5CDLA

Proline dipeptidase from deinococcus radiodurans (selenomethionine derivative)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
349
structure length
349
Chain Sequence
SSKMDQLRPVLGRAGVDALWVSAPANVRWLSGFTSAEDGKVLVSPDGATLYTDARYTVQAQEESSLPQYIARPPATYEHAADTVRGLRVGFEAESLTVAELEDLRQAWPNSTLVALRGTLGGLRAVKTPEEIGAIRAAQDLADRVYTEVRPMIRAGVRELDVAVEIETRLRRAGGESAFELIVASGPNGAKPHGHASKRVIEDGDLVTIDMGARLGGYNSDMTRTVAVGTPSAEMKRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRHGLGEAFAHSLGHGVGLEVHEGPGLRGTSQDVLEAGMVITIEPGAYLPGVGGVRIEDLILVTEDGYEVLSHSAKESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proline dipeptidase from Deinococcus radiodurans (selenomethionine derivative)
rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords Proline dipeptidase
total genus 107
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2015-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5cdlA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 5cdlA02
3OOOA 4IKRA 2BHBA 1R5HA 1YW8A 1R58A 4FLJA 2V6CA 2Q94A 5CE6A 1W2MA 3MR1A 4ZWOA 1PV9A 4FLKA 5FCHA 2V3ZA 2Q95A 5E2CA 1Y1NA 1CHMA 5JHUA 1KQ9A 4IU6A 1BOAA 2BWVA 3PKBA 2GTXA 2BHDA 4U6ZA 2GU4A 4IKUA 5E5BA 2P9AA 4IF7A 2B3KA 3TB5A 3BIPA 5JFRA 2GG8A 2G6PA 4U76A 4U6JA 4JUQA 3PN9A 4FO7A 4S2RP 2BH3A 4HXXA 1XGMA 2BWWA 4FLLA 3IU7A 3BITA 3L24A 4U69A 1WL9A 1KP0A 3O5VA 5CDLA 2EA2A 4A6WA 1MATA 1XGSA 3MX6A 1A16A 3Q6DA 2GG9A 4ZWPA 1WLRA 4RZYA 2GU6A 2GA2A 5JI6A 1C22A 2ZSGA 4R60A 3OVKA 4RGZ1 1QXZA 1QXYA 4U6EA 2OKNA 4ZNGA 2GG2A 2Q8KA 1KQ0A 2GG3A 3IU8A 2DFIA 2HOWA 2V3YA 5D6FA 2EVCA 2BWTA 4IECA 2Q96A 5D6EA 2OAZA 2GU7A 2GZ5A 4IKTA 4IPAA 2NQ7A 4IKSA 3IG4A 1B59A 1XGNA 4QR8A 1YJ3A 4A6VA 2GU5A 2BWUA 1YVMA 4U1BA 1YW7A 1C23A 4B28A 2BWSA 4S2TP 1BN5A 1YW9A 4MATA 3RVAA 3PKDA 1M35A 3CB6A 2GGCA 3FM3A 3S6BA 3CTZA 3PEBA 2EVOA 2Q92A 1QZYA 4KM3A 3FMQA 2P99A 1N51A 1W7VA 4U75A 1XNZA 3FMRA 2BHCA 2V3XA 3CB5A 2BWYA 4U70A 4U6WA 3MATA 2IW2A 2EA4A 3TAVA 1WL6A 4IDYA 4ZWUA 1WY2A 2GGBA 3IU9A 4PNCA 3RORA 2ADUA 3PKCA 4PV4A 2P98A 4S01A 2GG7A 2NQ6A 4FLIA 1C27A 1XGOA 2BB7A 1R5GA 4U71A 3L7GA 2BHAA 5CIKA 1WKMA 3D27A 3QOCA 5CNXA 3I7MA 1WBQA 2GG0A 4OOKA 2GG5A 1C24A 3IL0A 1WN1A 3BIQA 1O0XA 1QXWA 4FKCA 4EGEA 2B3LA 4FO8A 4Z7MA 1JAWA 2MATA 2BWXA 4U6CA 5FCFA 2EVMA 5CLSA 3PKAA 1C21A 2Q93A 4RZZA 4S00A 1B6AA 3PKEA 4FUKA 5CDEA 2B3HA 4U73A 5CDVA 2BN7A
