5CEAA

Bd3460 immunity protein from bdellovibrio bacteriovorus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
193
structure length
193
Chain Sequence
SGKSSKALNEAAEQGDLAKVKNLVQKNKIDLNAQDETGMTPLMNAAMGGNLDIVKFLLSKKVNLELKNNGGETALAFAVTNDAYDVAEELIKAGANVDIIVAGDEGDTLFMRAAQNNKKTAESILAKNKSLINKANTLGETALFAVARYGTPADIDFLIKKGADLKLKNKKGQTALDVAKEASNQDTAKALSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
molecule keywords Bd3460
molecule tags Protein binding
source organism Bdellovibrio bacteriovorus (strain atcc 15356 / dsm 50701 / ncib 9529 / hd100)
total genus 67
structure length 193
sequence length 193
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5ceaA00
1NFIE 3HG0D 5ENRD 5D66A 1SW6A 5JMND 4BEPA 2ETCA 2V5QC 4UUCA 2F8XK 2PNNA 3HRAA 1YYHA 1N11A 4CYMD 4ATZD 5ENQD 2BKGA 5AQ9A 3W9FA 4RLYA 4K5BA 1IHBA 4J7WA 3W9GA 3V79K 4B93B 3DEOA 4YDWA 5FIOA 3Q9UC 1K3ZD 5FINA 3NOGD 4BERA 3Q9NC 2F37A 3V2OA 4BESA 2QYJA 2RFAA 2Y1LE 2HE0A 3TWUA 3V31A 3ZNGA 3T9KA 2L6BA 5AQ7A 1MX2A 2XEEA 2ETBA 5ENOD 1BLXB 4QFVA 2DZOA 3F6QA 5EYPF 4HLLA 3TWVA 1UOHA 4DRXE 2MYOA 5KBAA 5AN8A 1A5EA 5EIDA 5HRYA 4DX2A 4DUIA 3AAAC 4O1PA 2VGEA 4GPMA 4N5QA 5AQAA 4CZ2D 5ENPD 4BETA 4ZFHA 5JA4D 3EU9A 1IXVA 1WDYA 1IKND 4LG6A 5CEAA 4OAVB 4F1PA 4LSZE 1OY3D 5AQBA 5BXOA 2KXPC 5EILA 2DZNA 1MX6A 3TWWA 4O1OA 5AARA 4U8VD 3B7BA 4U95D 3TWSA 5CERB 4TUMA 1YMPA 1K1AA 2DWZA 4HRNA 2XENA 2ETAA 3JXJA 3D9HA 4K5AB 5AAOA 2FO1E 4NIKA 5EIBE 4DX1A 5HKPA 2XZDG 1K1BA 3AJIA 5ENSD 3V30A 5CBOA 5EN5D 1N0QA 3ZUVB 2V4HC 1BI8B 5HS0A 3UTMA 1AP7A 1DC2A 2Y0BG 4G8KA 3EHQA 3ZKJA 2NYJA 3J5PA 4F6RD 4U96D 4HQDA 4HI9A 2ZGDA 2P2CP 3EHRA 5KWDA 2DVWA 2RFMA 4U8YD 2AJAA 3UXGA 4BSZB 2A5EA 3ZU7B 4HRLA 4HBDA 4O60A 5CECB 1D9SA 1MX4A 4K5CA 4DX7D 1BD8A 1BI7B 2J8SD 2BKKB 3TWQA 4HNAD 4GMRA 4HI8A 5ITZF 1SVXA 1QYMA 5CBNA 3KEAA 3J5QB 3TWRA 5KNGA 1G3NB 3JUEA 1YCSB 2XEHA 1MYOA 3SO8A 3NOCD 4DX5D 1WG0A 4G8LA 4LNUD 2JABA 2F8YA 4C48B 3B95A 1S70B 2B0OE 2KBXA 4QQIA 3TWTA 3C5RA 3V2XA 4HRMB 2ZGGA 4ZHBA 2QC9A 1OT8A 4HB5A 4DX6D 1MJ0A 3NBNB 1BU9A 3DEPA 3T8KA 4JB8P 4A63B 5CEDB 3TWXA 4Z68A 3IXEA 5KNHD 1N0RA 1AWCB 4YDYA 5BXUA 4J8YA 2XZTG 5EYLA 1DCQA 1TR4A 3LJNA 4OAUC 5ENTD 3UI2A 3JXIA
chains in the Genus database with same CATH superfamily
1MQSA 3HDXA 4U0UA 2ETCA 3ZVVA 2F8XK 3FUFA 1N11A 4LNGA 4ATZD 4FA6A 2XCCA 5ARFA 4HOSA 3PE3A 5CCLA 3V31A 1MX2A 3CVNA 5ENOD 3ESKA 1UOHA 3ZHEB 5ARGA 4DX2A 4C0EA 2IY0C 3FTZA 3FUIA 3JQ1A 2BTDA 2R02A 2XS1A 2KXPC 4I6JA 2XRYA 1SA5A 5BNWA 5CERB 3ASNE 3LVQE 4XIFA 1X5BA 3ZN3A 3PZ1A 4K5AB 3ULEG 5EIBE 1BPOA 4I1AA 4WWOA 2X3MA 2IQCA 4GTOA 1E7VA 2HR2A 4GMJA 4XI0A 4O60A 4HVBA 2NXPA 2WXLA 4Y6CA 4GZCA 2Y69E 2ONDA 4ABNA 2XEHA 4PS3A 2RD0A 4GPKA 4C48B 2WXRA 4U07A 2V8SE 4R7LA 4XE0A 3DSVA 3CVLA 1N4SA 1RZ4A 3CVQA 4RG6A 3E4BA 4GYWA 4GTMA 4N3CA 2FF4A 3MEKA 3L16A 2BKGA 4LEUA 3CHQA 3W9GA 4B93B 1O5MA 2EIME 4GTSA 4BFRA 4H7XA 3TWUA 4U0ZA 2R05A 3ZNGA 4NURA 3B7SA 4N39A 1N9AA 5G04J 3D9IA 2PZIA 2DBAA 5BUZA 4LSZE 3EDTB 3VLDA 5JHAA 4CT0A 4TUMA 3RIBA 5E75A 3DSXA 3LJ3A 5B3SE 4NIKA 1XNFA 2WXIA 4U63A 5ENSD 4IRUA 3Q78A 3UTMA 4MLPA 1E8WA 3EHQA 4F6RD 2QYUA 2DVWA 4N3AA 5JJTA 4K5CA 4L23A 3FTUA 3E33A 4ANXA 2PL2A 3L13A 3Q79A 2AVPA 2B6CA 3QOUA 5KNGA 1MYOA 2VSOE 1ZU2A 2BEDA 4IYPA 1SZ9A 2LXLA 4LERA 1HE8A 4HB5A 3T8KA 1WAO1 2P9KG 2WXNA 3OXFA 1FT2A 3CEQA 3GW4A 4JD2G 3L54A 4J8DA 3DXMG 4GCNA 3FH7A 5CRUA 4JEUA 1MHQA 4WNGA 3QAQA 2QZAA 3V79K 3DXKG 3BQOA 1SA4A 4ANWA 3FUKA 2LAHA 1JWGA 3G2UA 3Q9NC 2CHWA 3D9PA 3HIZA 3D3MA 3D9LA 3CVWA 4XKCA 2H6FA 1E90A 2YINA 3BG1B 2R03A 1HXIA 5HRYA 2OVFA 3ONLA 2R5SA 2CFZA 3Q7AA 5LX8A 4P29A 3Q5MA 1IXVA 1V55E 3SNXA 3EUVA 4GZ6A 4UI9C 4AIFA 2KZTB 2I1JA 5B1BE 3LCAA 3RSEG 3R9AB 3FUHA 3BG0B 3JXJA 3D9HA 2VTBA 1FPPA 3B7UX 3QKYA 3Q75A 2WXJA 1N0QA 4U96D 3T5VA 3LYAA 1W3BA 3EIQC 4DX7D 3L22A 