5CDLA

Proline dipeptidase from deinococcus radiodurans (selenomethionine derivative)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
349
structure length
349
Chain Sequence
SSKMDQLRPVLGRAGVDALWVSAPANVRWLSGFTSAEDGKVLVSPDGATLYTDARYTVQAQEESSLPQYIARPPATYEHAADTVRGLRVGFEAESLTVAELEDLRQAWPNSTLVALRGTLGGLRAVKTPEEIGAIRAAQDLADRVYTEVRPMIRAGVRELDVAVEIETRLRRAGGESAFELIVASGPNGAKPHGHASKRVIEDGDLVTIDMGARLGGYNSDMTRTVAVGTPSAEMKRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRHGLGEAFAHSLGHGVGLEVHEGPGLRGTSQDVLEAGMVITIEPGAYLPGVGGVRIEDLILVTEDGYEVLSHSAKESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline dipeptidase
publication title Proline dipeptidase from Deinococcus radiodurans (selenomethionine derivative)
rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 107
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2015-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5cdlA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 5cdlA02
2BWSA 2V3YA 4RZZA 1WN1A 2BWWA 4IKSA 3D27A 3IL0A 3L24A 1YJ3A 4OOKA 1XGMA 4U71A 2OAZA 4S01A 4FLLA 1R5GA 1W2MA 2GU5A 1KQ0A 1C24A 5JI6A 4PNCA 3Q6DA 1XGOA 3S6BA 2GGBA 4U1BA 2GTXA 1BN5A 3PKDA 1R58A 3IU9A 4U75A 4FLJA 2BWVA 4RZYA 4A6VA 4MATA 4JUQA 1MATA 2Q92A 1R5HA 2EVOA 2GG8A 3BITA 2GZ5A 3PN9A 1QZYA 4FLIA 2GG0A 2BWYA 2V3ZA 2BN7A 3CB5A 1C27A 2BWTA 4U6CA 4HXXA 3MR1A 4FUKA 1C22A 5CLSA 2BHCA 2OKNA 3BIQA 2B3HA 2BWXA 1CHMA 2Q95A 3FMQA 3RVAA 4ZWUA 3IU8A 4FKCA 5D6FA 4FO8A 4IF7A 4S2RP 1YW9A 1C21A 2GG3A 4Z7MA 2Q8KA 4B28A 4IPAA 3OVKA 2P9AA 3MATA 2GA2A 2DFIA 1XNZA 2NQ6A 1A16A 4U70A 4IDYA 1WBQA 1WLRA 3CB6A 1YVMA 3PKBA 1WY2A 4PV4A 2BWUA 2B3LA 2Q96A 3PKAA 3FM3A 2BHAA 2GG2A 2Q94A 3L7GA 4U69A 5CDVA 2V6CA 4ZNGA 3PKCA 2GG5A 3RORA 3TB5A 3IG4A 3CTZA 4U6EA 5D6EA 1QXZA 1QXYA 1YW8A 3MX6A 4U6ZA 4S00A 4S2TP 5FCHA 1B6AA 2EA4A 4IU6A 2BB7A 4FLKA 1O0XA 1YW7A 3I7MA 1PV9A 5CDEA 2BH3A 3O5VA 4EGEA 1N51A 5FCFA 2Q93A 4ZWPA 1QXWA 4U6JA 5JFRA 4IKTA 2HOWA 2EVMA 2BHDA 2EA2A 5JHUA 2GG7A 3PEBA 3PKEA 1KQ9A 2GU7A 4U76A 4IKUA 5CNXA 3QOCA 2ADUA 1W7VA 5CIKA 2V3XA 2ZSGA 5E2CA 3FMRA 2P98A 4U6WA 1M35A 4IKRA 4R60A 3TAVA 3BIPA 4ZWOA 2G6PA 2B3KA 2GU4A 2P99A 1BOAA 1B59A 2IW2A 5CE6A 2GGCA 4IECA 2GU6A 4U73A 5E5BA 3IU7A 1Y1NA 1JAWA 2NQ7A 1WL9A 2GG9A 4FO7A 4QR8A 2EVCA 1WKMA 1C23A 1XGSA 5CDLA 4KM3A 1WL6A 2MATA 2BHBA 1XGNA 1KP0A 4RGZ1 4A6WA 3OOOA