chains in the Genus database with same CATH superfamily
3OOOA 4IKRA 2BHBA 1R5HA 1YW8A 1R58A 4FLJA 2V6CA 2Q94A 5CE6A 1W2MA 3MR1A 4ZWOA 1PV9A 4FLKA 5FCHA 2V3ZA 2Q95A 5E2CA 1Y1NA 1CHMA 5JHUA 1KQ9A 4IU6A 1BOAA 2BWVA 3PKBA 2GTXA 2BHDA 4U6ZA 2GU4A 4IKUA 5E5BA 2P9AA 4IF7A 2B3KA 3TB5A 3BIPA 5JFRA 2GG8A 2G6PA 4U76A 4U6JA 4JUQA 3PN9A 4FO7A 4S2RP 2BH3A 4HXXA 1XGMA 2BWWA 4FLLA 3IU7A 3BITA 3L24A 4U69A 1WL9A 1KP0A 3O5VA 5CDLA 2EA2A 4A6WA 1MATA 1XGSA 3MX6A 1A16A 3Q6DA 2GG9A 4ZWPA 1WLRA 4RZYA 2GU6A 2GA2A 5JI6A 1C22A 2ZSGA 4R60A 3OVKA 4RGZ1 1QXZA 1QXYA 4U6EA 2OKNA 4ZNGA 2GG2A 2Q8KA 1KQ0A 2GG3A 3IU8A 2DFIA 2HOWA 2V3YA 5D6FA 2EVCA 2BWTA 4IECA 2Q96A 5D6EA 2OAZA 2GU7A 2GZ5A 4IKTA 4IPAA 2NQ7A 4IKSA 3IG4A 1B59A 1XGNA 4QR8A 1YJ3A 4A6VA 2GU5A 2BWUA 1YVMA 4U1BA 1YW7A 1C23A 4B28A 2BWSA 4S2TP 1BN5A 1YW9A 4MATA 3RVAA 3PKDA 1M35A 3CB6A 2GGCA 3FM3A 3S6BA 3CTZA 3PEBA 2EVOA 2Q92A 1QZYA 4KM3A 3FMQA 2P99A 1N51A 1W7VA 4U75A 1XNZA 3FMRA 2BHCA 2V3XA 3CB5A 2BWYA 4U70A 4U6WA 3MATA 2IW2A 2EA4A 3TAVA 1WL6A 4IDYA 4ZWUA 1WY2A 2GGBA 3IU9A 4PNCA 3RORA 2ADUA 3PKCA 4PV4A 2P98A 4S01A 2GG7A 2NQ6A 4FLIA 1C27A 1XGOA 2BB7A 1R5GA 4U71A 3L7GA 2BHAA 5CIKA 1WKMA 3D27A 3QOCA 5CNXA 3I7MA 1WBQA 2GG0A 4OOKA 2GG5A 1C24A 3IL0A 1WN1A 3BIQA 1O0XA 1QXWA 4FKCA 4EGEA 2B3LA 4FO8A 4Z7MA 1JAWA 2MATA 2BWXA 4U6CA 5FCFA 2EVMA 5CLSA 3PKAA 1C21A 2Q93A 4RZZA 4S00A 1B6AA 3PKEA 4FUKA 5CDEA 2B3HA 4U73A 5CDVA 2BN7A
chains in the Genus database with same CATH topology
3OOOA 4IKRA 2BHBA 1R5HA 1YW8A 1R58A 4FLJA 2V6CA 2Q94A 5CE6A 1W2MA 3MR1A 4ZWOA 1PV9A 4FLKA 5FCHA 2V3ZA 2Q95A 5E2CA 1Y1NA 1CHMA 5JHUA 1KQ9A 4IU6A 1BOAA 2BWVA 3PKBA 2GTXA 2BHDA 4U6ZA 2GU4A 4IKUA 5E5BA 2P9AA 4IF7A 2B3KA 3TB5A 3BIPA 5JFRA 2GG8A 2G6PA 4U76A 4U6JA 4JUQA 3PN9A 4FO7A 4S2RP 2BH3A 4HXXA 1XGMA 2BWWA 4FLLA 3IU7A 3BITA 3L24A 4U69A 1WL9A 1KP0A 3O5VA 5CDLA 2EA2A 4A6WA 1MATA 1XGSA 3MX6A 1A16A 3Q6DA 2GG9A 4ZWPA 1WLRA 4RZYA 2GU6A 2GA2A 5JI6A 1C22A 2ZSGA 4R60A 3OVKA 4RGZ1 1QXZA 1QXYA 4U6EA 2OKNA 4ZNGA 2GG2A 2Q8KA 1KQ0A 2GG3A 3IU8A 2DFIA 2HOWA 2V3YA 5D6FA 2EVCA 2BWTA 4IECA 2Q96A 5D6EA 2OAZA 2GU7A 2GZ5A 4IKTA 4IPAA 2NQ7A 4IKSA 3IG4A 1B59A 1XGNA 4QR8A 1YJ3A 4A6VA 2GU5A 2BWUA 1YVMA 4U1BA 1YW7A 1C23A 4B28A 2BWSA 4S2TP 1BN5A 1YW9A 4MATA 3RVAA 3PKDA 