQDB 2NY5L 4X6CF 1DBJL 4X80H 3CXHJ 3FFDA 3U7WH 3RGVA 4XTRC 4OIAA 4GAGL 2B0SH 3FT2B 1KYOK 3GRWL 3S37L 1NL0H 1BBDH 4J23A 4K3EL 2HJLA 4YQXL 1I1FB 1HQ4B 1MCDA 2UUDH 1X4ZA 3RAJH 2H2SD 5I75C 2HH0H 4Q97A 1IT9L 2LU7A 4I3SH 5EWIL 3QFJD 4YHLH 2FIRT 3VDBA 4NSKB 3AROA 3DHMA 3LN4A 4Q0XL 1MAKA 4HMDA 2RFXB 3FTGB 4V1DE 5F96L 5FB8A 4PLKC 3ZE2E 2ZSVB 4QRPA 5C0ND 2B2XH 5CJOL 5IJVB 2YD2A 4BUHA 2ID5A 4ORZC 3W9EA 2AV1B 5C0AD 3N1QC 3GI9L 1KF9B 3BPNB 3D2UD 1TJHH 5DK2A 2FIKB 2EDLA 3ARSA 3QXDB 4U49A 5EPMB 3R4DA 5DFVD 4CVZB 5EU4A 2ZUSA 1T80A 2C3WA 5C86A 2SEBB 5D70L 2D03H 1CLOH 4UU9A 1ZK9A 2ZG1A 2F5BH 3P3YA 4U6VH 4ALAH 2YN3A 2DI8A 3LAFA 1NBVH 3PWPB 4AG4L 4Q2ZB 4IIQC 5I1AB 2WWKT 3MJ6A 1I7UB 5KSVA 2CDEB 3CZFB 4JY4A 3TBTA 4PB0H 3CFBB 1YMME 4G9DB 3B5TA 4WEBH 4PY7A 3OZ9H 3BSZH 2JELH 1CT8B 1EAPB 4JKLA 1BQHG 4HDIB 3PF2A 3MV7B 2P5ED 5FK9B 2QR0B 2VZOA 4YDIL 5DRZA 5L8LB 5GGTA 3UPCA 4APQC 2UVFA 3T0VA 1A5FL 4MJ5A 4LNRA 5D2LE 1NAMA 2E9BA 3HE7C 4ZXBD 4NHUA 3S3PA 1PG7W 2YK1L 3GJFH 1ZOXA 1JRHL 1NC2D 4XPFL 2ZCKL 2CKBH 5ID0A 3P9MB 3GIZH 4UDTA 5KVFH 3HS0A 3U0TA 2A1WH 3FCTB 5JPMA 1A47A 2A9MH 4PLNC 4XNZB 3I9GH 3C60B 2FNBA 3ECBB 3B9KB 4PJBB 4YHNA 3QPQD 4NUGL 1A64A 3SDAD 2CLVB 4FQQB 1L9NA 4C4KO 3WD5H 2A6IB 1FIGH 4HS6A 4LRIA 3U36B 3ZE0E 2A2QT 4QRPE 2DQUH 4J6RL 3GHEL 3QIWD 4PJIA 1XGYH 2JK5B 1JF6A 5LGHH 1KJ2B 3MRFA 2GJ6D 4NO2B 1S5IH 4XBGB 3G5YA 3NIDE 5HYSB 1RULH 3MQIA 4PP1C 5I1DB 2D7TH 3BE1L 3EO0B 4I48A 1IQWH 5DLMH 5FUOH 4RA3A 4OQTH 5F7DB 2IGFL 3SGEI 3UTZB 3F5WA 2FEDD 4K3JH 4JRXA 4IEFB 3RWIB 1ZLSH 4TYUA 2GJZA 2OTWB 3UXFA 3MLVH 2PTUA 3WDIA 2EDQA 1F4WH 5D7IE 1R5VB 2XY1A 3H9SA 2EO1A 5IFHH 3KNBA 1KIQA 1NEZA 1MREH 4PRHE 2BDNL 3HG1A 1EHXA 4JFQB 1NDGB 2H9GA 4JM2C 3C6LB 1F3DH 2RCSH 4AEIH 3MJ8A 5T5NG 4X6CA 4OLWH 2PETA 5EOCL 4F58L 5B3JE 1YEDB 2BSSA 2Z4QB 4R2GD 2PO6C 2MFNA 4Y2OA 5KSUB 2A9NL 1Z9LA 5ABDE 2B20A 5DEFB 1TFHA 4JFZH 1NGWA 5C0IB 2OR8A 5ESQA 3BIBX 3AU1A 5CP3H 2J1KA 4J3SA 1V3MA 1V5JA 4JGMA 3QWOA 4PRID 3GMRB 3BH9B 4PS4L 3SO3B 1U6AL 1K8IA 4POYA 1I9JL 4LCIH 4RMWA 4P2OA 2DQIH 5SWZE 5T5FL 4KI1A 2V5TA 4L29B 4D0DA 1RURL 2BP3A 3TIEA 3GGWB 3LSOA 3WO4B 1X3DA 3T8XA 2FHCA 2R1XA 4N0UA 2BSTB 3OJVC 2HRPL 3FQWB 3EYUL 5E6IC 3CMGA 4JG1L 3WNPA 5SWSD 2GY5A 1N0LA 2LE9A 3OZ9L 5C0JA 1T22B 5FM8A 1MHPH 2DBLH 4JFYA 4DKFL 2A73B 2N4IA 4N8VA 3BGFC 4I1NB 2AJSL 4R4FH 5JPMB 7FABL 3JTTB 3BPLB 3BPLC 4HJJH 4YHMH 4ZMAT 3D69B 4ZXBC 5JIIA 2LABA 3OXRA 3LPGA 3C8HA 5FO7B 3MRIB 3FN3A 1DTUA 4LSRH 4P2RA 4XHJD 3QUXA 4RAUB 4OAWB 1I8IA 2DQEH 2FHBA 4M1CD 4HIEA 4GKSB 1DE4B 4LVOC 5D7SH 1IM9A 2RBLA 3QUKA 1VFOA 1MIMH 4LIQH 4G5ZL 4Z7WF 1DQTA 5FIEA 1MQKL 3PWLB 5J11B 2BJMH 5HVHC 2NQCA 4Y88A 1HINH 1T89C 5C0EB 3SE9H 5I8CB 2VKWA 4GBXD 4P23D 2XA8H 3L95A 4HQQH 4ZOEA 1YY9C 4EUPB 3HZYA 1CGSH 3EHBD 1FIGL 2NY7H 3BDBA 2W9DL 1ZHNA 2BERA 4OFIA 2V9QA 1P7KA 3DTXB 1CTOA 5JTWA 3H9HA 1J1XL 1JPSH 5I1HH 4MQXD 4JFHD 3UTOA 4Y7MA 4X7EC 3TBYB 1CF8H 1RFDH 5B8CC 2X9YA 1RHHB 4Z77A 1XF4B 2OQJB 4OBRA 5IJKA 4IIQB 1Y6KR 4RGOH 4J12A 2G2RA 3RVVC 2VDLH 4RSVA 1C08B 3GMQB 1I8LA 4OD1H 4P57A 2APVA 1BECA 1KJMB 5DVKA 3AS2A 4XAKE 2XWJA 4CMMB 3MCKA 4LKCA 4PJHE 3WFDL 4L4VA 3KHOA 1KFAH 3LKNA 4M02A 3REWB 4RZCA 2YSSA 4BQ8A 5HYSG 1AO7E 3PWNA 2OI9C 4Y4FC 1N4XL 2WWMC 2ZOLA 5HHVL 1KFAL 4QY8B 5I76A 3K4ZA 5TDPB 4IOFD 1MLBA 4L3ED 3MCKB 4KI5D 4WNQB 1BZ9B 5BRZE 1SVZA 4I9WE 3MLTB 5CEYA 3VGFA 4YDIH 4QTIH 1T1XA 4UIKL 2NXYC 1CBVL 4MJ6B 3TEUA 3LD8B 5HHNB 3TYGL 4POZD 1IGFH 3ETBF 4DKAA 3T8XB 4H8WC 3CXHK 3QRGH 4RFNC 5IVXA 4RGNC 1UZ6F 