4Q96A 3HXBA 3I3NA 2X6KA 3QWWA 3CKBA 3SBSA 2C0MA 1NI1A 3UMVA 3RK6A 1KPSB 4J8SA 1IYGA 2J09A 1OT8A 4I2ZA 5KJNA 2GGFA 4IN3B 3UT8A 2WB2A 4JPSA 3FTYA 1P5QA 4MRUA 4A3VA 5G2NA 2IOSA 1OUVA 2IF4A 3ZYQA 4I6EA 5KBAA 5D0OD 4A55A 4G25A 3C3RA 3LY8A 3L82A 5CEAA 1TNZA 1OY3D 3G2TA 4UWFA 2P9IG 3SFXA 1O1TA 3QARA 2Y3AA 4NQ0A 5EILA 4JA7A 1HU3A 5ANRA 4U95D 3CVPA 1HG2A 2V5FA 1H19A 4AVXA 4HORA 4GB9A 3E37A 3ZUVB 3MYVA 3PZ4A 1AP7A 2Y0BG 2XGMA 3ZXSA 2A5EA 2CG2A 4CEMA 3U64A 2H6IA 2BKKB 4G11A 3IEGA 3R7QA 2IO2C 1HZ4A 4EECA 1TJFA 3TWRA 3MZLB 3SO8A 3TG4A 2XEVA 3C5RA 3QK0A 2QC9A 1BU9A 4F53A 5FQ8A 2LAIA 5KNHD 1N0RA 5ENTD 3CVXA 2L0TB 3S2AA 5JMND 1UG3A 4XI9A 3VTXA 5CMWA 3LVRE 2P58C 1N95A 1KT1A 2ILRA 4GZ5A 1TNYA 4JL0A 5A23A 3G2SA 4GAAA 2HE0A 5BPPA 2FI7A 5EYPF 4DRXE 3MA5A 2MYOA 5AIJA 3CQCB 5FQ6A 2P9UG 3EU9A 3WG7E 3QNKA 2LXMA 3ONKA 4BY6A 3UT4A 3T5XA 3AU5A 4FP7A 3CHMA 4UWHA 2ZXWE 3V30A 4PH4B 2AXUA 3CK7A 3NAWA 4ILIA 5FJYA 4G8KA 3RKVA 2P2CP 4GCOA 3UXGA 5CRVA 4URKA 3S7JA 4HOTA 4JHJA 3FH5A 2P9NG 3O48A 1E96B 3N71A 1QYMA 5JJ6A 2X6FA 4AOFA 2VGXB 3SBTB 5AENA 2J9QA 4GZDA 4DLOA 3EIJA 5CEDB 3FTWA 4AM9A 2EILE 4I17A 1DCQA 2Q7FA 2V5QC 1N4QA 4RG9A 3TXNA 5E76A 4BT9A 3Q9UC 4LRZA 4I43A 3MV2B 2ETBA 2LUHA 4QFVA 3UKRG 5A7DB 3PZ3A 3NZUA 3ZHEA 1JWFA 3MGBA 2WQ6A 5JA4D 4CZ2D 4OVUA 2ZISA 2OV8A 3MCXA 2VJ8A 5AARA 3D9OA 3HXFA 1WY6A 1K1AA 2AXZA 2ETAA 3CKCA 3LKUA 4AY6A 4E85A 4N5CA 5AAOA 1LF8A 4XKBA 4B8AA 1K8KG 4BX9A 4F3VA 1DNPA 4HI9A 2KCVA 3NB2A 1JPLA 3LS8A 2RFMA 4U8YD 1OWLA 1ELWA 1D9SA 1H6OA 1O1SA 3DSTA 4GU5A 3FUDA 1OWPA 2VSYA 3U4TA 4G1TA 4AXHA 4LNUD 3B95A 3OXGA 3EHNA 1S64A 1N4PA 1U3DA 1ELRA 3G2VA 2H6HA 1OCOE 1IHGA 3AS4A 3TGOA 3B7TA 2IONA 1NA0A 5ENRD 4Y6WA 4G26A 3MKQA 5KJLA 2EIKE 1YYHA 4BWRA 2WXHA 4HFGA 4K5BA 4FHJA 3APDA 3NOGD 4BERA 4JHRA 3FU0A 3S7BA 3PS6A 4UI9K 1INZA 2WXKA 3UKUG 2YQ8A 4ATGA 3ZFWA 4MBGA 1H2TC 4PS8A 3KAEA 1QBQA 5EX3A 2UWJG 2JLBA 3QWPA 1H0AA 4WUYA 1TYQG 3TWWA 3B7BA 2VSXE 1OCZE 2DYRE 3RO3A 3TL5A 4CCAA 1QNFA 4PDXA 5FT9A 3ASFA 3PDNA 3JYSA 1H6PA 3FFLA 5G05C 5KWDA 4U0SA 3ABME 1SQMA 3DPDA 2C2LA 3TG5A 5DIZA 4FULA 3ASOE 3KEAA 5B1AE 3FU6A 3E32A 3VTYA 4G8LA 3LY9A 5D2MC 4UQXA 3GZ1A 3DEPA 3OXLA 2QFCA 1HG5A 4GA0A 3R9MA 4FLBA 4UI9J 3D9JA 3QWVA 2IO3C 2GW1A 2PNNA 1UN9A 3ZIMA 3MKRA 1HF8A 3PZDA 1K3ZD 4FHKA 3O4ZA 3RAUA 4LUNU 1HO8A 1UW4B 3V2OA 5J90A 1A17A 1UJKA 3CHSA 3CLJA 1BLXB 3AS5A 5EIDA 3HYMB 4AY5A 2BUGA 4X8QA 3ZEFA 4L1BA 5BW8C 3ZYMA 1Z6TA 3E30A 4AP2A 1V54E 2NC9A 4K0RA 4HRNA 3CVUA 1JCQA 1N4RA 1S0PA 2AJAA 4F7AA 4HRLA 3PH0C 4N3BA 3QDNA 1H6KA 1KZPA 4EBAA 1B89A 3FTVA 2C0LA 4TUUA 3ZPJA 5HQ8A 2GRQB 4A63B 2GRLA 3KEZA 2PQRA 1E8XA 3C98A 3FULA 3I4GA 3URZA 2YNQA 4B94A 2PM6A 2XPZA 1Z3XA 4DK5A 1KT0A 2KATA 3FUEA 1U2VG 3W9FA 3FU3A 4H7YA 4RLYA 4AJWA 2H6GA 4UQZA 4EZJA 3S7DA 3I5PA 4GTTA 4KVMA 2F37A 3CHPA 5FQ7A 1FT1A 2VTBB 2XHEA 1H2VC 1X81A 5EKQD 4JC8A 4B0ZA 3AAAC 2VGEA 5AQAA 1HS6A 4EPZA 3AS8A 1UN8A 3UIPC 2WQ7A 4L9PA 3UIOC 4V3IA 4KVOA 4IULA 5LCWC 3JCKC 2PQNA 1OCCE 4G24A 4TXRA 4UWGA 3SI5A 3DBSA 3ASGA 2WXFA 3ULQA 2V4HC 3ISMC 5HS0A 3SGHA 2WXMA 3ASHA 4GTPA 1ELKA 3EHRA 3NF1A 5EDSA 1OCRE 4WNEA 3ZU7B 4HNAD 4O6FA 4A3TA 5ITZF 3Q49B 4GMLA 4N2QA 1WG0A 3DRAA 1DCEA 4CDMA 4Q94A 1PC2A 3C72A 4Z68A 5BV1A 4KT6B 4OAUC 3AU4A 2X6HA 2R2LA 4GTQA 2YHCA 3CIAA 1QQEA 5T3RA 2MHKA 2J4DA 3FWVA 2P9PG 5EX0A 1EDUA 3IHYA 1U3CA 5C1DA 2RFAA 5BV0A 3FTSA 4J8FA 3U9WA 5AQ7A 2BF0X 2L0IA 4M3OA 1TNBA 3C3QA 4CDNA 4DUIA 4UQYA 2X6JA 2ZIRA 4N5QA 4HLEA 4EZKA 4A1SA 5KCMA 3IKOB 2XGOA 3JUIA 4HXIA 3D9KA 3HVEB 4YNDA 4WAFA 2CG3A 3TWSA 2Y4UA 4C0MA 3L08A 1D8DA 5HKPA 1K1BA 3AJIA 1LD8A 2WQHA 3PRZA 2UY1A 2WXOA 4U7EB 2IFUA 2XQ0A 3PZ2A 3NZSA 3CVVA 3IHVA 5C2YA 4GMRA 1PAQA 2A5UA 4HOQA 3T8MA 3J5QB 5LFAA 1N94A 2E2EA 4DX5D 3QJZA 4HRMB 1QZ2A 4MKTA 1GW6A 3FH8A 4DJAA 3P2BA 4OYSA 3ULYA 1S63A 1HH8A 1NFIE 4YVOA 5D66A 