1M35A 3CB6A 2GGCA 3FM3A 3S6BA 3CTZA 3PEBA 2EVOA 2Q92A 1QZYA 4KM3A 3FMQA 2P99A 1N51A 1W7VA 4U75A 1XNZA 3FMRA 2BHCA 2V3XA 3CB5A 2BWYA 4U70A 4U6WA 3MATA 2IW2A 2EA4A 3TAVA 1WL6A 4IDYA 4ZWUA 1WY2A 2GGBA 3IU9A 4PNCA 3RORA 2ADUA 3PKCA 4PV4A 2P98A 4S01A 2GG7A 2NQ6A 4FLIA 1C27A 1XGOA 2BB7A 1R5GA 4U71A 3L7GA 2BHAA 5CIKA 1WKMA 3D27A 3QOCA 5CNXA 3I7MA 1WBQA 2GG0A 4OOKA 2GG5A 1C24A 3IL0A 1WN1A 3BIQA 1O0XA 1QXWA 4FKCA 4EGEA 2B3LA 4FO8A 4Z7MA 1JAWA 2MATA 2BWXA 4U6CA 5FCFA 2EVMA 5CLSA 3PKAA 1C21A 2Q93A 4RZZA 4S00A 1B6AA 3PKEA 4FUKA 5CDEA 2B3HA 4U73A 5CDVA 2BN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOO A;  4IKR A;  2BHB A;  1R5H A;  1YW8 A;  1R58 A;  4FLJ A;  2V6C A;  2Q94 A;  5CE6 A;  1W2M A;  3MR1 A;  4ZWO A;  1PV9 A;  4FLK A;  5FCH A;  2V3Z A;  2Q95 A;  5E2C A;  1Y1N A;  1CHM A;  5JHU A;  1KQ9 A;  4IU6 A;  1BOA A;  2BWV A;  3PKB A;  2GTX A;  2BHD A;  4U6Z A;  2GU4 A;  4IKU A;  5E5B A;  2P9A A;  4IF7 A;  2B3K A;  3TB5 A;  3BIP A;  5JFR A;  2GG8 A;  2G6P A;  4U76 A;  4U6J A;  4JUQ A;  3PN9 A;  4FO7 A;  4S2R P;  2BH3 A;  4HXX A;  1XGM A;  2BWW A;  4FLL A;  3IU7 A;  3BIT A;  3L24 A;  4U69 A;  1WL9 A;  1KP0 A;  3O5V A;  5CDL A;  2EA2 A;  4A6W A;  1MAT A;  1XGS A;  3MX6 A;  1A16 A;  3Q6D A;  2GG9 A;  4ZWP A;  1WLR A;  4RZY A;  2GU6 A;  2GA2 A;  5JI6 A;  1C22 A;  2ZSG A;  4R60 A;  3OVK A;  4RGZ 1;  1QXZ A;  1QXY A;  4U6E A;  2OKN A;  4ZNG A;  2GG2 A;  2Q8K A;  1KQ0 A;  2GG3 A;  3IU8 A;  2DFI A;  2HOW A;  2V3Y A;  5D6F A;  2EVC A;  2BWT A;  4IEC A;  2Q96 A;  5D6E A;  2OAZ A;  2GU7 A;  2GZ5 A;  4IKT A;  4IPA A;  2NQ7 A;  4IKS A;  3IG4 A;  1B59 A;  1XGN A;  4QR8 A;  1YJ3 A;  4A6V A;  2GU5 A;  2BWU A;  1YVM A;  4U1B A;  1YW7 A;  1C23 A;  4B28 A;  2BWS A;  4S2T P;  1BN5 A;  1YW9 A;  4MAT A;  3RVA A;  3PKD A;  1M35 A;  3CB6 A;  2GGC A;  3FM3 A;  3S6B A;  3CTZ A;  3PEB A;  2EVO A;  2Q92 A;  1QZY A;  4KM3 A;  3FMQ A;  2P99 A;  1N51 A;  1W7V A;  4U75 A;  1XNZ A;  3FMR A;  2BHC A;  2V3X A;  3CB5 A;  2BWY A;  4U70 A;  4U6W A;  3MAT A;  2IW2 A;  2EA4 A;  3TAV A;  1WL6 A;  4IDY A;  4ZWU A;  1WY2 A;  2GGB A;  3IU9 A;  4PNC A;  3ROR A;  2ADU A;  3PKC A;  4PV4 A;  2P98 A;  4S01 A;  2GG7 A;  2NQ6 A;  4FLI A;  1C27 A;  1XGO A;  2BB7 A;  1R5G A;  4U71 A;  3L7G A;  2BHA A;  5CIK A;  1WKM A;  3D27 