1JL8A 3G6JF 1SEBA 4MCZB 4NRYB 4R90H 1B4JL 1OWRM 1HIMH 4NKIL 5DTFB 3T2QA 3LV3B 3BDYH 1I7ZA 2VR5A 5JXAH 5I1EH 4TVPH 1U8NB 2MQCA 4OFPA 3NAAH 4XC3L 4LSTH 4OQTA 2OK0L 3OGCA 4S1SH 3OKNA 4JJ5B 1KCUL 4Q6IA 4HCRL 1I4FB 3QQ9C 2P8PA 1JE6A 1WTLA 5E2TH 2CRMA 4I0PA 4H0GA 3BYYA 3V4PL 5HD8C 4G9FE 1T0NA 4GXVH 1BJ8A 1TJGL 1WGOA 2OMBA 5TFSL 1JWUB 2ICWJ 3D69A 4DOHE 1BFVH 4I2XA 1LP9B 4TNVK 3ZYZA 4CAGA 3ZDZF 4OLUL 5L88H 1U95B 1WSST 3DXAD 3QRGL 4M03A 4JFQA 1LEGA 3EYVB 2PCPB 2X4OB 1WAAF 1KT2B 1BQUA 4F33B 3MRLB 2AXJA 4JGUA 2HFFA 5C7XH 2XN9D 4LSUL 3T4AA 3HNVL 2CPCA 1A7PL 3QG7H 5MEOA 1EEZB 2ENYA 4PGEB 1MFDL 5AYQA 5I1DA 2OK0H 3LHPH 5EWIH 4OB5L 3U46A 2YEZB 5GGTH 5JHDE 5I19L 4K94L 4U1GB 4M5YH 3O41A 1ZHBB 3T3ME 5DVLA 2VOTA 4JFED 1I75A 2M2DA 1FYHB 4NBXB 1BFVL 3QEHB 1VEMA 3SDCC 3O6KL 4X80L 2QHLA 5HYEA 4PRPD 3M8OH 2V9TA 5KANI 2ED8A 3KPTA 1D5MB 1W0WA 5JW4M 3O6FC 3QXWA 1J1XH 2EYSA 1GAFH 3JTTA 2EIZA 2W0FA 4JR9L 3UJIL 4I4WA 5I6XB 2XA3A 1F3RB 1T2QL 2AABL 4MXVF 3H0TA 5MI0C 2UZIH 1T22A 1X5KA 2WP3O 4HS8L 4Y4FA 4Y4FD 5I75B 1IAKA 4BFEA 5INCB 2F74B 1RZFL 4JO2H 4N1CA 4FQXB 5I1IH 3ZT7A 5MERA 3RWGA 5H35A 3QUZA 2YPLE 1QTYT 4P3CH 3KJ6H 3VXSB 1A4KB 3B9KA 4PJBA 3VI3F 4JKWA 3GSWA 5I2IA 4U7SA 3GI9H 3VFPA 2ADFH 1WK0A 3WFEL 4PJCA 1Q94A 1WWAX 3BGFB 4IRSD 5EBGA 2HLAA 3FCTA 4OM0L 5MHSE 5DFVC 3IKCB 2NNAB 4HBQA 3DNKA 3FAXA 4HMEA 1D5IL 4O5LL 2A6DA 1RIHL 3ZKMD 1DQQB 1BQHB 1MCWW 1IGFL 1A6PA 5JORA 5M95B 3MRDB 3TNNA 3EFFB 3DIFB 5DC4B 4LLDA 1VENA 2BVOA 4J4PC 3G5VB 5CGTA 1AIFA 4YHOH 5JNYB 1IARB 2A1WL 1KXVC 3OKOA 5T1DL 1HILA 1URLA 3VD4A 4IRJD 3EAKA 5E8OA 4ZFOA 1WJ3A 1QFWM 1N5AA 1IJ9A 4G6AD 1UVQA 2FGWL 1WTGT 4RQQA 5C70A 3OPZH 5F9JA 1YYMH 3TBSB 4X8JA 1I9IL 3AU1B 4NNYB 4LLYB 5CGMA 5F44A 1GC1C 2BOCA 2EE3A 3QNZA 3PWJB 3QDAA 5MEQA 2E7BA 1S78D 5IB5A 5EC1B 1PSKH 2NCMA 3ARFC 1QKZL 3MRMB 1E4XI 1QRND 2WBJB 1ZT7B 2I5YL 4LCWA 4HDIA 5TE7H 3U48A 5EU5B 5CCKH 4ZOBA 3S4SA 2NXZC 4ODHH 4HIJA 4X7TB 3GIVA 1FYTA 3TCLB 3CFCL 4U1JA 4PPTA 3GMMB 3OG6B 3WFHA 3ZE2F 1QLRA 2OXHA 3LEYH 1EEYA 3GI8L 1EBAA 3GEWB 4Y5YB 3N06B 5J1AB 1T1WA 2DKSA 4GW4B 3SE9L 3K2UH 2AKRB 3SGDH 5CD3A 5GZNC 4PJ7B 3RGHA 1NMBH 1WFNA 4GSDH 3C5ZB 1P5UA 1CFVH 3CFEA 1XGPB 3ARZA 4QHUB 2VQ1B 4Y2DC 4MXVE 4HF5H 5GGSY 1OD7A 3VFNA 1HHIB 3LS4H 3D3VE 5L7XL 4FFWC 4JFZL 4JJHA 1IQWL 3C87A 1KULA 3VFSA 4ORGB 2R1YB 3LZFL 3HRPA 4FFYL 3P4NB 5GRJH 1XGPA 1RJZA 5EFIB 3Q6FA 1PX4A 1NMAH 5DQDH 3RGVB 4WI3A 5KTEL 1IE5A 4D2NA 2CK0H 3MUY1 3ESVF 4NQXB 4DVRL 1WITA 4OZFH 4NGHH 4QLRA 1RZIA 3S4SG 2F74A 2OJZH 5I1CH 1CLCA 3QDMD 1HOCA 2DJ4A 1JFQL 1KT2A 2R8SL 5DFWH 3BZEB 4R96B 5EFIA 2ZSWB 1R3JA 1UYWL 4OGYL 4BK4A 4F9PC 4R2GC 1ZT4B 3HC4L 1JGLL 1FO0H 1T89A 2X4RA 2A74B 3VXSE 4PJEF 3CVIH 4MCYB 5DWUH 2YPLB 4HGWA 2WBKA 3C6LA 1X7QB 5DMGD 4NWUL 3WUWG 3FO9B 2YHGA 4HWNA 1FC1A 1IGYA 1KPVA 5EO0B 1JNHA 2ATKA 1NDMB 4WU5B 2Z8WC 4LLDB 5IEKB 1QFOA 3M1BB 3NBNA 3MRHB 1Y0LB 5KS9E 4J4PD 3MNVB 3BPCA 5E2JA 1SBSL 1ZA3A 2HT4C 3B8SA 2LV4A 3HZKA 1H5BB 5GGUB 5IOPA 2QADC 4G7YH 2CR3A 1JTPA 3MOBH 3MXVH 4MYWB 5CJXA 1WBZB 2UV3A 4TSBL 2NY6D 3HCVB 1OLZA 4U1IA 4G6AC 3PWUB 5D93C 1DN0A 3MOBL 4DVBA 2C7UA 2DTSA 2B4CL 1D6VH 3L7FA 3B9DA 3VI3E 3FZUD 3OR6B 4P2RD 5GGSB 1AQDB 5DEZA 5FYLL 3PHQB 5KS9A 1OAQH 3QUYB 4E0RB 2H8PA 4R4NC 1I7UA 1OGAE 3MGTA 1MAML 2FX7H 3U30B 4HW6A 2IF7A 3EJYC 2EYSB 2APBA 1UKQA 4UT9H 3IGAB 3LKPB 5T1MB 4D9RE 3ZDYF 1I1YA 1A4JB 3C5JA 5C8JB 1VACB 2P45B 1PKQE 3X3FH 4OCSH 3UJTH 1MWAB 4Y8AA 4XBPA 4PJ5B 1N0XH 4OLZH 3CXDH 1OAZH 1WWWX 2P24B 3CDYA 1B88A 4U6VL 5GS2H 