5KJKA 3OTNA 4FJZA 4UWKA 3LDZA 1H2UA 3ESLA 1TNUA 3U3WA 3DEOA 4J8EA 2Y1LE 3PUKA 4NACA 3CV0A 2L6BA 4TV3A 2XEEA 2MOWA 5KJMA 2FBNA 5AN8A 1HFAA 1A5EA 3Q15A 3CSFA 5H7PA 3HXDA 2I6HA 3L17A 3ZRHA 4CT4A 1WDYA 4F1PA 3P1UA 1MX6A 5ANLA 1E7UA 1Z3YA 4RQIA 4U04A 4PS7A 4DI4A 4W9RA 5EN5D 3HXEA 2LSVA 4WNFA 2P9SG 3MV3B 2IOLA 2V0PA 5DBKA 3SZ7A 3CHRA 3SF4A 1ZB1A 4HI8A 2HYZA 2I2OA 2LO6A 4J0UA 4BSXA 4DPRA 5FZRA 2GROB 3TJPA 1YCSB 4HOUA 1S70B 1FVFA 1XGWA 4ZHBA 4CGWA 2J08A 3KD7A 1EF1C 2M63A 5ENNA 2LNIA 3EJNA 3X2QE 3UINC 1Y6IA 3BEEA 3L6AA 3HG0D 3Q47B 4U8HA 2XGSA 3ZYLA 2KCLA 3DSWA 3FU5A 3BU8A 3AG3E 3FEYA 5FINA 1UJJA 1KLXA 4BESA 2R59A 1E8YA 3RRMB 5G05J 4BTBA 3F6QA 3TAXA 3CK8A 4EQFA 2OOEA 3UX4A 2VSNA 2IJGX 2FULA 3ZGQA 1EPUA 4FADA 4BETA 3FUJA 1PY1A 5AQBA 4L2YA 3EU5A 3FHEA 5LP0A 3SY2A 3GZSA 3FDHA 2EIJE 4BT8A 3FP3A 3UUXA 3ML9A 4JEHA 5HI7A 4K03A 2FO1E 2GRNB 4KZ0A 4RSYA 3PNLB 1FCHA 3ZKJA 2NYJA 3D9NA 4G2VA 2EQXA 4HS2A 1RW2A 2HO1A 2J8SD 3ABKE 4Q69A 3SQVA 3MKQB 4XZ4A 1L5JA 2KC7A 1LD7A 3R7RA 3IBEA 4JW1A 3I4RB 4I6GA 4AV7A 3ZW3A 2F8YA 3NQPA 5FWQA 3UQ3A 3KS2A 5AJLA 4YDYA 2AXVA 2OCCE 5FTPA 3UM2A 1IQUA 3JXIA 1TN6A 4EBAG 3PNTB 1N52A 2I9CA 1EYHA 2WMNA 4GA1A 1TN7A 5AQ9A 2F0YA 3KSQA 5FIOA 3B13A 3LY7A 3FUNA 1NP7A 4ME2A 2IU1A 1FVHA 3TWVA 3UM1A 4M7CA 4ACKA 4GPMA 2CHXA 3MX3A 1IKND 3PREA 2X38A 3PE4A 4I9CA 4KMOA 2DYSE 2VQ2A 5JJ7A 4ILHB 4O1OA 4U8VD 3ASDA 3C3OA 2J07A 4F1SA 1Y8MA 5FZQA 2OEVA 3TXMA 3DWLG 4JHKA 4DX1A 1DC2A 4YVQC 3LEWA 3SHFA 4ACLA 5J08A 3LXUX 1BD8A 2KZTA 3TWQA 5G04C 2QY7A 5CBNA 3G2WA 2WM9A 2DCPA 2FO7A 3NOCD 5G55A 2JABA 2CFUA 3L9TA 2EINE 3RRNB 2ZGGA 4CGVA 4DX6D 1MJ0A 2AWIA 2E0IA 2WVIA 4I1OB 3IXEA 1NZNA 4A1GA 5EYLA 4I2WA 4WWPA 4KYOB 5LCWJ 4XEIG 4UUCA 2R17C 3HRAA 4MS6A 1IHBA 4J7WA 1NL4A 5CHEE 3E34A 4YDWA 3QB2A 4KXKB 4G23A 5CMYA 4JA9A 2J49A 4AEZC 2RKKA 3APCA 3DSSA 5M72A 2MRIA 4WWNA 2PM7A 3Q4AB 4TXQA 2X6IA 1N54A 2WXGA 4FLHA 5ENPD 4ZFHA 4OVVA 4ILGA 1OWNA 3CK9A 2WXPA 3ML8A 3S7FA 3IV0A 2I1KA 3CSTA 4GTVA 2DZNA 1Q2ZA 4GYYA 3CVYA 4GZ3A 3PVLA 1ZBPA 2OEWA 5CBOA 3Q73A 2IEJA 3FY4A 4I1MA 4KBQA 2ZGDA 4BX8A 3WXXA 3PEVB 3CHOA 1JCSA 1WM5A 3ZXPA 2RG8A 3BUAA 3PUJA 3CQGB 3AG4E 2AW6A 4QQIA 2KBXA 4FJYA 3UT7A 4LCTA 4JB8P 2OVBA 3Q7FA 4APFA 1SZAA 1MZCA 4J8YA 1JCRA 2XZTG 1TR4A 3PEUB 3LJNA 3RU0A 3UPVA 3UI2A 2A4ZA 4GTRA 5A6CA 4NRHB 2WXQA 1TEZA 1SW6A 1OXJA 3EHMA 4CYMD 4C9BB 2NSZA 3SFZA 5D0QD 5T4YA 2XPIA 2KCKA 4YDEA 3DSUA 4XX5A 3T9KA 5AJDA 2VYIA 2DZOA 3QC1A 3ENEA 1OWMA 4L7TA 3FEXA 2WMOA 1TNOA 4LNBA 4O1PA 5T8IA 1OWOA 4LG6A 4RVBA 2P9LG 5BXOA 4DLQA 2XS8A 3HVEA 4JVSA 2DWZA 3CR3A 2XENA 3RO2A 1KZOA 3GZ2A 2JEKA 2ZU6B 4GA2A 4WNDA 4TXPA 4CRWA 5JHBA 1IQRA 1LTXA 4HQDA 2FEZA 4GYOA 3SFYA 5IY5E 2L9BA 4PUCA 2HM8A 4CDRA 1BI7B 3FUMA 3LPZA 2GRPB 1TJCA 1NA3A 2CHZA 3UM0A 3APFA 1G3NB 2YHEA 2XCBA 3RJVA 3TWTA 2B0OE 3GYZA 2XPYA 3AG2E 5LOZA 3NBNB 3DPYA 3TWXA 5CCMA 4D10C 1AWCB 5BXUA 3VLFA 5BT1A 5FZSA 4N2SA 4BEPA 4ANUA 5ENQD 3SD5A 2VGXA 4BTAA 2Y4TA 2GRMA 1HX8A 4E6HA 5AYWD 4KZCA 4APOA 2QYJA 3OAWA 3ZYKA 4HLLA 4B89A 3ABLE 2KM4A 3K9IA 4B8CB 1TN8A 3JQ0A 2UY1B 2J4BA 3AG1E 3UM3A 4OAVB 4L2LA 2VGYA 2V4LA 4YDOA 3D9MA 4DI3A 1YMPA 2L6JA 1YA0A 4ANVA 3B7RL 2LSUA 2DIWA 3MJWA 2XZDG 4EHMA 1BI8B 1E8ZA 4FC8A 3J5PA 1D8EA 1O1RA 1VDYA 4I9EA 3VLEA 4BSZB 3U66A 4HBDA 1JUQA 5CECB 2WPVA 3KSLA 1MX4A 4EZLA 1DVPA 4JXTA 3CGHA 1SVXA 4UWLA 5FQ4A 3JUEA 3FTXA 3HXCA 2GRRB 3V2XA 4J6IA 3HHMA 1Z5SC 3RRUA 4TRQA 4JZYA 2XRZA 4FU3A
chains in the Genus database with same CATH topology