chains in the Genus database with same CATH superfamily
2BWSA 2V3YA 4RZZA 1WN1A 2BWWA 4IKSA 3D27A 3IL0A 3L24A 1YJ3A 4OOKA 1XGMA 4U71A 2OAZA 4S01A 4FLLA 1R5GA 1W2MA 2GU5A 1KQ0A 1C24A 5JI6A 4PNCA 3Q6DA 1XGOA 3S6BA 2GGBA 4U1BA 2GTXA 1BN5A 3PKDA 1R58A 3IU9A 4U75A 4FLJA 2BWVA 4RZYA 4A6VA 4MATA 4JUQA 1MATA 2Q92A 1R5HA 2EVOA 2GG8A 3BITA 2GZ5A 3PN9A 1QZYA 4FLIA 2GG0A 2BWYA 2V3ZA 2BN7A 3CB5A 1C27A 2BWTA 4U6CA 4HXXA 3MR1A 4FUKA 1C22A 5CLSA 2BHCA 2OKNA 3BIQA 2B3HA 2BWXA 1CHMA 2Q95A 3FMQA 3RVAA 4ZWUA 3IU8A 4FKCA 5D6FA 4FO8A 4IF7A 4S2RP 1YW9A 1C21A 2GG3A 4Z7MA 2Q8KA 4B28A 4IPAA 3OVKA 2P9AA 3MATA 2GA2A 2DFIA 1XNZA 2NQ6A 1A16A 4U70A 4IDYA 1WBQA 1WLRA 3CB6A 1YVMA 3PKBA 1WY2A 4PV4A 2BWUA 2B3LA 2Q96A 3PKAA 3FM3A 2BHAA 2GG2A 2Q94A 3L7GA 4U69A 5CDVA 2V6CA 4ZNGA 3PKCA 2GG5A 3RORA 3TB5A 3IG4A 3CTZA 4U6EA 5D6EA 1QXZA 1QXYA 1YW8A 3MX6A 4U6ZA 4S00A 4S2TP 5FCHA 1B6AA 2EA4A 4IU6A 2BB7A 4FLKA 1O0XA 1YW7A 3I7MA 1PV9A 5CDEA 2BH3A 3O5VA 4EGEA 1N51A 5FCFA 2Q93A 4ZWPA 1QXWA 4U6JA 5JFRA 4IKTA 2HOWA 2EVMA 2BHDA 2EA2A 5JHUA 2GG7A 3PEBA 3PKEA 1KQ9A 2GU7A 4U76A 4IKUA 5CNXA 3QOCA 2ADUA 1W7VA 5CIKA 2V3XA 2ZSGA 5E2CA 3FMRA 2P98A 4U6WA 1M35A 4IKRA 4R60A 3TAVA 3BIPA 4ZWOA 2G6PA 2B3KA 2GU4A 2P99A 1BOAA 1B59A 2IW2A 5CE6A 2GGCA 4IECA 2GU6A 4U73A 5E5BA 3IU7A 1Y1NA 1JAWA 2NQ7A 1WL9A 2GG9A 4FO7A 4QR8A 2EVCA 1WKMA 1C23A 1XGSA 5CDLA 4KM3A 1WL6A 2MATA 2BHBA 1XGNA 1KP0A 4RGZ1 4A6WA 3OOOA
chains in the Genus database with same CATH topology
2BWSA 2V3YA 4RZZA 1WN1A 2BWWA 4IKSA 3D27A 3IL0A 3L24A 1YJ3A 4OOKA 1XGMA 4U71A 2OAZA 4S01A 4FLLA 1R5GA 1W2MA 2GU5A 1KQ0A 1C24A 5JI6A 4PNCA 3Q6DA 1XGOA 3S6BA 2GGBA 4U1BA 2GTXA 1BN5A 3PKDA 1R58A 3IU9A 4U75A 4FLJA 2BWVA 4RZYA 4A6VA 4MATA 4JUQA 1MATA 2Q92A 1R5HA 2EVOA 2GG8A 3BITA 2GZ5A 3PN9A 1QZYA 4FLIA 2GG0A 2BWYA 2V3ZA 2BN7A 3CB5A 1C27A 2BWTA 4U6CA 4HXXA 3MR1A 4FUKA 1C22A 5CLSA 2BHCA 2OKNA 3BIQA 2B3HA 2BWXA 1CHMA 2Q95A 3FMQA 3RVAA 4ZWUA 3IU8A 4FKCA 5D6FA 4FO8A 4IF7A 4S2RP 1YW9A 1C21A 2GG3A 4Z7MA 2Q8KA 4B28A 4IPAA 3OVKA 2P9AA 3MATA 2GA2A 2DFIA 1XNZA 2NQ6A 1A16A 4U70A 4IDYA 1WBQA 1WLRA 3CB6A 1YVMA 3PKBA 1WY2A 4PV4A 2BWUA 2B3LA 2Q96A 3PKAA 3FM3A 2BHAA 2GG2A 2Q94A 3L7GA 4U69A 5CDVA 2V6CA 4ZNGA 3PKCA 2GG5A 3RORA 3TB5A 3IG4A 3CTZA 4U6EA 5D6EA 1QXZA 