5CDLA

Proline dipeptidase from deinococcus radiodurans (selenomethionine derivative)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
349
structure length
349
Chain Sequence
b'SSKMDQLRPVLGRAGVDALWVSAPANVRWLSGFTSAEDGKVLVSPDGATLYTDARYTVQAQEESSLPQYIARPPATYEHAADTVRGLRVGFEAESLTVAELEDLRQAWPNSTLVALRGTLGGLRAVKTPEEIGAIRAAQDLADRVYTEVRPMIRAGVRELDVAVEIETRLRRAGGESAFELIVASGPNGAKPHGHASKRVIEDGDLVTIDMGARLGGYNSDMTRTVAVGTPSAEMKRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRHGLGEAFAHSLGHGVGLEVHEGPGLRGTSQDVLEAGMVITIEPGAYLPGVGGVRIEDLILVTEDGYEVLSHSAKESV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline dipeptidase
publication title Proline dipeptidase from Deinococcus radiodurans (selenomethionine derivative)
rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 107
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2015-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5cdlA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 5cdlA02
3OOOA 4HXXA 2GGBA 1WBQA 2ZSGA 1C23A 4IKTA 4U6WA 3S6BA 1Y1NA 5D6FA 2NQ6A 1C21A 1PV9A 2EVMA 4FLIA 1XGMA 1XNZA 4ZWUA 4A6VA 5JFRA 3TB5A 3BIQA 2OKNA 4ZWPA 1B6AA 1QXYA 4S2RP 4U69A 4RZZA 5JI6A 2MATA 2P98A 4PV4A 3Q6DA 1N51A 2BHCA 2EVCA 2Q94A 3PKAA 4PNCA 4S2TP 2EA4A 1M35A 2Q95A 2GGCA 4FLLA 1WKMA 4U6EA 3RVAA 5CDVA 4U75A 4R60A 4S01A 4KM3A 4U6ZA 4IKUA 4IDYA 1YJ3A 2V6CA 5CDLA 4ZNGA 2OAZA 4FO8A 2BHBA 3PKEA 2GZ5A 2GG9A 3IU7A 5CNXA 4EGEA 3FM3A 4S00A 2BWWA 4FUKA 1A16A 1C27A 1XGNA 2B3LA 1R5GA 2V3XA 4U6CA 2BHDA 4IKRA 4FO7A 3PKDA 4U1BA 1WN1A 1KQ9A 2GG3A 1MATA 5JHUA 1YW8A 1WL9A 1C22A 1JAWA 4U71A 2BWYA 3IG4A 2BB7A 1YW9A 3PN9A 2GG8A 3QOCA 3CTZA 5CDEA 1QXWA 2BWSA 2B3HA 2B3KA 4IECA 5D6EA 1W7VA 4OOKA 4JUQA 3OVKA 4FKCA 2NQ7A 2GU7A 3PKCA 3BIPA 3BITA 1CHMA 2HOWA 1XGSA 4U76A 3I7MA 2Q8KA 2V3YA 4ZWOA 2GG2A 1YVMA 2GG5A 3D27A 4IKSA 5CLSA 1KQ0A 2GU5A 4FLKA 4IU6A 3PEBA 2BWXA 4RZYA 2DFIA 2G6PA 4MATA 1B59A 3IU8A 3L24A 5E5BA 1O0XA 2EVOA 1XGOA 1W2MA 2IW2A 5CIKA 4IPAA 1KP0A 2BN7A 2GU6A 4B28A 1BOAA 3CB6A 5E2CA 4IF7A 3FMQA 3IL0A 2P9AA 4A6WA 4Z7MA 3L7GA 1WY2A 4QR8A 3MATA 3O5VA 2GG0A 5FCHA 2GG7A 2GU4A 2EA2A 1WL6A 2BWUA 2BH3A 1YW7A 1QZYA 1WLRA 4U73A 4U70A 2Q92A 1C24A 2P99A 3MR1A 1R58A 5FCFA 3PKBA 5CE6A 3IU9A 2BWVA 2GA2A 3RORA 2BHAA 3CB5A 2BWTA 4RGZ1 3MX6A 4U6JA 2Q93A 4FLJA 2ADUA 2GTXA 1BN5A 2V3ZA 2Q96A 3FMRA 1R5HA 3TAVA 1QXZA