1NFIE 3HG0D 5ENRD 5D66A 1SW6A 5JMND 4BEPA 2ETCA 2V5QC 4UUCA 2F8XK 2PNNA 3HRAA 1YYHA 1N11A 4CYMD 4ATZD 5ENQD 2BKGA 5AQ9A 3W9FA 4RLYA 4K5BA 1IHBA 4J7WA 3W9GA 3V79K 4B93B 3DEOA 4YDWA 5FIOA 3Q9UC 1K3ZD 5FINA 3NOGD 4BERA 3Q9NC 2F37A 3V2OA 4BESA 2QYJA 2RFAA 2Y1LE 2HE0A 3TWUA 3V31A 3ZNGA 3T9KA 2L6BA 5AQ7A 1MX2A 2XEEA 2ETBA 5ENOD 1BLXB 4QFVA 2DZOA 3F6QA 5EYPF 4HLLA 3TWVA 1UOHA 4DRXE 2MYOA 5KBAA 5AN8A 1A5EA 5EIDA 5HRYA 4DX2A 4DUIA 3AAAC 4O1PA 2VGEA 4GPMA 4N5QA 5AQAA 4CZ2D 5ENPD 4BETA 4ZFHA 5JA4D 3EU9A 1IXVA 1WDYA 1IKND 4LG6A 5CEAA 4OAVB 4F1PA 4LSZE 1OY3D 5AQBA 5BXOA 2KXPC 5EILA 2DZNA 1MX6A 3TWWA 4O1OA 5AARA 4U8VD 3B7BA 4U95D 3TWSA 5CERB 4TUMA 1YMPA 1K1AA 2DWZA 4HRNA 2XENA 2ETAA 3JXJA 3D9HA 4K5AB 5AAOA 2FO1E 4NIKA 5EIBE 4DX1A 5HKPA 2XZDG 1K1BA 3AJIA 5ENSD 3V30A 5CBOA 5EN5D 1N0QA 3ZUVB 2V4HC 1BI8B 5HS0A 3UTMA 1AP7A 1DC2A 2Y0BG 4G8KA 3EHQA 3ZKJA 2NYJA 3J5PA 4F6RD 4U96D 4HQDA 4HI9A 2ZGDA 2P2CP 3EHRA 5KWDA 2DVWA 2RFMA 4U8YD 2AJAA 3UXGA 4BSZB 2A5EA 3ZU7B 4HRLA 4HBDA 4O60A 5CECB 1D9SA 1MX4A 4K5CA 4DX7D 1BD8A 1BI7B 2J8SD 2BKKB 3TWQA 4HNAD 4GMRA 4HI8A 5ITZF 1SVXA 1QYMA 5CBNA 3KEAA 3J5QB 3TWRA 5KNGA 1G3NB 3JUEA 1YCSB 2XEHA 1MYOA 3SO8A 3NOCD 4DX5D 1WG0A 4G8LA 4LNUD 2JABA 2F8YA 4C48B 3B95A 1S70B 2B0OE 2KBXA 4QQIA 3TWTA 3C5RA 3V2XA 4HRMB 2ZGGA 4ZHBA 2QC9A 1OT8A 4HB5A 4DX6D 1MJ0A 3NBNB 1BU9A 3DEPA 3T8KA 4JB8P 4A63B 5CEDB 3TWXA 4Z68A 3IXEA 5KNHD 1N0RA 1AWCB 4YDYA 5BXUA 4J8YA 2XZTG 5EYLA 1DCQA 1TR4A 3LJNA 4OAUC 5ENTD 3UI2A 3JXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NFI E;  3HG0 D;  5ENR D;  5D66 A;  1SW6 A;  5JMN D;  4BEP A;  2ETC A;  2V5Q C;  4UUC A;  2F8X K;  2PNN A;  3HRA A;  1YYH A;  1N11 A;  4CYM D;  4ATZ D;  5ENQ D;  2BKG A;  5AQ9 A;  3W9F A;  4RLY A;  4K5B A;  1IHB A;  4J7W A;  3W9G A;  3V79 K;  4B93 B;  3DEO A;  4YDW A;  5FIO A;  3Q9U C;  1K3Z D;  5FIN A;  3NOG D;  4BER A;  3Q9N C;  2F37 A;  3V2O A;  4BES A;  2QYJ A;  2RFA A;  2Y1L E;  2HE0 A;  3TWU A;  3V31 A;  3ZNG A;  3T9K A;  2L6B A;  5AQ7 A;  1MX2 A;  2XEE A;  2ETB A;  5ENO D;  1BLX B;  4QFV A;  2DZO A;  3F6Q A;  5EYP F;  4HLL A;  3TWV A;  1UOH A;  4DRX E;  2MYO A;  5KBA A;  5AN8 A;  1A5E A;  5EID A;  5HRY A;  4DX2 A;  4DUI A;  3AAA C;  4O1P A;  2VGE A;  4GPM A;  4N5Q A;  5AQA A;  4CZ2 D;  5ENP D;  4BET A;  4ZFH A;  5JA4 D;  3EU9 A;  1IXV A;  1WDY A;  1IKN D;  4LG6 A;  5CEA A;  4OAV B;  4F1P A;  4LSZ E;  1OY3 D;  5AQB A;  5BXO A;  2KXP C;  5EIL A;  2DZN A;  1MX6 A;  3TWW A;  4O1O A;  5AAR A;  4U8V D;  3B7B A;  4U95 D;  3TWS A;  5CER B;  4TUM A;  1YMP A;  1K1A A;  2DWZ A;  4HRN A;  2XEN A;  2ETA A;  3JXJ A;  3D9H A;  4K5A B;  5AAO A;  2FO1 E;  4NIK A;  5EIB E;  4DX1 A;  5HKP A;  2XZD G;  1K1B A;  3AJI A;  5ENS D;  3V30 A;  5CBO A;  5EN5 D;  1N0Q A;  3ZUV B;  2V4H C;  1BI8 B;  5HS0 A;  3UTM A;  1AP7 A;  1DC2 A;  2Y0B G;  4G8K A;  3EHQ A;  3ZKJ A;  2NYJ A;  3J5P A;  4F6R D;  4U96 D;  4HQD A;  4HI9 A;  2ZGD A;  2P2C P;  3EHR A;  5KWD A;  2DVW A;  2RFM A;  4U8Y D;  2AJA A;  3UXG A;  4BSZ B;  2A5E A;  3ZU7 B;  4HRL A;  4HBD A;  4O60 A;  5CEC B;  1D9S A;  1MX4 A;  4K5C A;  4DX7 D;  1BD8 A;  1BI7 B;  2J8S D;  2BKK B;  3TWQ A;  4HNA D;  4GMR A;  4HI8 A;  5ITZ F;  1SVX A;  1QYM A;  5CBN A;  3KEA A;  3J5Q B;  3TWR A;  5KNG A;  1G3N B;  3JUE A;  1YCS B;  2XEH A;  1MYO A;  3SO8 A;  3NOC D;  4DX5 D;  1WG0 A;  4G8L A;  4LNU D;  2JAB A;  2F8Y A;  4C48 B;  3B95 A;  1S70 B;  2B0O E;  2KBX A;  4QQI A;  3TWT A;  3C5R A;  3V2X A;  4HRM B;  2ZGG A;  4ZHB A;  2QC9 A;  1OT8 A;  4HB5 A;  4DX6 D;  1MJ0 A;  3NBN B;  1BU9 A;  3DEP A;  3T8K A;  4JB8 P;  4A63 B;  5CED B;  3TWX A;  4Z68 A;  3IXE A;  5KNH D;  1N0R A;  1AWC B;  4YDY A;  5BXU A;  4J8Y A;  2XZT G;  5EYL A;  1DCQ A;  1TR4 A;  3LJN A;  4OAU C;  5ENT D;  3UI2 A;  3JXI A; 
#chains in the Genus database with same CATH topology