3MSPA 4KPHL 1AO7D 5K93A 1WAAE 3FO0L 3B8YA 4DGYH 2NY4B 1TIUA 4RMVA 4ZUTA 4K71C 5E9DE 5F8QC 5D7LE 2X5PA 2BK8A 1FC2D 1XGTA 1KTDA 3W82A 5FHBL 2RFXA 3FTGA 4YFLF 4NT6A 3ARUA 5T1LD 1ZEAL 1INEH 2EEBA 4Z0XB 4NZDA 4Z0BL 4ZSOB 4QTHA 4OCWH 3CJJA 4X99A 2HKHH 4XVSH 4LPYA 3P73A 2COQA 2AEPL 2NNAA 1CD8A 5ID1A 1FNEA 3OHXB 3ZTJG 3VWJB 5DQJB 5GJSL 4ZDHA 4CNIA 4H5SB 1NGPH 3MOAL 4PJIF 1UM5H 2XKNB 4ZUUB 1UM6L 2D31A 1KJMA 1QFWL 2XWBA 3FT3B 4KHXL 1UACH 3I50H 5C0BD 5JXEA 4DCQB 4AH2A 1P6AB 2DIBA 1H5BC 1YDPB 4M93C 4DUWA 1AKJA 1S9XB 2KUTA 2XTJD 4M8QB 5HHME 1EHLH 1FFPB 3Q1SL 5JW5A 5D1ZC 2FB4H 3FRPG 2FYYA 2RR3A 3RL2A 4HULB 2AXHA 1YY8B 3O8XA 4UDUA 3UTTD 2XTLA 3ULUC 1PZ5A 2Z91B 2J5LB 2VXTL 1J8HB 3BH8A 1AFVH 3P0GB 4K8RL 2XN9E 1LEIA 1PYWA 3HUJB 4HK0A 5CJXC 1ES0A 4F7EA 5DD6B 4S1RH 4YDVB 5C0BE 4X6FA 4K9EL 4YGAB 1U6AH 4KTDH 1OHQA 3M07A 3IF1A 2XRAL 1CU4L 4G6JL 4KJYB 4XPBH 3LKRA 2NY2B 2NY4C 4MQTB 4D8PA 1LP9F 5CEZH 5FO8A 3G5ZA 4Y0GA 2AJ3B 4OFKA 5FKAA 2YOCA 4LPTA 5BXFB 5A3ID 2NY5H 3MLSL 3MODL 2IG2L 2R29H 1MUJB 2E9JA 1IAIL 4U1KB 3RX5A 5ESVA 5HJ3A 3HLAB 4IMKC 5GS1A 3ULUH 1E4JA 4PJ5A 1ZV5A 4JFYB 5I8KL 4OZHA 4PR5B 2AJ3A 4AT6B 4ONGH 1RUMH 4OV6F 3VG0L 4ETQB 2VXVH 4L9LB 5LBSL 4WWID 1UJ3B 4WEUD 3IU3B 3BQUD 2X4TB 5TF1L 2PYEA 2AJZB 2O5ZH 3QI9C 1V7ML 3OX8A 1FH5L 1KEML 1EK3A 5JW4R 3TVMA 5I1IL 3O9WD 3VXRB 4Q9QL 2D0HA 3BWAB 1FBIL 3MFFA 5EOQH 1I8MA 3DUHA 3UTTE 1UZ8B 3QDGA 5DDHA 1YEFH 4G6ML 2AK4E 2F19L 1XGQA 3SDCD 1QO3B 2DICA 4I18B 4PP1D 5KSAB 4S1QL 1FAIL 1J5OL 1FL5A 3QUKB 4QXUL 2ZSWA 4K23L 1KCRL 2IQ9L 4U4BA 3FB6A 1VGEH 3QA3B 4BZ1L 5JQHC 4WHDA 4ZUVB 2EDYA 4Z7WE 3SKMB 2IALA 5JIKA 2YPLA 4HGWB 5CBEB 3F5WB 2DS4A 3V52L 4UINL 5EUKA 4E0RA 1TQCB 4X6CB 1E6JH 5DQJA 3ULVD 5H2BB 3TVMD 3DMMA 3MGTB 1YEDA 1AKJB 3PGFL 1CLZL 3ZE0F 5GGVL 1H3PH 2NY3B 5CZKA 1JFQH 3FOMA 4PJGA 5DJDB 1FPTL 3WN5C 4MA1B 2ZCHL 3MRHA 4V1DA 1ZKAA 4U6XA 2HT2D 1RVFH 4OGYH 5I1EL 3HC0A 1T4KB 1YPZB 4KDWA 4XP4H 4DEPC 4R4BA 3STLA 1IGJA 2FJHA 1YEEH 3BGMB 4P2YA 2R1XB 5DJYB 5FV2A 3BI9X 4LHUG 4MX7B 3HHRB 3Q1SH 2BVQA 3QFJB 4XPAH 3V4VH 3QT2A 3WXVL 2ADFL 3L3IB 1G7PB 1KCLA 3IVKA 3VFNB 5ALCL 4LVNB 2A73A 3QXVA 2VE6A 3QP3A 3U1SH 3FONA 3ULUE 1OW0A 3C5ZA 3CU1A 4DKEL 1UWGH 3V52H 4S2SA 3AUVA 1F8TH 5ESAB 3UBXA 3GBMH 4LSDA 1XF2B 1VA9A 4G9FA 4IRJC 2WBJD 2O5XL 5CGYC 4D0DB 1HCVA 3UPRA 4KUCD 4M5ZH 4GBXA 1LK3L 3L5JA 3EO0A 1EERB 3MO1A 4YK4C 4W6XB 1T66C 4EN3D 4HUVB 1VERA 2Q1EA 5HYJE 4JG0H 1N64H 1YN6B 1LEKA 3ARXA 2F54D 2CRZA 1N3NA 3NAAL 1LK2A 4NKOA 1ACYH 4XP6L 4ZOCA 4HKBA 5CWSA 1MVFA 3FQRB 5F7NC 3OF6A 4F7MB 4N0FB 4GRWF 2H9GB 3PE9A 4XHJC 5CJ8A 5D9SB 2EE9A 1CF8L 3EDKA 3RWIA 4Y5YC 4DCQA 4M1CC 1AKJD 2JCCE 1QSZA 4PTTA 1WIOA 3RDTB 3INUH 4P5TB 4NBYB 4TSCL 5E5MB 2I25N 5SWSE 4F7PB 3PQYB 4KVCH 4M6NH 1Q0XL 4P23C 1RJYA 5DSCB 2PYFA 3NCYS 4NQTA 2DQUL 5E7FA 4YHYC 3BQUC 1XFPA 3QQNA 4TN9A 4Q2ZA 4U0RC 3VD9A 1YUHA 1I3RB 2YUWA 3LQAH 4LFHG 1MY7A 2L7JA 1O0VA 4M3KB 1FNFA 5D1XC 4WU5A 2CLRA 2J4WL 3FQTA 1R0AL 4NQSA 3ARDB 2QSCH 3K8MA 3MBXL 2NY5C 3TYGH 2FLBT 2EYRB 4OKVB 4PLJC 2XQYG 1PD6A 5J0BA 1IFHH 2CRIA 3W5NA 1FLRH 3IAGC 5DGQA 2BNQA 1KYOJ 2YRZA 2GYSA 5TE4H 2GFBA 1TENA 4YXKH 3QCVH 2QR0A 3MRBB 3QDME 1ZSDB 4X5XB 1AO7A 1HXMB 1Q9KA 4QOKA 3ESUF 1HYSD 5FECA 2V7NB 2RGSA 3ORJA 4K3JL 3RWEB 2DQGL 1HEZB 3VFWB 2W9LA 5DC0A 4X8XA 5D7JB 4KK8D 1MCIA 3WE6A 2AABH 2VDQH 3QEQA 1L7IL 4I4WB 3ZMRA 3CSPA 2VISB 3VG9B 4HD9A 4JKPH 4OF0A 5E2VH 5TPWH 5HSFA 3SDXE 1AH1A 4L1DA 3LKSA 1RZ7L 1MCQA 1UEMA 1EEQA 5D71L 3AB0C 4TPRH 1JGDB 1FFNA 4GBXB 3Q0HA 