chains in the Genus database with same CATH superfamily
3OOOA 4HXXA 2GGBA 1WBQA 2ZSGA 1C23A 4IKTA 4U6WA 3S6BA 1Y1NA 5D6FA 2NQ6A 1C21A 1PV9A 2EVMA 4FLIA 1XGMA 1XNZA 4ZWUA 4A6VA 5JFRA 3TB5A 3BIQA 2OKNA 4ZWPA 1B6AA 1QXYA 4S2RP 4U69A 4RZZA 5JI6A 2MATA 2P98A 4PV4A 3Q6DA 1N51A 2BHCA 2EVCA 2Q94A 3PKAA 4PNCA 4S2TP 2EA4A 1M35A 2Q95A 2GGCA 4FLLA 1WKMA 4U6EA 3RVAA 5CDVA 4U75A 4R60A 4S01A 4KM3A 4U6ZA 4IKUA 4IDYA 1YJ3A 2V6CA 5CDLA 4ZNGA 2OAZA 4FO8A 2BHBA 3PKEA 2GZ5A 2GG9A 3IU7A 5CNXA 4EGEA 3FM3A 4S00A 2BWWA 4FUKA 1A16A 1C27A 1XGNA 2B3LA 1R5GA 2V3XA 4U6CA 2BHDA 4IKRA 4FO7A 3PKDA 4U1BA 1WN1A 1KQ9A 2GG3A 1MATA 5JHUA 1YW8A 1WL9A 1C22A 1JAWA 4U71A 2BWYA 3IG4A 2BB7A 1YW9A 3PN9A 2GG8A 3QOCA 3CTZA 5CDEA 1QXWA 2BWSA 2B3HA 2B3KA 4IECA 5D6EA 1W7VA 4OOKA 4JUQA 3OVKA 4FKCA 2NQ7A 2GU7A 3PKCA 3BIPA 3BITA 1CHMA 2HOWA 1XGSA 4U76A 3I7MA 2Q8KA 2V3YA 4ZWOA 2GG2A 1YVMA 2GG5A 3D27A 4IKSA 5CLSA 1KQ0A 2GU5A 4FLKA 4IU6A 3PEBA 2BWXA 4RZYA 2DFIA 2G6PA 4MATA 1B59A 3IU8A 3L24A 5E5BA 1O0XA 2EVOA 1XGOA 1W2MA 2IW2A 5CIKA 4IPAA 1KP0A 2BN7A 2GU6A 4B28A 1BOAA 3CB6A 5E2CA 4IF7A 3FMQA 3IL0A 2P9AA 4A6WA 4Z7MA 3L7GA 1WY2A 4QR8A 3MATA 3O5VA 2GG0A 5FCHA 2GG7A 2GU4A 2EA2A 1WL6A 2BWUA 2BH3A 1YW7A 1QZYA 1WLRA 4U73A 4U70A 2Q92A 1C24A 2P99A 3MR1A 1R58A 5FCFA 3PKBA 5CE6A 3IU9A 2BWVA 2GA2A 3RORA 2BHAA 3CB5A 2BWTA 4RGZ1 3MX6A 4U6JA 2Q93A 4FLJA 2ADUA 2GTXA 1BN5A 2V3ZA 2Q96A 3FMRA 1R5HA 3TAVA 1QXZA
chains in the Genus database with same CATH topology
3OOOA 4HXXA 2GGBA 1WBQA 2ZSGA 1C23A 4IKTA 4U6WA 3S6BA 1Y1NA 5D6FA 2NQ6A 1C21A 1PV9A 2EVMA 4FLIA 1XGMA 1XNZA 4ZWUA 4A6VA 5JFRA 3TB5A 3BIQA 2OKNA 4ZWPA 1B6AA 1QXYA 4S2RP 4U69A 4RZZA 5JI6A 2MATA 2P98A 4PV4A 3Q6DA 1N51A 2BHCA 2EVCA 2Q94A 3PKAA 4PNCA 4S2TP 2EA4A 1M35A 2Q95A 2GGCA 4FLLA 1WKMA 4U6EA 3RVAA 5CDVA 4U75A 4R60A 4S01A 4KM3A 4U6ZA 4IKUA 4IDYA 1YJ3A 2V6CA 5CDLA 4ZNGA 2OAZA 4FO8A 2BHBA 3PKEA 2GZ5A 2GG9A 3IU7A 5CNXA 4EGEA 3FM3A 4S00A 2BWWA 4FUKA 1A16A 1C27A 1XGNA 2B3LA 1R5GA 2V3XA 4U6CA 2BHDA 4IKRA 4FO7A 3PKDA 4U1BA 1WN1A 1KQ9A 2GG3A 1MATA 5JHUA 1YW8A 1WL9A 1C22A 1JAWA 4U71A 2BWYA 3IG4A 2BB7A 1YW9A 3PN9A 2GG8A 3QOCA 3CTZA 5CDEA 1QXWA 2BWSA 2B3HA 2B3KA 4IECA 5D6EA 1W7VA 4OOKA 4JUQA 3OVKA 4FKCA 2NQ7A 2GU7A 3PKCA 3BIPA 3BITA 1CHMA 2HOWA 1XGSA 