A;  3QOC A;  5CNX A;  3I7M A;  1WBQ A;  2GG0 A;  4OOK A;  2GG5 A;  1C24 A;  3IL0 A;  1WN1 A;  3BIQ A;  1O0X A;  1QXW A;  4FKC A;  4EGE A;  2B3L A;  4FO8 A;  4Z7M A;  1JAW A;  2MAT A;  2BWX A;  4U6C A;  5FCF A;  2EVM A;  5CLS A;  3PKA A;  1C21 A;  2Q93 A;  4RZZ A;  4S00 A;  1B6A A;  3PKE A;  4FUK A;  5CDE A;  2B3H A;  4U73 A;  5CDV A;  2BN7 A; 
#chains in the Genus database with same CATH topology
 3OOO A;  4IKR A;  2BHB A;  1R5H A;  1YW8 A;  1R58 A;  4FLJ A;  2V6C A;  2Q94 A;  5CE6 A;  1W2M A;  3MR1 A;  4ZWO A;  1PV9 A;  4FLK A;  5FCH A;  2V3Z A;  2Q95 A;  5E2C A;  1Y1N A;  1CHM A;  5JHU A;  1KQ9 A;  4IU6 A;  1BOA A;  2BWV A;  3PKB A;  2GTX A;  2BHD A;  4U6Z A;  2GU4 A;  4IKU A;  5E5B A;  2P9A A;  4IF7 A;  2B3K A;  3TB5 A;  3BIP A;  5JFR A;  2GG8 A;  2G6P A;  4U76 A;  4U6J A;  4JUQ A;  3PN9 A;  4FO7 A;  4S2R P;  2BH3 A;  4HXX A;  1XGM A;  2BWW A;  4FLL A;  3IU7 A;  3BIT A;  3L24 A;  4U69 A;  1WL9 A;  1KP0 A;  3O5V A;  5CDL A;  2EA2 A;  4A6W A;  1MAT A;  1XGS A;  3MX6 A;  1A16 A;  3Q6D A;  2GG9 A;  4ZWP A;  1WLR A;  4RZY A;  2GU6 A;  2GA2 A;  5JI6 A;  1C22 A;  2ZSG A;  4R60 A;  3OVK A;  4RGZ 1;  1QXZ A;  1QXY A;  4U6E A;  2OKN A;  4ZNG A;  2GG2 A;  2Q8K A;  1KQ0 A;  2GG3 A;  3IU8 A;  2DFI A;  2HOW A;  2V3Y A;  5D6F A;  2EVC A;  2BWT A;  4IEC A;  2Q96 A;  5D6E A;  2OAZ A;  2GU7 A;  2GZ5 A;  4IKT A;  4IPA A;  2NQ7 A;  4IKS A;  3IG4 A;  1B59 A;  1XGN A;  4QR8 A;  1YJ3 A;  4A6V A;  2GU5 A;  2BWU A;  1YVM A;  4U1B A;  1YW7 A;  1C23 A;  4B28 A;  2BWS A;  4S2T P;  1BN5 A;  1YW9 A;  4MAT A;  3RVA A;  3PKD A;  1M35 A;  3CB6 A;  2GGC A;  3FM3 A;  3S6B A;  3CTZ A;  3PEB A;  2EVO A;  2Q92 A;  1QZY A;  4KM3 A;  3FMQ A;  2P99 A;  1N51 A;  1W7V A;  4U75 A;  1XNZ A;  3FMR A;  2BHC A;  2V3X A;  3CB5 A;  2BWY A;  4U70 A;  4U6W A;  3MAT A;  2IW2 A;  2EA4 A;  3TAV A;  1WL6 A;  4IDY A;  4ZWU A;  1WY2 A;  2GGB A;  3IU9 A;  4PNC A;  3ROR A;  2ADU A;  3PKC A;  4PV4 A;  2P98 A;  4S01 A;  2GG7 A;  2NQ6 A;  4FLI A;  1C27 A;  1XGO A;  2BB7 A;  1R5G A;  4U71 A;  3L7G A;  2BHA A;  5CIK A;  1WKM A;  3D27 A;  3QOC A;  5CNX A;  3I7M A;  1WBQ A;  2GG0 A;  4OOK A;  2GG5 A;  1C24 A;  3IL0 A;  1WN1 A;  3BIQ A;  1O0X A;  1QXW A;  4FKC A;  4EGE A;  2B3L A;  4FO8 A;  4Z7M A;  1JAW A;  2MAT A;  2BWX A;  4U6C A;  5FCF A;  2EVM A;  5CLS A;  3PKA A;  1C21 A;  2Q93 A;  4RZZ A;  4S00 A;  1B6A A;  3PKE A;  4FUK A;  5CDE A;  2B3H A;  4U73 A;  5CDV A;  2BN7 A; 