3UDWA 1T7VA 4LRNL 2FO4A 4NQCD 2XKUA 5BS0B 3SPVB 1F4YL 2QQQA 4LCCA 4YBLB 3CSGA 1ZVSA 4LLVA 3P11L 5D72H 3UBXB 2FHFA 4QOKE 5DD3L 4U7MA 3BVNB 4OF8A 5BZDA 1BQHA 1A3QA 4P5KA 3S5LG 3U0PB 3V6ZA 4FP8H 3QH3A 4PJCB 1RIUL 3QFDB 3VXQB 2R0ZH 4XC1H 1T66D 3MNVA 1NGZB 1WZ1H 1CGUA 5HYQB 1GC1H 1UG9A 1X5LA 4KJPC 1Y18B 1I1RA 4LSUH 3UO1H 3JZ7A 4M7KH 4KY1L 1WEJL 4TUOA 4KU1A 4J8RA 4NUGH 4HUWA 3QIBC 5AEAA 4H1LA 2XWTA 5C2BL 1JPSL 2G5BB 1IKFL 3DMMB 5E8DL 1IC7L 1ZAGA 4PJFA 1FNAA 3F62A 2A83B 2H45A 2IALB 5CBEA 1L6ZA 1U8PA 2QTEA 1PBYA 4MWFB 4FZEL 3O4LD 3VA2C 1X6NA 1MCNA 3TBWA 3STLB 5MEOB 2YUXA 5DF0A 4IRZH 4XP1L 2BOCB 4IMKA 3R06A 3ZKXB 2VR4A 5SX5K 2PR4L 4V1DD 3IETB 3DXAE 2CUIA 4OTXL 1GPOL 1L0YA 3QO1A 3D9AL 2AXGA 2AVGA 1BFOA 5C0AE 5C6WH 3H9SE 1W0VA 1B9ZA 1I3VA 3LH2H 5EOTB 1P4LA 2AXFA 2D7OA 5JHDB 1IEBB 5IVXB 4GG6B 3MOQA 3K2UL 3P30L 2FATH 4QXUH 3L3OA 2QHRL 1NBVL 3V7AG 3QDJA 3BZDA 3DI3B 5DJCA 1ZE3C 2IANE 3J7HA 1Y6NR 3P4LA 4XI5C 4EBQL 4WFGE 4QEGA 2G9HB 4XT1C 1LHZA 2APTA 2D7NA 3IKCA 4NPYB 1GIGL 5DJ0B 3WXWL 3LOWA 1NFDA 5GJTH 3WJJA 2DQGH 1JPTH 3BISA 1WISA 4ISVB 4JDZA 1YNLL 3Q5TA 1RJYB 5DSCA 4DN3L 4CADB 2WQ8A 3BQUA 4DW2H 3LB6C 1ZLUH 4Y4KC 5DT1L 3WDHA 5HBBA 3ALXA 3VFRB 1H3XA 3D6GA 3R0MA 3SQBA 4C57C 5HXMA 2A6JA 3HC3L 3QEUB 1JZ7A 3NFSH 1DVFD 5JDJA 4XH2B 3TO2B 6FABL 3KPLB 2ZG2A 4PJIE 3PDGA 4LK4A 1MI5D 2Q3AA 1HDMB 3QJFA 3ULUD 3ABZA 5DRXA 5BS0D 1BAFH 3RVXC 3I84A 3KPMB 3BO8A 3AMKA 5C09A 4BUGA 1JYXA 1VFUA 3EOBB 3GSXA 4NZJA 1HDMA 1PJ9A 1YMMA 2A38A 1H8SA 3ZE1F 1M6OB 4PRPB 5I17B 3GSNB 3Q48A 1ZHBA 3DRQA 5J6GA 4XPFH 2NY6B 5C08E 4P9MH 2NX5A 4JFFD 3R1GH 3TN0B 4ELMA 4RGNE 3BEVA 4BH7A 1HINL 2VLJE 4WFHD 4PGCA 4PJXA 2N1KA 3BWUC 4S1SL 5IW1B 1MQKH 1MCRA 4UT6H 4D0CB 4HPOL 2Y06H 1C7TA 4X6BA 1A1MB 1JMXA 3UTTA 5DRWA 2EC9U 4HIHB 2HTLD 4GW5A 4XXCA 1K8DA 4ZYKA 3SDXB 2XNAB 3QR2A 2Z0BA 3T0AA 1ZLVH 4HUKB 2CJUL 1IKNA 2DL9A 3DYOA 4BKLA 4Z7WB 4OLYH 3U0WH 2ITCA 2VAAB 2WIIB 3RIAK 1OL0A 4Z7QF 2R0LL 1LNUA 4OZIA 5T3XL 5ALBL 4QT5A 4P9HH 5C0DB 2R56L 4YUEL 2MSPA 1I7TA 2EYTA 3EHBC 2NW2B 3QEGL 5E1HB 2WUCL 3TA3C 4UTBH 1I1YB 1UENA 4X4YB 4P59H 1WCBB 3D39E 4XVSL 1PDKA 3PHOA 3QDGD 5D6DC 2HN7B 5C0AB 4YK4B 4NQVB 3O6LH 4FFZH 4W4OC 3E3QC 15C8L 1DLHB 4R3SB 1J0KA 5GRUH 3CXDL 3RVVD 2AJXL 3WBDA 4LCIL 1I3GH 1I4FA 3H3PL 4MD0A 3VMNA 4F7CB 3MJGX 5FO9B 4XNMB 5TH2B 3NCYP 3OJ2C 4NC1E 4HKXA 1GZPB 4XMLL 4JM2F 2OP4L 5EU6D 5K33A 1S7WA 2FDBP 5GSVB 5EIIA 5JW4Q 4P46A 4R7NA 4YHOL 2A83A 1NUNB 1M7DA 3GNMH 2ZUTA 1P5VA 5JLZB 1T83C 2ZZUT 3ARBA 4ALAL 2CO7B 5DHVB 1NANI 4OCWL 1NC4B 5KSBA 4OZ4B 3LN5A 4GS7B 3W2DH 1YYLL 2A6JB 3QEUA 1RIHH 2W65A 4MXQC 1YNLH 3PQYD 3CC5B 3IDUA 3IKKA 5IUSA 1OSZB 1IAMA 1KENL 3WSQL 3NA4A 1KELL 4Y1AB 4IRJB 5EOCJ 3PWUA 4TSAL 4PJ8B 3DXAA 1HN1A 1TQCC 5JOFA 5FYKE 3JV5A 4CVWA 3OAUL 4KKLD 5D7LA 5F7MC 4H5SA 4LASL 3MMEA 2Q86B 4X6DF 2B4CH 1WAAA 5HHOE 1K85A 1AE6L 5EC2A 4FTVD 1AGFB 3OXSB 1W2KT 3AS1A 4H1LB 4OFYA 4I0PD 4X0KA 5C0IA 3GJEA 3RWCB 2IADA 2HAZA 4Y19D 4OCXH 4HAGA 5EU3A 3LRGA 1IGIL 3RY6A 5LBSH 2GJ6B 3P4MB 1YNKL 2W0LA 5JUEL 3LN9A 4JPWL 5CLWA 4NHCH 3FO1B 2Y07L 2Q7NA 2CH8A 5D7SL 3DX8A 1UA6L 2PF6A 4E41E 4JY4B 2IH1B 5D6CB 2YBRB 5FGBC 1HHGA 4RIRB 3GHBH 1KB9K 2HFGH 3IDNB 1FZKB 8FABA 2QQLL 1DDHA 3CVHL 4G6JH 5D5MB 5T33H 1IC7H 5EORH 2X4QB 2AERT 4M9OA 2FX9H 1TTUA 1OOAA 5HDBE 1NGZA 3A6OA 3PNWA 1KJ2A 5D1XB 3CFKB 5IB3A 1P7QB 3THML 4RAVB 4TNWK 3S88L 1TZGH 4U2YA 3IJSA 3LD8C 1G7JA 3QH3B 4GMSL 1XIWB 2BVYA 1IC1A 3PGCA 4LF3A 2GTWA 1KPRB 4KZDL 1Y0LA 1INQA 4JFDD 4M1GL 2JJTC 2P42B 4PJHB 