4U76A 3I7MA 2Q8KA 2V3YA 4ZWOA 2GG2A 1YVMA 2GG5A 3D27A 4IKSA 5CLSA 1KQ0A 2GU5A 4FLKA 4IU6A 3PEBA 2BWXA 4RZYA 2DFIA 2G6PA 4MATA 1B59A 3IU8A 3L24A 5E5BA 1O0XA 2EVOA 1XGOA 1W2MA 2IW2A 5CIKA 4IPAA 1KP0A 2BN7A 2GU6A 4B28A 1BOAA 3CB6A 5E2CA 4IF7A 3FMQA 3IL0A 2P9AA 4A6WA 4Z7MA 3L7GA 1WY2A 4QR8A 3MATA 3O5VA 2GG0A 5FCHA 2GG7A 2GU4A 2EA2A 1WL6A 2BWUA 2BH3A 1YW7A 1QZYA 1WLRA 4U73A 4U70A 2Q92A 1C24A 2P99A 3MR1A 1R58A 5FCFA 3PKBA 5CE6A 3IU9A 2BWVA 2GA2A 3RORA 2BHAA 3CB5A 2BWTA 4RGZ1 3MX6A 4U6JA 2Q93A 4FLJA 2ADUA 2GTXA 1BN5A 2V3ZA 2Q96A 3FMRA 1R5HA 3TAVA 1QXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOO A;  4HXX A;  2GGB A;  1WBQ A;  2ZSG A;  1C23 A;  4IKT A;  4U6W A;  3S6B A;  1Y1N A;  5D6F A;  2NQ6 A;  1C21 A;  1PV9 A;  2EVM A;  4FLI A;  1XGM A;  1XNZ A;  4ZWU A;  4A6V A;  5JFR A;  3TB5 A;  3BIQ A;  2OKN A;  4ZWP A;  1B6A A;  1QXY A;  4S2R P;  4U69 A;  4RZZ A;  5JI6 A;  2MAT A;  2P98 A;  4PV4 A;  3Q6D A;  1N51 A;  2BHC A;  2EVC A;  2Q94 A;  3PKA A;  4PNC A;  4S2T P;  2EA4 A;  1M35 A;  2Q95 A;  2GGC A;  4FLL A;  1WKM A;  4U6E A;  3RVA A;  5CDV A;  4U75 A;  4R60 A;  4S01 A;  4KM3 A;  4U6Z A;  4IKU A;  4IDY A;  1YJ3 A;  2V6C A;  5CDL A;  4ZNG A;  2OAZ A;  4FO8 A;  2BHB A;  3PKE A;  2GZ5 A;  2GG9 A;  3IU7 A;  5CNX A;  4EGE A;  3FM3 A;  4S00 A;  2BWW A;  4FUK A;  1A16 A;  1C27 A;  1XGN A;  2B3L A;  1R5G A;  2V3X A;  4U6C A;  2BHD A;  4IKR A;  4FO7 A;  3PKD A;  4U1B A;  1WN1 A;  1KQ9 A;  2GG3 A;  1MAT A;  5JHU A;  1YW8 A;  1WL9 A;  1C22 A;  1JAW A;  4U71 A;  2BWY A;  3IG4 A;  2BB7 A;  1YW9 A;  3PN9 A;  2GG8 A;  3QOC A;  3CTZ A;  5CDE A;  1QXW A;  2BWS A;  2B3H A;  2B3K A;  4IEC A;  5D6E A;  1W7V A;  4OOK A;  4JUQ A;  3OVK A;  4FKC A;  2NQ7 A;  2GU7 A;  3PKC A;  3BIP A;  3BIT A;  1CHM A;  2HOW A;  1XGS A;  4U76 A;  3I7M A;  2Q8K A;  2V3Y A;  4ZWO A;  2GG2 A;  1YVM A;  2GG5 A;  3D27 A;  4IKS A;  5CLS A;  1KQ0 A;  2GU5 A;  4FLK A;  4IU6 A;  3PEB A;  2BWX A;  4RZY A;  2DFI A;  2G6P A;  4MAT A;  1B59 A;  3IU8 A;  3L24 A;  5E5B A;  1O0X A;  2EVO A;  1XGO A;  1W2M A;  2IW2 A;  5CIK A;  4IPA A;  1KP0 A;  2BN7 A;  2GU6 A;  4B28 A;  1BOA A;  3CB6 A;  5E2C A;  4IF7 A;  3FMQ A;  3IL0 A;  2P9A A;  4A6W A;  4Z7M A;  3L7G A;  1WY2 A;  4QR8 A;  3MAT A;  3O5V A;  2GG0 A;  5FCH A;  2GG7 A;  2GU4 