1QXYA 1YW8A 3MX6A 4U6ZA 4S00A 4S2TP 5FCHA 1B6AA 2EA4A 4IU6A 2BB7A 4FLKA 1O0XA 1YW7A 3I7MA 1PV9A 5CDEA 2BH3A 3O5VA 4EGEA 1N51A 5FCFA 2Q93A 4ZWPA 1QXWA 4U6JA 5JFRA 4IKTA 2HOWA 2EVMA 2BHDA 2EA2A 5JHUA 2GG7A 3PEBA 3PKEA 1KQ9A 2GU7A 4U76A 4IKUA 5CNXA 3QOCA 2ADUA 1W7VA 5CIKA 2V3XA 2ZSGA 5E2CA 3FMRA 2P98A 4U6WA 1M35A 4IKRA 4R60A 3TAVA 3BIPA 4ZWOA 2G6PA 2B3KA 2GU4A 2P99A 1BOAA 1B59A 2IW2A 5CE6A 2GGCA 4IECA 2GU6A 4U73A 5E5BA 3IU7A 1Y1NA 1JAWA 2NQ7A 1WL9A 2GG9A 4FO7A 4QR8A 2EVCA 1WKMA 1C23A 1XGSA 5CDLA 4KM3A 1WL6A 2MATA 2BHBA 1XGNA 1KP0A 4RGZ1 4A6WA 3OOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWS A;  2V3Y A;  4RZZ A;  1WN1 A;  2BWW A;  4IKS A;  3D27 A;  3IL0 A;  3L24 A;  1YJ3 A;  4OOK A;  1XGM A;  4U71 A;  2OAZ A;  4S01 A;  4FLL A;  1R5G A;  1W2M A;  2GU5 A;  1KQ0 A;  1C24 A;  5JI6 A;  4PNC A;  3Q6D A;  1XGO A;  3S6B A;  2GGB A;  4U1B A;  2GTX A;  1BN5 A;  3PKD A;  1R58 A;  3IU9 A;  4U75 A;  4FLJ A;  2BWV A;  4RZY A;  4A6V A;  4MAT A;  4JUQ A;  1MAT A;  2Q92 A;  1R5H A;  2EVO A;  2GG8 A;  3BIT A;  2GZ5 A;  3PN9 A;  1QZY A;  4FLI A;  2GG0 A;  2BWY A;  2V3Z A;  2BN7 A;  3CB5 A;  1C27 A;  2BWT A;  4U6C A;  4HXX A;  3MR1 A;  4FUK A;  1C22 A;  5CLS A;  2BHC A;  2OKN A;  3BIQ A;  2B3H A;  2BWX A;  1CHM A;  2Q95 A;  3FMQ A;  3RVA A;  4ZWU A;  3IU8 A;  4FKC A;  5D6F A;  4FO8 A;  4IF7 A;  4S2R P;  1YW9 A;  1C21 A;  2GG3 A;  4Z7M A;  2Q8K A;  4B28 A;  4IPA A;  3OVK A;  2P9A A;  3MAT A;  2GA2 A;  2DFI A;  1XNZ A;  2NQ6 A;  1A16 A;  4U70 A;  4IDY A;  1WBQ A;  1WLR A;  3CB6 A;  1YVM A;  3PKB A;  1WY2 A;  4PV4 A;  2BWU A;  2B3L A;  2Q96 A;  3PKA A;  3FM3 A;  2BHA A;  2GG2 A;  2Q94 A;  3L7G A;  4U69 A;  5CDV A;  2V6C A;  4ZNG A;  3PKC A;  2GG5 A;  3ROR A;  3TB5 A;  3IG4 A;  3CTZ A;  4U6E A;  5D6E A;  1QXZ A;  1QXY A;  1YW8 A;  3MX6 A;  4U6Z A;  4S00 A;  4S2T P;  5FCH A;  1B6A A;  2EA4 A;  4IU6 A;  2BB7 A;  4FLK A;  1O0X A;  1YW7 A;  3I7M A;  1PV9 A;  5CDE A;  2BH3 A;  3O5V A;  4EGE A;  1N51 A;  5FCF A;  2Q93 A;  4ZWP A;  1QXW A;  4U6J A;  5JFR A;  4IKT A;  2HOW A;  2EVM A;  2BHD A;  2EA2 A;  5JHU A;  2GG7 A;  3PEB A;  3PKE A;  1KQ9 A;  2GU7 A;  4U76 A;  4IKU A;  5CNX A;  3QOC A;  2ADU A;  1W7V A;  5CIK A;  2V3X A;  2ZSG A;  5E2C A;  3FMR A;  2P98 A;  4U6W A;  1M35 A;  4IKR A;  4R60 