 1MQS A;  3HDX A;  4U0U A;  2ETC A;  3ZVV A;  2F8X K;  3FUF A;  1N11 A;  4LNG A;  4ATZ D;  4FA6 A;  2XCC A;  5ARF A;  4HOS A;  3PE3 A;  5CCL A;  3V31 A;  1MX2 A;  3CVN A;  5ENO D;  3ESK A;  1UOH A;  3ZHE B;  5ARG A;  4DX2 A;  4C0E A;  2IY0 C;  3FTZ A;  3FUI A;  3JQ1 A;  2BTD A;  2R02 A;  2XS1 A;  2KXP C;  4I6J A;  2XRY A;  1SA5 A;  5BNW A;  5CER B;  3ASN E;  3LVQ E;  4XIF A;  1X5B A;  3ZN3 A;  3PZ1 A;  4K5A B;  3ULE G;  5EIB E;  1BPO A;  4I1A A;  4WWO A;  2X3M A;  2IQC A;  4GTO A;  1E7V A;  2HR2 A;  4GMJ A;  4XI0 A;  4O60 A;  4HVB A;  2NXP A;  2WXL A;  4Y6C A;  4GZC A;  2Y69 E;  2OND A;  4ABN A;  2XEH A;  4PS3 A;  2RD0 A;  4GPK A;  4C48 B;  2WXR A;  4U07 A;  2V8S E;  4R7L A;  4XE0 A;  3DSV A;  3CVL A;  1N4S A;  1RZ4 A;  3CVQ A;  4RG6 A;  3E4B A;  4GYW A;  4GTM A;  4N3C A;  2FF4 A;  3MEK A;  3L16 A;  2BKG A;  4LEU A;  3CHQ A;  3W9G A;  4B93 B;  1O5M A;  2EIM E;  4GTS A;  4BFR A;  4H7X A;  3TWU A;  4U0Z A;  2R05 A;  3ZNG A;  4NUR A;  3B7S A;  4N39 A;  1N9A A;  5G04 J;  3D9I A;  2PZI A;  2DBA A;  5BUZ A;  4LSZ E;  3EDT B;  3VLD A;  5JHA A;  4CT0 A;  4TUM A;  3RIB A;  5E75 A;  3DSX A;  3LJ3 A;  5B3S E;  4NIK A;  1XNF A;  2WXI A;  4U63 A;  5ENS D;  4IRU A;  3Q78 A;  3UTM A;  4MLP A;  1E8W A;  3EHQ A;  4F6R D;  2QYU A;  2DVW A;  4N3A A;  5JJT A;  4K5C A;  4L23 A;  3FTU A;  3E33 A;  4ANX A;  2PL2 A;  3L13 A;  3Q79 A;  2AVP A;  2B6C A;  3QOU A;  5KNG A;  1MYO A;  2VSO E;  1ZU2 A;  2BED A;  4IYP A;  1SZ9 A;  2LXL A;  4LER A;  1HE8 A;  4HB5 A;  3T8K A;  1WAO 1;  2P9K G;  2WXN A;  3OXF A;  1FT2 A;  3CEQ A;  3GW4 A;  4JD2 G;  3L54 A;  4J8D A;  3DXM G;  4GCN A;  3FH7 A;  5CRU A;  4JEU A;  1MHQ A;  4WNG A;  3QAQ A;  2QZA A;  3V79 K;  3DXK G;  3BQO A;  1SA4 A;  4ANW A;  3FUK A;  2LAH A;  1JWG A;  3G2U A;  3Q9N C;  2CHW A;  3D9P A;  3HIZ A;  3D3M A;  3D9L A;  3CVW A;  4XKC A;  2H6F A;  1E90 A;  2YIN A;  3BG1 B;  2R03 A;  1HXI A;  5HRY A;  2OVF A;  3ONL A;  2R5S A;  2CFZ A;  3Q7A A;  5LX8 A;  4P29 A;  3Q5M A;  1IXV A;  1V55 E;  3SNX A;  3EUV A;  4GZ6 A;  4UI9 C;  4AIF A;  2KZT B;  2I1J A;  5B1B E;  3LCA A;  3RSE G;  3R9A B;  3FUH A;  3BG0 B;  3JXJ A;  3D9H A;  2VTB A;  1FPP A;  3B7U X;  3QKY A;  3Q75 A;  2WXJ A;  1N0Q A;  4U96 D;  3T5V A;  3LYA A;  1W3B A;  3EIQ C;  4DX7 D;  3L22 A;  4Q96 A;  3HXB A;  3I3N A;  2X6K A;  3QWW A;  3CKB A;  3SBS A;  2C0M A;  1NI1 A;  3UMV A;  3RK6 A;  1KPS B;  4J8S A;  1IYG A;  2J09 A;  1OT8 A;  4I2Z A;  5KJN A;  2GGF A;  4IN3 B;  3UT8 A;  2WB2 A;  4JPS A;  3FTY A;  1P5Q A;  4MRU A;  4A3V A;  5G2N A;  2IOS A;  1OUV A;  2IF4 A;  3ZYQ A;  4I6E A;  5KBA A;  5D0O D;  4A55 A;  4G25 A;  3C3R A;  3LY8 A;  3L82 A;  5CEA A;  1TNZ A;  1OY3 D;  3G2T A;  4UWF A;  2P9I G;  3SFX A;  1O1T A;  3QAR A;  2Y3A A;  4NQ0 A;  5EIL A;  4JA7 A;  1HU3 A;  5ANR A;  4U95 D;  3CVP A;  1HG2 A;  2V5F A;  1H19 A;  4AVX A;  4HOR A;  4GB9 A;  3E37 A;  3ZUV B;  3MYV A;  3PZ4 A;  1AP7 A;  2Y0B G;  2XGM A;  3ZXS A;  2A5E A;  2CG2 A;  4CEM A;  3U64 A;  2H6I A;  2BKK B;  4G11 A;  3IEG A;  3R7Q A;  2IO2 C;  1HZ4 A;  4EEC A;  1TJF A;  3TWR A;  3MZL B;  3SO8 A;  3TG4 A;  2XEV A;  3C5R A;  3QK0 A;  2QC9 A;  1BU9 A;  4F53 A;  5FQ8 A;  2LAI A;  5KNH D;  1N0R A;  5ENT D;  3CVX A;  2L0T B;  3S2A A;  5JMN D;  1UG3 A;  4XI9 A;  3VTX A;  5CMW A;  3LVR E;  2P58 C;  1N95 A;  1KT1 A;  2ILR A;  4GZ5 A;  1TNY A;  4JL0 A;  5A23 A;  3G2S A;  4GAA A;  2HE0 A;  5BPP A;  2FI7 A;  5EYP F;  4DRX E;  3MA5 A;  2MYO A;  5AIJ A;  3CQC B;  5FQ6 A;  2P9U G;  3EU9 A;  3WG7 E;  3QNK A;  2LXM A;  3ONK A;  4BY6 A;  3UT4 A;  3T5X A;  3AU5 A;  4FP7 A;  3CHM A;  4UWH A;  2ZXW E;  3V30 A;  4PH4 B;  2AXU A;  3CK7 A;  3NAW A;  4ILI A;  5FJY A;  4G8K A;  3RKV A;  2P2C P;  4GCO A;  3UXG A;  5CRV A;  4URK A;  3S7J A;  4HOT A;  4JHJ A;  3FH5 A;  2P9N G;  3O48 A;  1E96 B;  3N71 A;  1QYM A;  5JJ6 A;  2X6F A;  4AOF A;  2VGX B;  3SBT B;  5AEN A;  2J9Q A;  4GZD A;  4DLO A;  3EIJ A;  5CED B;  3FTW A;  4AM9 A;  2EIL E;  4I17 A;  1DCQ A;  2Q7F A;  2V5Q C;  1N4Q A;  4RG9 A;  3TXN A;  5E76 A;  4BT9 