5LQBH 4R0LB 5T5FH 1C1EL 1A7NH 3F65A 5EO0A 4PRAA 1P84J 1YMMD 3H9HB 2OI9B 5IFAL 3VGAB 5SWQA 4P2QE 1G7IA 3GKWH 2C26A 2J5LC 1RUAH 2IPKA 3QXDA 3QFDA 3QO0A 1X7QA 4JDTL 2H26B 1VFAA 3S34H 1R5IA 3UTTB 2R69L 1A7RL 3MCG1 4YHIA 1AGCB 4YXKL 5BV7C 3HZKB 2DBLL 2ICCA 3P9LA 2KZ1B 4HHAB 3GMRA 2NX5B 1NDGA 3F58H 3HZVB 5F72S 1TNMA 2IFFH 5IB5B 3WUZA 2D9CA 1J1OH 1YN7B 2GTZA 3CDCA 4OGXL 4UZGA 5TE6L 1CFBA 4HXAL 4I5BA 4LLAA 5D7IF 5HDBF 1BF2A 1QSVA 4UT7H 2EDEA 2IQAA 4PGDB 3KLSA 2VDQL 3H7BB 4EI6B 4JZJC 5I1LB 3BHBA 3KR3H 1ZSDA 4KK5C 5IM7A 5HVGB 1EFXA 5DUML 1JNJA 2VYRE 1NJ9B 4OZFG 5GGRA 4MNGA 5H37H 5FHAH 3S37X 5MI0B 1KBGL 2YD6A 5BW7C 1W72H 1QEWA 3S36L 4ACPA 2HVJA 3PP3H 5DI8A 1DANT 1CD0A 4KZEH 2AK1L 4QRUB 3HPLA 3NVQA 4NO0B 5ICZA 1HXYB 4ZPVA 1CDIA 3F12A 3CFEB 4MDIA 1QBBA 4A6YH 2EDFA 4TPRL 4G8EB 1RK1A 2GK0B 2EDWA 2X4PB 3INUL 1RZ8A 1NBYA 3T3PF 3O4OB 3A0OA 5I1HL 5D6CA 4CADA 3T0ED 4PGBA 3N9GL 4P0DA 2DMKA 4K71B 4KAQL 4MVBC 3P4NA 3RTQA 3OKLA 1IGIH 1J8HE 4Y4HC 3IVKB 3PQYE 1MREL 4JFOA 4ZTPL 4H8WH 3UPRB 1KTRL 3L5HA 4EI5A 5L2JB 2A0LC 5FA4B 4HS6B 2X4QA 4ONGL 3VG0H 1QSFB 3SDYH 1QSFE 2OZ4A 3VWJC 1EEUA 3D85B 3KS0J 3L1OL 1RPQA 3WNLA 2KPNA 5L2KD 2FATL 5L6YH 4WTZA 3SOBH 1BIIB 1ZA6A 3O2WL 2GTWB 1JGVL 5EUOF 2DD8L 3QQ4B 5L7XH 4FMFA 1KLUB 1HCFX 4F57H 1PX3A 4WTWA 1P7QA 1AJ7H 4KI5F 3LS5L 4PGEA 3H8NA 5DGRA 3QCVL 3R8QA 4LVEA 4WUUE 5KBNC 3QB7C 3W5MA 1HKLH 1YEIL 3VD5A 3UTPE 2C4XA 4YXLL 1A6ZA 1WT5C 3FB6B 4FFWD 2HP4A 3TH4T 4MA3B 4B5EA 4HHAA 2R15A 1WFTA 5HGHA 4XX1E 2IJ0C 4OLVH 1MRCH 3PL6B 4ONFL 1W72A 4NWTL 3FO1A 2VZVA 4BZ2H 5CSBA 2XZCH 1GGUA 1OT2A 4R6UA 2GSGB 3C8KB 4Y19A 5D7LB 4LLWA 1ZT1A 5T3XD 4OZHF 1RZKL 4B0MM 3U9UA 2DWDA 2FB4L 1N5YH 3RZCC 4RFNB 4JG1H 1I7TB 2EYTB 2WWKO 3UJJL 3WS6A 3MNWA 4FA8A 2Z31D 1RUAL 3TLRA 1AGFA 3VCLA 1NGQH 2RB8A 2VERN 3RU8L 3SCMB 4MS8D 1S7UB 4BJLA 3IDGA 3L5IA 1C5CH 3KPRE 3GMMA 3O6FA 4UT7L 1LO2H 3MZTA 4J2XA 4KJWD 4KK5D 1NLDH 1CZ8H 4KRPB 3A6BL 4NRYA 4NNXA 3PNWB 4OGXH 3K1DA 43CAB 2DKMA 1UCBH 3GSRA 1U3HC 2XTJE 8FABB 4GXUN 3CU7A 1XEDA 4MJ4A 5E1AA 5H35B 4NO3A 5JXAL 3HE6B 4JFEE 5HDLA 4WUUA 1R6VA 4K8RC 4NUJB 2YD1A 1MCSA 4P5TD 4NNPH 1DSFH 3LV3A 3TYFB 5EOCH 4F58H 2QSVA 1JPFB 4Y1AD 1UZ8A 1YPZF 5CGYD 2R29L 5DJZA 3VXRD 3WKML 3BZ4A 3TH2T 1LDSA 2X7LB 1JF5A 3Q5YA 5EBWA 2CSPA 1MQ8A 1Z5LB 2CUHA 4MAYA 3WV0A 3K3QA 5TE4L 3QSKB 3TYFA 4U1NA 5EBMA 3C5ZC 4XAKD 5K9OB 4L9LA 2V2WA 5ICXA 3MLVL 3ELAT 4N0FA 4Z78B 3EYFB 4HKXB 2VDNL 3D0VA 3FFCE 4I18A 3ZHLA 4F33A 3IB4A 3EYOA 3ILQC 2GUOB 4CN1A 3GO1L 2D7TL 3BE1H 5DLML 2AI0L 5FOBA 2HTLC 5JQ6H 1FGVL 4R8WH 1OAZL 1QP1A 2JTDA 2VXVL 4PG2A 1FZMA 4EOWH 4HZLA 3HMXL 3TV3H 2HJKA 4YDJA 2ICEA 1NLBH 2FYYB 4BELD 3REWA 4BZ1H 1MJ8H 4G3YL 2JJSA 4MLSA 2OSLB 2G2RB 4I0KA 5HDOA 3IFPB 4Y16D 1CK0H 3T65B 1JNLL 2F19H 1Z0MA 4V1DB 1FG9C 2EE2A 4GRMA 5DD6A 3QFJA 4P99A 4JY6B 1DUYA 4AY0A 2WIIA 4JY5L 3AS3A 4ZO8A 4MXWH 5E0QA 1F3JA 1Z3GL 2VLKE 4PFEA 4PLJD 1J8HA 3KYOA 4PJAF 4WW2F 3K74B 4Y1AE 5ACZB 2NX5D 3NZHL 4P4RB 5KVDL 4AIZB 1J1OL 3CDFA 4ODWB 5T5NF 1A6TB 3HAEH 3UAJC 2V5YA 4N68A 3VXME 2EICA 4HWEH 4QHLA 3IU4L 4G9FD 4GRWB 4YBQC 1S7UA 3TCXA 2B39A 1J88A 4HWEL 2BCKA 3C8DA 4WWKB 2FWOB 1IM3B 3ARWA 3MNWB 1HHGB 1KJ2L 5C0CA 1HYSC 3E6HB 4Z7VA 4YDKL 5CSGA 4L3CA 3P0VL 1G84A 1C5DB 1NCDL 4LGPB 3TIEB 5HHOD 5E95B 2PW2A 4G80A 4F37K 1YEGL 3OKDA 1MI5A 3S96A 3RX7A 1P4LB 1HSBA 4G6KL 3RA7L 4PRNA 5D93B 2Y25A 4HMCA 4L4VE 1A6AA 1CDBA 4P23A 3KPRB 4MXQD 1XF2A 4N0RA 5CZXD 4IRZL 4XP1H 2BRRL 2VN4A 4ZAKD 4NQEE 2GEEA 1OARH 2XPGB 3L5WB 1CFNA 3TO4B 1S7TB 