A;  3TAV A;  3BIP A;  4ZWO A;  2G6P A;  2B3K A;  2GU4 A;  2P99 A;  1BOA A;  1B59 A;  2IW2 A;  5CE6 A;  2GGC A;  4IEC A;  2GU6 A;  4U73 A;  5E5B A;  3IU7 A;  1Y1N A;  1JAW A;  2NQ7 A;  1WL9 A;  2GG9 A;  4FO7 A;  4QR8 A;  2EVC A;  1WKM A;  1C23 A;  1XGS A;  5CDL A;  4KM3 A;  1WL6 A;  2MAT A;  2BHB A;  1XGN A;  1KP0 A;  4RGZ 1;  4A6W A;  3OOO A; 
#chains in the Genus database with same CATH topology
 2BWS A;  2V3Y A;  4RZZ A;  1WN1 A;  2BWW A;  4IKS A;  3D27 A;  3IL0 A;  3L24 A;  1YJ3 A;  4OOK A;  1XGM A;  4U71 A;  2OAZ A;  4S01 A;  4FLL A;  1R5G A;  1W2M A;  2GU5 A;  1KQ0 A;  1C24 A;  5JI6 A;  4PNC A;  3Q6D A;  1XGO A;  3S6B A;  2GGB A;  4U1B A;  2GTX A;  1BN5 A;  3PKD A;  1R58 A;  3IU9 A;  4U75 A;  4FLJ A;  2BWV A;  4RZY A;  4A6V A;  4MAT A;  4JUQ A;  1MAT A;  2Q92 A;  1R5H A;  2EVO A;  2GG8 A;  3BIT A;  2GZ5 A;  3PN9 A;  1QZY A;  4FLI A;  2GG0 A;  2BWY A;  2V3Z A;  2BN7 A;  3CB5 A;  1C27 A;  2BWT A;  4U6C A;  4HXX A;  3MR1 A;  4FUK A;  1C22 A;  5CLS A;  2BHC A;  2OKN A;  3BIQ A;  2B3H A;  2BWX A;  1CHM A;  2Q95 A;  3FMQ A;  3RVA A;  4ZWU A;  3IU8 A;  4FKC A;  5D6F A;  4FO8 A;  4IF7 A;  4S2R P;  1YW9 A;  1C21 A;  2GG3 A;  4Z7M A;  2Q8K A;  4B28 A;  4IPA A;  3OVK A;  2P9A A;  3MAT A;  2GA2 A;  2DFI A;  1XNZ A;  2NQ6 A;  1A16 A;  4U70 A;  4IDY A;  1WBQ A;  1WLR A;  3CB6 A;  1YVM A;  3PKB A;  1WY2 A;  4PV4 A;  2BWU A;  2B3L A;  2Q96 A;  3PKA A;  3FM3 A;  2BHA A;  2GG2 A;  2Q94 A;  3L7G A;  4U69 A;  5CDV A;  2V6C A;  4ZNG A;  3PKC A;  2GG5 A;  3ROR A;  3TB5 A;  3IG4 A;  3CTZ A;  4U6E A;  5D6E A;  1QXZ A;  1QXY A;  1YW8 A;  3MX6 A;  4U6Z A;  4S00 A;  4S2T P;  5FCH A;  1B6A A;  2EA4 A;  4IU6 A;  2BB7 A;  4FLK A;  1O0X A;  1YW7 A;  3I7M A;  1PV9 A;  5CDE A;  2BH3 A;  3O5V A;  4EGE A;  1N51 A;  5FCF A;  2Q93 A;  4ZWP A;  1QXW A;  4U6J A;  5JFR A;  4IKT A;  2HOW A;  2EVM A;  2BHD A;  2EA2 A;  5JHU A;  2GG7 A;  3PEB A;  3PKE A;  1KQ9 A;  2GU7 A;  4U76 A;  4IKU A;  5CNX A;  3QOC A;  2ADU A;  1W7V A;  5CIK A;  2V3X A;  2ZSG A;  5E2C A;  3FMR A;  2P98 A;  4U6W A;  1M35 A;  4IKR A;  4R60 A;  3TAV A;  3BIP A;  4ZWO A;  2G6P A;  2B3K A;  2GU4 A;  2P99 A;  1BOA A;  1B59 A;  2IW2 A;  5CE6 A;  2GGC A;  4IEC A;  2GU6 A;  4U73 A;  5E5B A;  3IU7 A;  1Y1N A;  1JAW A;  2NQ7 A;  1WL9 A;  2GG9 A;  4FO7 A;  4QR8 A;  2EVC A;  1WKM A;  1C23 A;  1XGS A;  5CDL A;  4KM3 A;  1WL6 A;  2MAT A;  2BHB A;  1XGN A;  1KP0 A;  4RGZ 1;  4A6W A;  3OOO A; 