A;  2EA2 A;  1WL6 A;  2BWU A;  2BH3 A;  1YW7 A;  1QZY A;  1WLR A;  4U73 A;  4U70 A;  2Q92 A;  1C24 A;  2P99 A;  3MR1 A;  1R58 A;  5FCF A;  3PKB A;  5CE6 A;  3IU9 A;  2BWV A;  2GA2 A;  3ROR A;  2BHA A;  3CB5 A;  2BWT A;  4RGZ 1;  3MX6 A;  4U6J A;  2Q93 A;  4FLJ A;  2ADU A;  2GTX A;  1BN5 A;  2V3Z A;  2Q96 A;  3FMR A;  1R5H A;  3TAV A;  1QXZ A; 
#chains in the Genus database with same CATH topology
 3OOO A;  4HXX A;  2GGB A;  1WBQ A;  2ZSG A;  1C23 A;  4IKT A;  4U6W A;  3S6B A;  1Y1N A;  5D6F A;  2NQ6 A;  1C21 A;  1PV9 A;  2EVM A;  4FLI A;  1XGM A;  1XNZ A;  4ZWU A;  4A6V A;  5JFR A;  3TB5 A;  3BIQ A;  2OKN A;  4ZWP A;  1B6A A;  1QXY A;  4S2R P;  4U69 A;  4RZZ A;  5JI6 A;  2MAT A;  2P98 A;  4PV4 A;  3Q6D A;  1N51 A;  2BHC A;  2EVC A;  2Q94 A;  3PKA A;  4PNC A;  4S2T P;  2EA4 A;  1M35 A;  2Q95 A;  2GGC A;  4FLL A;  1WKM A;  4U6E A;  3RVA A;  5CDV A;  4U75 A;  4R60 A;  4S01 A;  4KM3 A;  4U6Z A;  4IKU A;  4IDY A;  1YJ3 A;  2V6C A;  5CDL A;  4ZNG A;  2OAZ A;  4FO8 A;  2BHB A;  3PKE A;  2GZ5 A;  2GG9 A;  3IU7 A;  5CNX A;  4EGE A;  3FM3 A;  4S00 A;  2BWW A;  4FUK A;  1A16 A;  1C27 A;  1XGN A;  2B3L A;  1R5G A;  2V3X A;  4U6C A;  2BHD A;  4IKR A;  4FO7 A;  3PKD A;  4U1B A;  1WN1 A;  1KQ9 A;  2GG3 A;  1MAT A;  5JHU A;  1YW8 A;  1WL9 A;  1C22 A;  1JAW A;  4U71 A;  2BWY A;  3IG4 A;  2BB7 A;  1YW9 A;  3PN9 A;  2GG8 A;  3QOC A;  3CTZ A;  5CDE A;  1QXW A;  2BWS A;  2B3H A;  2B3K A;  4IEC A;  5D6E A;  1W7V A;  4OOK A;  4JUQ A;  3OVK A;  4FKC A;  2NQ7 A;  2GU7 A;  3PKC A;  3BIP A;  3BIT A;  1CHM A;  2HOW A;  1XGS A;  4U76 A;  3I7M A;  2Q8K A;  2V3Y A;  4ZWO A;  2GG2 A;  1YVM A;  2GG5 A;  3D27 A;  4IKS A;  5CLS A;  1KQ0 A;  2GU5 A;  4FLK A;  4IU6 A;  3PEB A;  2BWX A;  4RZY A;  2DFI A;  2G6P A;  4MAT A;  1B59 A;  3IU8 A;  3L24 A;  5E5B A;  1O0X A;  2EVO A;  1XGO A;  1W2M A;  2IW2 A;  5CIK A;  4IPA A;  1KP0 A;  2BN7 A;  2GU6 A;  4B28 A;  1BOA A;  3CB6 A;  5E2C A;  4IF7 A;  3FMQ A;  3IL0 A;  2P9A A;  4A6W A;  4Z7M A;  3L7G A;  1WY2 A;  4QR8 A;  3MAT A;  3O5V A;  2GG0 A;  5FCH A;  2GG7 A;  2GU4 A;  2EA2 A;  1WL6 A;  2BWU A;  2BH3 A;  1YW7 A;  1QZY A;  1WLR A;  4U73 A;  4U70 A;  2Q92 A;  1C24 A;  2P99 A;  3MR1 A;  1R58 A;  5FCF A;  3PKB A;  5CE6 A;  3IU9 A;  2BWV A;  2GA2 A;  3ROR A;  2BHA A;  3CB5 A;  2BWT A;  4RGZ 1;  3MX6 A;  4U6J A;  2Q93 A;  4FLJ A;  2ADU A;  2GTX A;  1BN5 A;  2V3Z A;  2Q96 A;  3FMR A;  1R5H A;  3TAV A;  1QXZ A; 