A;  3Q9U C;  4LRZ A;  4I43 A;  3MV2 B;  2ETB A;  2LUH A;  4QFV A;  3UKR G;  5A7D B;  3PZ3 A;  3NZU A;  3ZHE A;  1JWF A;  3MGB A;  2WQ6 A;  5JA4 D;  4CZ2 D;  4OVU A;  2ZIS A;  2OV8 A;  3MCX A;  2VJ8 A;  5AAR A;  3D9O A;  3HXF A;  1WY6 A;  1K1A A;  2AXZ A;  2ETA A;  3CKC A;  3LKU A;  4AY6 A;  4E85 A;  4N5C A;  5AAO A;  1LF8 A;  4XKB A;  4B8A A;  1K8K G;  4BX9 A;  4F3V A;  1DNP A;  4HI9 A;  2KCV A;  3NB2 A;  1JPL A;  3LS8 A;  2RFM A;  4U8Y D;  1OWL A;  1ELW A;  1D9S A;  1H6O A;  1O1S A;  3DST A;  4GU5 A;  3FUD A;  1OWP A;  2VSY A;  3U4T A;  4G1T A;  4AXH A;  4LNU D;  3B95 A;  3OXG A;  3EHN A;  1S64 A;  1N4P A;  1U3D A;  1ELR A;  3G2V A;  2H6H A;  1OCO E;  1IHG A;  3AS4 A;  3TGO A;  3B7T A;  2ION A;  1NA0 A;  5ENR D;  4Y6W A;  4G26 A;  3MKQ A;  5KJL A;  2EIK E;  1YYH A;  4BWR A;  2WXH A;  4HFG A;  4K5B A;  4FHJ A;  3APD A;  3NOG D;  4BER A;  4JHR A;  3FU0 A;  3S7B A;  3PS6 A;  4UI9 K;  1INZ A;  2WXK A;  3UKU G;  2YQ8 A;  4ATG A;  3ZFW A;  4MBG A;  1H2T C;  4PS8 A;  3KAE A;  1QBQ A;  5EX3 A;  2UWJ G;  2JLB A;  3QWP A;  1H0A A;  4WUY A;  1TYQ G;  3TWW A;  3B7B A;  2VSX E;  1OCZ E;  2DYR E;  3RO3 A;  3TL5 A;  4CCA A;  1QNF A;  4PDX A;  5FT9 A;  3ASF A;  3PDN A;  3JYS A;  1H6P A;  3FFL A;  5G05 C;  5KWD A;  4U0S A;  3ABM E;  1SQM A;  3DPD A;  2C2L A;  3TG5 A;  5DIZ A;  4FUL A;  3ASO E;  3KEA A;  5B1A E;  3FU6 A;  3E32 A;  3VTY A;  4G8L A;  3LY9 A;  5D2M C;  4UQX A;  3GZ1 A;  3DEP A;  3OXL A;  2QFC A;  1HG5 A;  4GA0 A;  3R9M A;  4FLB A;  4UI9 J;  3D9J A;  3QWV A;  2IO3 C;  2GW1 A;  2PNN A;  1UN9 A;  3ZIM A;  3MKR A;  1HF8 A;  3PZD A;  1K3Z D;  4FHK A;  3O4Z A;  3RAU A;  4LUN U;  1HO8 A;  1UW4 B;  3V2O A;  5J90 A;  1A17 A;  1UJK A;  3CHS A;  3CLJ A;  1BLX B;  3AS5 A;  5EID A;  3HYM B;  4AY5 A;  2BUG A;  4X8Q A;  3ZEF A;  4L1B A;  5BW8 C;  3ZYM A;  1Z6T A;  3E30 A;  4AP2 A;  1V54 E;  2NC9 A;  4K0R A;  4HRN A;  3CVU A;  1JCQ A;  1N4R A;  1S0P A;  2AJA A;  4F7A A;  4HRL A;  3PH0 C;  4N3B A;  3QDN A;  1H6K A;  1KZP A;  4EBA A;  1B89 A;  3FTV A;  2C0L A;  4TUU A;  3ZPJ A;  5HQ8 A;  2GRQ B;  4A63 B;  2GRL A;  3KEZ A;  2PQR A;  1E8X A;  3C98 A;  3FUL A;  3I4G A;  3URZ A;  2YNQ A;  4B94 A;  2PM6 A;  2XPZ A;  1Z3X A;  4DK5 A;  1KT0 A;  2KAT A;  3FUE A;  1U2V G;  3W9F A;  3FU3 A;  4H7Y A;  4RLY A;  4AJW A;  2H6G A;  4UQZ A;  4EZJ A;  3S7D A;  3I5P A;  4GTT A;  4KVM A;  2F37 A;  3CHP A;  5FQ7 A;  1FT1 A;  2VTB B;  2XHE A;  1H2V C;  1X81 A;  5EKQ D;  4JC8 A;  4B0Z A;  3AAA C;  2VGE A;  5AQA A;  1HS6 A;  4EPZ A;  3AS8 A;  1UN8 A;  3UIP C;  2WQ7 A;  4L9P A;  3UIO C;  4V3I A;  4KVO A;  4IUL A;  5LCW C;  3JCK C;  2PQN A;  1OCC E;  4G24 A;  4TXR A;  4UWG A;  3SI5 A;  3DBS A;  3ASG A;  2WXF A;  3ULQ A;  2V4H C;  3ISM C;  5HS0 A;  3SGH A;  2WXM A;  3ASH A;  4GTP A;  1ELK A;  3EHR A;  3NF1 A;  5EDS A;  1OCR E;  4WNE A;  3ZU7 B;  4HNA D;  4O6F A;  4A3T A;  5ITZ F;  3Q49 B;  4GML A;  4N2Q A;  1WG0 A;  3DRA A;  1DCE A;  4CDM A;  4Q94 A;  1PC2 A;  3C72 A;  4Z68 A;  5BV1 A;  4KT6 B;  4OAU C;  3AU4 A;  2X6H A;  2R2L A;  4GTQ A;  2YHC A;  3CIA A;  1QQE A;  5T3R A;  2MHK A;  2J4D A;  3FWV A;  2P9P G;  5EX0 A;  1EDU A;  3IHY A;  1U3C A;  5C1D A;  2RFA A;  5BV0 A;  3FTS A;  4J8F A;  3U9W A;  5AQ7 A;  2BF0 X;  2L0I A;  4M3O A;  1TNB A;  3C3Q A;  4CDN A;  4DUI A;  4UQY A;  2X6J A;  2ZIR A;  4N5Q A;  4HLE A;  4EZK A;  4A1S A;  5KCM A;  3IKO B;  2XGO A;  3JUI A;  4HXI A;  3D9K A;  3HVE B;  4YND A;  4WAF A;  2CG3 A;  3TWS A;  2Y4U A;  4C0M A;  3L08 A;  1D8D A;  5HKP A;  1K1B A;  3AJI A;  1LD8 A;  2WQH A;  3PRZ A;  2UY1 A;  2WXO A;  4U7E B;  2IFU A;  2XQ0 A;  3PZ2 A;  3NZS A;  3CVV A;  3IHV A;  5C2Y A;  4GMR A;  1PAQ A;  2A5U A;  4HOQ A;  3T8M A;  3J5Q B;  5LFA A;  1N94 A;  2E2E A;  4DX5 D;  3QJZ A;  4HRM B;  1QZ2 A;  4MKT A;  1GW6 A;  3FH8 A;  4DJA A;  3P2B A;  4OYS A;  3ULY A;  1S63 A;  1HH8 A;  1NFI E;  4YVO A;  5D66 A;  5KJK A;  3OTN A;  4FJZ A;  4UWK A;  3LDZ A;  1H2U A;  3ESL A;  1TNU A;  3U3W A;  3DEO A;  4J8E A;  2Y1L E;  3PUK A;  4NAC A;  3CV0 A;  2L6B A;  4TV3 A;  2XEE A;  2MOW A;  5KJM A;  2FBN A;  5AN8 A;  1HFA A;  1A5E A;  3Q15 A;  3CSF A;  5H7P A;  3HXD A;  2I6H A;  3L17 A;  3ZRH A;  4CT4 A;  1WDY A;  4F1P A;  3P1U A;  1MX6 A;  5ANL A;  1E7U A;  1Z3Y A;  4RQI A;  4U04 A;  4PS7 A;  4DI4 A;  4W9R A;  5EN5 D;  3HXE A;  2LSV A;  4WNF A;  2P9S G;  3MV3 B;  2IOL A;  2V0P A;  5DBK A;  3SZ7 A;  3CHR A;  3SF4 A;  1ZB1 A;  4HI8 A;  2HYZ A;  2I2O A;  2LO6 A;  4J0U A;  4BSX A;  4DPR A;  5FZR A;  2GRO B;  3TJP A;  1YCS B;  4HOU A;  1S70 B;  1FVF A;  1XGW A;  4ZHB A;  4CGW A;  2J08 A;  3KD7 A;  1EF1 C;  2M63 A;  5ENN A;  2LNI A;  3EJN A;  3X2Q E;  3UIN C;  1Y6I A;  3BEE A;  3L6A A;  3HG0 D;  3Q47 B;  4U8H A;  2XGS A;  3ZYL A;  2KCL A;  3DSW A;  3FU5 A;  3BU8 A;  3AG3 E;  3FEY A;  5FIN A;  1UJJ A;  1KLX A;  4BES A;  2R59 A;  1E8Y A;  3RRM B;  5G05 J;  4BTB A;  3F6Q A;  3TAX A;  3CK8 A;  4EQF A;  2OOE A;  3UX4 A;  2VSN A;  2IJG X;  2FUL A;  3ZGQ A;  1EPU A;  4FAD A;  4BET A;  3FUJ A;  1PY1 A;  5AQB A;  4L2Y A;  3EU5 A;  3FHE A;  5LP0 A;  3SY2 A;  3GZS A;  3FDH A;  2EIJ E;  4BT8 A;  3FP3 A;  3UUX A;  3ML9 A;  4JEH A;  5HI7 A;  4K03 A;  2FO1 E;  2GRN B;  4KZ0 A;  4RSY A;  3PNL B;  1FCH A;  3ZKJ A;  2NYJ A;  3D9N A;  4G2V A;  2EQX A;  4HS2 A;  1RW2 A;  2HO1 A;  2J8S D;  3ABK E;  4Q69 A;  3SQV A;  3MKQ B;  4XZ4 A;  1L5J A;  2KC7 A;  1LD7 A;  3R7R A;  3IBE A;  4JW1 A;  3I4R B;  4I6G A;  4AV7 A;  3ZW3 A;  2F8Y A;  3NQP A;  5FWQ A;  3UQ3 A;  3KS2 A;  5AJL A;  4YDY A;  2AXV A;  2OCC E;  5FTP A;  3UM2 A;  1IQU A;  3JXI A;  1TN6 A;  4EBA G;  3PNT B;  1N52 A;  2I9C A;  1EYH A;  2WMN A;  4GA1 A;  1TN7 A;  5AQ9 A;  2F0Y A;  3KSQ A;  5FIO A;  3B13 A;  3LY7 A;  3FUN A;  1NP7 A;  4ME2 A;  2IU1 A;  1FVH A;  3TWV A;  3UM1 A;  4M7C A;  4ACK A;  4GPM A;  2CHX A;  3MX3 A;  1IKN D;  3PRE A;  2X38 A;  3PE4 A;  4I9C A;  4KMO A;  2DYS E;  2VQ2 A;  5JJ7 A;  4ILH B;  4O1O A;  4U8V D;  3ASD A;  3C3O A;  2J07 A;  4F1S A;  1Y8M A;  5FZQ A;  2OEV A;  3TXM A;  3DWL G;  4JHK A;  4DX1 A;  1DC2 A;  4YVQ C;  3LEW A;  3SHF A;  4ACL A;  5J08 A;  3LXU X;  1BD8 A;  2KZT A;  3TWQ A;  5G04 C;  2QY7 A;  5CBN A;  3G2W A;  2WM9 A;  2DCP A;  2FO7 A;  3NOC D;  5G55 A;  2JAB A;  2CFU A;  3L9T A;  2EIN E;  3RRN B;  2ZGG A;  4CGV A;  4DX6 D;  1MJ0 A;  2AWI A;  2E0I A;  2WVI A;  4I1O B;  3IXE A;  1NZN A;  4A1G A;  5EYL A;  4I2W A;  4WWP A;  4KYO B;  5LCW J;  4XEI G;  4UUC A;  2R17 C;  3HRA A;  4MS6 A;  1IHB A;  4J7W A;  1NL4 A;  5CHE E;  3E34 A;  4YDW A;  3QB2 A;  4KXK B;  4G23 A;  5CMY A;  4JA9 A;  2J49 A;  4AEZ C;  2RKK A;  3APC A;  3DSS A;  5M72 A;  2MRI A;  4WWN A;  2PM7 A;  3Q4A B;  4TXQ A;  2X6I A;  1N54 A;  2WXG A;  4FLH A;  5ENP D;  4ZFH A;  4OVV A;  4ILG A;  1OWN A;  3CK9 A;  2WXP A;  3ML8 A;  3S7F A;  3IV0 A;  2I1K A;  3CST A;  4GTV A;  2DZN A;  1Q2Z A;  4GYY A;  3CVY A;  4GZ3 A;  3PVL A;  1ZBP A;  2OEW A;  5CBO A;  3Q73 A;  2IEJ A;  3FY4 A;  4I1M A;  4KBQ A;  2ZGD A;  4BX8 A;  3WXX A;  3PEV B;  3CHO A;  1JCS A;  1WM5 A;  3ZXP A;  2RG8 A;  3BUA A;  3PUJ A;  3CQG B;  3AG4 E;  2AW6 A;  4QQI A;  2KBX A;  4FJY A;  3UT7 A;  4LCT A;  4JB8 P;  2OVB A;  3Q7F A;  4APF A;  1SZA A;  1MZC A;  4J8Y A;  1JCR A;  2XZT G;  1TR4 A;  3PEU B;  3LJN A;  3RU0 A;  3UPV A;  3UI2 A;  2A4Z A;  4GTR A;  5A6C A;  4NRH B;  2WXQ A;  1TEZ A;  1SW6 A;  1OXJ A;  3EHM A;  4CYM D;  4C9B B;  2NSZ A;  3SFZ A;  5D0Q D;  5T4Y A;  2XPI A;  2KCK A;  4YDE A;  3DSU A;  4XX5 A;  3T9K A;  5AJD A;  2VYI A;  2DZO A;  3QC1 A;  3ENE A;  