3BD5A 4LEOB 3BKMH 5T1LB 4P23B 2YK1H 2JIXB 3OTTA 1OARL 3BP5B 5FXCH 1LP9A 4JDVB 4O4YH 1CU4H 1BVLB 3DTXA 4P5TC 1AQKL 5IG7A 5IQ7L 2F9BT 1TVHB 4QHKJ 3VXUE 1EXUB 1BFTA 1FV1A 1OTUD 2CXKA 2X40A 4XMKH 3IDXL 4NCC2 3BPCB 5T33L 2XA8L 1M1SA 2ZUYA 4KRPD 2G5BA 3BVNA 4KQ3L 1JUFB 1TETL 1OQOA 3KPRD 4RRPA 1F11B 5I8CA 2AGJL 3NPSB 4FMKA 5EZLA 5K9OA 5JZ7D 2FEEL 2K7PA 3RKDD 1RHFA 4TRPH 1L7TL 1R3KA 1D9KA 3MUGA 5HHPB 3UBXG 4NJ9H 3OBAA 4JPWH 4OZGF 1RUKL 3I6KA 4QHMB 4HEME 3ES6B 1J0JA 1A02N 1YEJH 3VMOA 5ITFB 3QIBD 5DMKB 3IJHA 3C60C 4KKAC 3ARVA 1GHFL 1ZLUK 2DWDB 3RVTC 1AXSB 1V7NH 4WO4C 3UZEA 1R3LB 4GKNA 1JGUH 4MAYD 4EUPH 1DLFL 3CVHA 3U4BL 4L4TE 4RWHA 4AL8L 3RIFF 1CL7L 4AIXA 1ZT7A 1T1XB 4OI8A 4NM8L 1A9EA 1F4WL 1QUNA 1RV6X 3AMLA 2R2EB 3WHXB 3PWJA 4ZFGH 5EBLA 1RJZB 3IDYB 4NNXB 1VACA 2A6KB 1X4XA 1FNSL 5A2FA 2V5SA 3BT2H 5DJAB 5KJRL 5AAWA 4FFVD 2VZ1A 3S5LB 1KN4H 3PHQA 1IC4H 5KS9B 2MQ0A 3RTQB 5EO1A 5DJ0A 2APFA 3U7YH 1U91B 4XCNA 5F7HA 3U7AA 3B5HA 4PJ7A 3IDJA 2NZ9C 1Z9SA 1G9EA 1LMKA 1UM5L 2J3SA 4O51B 1MHCB 1JWSA 5A2IH 1EJOH 2HRPH 2VDPL 3DBXB 3IS0X 3LKSB 3B5GA 3QQ3B 4HKZB 2LAGB 2R4SH 4XRCA 1FZMB 2OTUA 4LLUA 3HS0B 4FG6D 2HMID 3U9PL 1QRNE 3QO0B 2VL4A 2HG5A 2ZSVA 1R3JB 1TZHA 4FP8L 1ODAA 4GXUM 2ILLA 5BZDB 2E9WA 5BZWB 1KPVB 4ETYA 2AP2A 4NZUL 2NTFA 3VDCA 5SV3A 4GFTB 3PV7A 4JHWH 3KGRA 3NACL 4HIXL 2IAND 3N1FC 4ZTPH 1YN7A 2HT3C 5EG6C 1VPOL 2DQCH 3QQ4A 4I8DA 4MWFA 2BY1A 3TO4C 3KR3L 3NIDF 1S5IL 3GNML 2YRPA 4JN2B 4POUB 3G5YB 2L4OA 4HIJB 1KSRA 3HKFA 1PLGH 1NMCB 3MFGB 4QOKD 4P2OD 5FYJU 3TWCH 4Z7NE 3MRMA 5DMIH 5KAQF 4W4NA 1KIQB 1LO5B 5D2NE 1EPFA 5K59F 1JPGA 4N0UB 3QXAA 2E7MA 5EORL 2HRLA 3LPFA 4HWBL 4NN6B 5ETUA 3V6FA 2NXYB 2X9WA 3T0BA 3VGHA 3W9DB 4XAWH 3QAZB 2R4RL 2X6MA 5J6HA 4DK6A 4PB9H 5D5ME 2VWEE 4YIQA 4B7LA 5CIPA 4YLQT 1TETH 1CXFA 4QXTB 2XG5A 2R9HC 4KKAD 4JZOB 2I07A 2R8SH 4FQJH 5I8OL 5CILH 3RVTD 3PG2A 4PGBB 4XVTL 2VLJA 2DQCL 4KZDH 5HI4C 2EZ0D 1A7PH 5A1AA 1KG0B 3T2NL 5ESQB 5FDWB 4XWGL 1KTLA 2MOVA 3O2VH 5J56B 3NIGF 5C3TA 4OF7A 3MBXH 3N50A 5GGVH 4EKXA 3RUGB 5HVWA 5AG9A 4LLQA 2HJLB 3ALPA 3NCBB 5BOZG 4GG6A 1ND0B 4PJDA 4LP5A 1AD0A 2DM4A 2HLFC 3MYJA 1T7YA 3O2DH 3QG6A 3RA7H 1VGKA 4Q0XH 5D1XD 4ODTH 1FORH 1N26A 3SY0A 5FA3B 1ITBB 1TCRA 3V5DB 1ZGLA 1CFQB 1GOGA 4FFVC 4O9HL 3O6MH 2IFFL 5CHNB 4GAFB 3SE8L 3MLPA 2Z31B 4BK5A 3WFEH 4PJCE 4HFUL 2P8PB 1S9KC 1ORSA 2F54A 1NCDH 5B38G 5DD5L 3QJHA 1CFQA 2XKSA 1CGWA 4Q9CA 3ARBB 3ARBC 5JUEH 3QZWG 4RQQB 5IK3B 4NM4L 4LFHD 1D3CA 3NFNA 4MD5A 4X7SH 4LPUA 2Z31C 1LO3H 2KH2B 4HUUB 3BMWA 3I6KB 4ODSL 1F97A 2QKIA 2HFFB 2XFXA 4L8CA 5C07D 3BP5A 1RU9H 1DN0B 1LO4L 4Z8FH 4ODSH 1OAYH 1UM4H 1LQSR 3D0LB 5D5MF 4I3RL 3QDJE 3B9VA 3QYCA 5DJDA 2X4OA 32C2A 3LKOB 4JFXB 2Y6SC 4O2EB 1VFAB 3MV11 4RFOL 3K7UA 5H2BA 4G8GD 5D1QD 5EIVA 4XP9H 4W6YB 5HY9A 5ADPL 1J8HD 3MMEB 1NFDE 5B38A 4NRZA 2XRAH 4PGJA 3O0RL 2WUBL 3QXAB 3HPJB 2O5XH 4BH7B 3AVEA 4GRLB 5CUSH 4LQ1A 4RGOL 4ELKB 5KVEL 4O4YL 4R4BB 2ZUWA 3DX9B 5HGDA 1T03L 3LEYL 4KROB 5I66B 1CDCA 4NQDD 1IT9H 2YBRA 2FL5B 1CGXA 1X6LA 3G08B 4JVUA 3ULVL 3IRZA 3ME0A 4YR6A 4Q74A 1PG7L 1MFEL 1S7XA 3REVB 1AGDA 3CGTA 4HKZA 5DTFA 1CQKA 4KKBC 4PRBB 1HI6A 4G42B 1JHLH 3E6FA 2HN7A 5C0AA 1IAOB 2EDTA 3JUYA 1MHHA 1U58B 4YHKH 3P4MA 2UY7A 1CG9B 3RWEA 4CU6A 4YBLC 5T1KD 4GMTL 1PY4A 1N7MH 2FZ3B 2CDFA 4MJIB 1A14H 3PWLA 4S1DC 5ITBL 1ONQB 2ADJA 4G7VH 4J1UB 1P1ZA 2R4RH 3Q3GA 4XRCB 1K4DA 2VE6B 1H3PL 4RAUA 1XGQB 3R1GL 5IIEB 3F6IA 1KPUA 1CDUA 5B8CB 1FYTD 4YZFF 1SEBB 4MCZA 4I2XB 2E9IA 3PP4H 4U1SA 3TFKD 3AM8C 