#chains in the Genus database with same CATH homology
 3OOO A;  4HXX A;  2GGB A;  1WBQ A;  2ZSG A;  1C23 A;  4IKT A;  4U6W A;  3S6B A;  1Y1N A;  5D6F A;  2NQ6 A;  1C21 A;  1PV9 A;  2EVM A;  4FLI A;  1XGM A;  1XNZ A;  4ZWU A;  4A6V A;  5JFR A;  3TB5 A;  3BIQ A;  2OKN A;  4ZWP A;  1B6A A;  1QXY A;  4S2R P;  4U69 A;  4RZZ A;  5JI6 A;  2MAT A;  2P98 A;  4PV4 A;  3Q6D A;  1N51 A;  2BHC A;  2EVC A;  2Q94 A;  3PKA A;  4PNC A;  4S2T P;  2EA4 A;  1M35 A;  2Q95 A;  2GGC A;  4FLL A;  1WKM A;  4U6E A;  3RVA A;  5CDV A;  4U75 A;  4R60 A;  4S01 A;  4KM3 A;  4U6Z A;  4IKU A;  4IDY A;  1YJ3 A;  2V6C A;  5CDL A;  4ZNG A;  2OAZ A;  4FO8 A;  2BHB A;  3PKE A;  2GZ5 A;  2GG9 A;  3IU7 A;  5CNX A;  4EGE A;  3FM3 A;  4S00 A;  2BWW A;  4FUK A;  1A16 A;  1C27 A;  1XGN A;  2B3L A;  1R5G A;  2V3X A;  4U6C A;  2BHD A;  4IKR A;  4FO7 A;  3PKD A;  4U1B A;  1WN1 A;  1KQ9 A;  2GG3 A;  1MAT A;  5JHU A;  1YW8 A;  1WL9 A;  1C22 A;  1JAW A;  4U71 A;  2BWY A;  3IG4 A;  2BB7 A;  1YW9 A;  3PN9 A;  2GG8 A;  3QOC A;  3CTZ A;  5CDE A;  1QXW A;  2BWS A;  2B3H A;  2B3K A;  4IEC A;  5D6E A;  1W7V A;  4OOK A;  4JUQ A;  3OVK A;  4FKC A;  2NQ7 A;  2GU7 A;  3PKC A;  3BIP A;  3BIT A;  1CHM A;  2HOW A;  1XGS A;  4U76 A;  3I7M A;  2Q8K A;  2V3Y A;  4ZWO A;  2GG2 A;  1YVM A;  2GG5 A;  3D27 A;  4IKS A;  5CLS A;  1KQ0 A;  2GU5 A;  4FLK A;  4IU6 A;  3PEB A;  2BWX A;  4RZY A;  2DFI A;  2G6P A;  4MAT A;  1B59 A;  3IU8 A;  3L24 A;  5E5B A;  1O0X A;  2EVO A;  1XGO A;  1W2M A;  2IW2 A;  5CIK A;  4IPA A;  1KP0 A;  2BN7 A;  2GU6 A;  4B28 A;  1BOA A;  3CB6 A;  5E2C A;  4IF7 A;  3FMQ A;  3IL0 A;  2P9A A;  4A6W A;  4Z7M A;  3L7G A;  1WY2 A;  4QR8 A;  3MAT A;  3O5V A;  2GG0 A;  5FCH A;  2GG7 A;  2GU4 A;  2EA2 A;  1WL6 A;  2BWU A;  2BH3 A;  1YW7 A;  1QZY A;  1WLR A;  4U73 A;  4U70 A;  2Q92 A;  1C24 A;  2P99 A;  3MR1 A;  1R58 A;  5FCF A;  3PKB A;  5CE6 A;  3IU9 A;  2BWV A;  2GA2 A;  3ROR A;  2BHA A;  3CB5 A;  2BWT A;  4RGZ 1;  3MX6 A;  4U6J A;  2Q93 A;  4FLJ A;  2ADU A;  2GTX A;  1BN5 A;  2V3Z A;  2Q96 A;  3FMR A;  1R5H A;  3TAV A;  1QXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...