1OWM A;  4L7T A;  3FEX A;  2WMO A;  1TNO A;  4LNB A;  4O1P A;  5T8I A;  1OWO A;  4LG6 A;  4RVB A;  2P9L G;  5BXO A;  4DLQ A;  2XS8 A;  3HVE A;  4JVS A;  2DWZ A;  3CR3 A;  2XEN A;  3RO2 A;  1KZO A;  3GZ2 A;  2JEK A;  2ZU6 B;  4GA2 A;  4WND A;  4TXP A;  4CRW A;  5JHB A;  1IQR A;  1LTX A;  4HQD A;  2FEZ A;  4GYO A;  3SFY A;  5IY5 E;  2L9B A;  4PUC A;  2HM8 A;  4CDR A;  1BI7 B;  3FUM A;  3LPZ A;  2GRP B;  1TJC A;  1NA3 A;  2CHZ A;  3UM0 A;  3APF A;  1G3N B;  2YHE A;  2XCB A;  3RJV A;  3TWT A;  2B0O E;  3GYZ A;  2XPY A;  3AG2 E;  5LOZ A;  3NBN B;  3DPY A;  3TWX A;  5CCM A;  4D10 C;  1AWC B;  5BXU A;  3VLF A;  5BT1 A;  5FZS A;  4N2S A;  4BEP A;  4ANU A;  5ENQ D;  3SD5 A;  2VGX A;  4BTA A;  2Y4T A;  2GRM A;  1HX8 A;  4E6H A;  5AYW D;  4KZC A;  4APO A;  2QYJ A;  3OAW A;  3ZYK A;  4HLL A;  4B89 A;  3ABL E;  2KM4 A;  3K9I A;  4B8C B;  1TN8 A;  3JQ0 A;  2UY1 B;  2J4B A;  3AG1 E;  3UM3 A;  4OAV B;  4L2L A;  2VGY A;  2V4L A;  4YDO A;  3D9M A;  4DI3 A;  1YMP A;  2L6J A;  1YA0 A;  4ANV A;  3B7R L;  2LSU A;  2DIW A;  3MJW A;  2XZD G;  4EHM A;  1BI8 B;  1E8Z A;  4FC8 A;  3J5P A;  1D8E A;  1O1R A;  1VDY A;  4I9E A;  3VLE A;  4BSZ B;  3U66 A;  4HBD A;  1JUQ A;  5CEC B;  2WPV A;  3KSL A;  1MX4 A;  4EZL A;  1DVP A;  4JXT A;  3CGH A;  1SVX A;  4UWL A;  5FQ4 A;  3JUE A;  3FTX A;  3HXC A;  2GRR B;  3V2X A;  4J6I A;  3HHM A;  1Z5S C;  3RRU A;  4TRQ A;  4JZY A;  2XRZ A;  4FU3 A; 
#chains in the Genus database with same CATH homology
 1NFI E;  3HG0 D;  5ENR D;  5D66 A;  1SW6 A;  5JMN D;  4BEP A;  2ETC A;  2V5Q C;  4UUC A;  2F8X K;  2PNN A;  3HRA A;  1YYH A;  1N11 A;  4CYM D;  4ATZ D;  5ENQ D;  2BKG A;  5AQ9 A;  3W9F A;  4RLY A;  4K5B A;  1IHB A;  4J7W A;  3W9G A;  3V79 K;  4B93 B;  3DEO A;  4YDW A;  5FIO A;  3Q9U C;  1K3Z D;  5FIN A;  3NOG D;  4BER A;  3Q9N C;  2F37 A;  3V2O A;  4BES A;  2QYJ A;  2RFA A;  2Y1L E;  2HE0 A;  3TWU A;  3V31 A;  3ZNG A;  3T9K A;  2L6B A;  5AQ7 A;  1MX2 A;  2XEE A;  2ETB A;  5ENO D;  1BLX B;  4QFV A;  2DZO A;  3F6Q A;  5EYP F;  4HLL A;  3TWV A;  1UOH A;  4DRX E;  2MYO A;  5KBA A;  5AN8 A;  1A5E A;  5EID A;  5HRY A;  4DX2 A;  4DUI A;  3AAA C;  4O1P A;  2VGE A;  4GPM A;  4N5Q A;  5AQA A;  4CZ2 D;  5ENP D;  4BET A;  4ZFH A;  5JA4 D;  3EU9 A;  1IXV A;  1WDY A;  1IKN D;  4LG6 A;  5CEA A;  4OAV B;  4F1P A;  4LSZ E;  1OY3 D;  5AQB A;  5BXO A;  2KXP C;  5EIL A;  2DZN A;  1MX6 A;  3TWW A;  4O1O A;  5AAR A;  4U8V D;  3B7B A;  4U95 D;  3TWS A;  5CER B;  4TUM A;  1YMP A;  1K1A A;  2DWZ A;  4HRN A;  2XEN A;  2ETA A;  3JXJ A;  3D9H A;  4K5A B;  5AAO A;  2FO1 E;  4NIK A;  5EIB E;  4DX1 A;  5HKP A;  2XZD G;  1K1B A;  3AJI A;  5ENS D;  3V30 A;  5CBO A;  5EN5 D;  1N0Q A;  3ZUV B;  2V4H C;  1BI8 B;  5HS0 A;  3UTM A;  1AP7 A;  1DC2 A;  2Y0B G;  4G8K A;  3EHQ A;  3ZKJ A;  2NYJ A;  3J5P A;  4F6R D;  4U96 D;  4HQD A;  4HI9 A;  2ZGD A;  2P2C P;  3EHR A;  5KWD A;  2DVW A;  2RFM A;  4U8Y D;  2AJA A;  3UXG A;  4BSZ B;  2A5E A;  3ZU7 B;  4HRL A;  4HBD A;  4O60 A;  5CEC B;  1D9S A;  1MX4 A;  4K5C A;  4DX7 D;  1BD8 A;  1BI7 B;  2J8S D;  2BKK B;  3TWQ A;  4HNA D;  4GMR A;  4HI8 A;  5ITZ F;  1SVX A;  1QYM A;  5CBN A;  3KEA A;  3J5Q B;  3TWR A;  5KNG A;  1G3N B;  3JUE A;  1YCS B;  2XEH A;  1MYO A;  3SO8 A;  3NOC D;  4DX5 D;  1WG0 A;  4G8L A;  4LNU D;  2JAB A;  2F8Y A;  4C48 B;  3B95 A;  1S70 B;  2B0O E;  2KBX A;  4QQI A;  3TWT A;  3C5R A;  3V2X A;  4HRM B;  2ZGG A;  4ZHB A;  2QC9 A;  1OT8 A;  4HB5 A;  4DX6 D;  1MJ0 A;  3NBN B;  1BU9 A;  3DEP A;  3T8K A;  4JB8 P;  4A63 B;  5CED B;  3TWX A;  4Z68 A;  3IXE A;  5KNH D;  1N0R A;  1AWC B;  4YDY A;  5BXU A;  4J8Y A;  2XZT G;  5EYL A;  1DCQ A;  1TR4 A;  3LJN A;  4OAU C;  5ENT D;  3UI2 A;  3JXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...