3VXRA 3DBXA 5SX5H 3SN6N 3T0EB 2DIJA 4WI7A 3CFIC 5SWQB 3WMSA 1OSZA 3IU3A 3JV0A 4LSPH 4JM4L 1H3GA 4GG8A 2HJFA 1B3JA 3WFBL 5HTSA 4XPGL 4HWBA 5DK3A 2D9QB 4OM1L 3UJJH 4U33A 5ESVB 1X5HA 4LSVL 2OLDA 3ZE1E 4YAQB 4DGVH 1I1AD 4TUKL 4JN1L 4XMLH 4GG6F 4IRJA 3ARBD 4IOIB 4P9ML 4X6BB 3STBA 1G7MB 5FYJE 5ILTH 1YPZE 2HWZH 1K4CB 5CFHA 3SDAC 5JW5B 2GCYB 3RVUD 1QO3A 3JTSA 4OCMC 4PGCB 4PJXB 4P48A 1RHHA 3EJZD 4K7FB 4J3XA 4Z77B 3SO5A 3H0TB 3P0VH 3SE3A 3O8XD 2DN7A 2JJVA 2MHAA 2NPLX 5T1DH 4L8BB 4BZ2L 1PW3A 3LB6D 4U7KA 5I76B 1NAML 3CFDB 3VGBA 3CLEL 3VFMB 4GKNB 3RWFB 3WKNA 1AXTL 1NBQA 1ZANL 5MHSD 4X9FA 5CZXC 4Z5RB 5F3BA 3VE0B 3CLEH 2C3VA 4FQXD 3VWKB 3C6SA 1RSFA 2DWEA 4LSQL 2BFVH 5EH1A 5F7FA 1ORQB 3RU8H 1VFMA 1UT9A 1HKFA 2DL2A 3FFCD 1MUJA 1MI5E 1EVUA 5HYFA 3CFJB 4J7RA 1CDHA 3AB0B 15C8H 2AK4D 4XVUD 3P0YH 2EH7L 4HPOH 4FTVE 2HLAB 1MHEA 3CH1A 3DUUB 1JGVH 4S0SD 1KTDB 1P7QD 3IFLL 2BOBB 4KRLB 1B90A 3UP1A 4U1GC 4MVBD 4X6DB 1A4KA 4IMLA 2CIIB 4JDVA 4GJTB 4DK3A 4P2RE 3Q3GB 4DAGL 2MTPA 1F6FB 1NMCC 1T1YA 4HUMB 1M7IB 3L95B 4M6AA 2OMNA 1XF3B 2B1AH 2W9EH 5T3XH 3IT8D 1AY1L 4ZUWA 4Y89A 4L8CB 3AAZB 4FN0A 1MWAH 2ICWB 5D1QA 1MELA 4WO4D 1M4KA 5J7CC 4BFIA 4MD5B 4PBWD 1ZEAH 4R0LC 5GISL 3MBED 2XY2A 4MB5A 3IDMB 3KJ4B 5J3HD 4PV9A 1EH9A 4FOMA 1W8OA 5L0QB 2PR4H 1RZJC 3GFUA 4MA8L 5FOBB 1HH6A 3X11B 5SV4A 4J3UA 5DHVH 3HG1B 5KVFL 2J8OA 1H15B 5C0BB 2DQIL 3FMGH 3T08A 2VTFA 3GRWA 4HC1H 4KPHH 5IT2L 1U92A 2HJFB 4N9GA 2BSRA 1I3GL 4DFIA 3HMXH 3RZWA 3ULSA 1JGEA 1XZ0B 3RWHB 3TF7C 4ODVL 2ZOLB 3G6JE 3WFBH 4JZNB 3HC4H 1OF2A 5ENWB 3P9LB 1TQBB 4NRZB 2K7QA 3OAZK 3FRUB 4U3CA 3C09C 4ZNCD 2K1MA 4TULH 2EXWC 2VLRB 3DV4A 4WWKC 1BLNB 4WEBL 5HHMB 4TUKH 5DQ9B 3RTQC 5D7JA 3N85L 5JMRA 3BKYL 3VFTA 3T2PA 2DQTH 4P4KB 2B7DT 1AQDA 2M1KA 2J8UB 5KVEH 3F7VB 4FQIL 1AGBA 5KAQG 5LQBL 3RVUC 1RK1B 4M5ZL 25C8L 3MR9A 5GHWL 1A3RL 4BSWA 3HG1E 4PRHA 5GPRA 3TM6A 3T0DA 1KGCE 2ZJSH 2Z91A 1JGDA 5KW9L 1SMOA 3KYKL 4ZS7H 3U9UB 5C0RH 1K8DB 5DYOB 3DECA 3X17A 4LGSB 3MRPB 4U1JB 5DS8A 4XNQB 3BZFA 3QI9B 3GSQA 3KXFA 1LE9B 1F4YH 4YR6B 4S1QH 4XTRD 4KJWC 5C0GA 4G8FA 1F90H 2UWEF 2OR9L 4K23H 1OAQL 1JZ8A 1GL4B 4WI6A 2MQ3A 5J12B 5D8JH 2YKLL 1MF2L 1A14L 1QSEA 3HUJF 5BV7B 4D0BB 2H2SC 3FFCB 3KG5A 4DVRH 3H9ZA 4PJGE 5H8DA 2DMBA 3BP7B 2O5YH 3T09A 3TZVD 2YXMA 3K4AA 5J12C 4LVNC 5AD0A 4JO4L 3HI5L 3SJVE 1KJVA 2BDNH 4OCSL 1CLZH 3UJTL 1DCLA 3VGAC 3QEQB 5IIEA 5FYJL 1FPTH 4KI5C 4Q9BA 1JYNA 3T77B 2JK5A 4OFDA 1A6ZB 4Q6IC 3DARA 4G3YH 3N1PC 1UA6H 1F58L 4PJ5E 1XMWA 4FABH 4KDTA 1CK0L 1MRFH 2VZ3A 4JFEB 4TUOB 5FAAA 3CZJA 5IR1B 2YD5A 2J6EH 5GRYA 4EOWL 3ZDXF 2MPAH 3VRIA 2FLRT 4LLWB 2R2BB 4NN5C 3UC0L 3M45A 3HNTH 1B0GB 4XBGA 1NPUA 3GM0A 4DGIH 4ZFGL 5IMLB 3CZFA 2YKLH 2QLVB 4HWBH 1QYGL 3SJVD 1IGCL 4C55A 1N5AB 7FABH 5J13C 3THMH 1IC5H 2ZKHL 1C8PA 4U1LB 2X1QA 3BP6A 5F7EL 1RMFH 3VCLB 1BZQK 2E7CA 1FNGA 3SCMA 1RUPL 1B0GA 1KV3A 3HI5H 1IGYB 4BZYA 1K3ZA 3RPIB 3HMXA 3W39B 3D0LA 1RZFH 2OJZL 4XNXL 1HHKA 1REIA 5HD8D 1P53A 4JKPL 4X9GA 2VLJB 3FN0L 1X5XA 3E0GA 4OCRH 5ANMB 4HH9A 2NYYD 4AENB 1SEQH 1H0DB 1A7NL 4PG2C 3SKNB 4YJZL 1NAKL 1J7VR 4Y19B 3NMEA 4JAMB 3WE6B 3SEPA 1SM3L 5EULV 1DBMH 5I73C 5D7LD 4RNRB 3L9RB 1U8IA 2QQKL 4UUJB 3VDAA 5B3NA 4LSQH 1A0QL 1H0DA 3T1WA 4HBCH 5LKNA 4KHTH 1IGJB 1UADC 2FJHB 2XG4A 3RL1A 1FFNB 1F02I 4GKZA 3R06B 3PHSA 3NN8B 4YO0A 4H25A 1TCRB 5DXWA 3RHWK 4DQOH 5JHDD 5EUOE 2DBJA 3W0WE 2RAMA 1EX0A 4K94C 3GK8H 1Z6JT 5JO5B 1KB5H 5DJ8B 1ZT4A 1AHWB 3WN5A 5DYOA 2ERJB 1WWCA 4WO4A 4HV8B 4KC3B 4Z7UA 1DQJB 4LIQE 2J4WH 1H9VA 4EEEA 1QLFA 1II4E 1AIFB 5C2BH 4M7JH 3FB8B 3TBVA 5C0JB 4PJGF 5KSBF 4KQ3H 3OKOB 3D85A 2OBGA 4OZHB 3V6BR 4AT6A 5I30H 5JW4N 5J4MA 2P5WA 4PJAA 4WW2A 1SYSB 3B6SB 1NCAL 4I48B 1SJHB 5IB2A 3MJ9H 4KK6D 4ZUSA 3AY4C 2BHZA 1QQDB 5IMOB 1Q72L 5EPMA 2BMKA 2DAVA 1RK0B 2NY1B 1FNSH 4IMLB 4CMHB 4UV7H 4JQVA 2XZZA 1MCOL 5ALBH 3HZMA 5HVHB 1V7NL 1K5NA 1BD2A 1XF5A 5BV7L 1JWUA 1EVTC 1KJ3L 1CI5A 1D9KD 2CK0L 3HR6A 1EZVX 5ERWB 1Z0NA 3ARGA 5FDYA 1KN2H 2OL3H 5C3LD 4GKOA 3VRIB 4EIZC 2DJUA 3RDTA 4PJ7E 4K3EH 3UTSD 4X4XA 1S7SB 4JANB 3U6RA 1X5AA 3MRNB 1NSNH 3PXJA 1H15A 2EDKA 4TVPL 2KKQA 1AGEA 1Q9LB 2ICWI 2YD7A 3NIGE 3K80A 3HUJA 4CN6A 1HE7A 3MPCA 4LHUD 1FFOA 1XR8A 3T4YB 3C5SB 2AK4B 4ONHA 3EO9H 5KOMC 3GKWL 4P2QA 3SDAB 3MTRA 3QUMH 2F53B 5DUPH 3VXPA 1PZ5B 4DAGH 5HHQB 2VQTA 4OB5H 4UT6L 3C9NB 2Y5TA 4XXDB 5MP6L 1KCRH 5C09B 1R3LA 4MJ5B 3DUSB 4PIRF 1S9YA 4A6YB 1G6RB 2AJYH 5ANMA 4YHZL 4ZQKA 3HN3A 1HNFA 1U3HB 4ZAKA 1WZLA 4X4YA 1CT8A 1EAPA 2IADB 4MJ6A 1IEHA 3S6CA 1C7SA 5FYLE 4JFFA 5K9KB 4OD2B 5INDA 3RY5A 4PJ9C 2R0LH 2X44D 3SO3C 1HQRB 2XXMB 4KTDL 1BX2B 2FX8L 5LGJA 3LQAL 3NZ8B 4IOSD 5MEPA 3BXNB 2VLMD 1SMAA 2B5IB 5C0FB 3MROB 5D96B 4RRPG 4ZS6C 3IFOB 3U2SB 3RWGB 1EBPA 5FYKL 3F7VA 3O6LL 1IL1A 1FFRA 2BVTA 2G5RA 3AAZA 1BMGA 1NAMH 2ERJC 5F6IB 3PGDA 4LU5L 1BEYL 3OAUH 3L3HB 1MJ8L 1AHWC 1W72L 3QHZH 1UJTA 1BM3L 4OZIB 5MP6H 1LO4H 1G7JB 1PAMA 5E8NB 1QBAA 4NWUH 3L5WA 3FRPA 1KOAA 3GMOB 4LCYA 5DHVA 4P9HC 3ZKQD 5DHXB 1LEKB 1OAXL 3QNXB 1GZQA 4NO5A 5ILTL 4IS6A 4YDLC 3U79A 4ZUTB 3G5ZB 1OTSD 1GJIA 1X5YA 4LHUB 3DSNA 5D8JL 4XPTL 5CEXB 4GOSA 4MNHB 1U92B 2HMIC 1U2CA 1FVEB 4Z76A 3EOTL 4XNUH 2YPLD 4OZ4A 2P43B 1L4IA 4MLIA 4BYHA 3F7YB 4Y2DD 4JE4B 4TQEL 3TT1H 1NL0L 3TPKA 1R5WB 3D2UA 3JWDC 4KV5E 3ZL4L 3AY4A 1CFVL 4Y2DA 1A22B 2FBJL 1M71B 4AMKH 5A2LH 2YC1B 2DDQL 4ODTL 5DZOA 3C09B 2FBJH 4AMKL 1TQBC 1FFPA 3HA0A 5E2WL 1LWRA 2AQ3A 5I9QB 5B4MC 3NPZB 3MLYH 3OXSA 4Y4HB 4PTUB 4CVZA 2ITCB 4U3HA 5HHNA 1UH4A 3JWDL 5D7JC 4G7VL 1OT1A 2N56A 5E00A 2QEJA 1T3FA 4F15C 1QR4A 3WIIL 1MY5A 4DKDC 4P4RA 4AIZA 2VLRA 4KJYA 4ODHL 3LKNB 4Y1AA 4OLZL 4FTVB 4X5WB 1FH5H 1KEMH 1V05A 2IC2A 3I6GA 3MR9B 4BSWB 5IBLD 1BBDL 4PJAE 4NQDB 4PUBL 3MV9E 2GAZA 4LHQB 1XCQA 3RAJL 4G6FD 3ILQD 1MFAH 3ZLQC 4EJ1C 3BW9A 3QUZB 1GRWA 4X9IA 4F9PA 2CK2A 5FV1L 1BJ1H 2DYPA 1LGVA 3NTCL 5M94B 1I9IH 4MD0B 1UKSA 1OGAB 2RHEA 3NCEB 3ZDZE 2YS4A 5FKAB 2Q8AL 1U58A 1JMZA 3RNQB 3NFPB 1XGTB 5DR5H 2CLZA 1I8IB 3WLBA 2NW3A 3W0WA 5EUOA 2P8LB 2VN7A 3O81A 2LAAA 3REVA 1FL6B 4WI2A 4JVPA 3TT3L 5LGJB 1EJ6A 4Y16C 4PRIE 2HLFD 4HUXB 1B2WH 4JO3L 1JHTA 4GAYB 1YEIH 3O3EA 3NZHH 4YHYB 4NO3B 3MRLA 4R26L 5HPMA 4E5XA 1Q9OB 2CQVA 1GYAA 1L7IH 5LVEA 1XCTA 1JIBA 4JQXC 1OAYL 1U95A 1EAJA 2Q3ZA 1IVLA 2XKNA 4LHUA 1QFPA 1PSKL 4S0TD 4UV7L 5I6XC 5LCVH 3U83A 5JXED 4Z7OE 4PJ8A 5E99H 3L3GB 4LKXB 3WKMH 4WHYG 3VH8A 2NXZB 1BQLL 1EEZA 4WV1B 5I1JH 1VCAA 2RJMA 3QPQC 4XNYL 3SKOB 1K6QH 5IB2B 2JKXA 1P4BL 1SYVB 2OQJA 5FHAL 2F8VA 1LD9B 1QA9B 4OD2A 5INDB 1FCGA 1U93B 4KMTL 1CE1H 4L8SC 5B39G 3BH8B 2ZUVA 3EFDL 1NFDF 1QRKA 2XNAA 1N8ZA 4EDWL 3LQZA 3D2UB 5ACLA 4GRWH 2J8UE 3KDMB 1NCCH 1KEGL 2X4NB 4QRSA 4UOW0 3KYNA 4TVPE 4ONOA 4EVNA 4MA3A 3C2SA 1H5BA 2KQNA 4QRRB 1QZ1A 4OIBA 4JHAL 5DA4A 1NAMB 1IKFH 1A21A 5H94A 4WDIB 1J8KA 2BXZA 1D6VL 4WUUD 2CMRL 2R23A 4S10A 5E5UB 1DBKL 1N2RB 4H26B 4ZAKB 3PGDB 1KNOA 4U1HB 2DI9A 4K94H 1AJ7L 4JFFB 3TN0D 5K9KA 2VDRL 1I7ZB 2QBWA 3VH8G 1FGNL 5B38B 2AXFB 5JHDA 1A7OH 4HV8A 1G9MH 3BUTA 4LCYB 5TF0A 3WFHB 2A9NH 3RY4A 5D2NC 4LBEB 4MNGB 1GZQB 5FM5M