#chains in the Genus database with same CATH homology
 2BWS A;  2V3Y A;  4RZZ A;  1WN1 A;  2BWW A;  4IKS A;  3D27 A;  3IL0 A;  3L24 A;  1YJ3 A;  4OOK A;  1XGM A;  4U71 A;  2OAZ A;  4S01 A;  4FLL A;  1R5G A;  1W2M A;  2GU5 A;  1KQ0 A;  1C24 A;  5JI6 A;  4PNC A;  3Q6D A;  1XGO A;  3S6B A;  2GGB A;  4U1B A;  2GTX A;  1BN5 A;  3PKD A;  1R58 A;  3IU9 A;  4U75 A;  4FLJ A;  2BWV A;  4RZY A;  4A6V A;  4MAT A;  4JUQ A;  1MAT A;  2Q92 A;  1R5H A;  2EVO A;  2GG8 A;  3BIT A;  2GZ5 A;  3PN9 A;  1QZY A;  4FLI A;  2GG0 A;  2BWY A;  2V3Z A;  2BN7 A;  3CB5 A;  1C27 A;  2BWT A;  4U6C A;  4HXX A;  3MR1 A;  4FUK A;  1C22 A;  5CLS A;  2BHC A;  2OKN A;  3BIQ A;  2B3H A;  2BWX A;  1CHM A;  2Q95 A;  3FMQ A;  3RVA A;  4ZWU A;  3IU8 A;  4FKC A;  5D6F A;  4FO8 A;  4IF7 A;  4S2R P;  1YW9 A;  1C21 A;  2GG3 A;  4Z7M A;  2Q8K A;  4B28 A;  4IPA A;  3OVK A;  2P9A A;  3MAT A;  2GA2 A;  2DFI A;  1XNZ A;  2NQ6 A;  1A16 A;  4U70 A;  4IDY A;  1WBQ A;  1WLR A;  3CB6 A;  1YVM A;  3PKB A;  1WY2 A;  4PV4 A;  2BWU A;  2B3L A;  2Q96 A;  3PKA A;  3FM3 A;  2BHA A;  2GG2 A;  2Q94 A;  3L7G A;  4U69 A;  5CDV A;  2V6C A;  4ZNG A;  3PKC A;  2GG5 A;  3ROR A;  3TB5 A;  3IG4 A;  3CTZ A;  4U6E A;  5D6E A;  1QXZ A;  1QXY A;  1YW8 A;  3MX6 A;  4U6Z A;  4S00 A;  4S2T P;  5FCH A;  1B6A A;  2EA4 A;  4IU6 A;  2BB7 A;  4FLK A;  1O0X A;  1YW7 A;  3I7M A;  1PV9 A;  5CDE A;  2BH3 A;  3O5V A;  4EGE A;  1N51 A;  5FCF A;  2Q93 A;  4ZWP A;  1QXW A;  4U6J A;  5JFR A;  4IKT A;  2HOW A;  2EVM A;  2BHD A;  2EA2 A;  5JHU A;  2GG7 A;  3PEB A;  3PKE A;  1KQ9 A;  2GU7 A;  4U76 A;  4IKU A;  5CNX A;  3QOC A;  2ADU A;  1W7V A;  5CIK A;  2V3X A;  2ZSG A;  5E2C A;  3FMR A;  2P98 A;  4U6W A;  1M35 A;  4IKR A;  4R60 A;  3TAV A;  3BIP A;  4ZWO A;  2G6P A;  2B3K A;  2GU4 A;  2P99 A;  1BOA A;  1B59 A;  2IW2 A;  5CE6 A;  2GGC A;  4IEC A;  2GU6 A;  4U73 A;  5E5B A;  3IU7 A;  1Y1N A;  1JAW A;  2NQ7 A;  1WL9 A;  2GG9 A;  4FO7 A;  4QR8 A;  2EVC A;  1WKM A;  1C23 A;  1XGS A;  5CDL A;  4KM3 A;  1WL6 A;  2MAT A;  2BHB A;  1XGN A;  1KP0 A;  4RGZ 1;  4A6W A;  3OOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...