#chains in the Genus database with same CATH homology
 3OOO A;  4IKR A;  2BHB A;  1R5H A;  1YW8 A;  1R58 A;  4FLJ A;  2V6C A;  2Q94 A;  5CE6 A;  1W2M A;  3MR1 A;  4ZWO A;  1PV9 A;  4FLK A;  5FCH A;  2V3Z A;  2Q95 A;  5E2C A;  1Y1N A;  1CHM A;  5JHU A;  1KQ9 A;  4IU6 A;  1BOA A;  2BWV A;  3PKB A;  2GTX A;  2BHD A;  4U6Z A;  2GU4 A;  4IKU A;  5E5B A;  2P9A A;  4IF7 A;  2B3K A;  3TB5 A;  3BIP A;  5JFR A;  2GG8 A;  2G6P A;  4U76 A;  4U6J A;  4JUQ A;  3PN9 A;  4FO7 A;  4S2R P;  2BH3 A;  4HXX A;  1XGM A;  2BWW A;  4FLL A;  3IU7 A;  3BIT A;  3L24 A;  4U69 A;  1WL9 A;  1KP0 A;  3O5V A;  5CDL A;  2EA2 A;  4A6W A;  1MAT A;  1XGS A;  3MX6 A;  1A16 A;  3Q6D A;  2GG9 A;  4ZWP A;  1WLR A;  4RZY A;  2GU6 A;  2GA2 A;  5JI6 A;  1C22 A;  2ZSG A;  4R60 A;  3OVK A;  4RGZ 1;  1QXZ A;  1QXY A;  4U6E A;  2OKN A;  4ZNG A;  2GG2 A;  2Q8K A;  1KQ0 A;  2GG3 A;  3IU8 A;  2DFI A;  2HOW A;  2V3Y A;  5D6F A;  2EVC A;  2BWT A;  4IEC A;  2Q96 A;  5D6E A;  2OAZ A;  2GU7 A;  2GZ5 A;  4IKT A;  4IPA A;  2NQ7 A;  4IKS A;  3IG4 A;  1B59 A;  1XGN A;  4QR8 A;  1YJ3 A;  4A6V A;  2GU5 A;  2BWU A;  1YVM A;  4U1B A;  1YW7 A;  1C23 A;  4B28 A;  2BWS A;  4S2T P;  1BN5 A;  1YW9 A;  4MAT A;  3RVA A;  3PKD A;  1M35 A;  3CB6 A;  2GGC A;  3FM3 A;  3S6B A;  3CTZ A;  3PEB A;  2EVO A;  2Q92 A;  1QZY A;  4KM3 A;  3FMQ A;  2P99 A;  1N51 A;  1W7V A;  4U75 A;  1XNZ A;  3FMR A;  2BHC A;  2V3X A;  3CB5 A;  2BWY A;  4U70 A;  4U6W A;  3MAT A;  2IW2 A;  2EA4 A;  3TAV A;  1WL6 A;  4IDY A;  4ZWU A;  1WY2 A;  2GGB A;  3IU9 A;  4PNC A;  3ROR A;  2ADU A;  3PKC A;  4PV4 A;  2P98 A;  4S01 A;  2GG7 A;  2NQ6 A;  4FLI A;  1C27 A;  1XGO A;  2BB7 A;  1R5G A;  4U71 A;  3L7G A;  2BHA A;  5CIK A;  1WKM A;  3D27 A;  3QOC A;  5CNX A;  3I7M A;  1WBQ A;  2GG0 A;  4OOK A;  2GG5 A;  1C24 A;  3IL0 A;  1WN1 A;  3BIQ A;  1O0X A;  1QXW A;  4FKC A;  4EGE A;  2B3L A;  4FO8 A;  4Z7M A;  1JAW A;  2MAT A;  2BWX A;  4U6C A;  5FCF A;  2EVM A;  5CLS A;  3PKA A;  1C21 A;  2Q93 A;  4RZZ A;  4S00 A;  1B6A A;  3PKE A;  4FUK A;  5CDE A;  2B3H A;  4U73 A;  5CDV A;  2BN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...