5CEAA

Bd3460 immunity protein from bdellovibrio bacteriovorus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
193
structure length
193
Chain Sequence
SGKSSKALNEAAEQGDLAKVKNLVQKNKIDLNAQDETGMTPLMNAAMGGNLDIVKFLLSKKVNLELKNNGGETALAFAVTNDAYDVAEELIKAGANVDIIVAGDEGDTLFMRAAQNNKKTAESILAKNKSLINKANTLGETALFAVARYGTPADIDFLIKKGADLKLKNKKGQTALDVAKEASNQDTAKALSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus (strain atcc 15356 / dsm 50701 / ncib 9529 / hd100)
molecule tags Protein binding
molecule keywords Bd3460
total genus 67
structure length 193
sequence length 193
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5ceaA00
5HS0A 4ZHBA 2ETCA 1WG0A 4K5CA 1IXVA 4OAUC 3B95A 4G8LA 1BI8B 5FINA 1S70B 3ZNGA 3F6QA 4HBDA 1BLXB 3V79K 2Y0BG 4G8KA 4CZ2D 3KEAA 5AQBA 2RFAA 4U96D 4DX7D 3V31A 5KWDA 2MYOA 3EHRA 4OAVB 3W9GA 4ATZD 4QFVA 5EIBE 2NYJA 3JXIA 5ENRD 3V30A 5AN8A 5AARA 4LSZE 3TWXA 1N0RA 3D9HA 1BD8A 4HLLA 4QQIA 3TWSA 5JMND 4C48B 4BETA 4BESA 3DEOA 1YCSB 5AQ7A 1IKND 4DX5D 1BI7B 5EILA 3HRAA 5EN5D 4GMRA 3AAAC 3UTMA 4HI9A 2DZNA 2ETAA 5KNHD 4DUIA 4J8YA 4U8YD 4HNAD 2KBXA 5HKPA 2A5EA 3J5QB 5CEDB 2PNNA 4DX2A 3IXEA 3DEPA 2RFMA 4O1OA 4K5AB 4DX6D 4BEPA 1DC2A 4BERA 2F37A 4GPMA 5ENQD 1WDYA 2ETBA 3TWUA 3ZKJA 5D66A 3TWTA 5BXOA 1MJ0A 4JB8P 2ZGGA 5ENSD 2FO1E 5BXUA 1DCQA 1YMPA 5EYPF 2BKKB 4F6RD 3ZU7B 3AJIA 3SO8A 4HRLA 3JUEA 2V4HC 4YDYA 1YYHA 2Y1LE 3Q9NC 5CBOA 3HG0D 4LNUD 3Q9UC 4K5BA 4B93B 1OY3D 2P2CP 2XZTG 3V2OA 1QYMA 4O1PA 1MYOA 1N11A 4Z68A 2VGEA 5CBNA 4N5QA 1UOHA 3UXGA 4YDWA 3C5RA 5KNGA 2JABA 2F8YA 3T8KA 4UUCA 5EIDA 2J8SD 5CECB 4ZFHA 5ITZF 2ZGDA 4LG6A 1BU9A 1K1AA 3W9FA 1NFIE 2B0OE 2XEHA 4TUMA 1K3ZD 4U95D 5ENOD 5FIOA 4J7WA 2AJAA 3UI2A 4A63B 4RLYA 3TWRA 5ENPD 2XEEA 1IHBA 4HRNA 4BSZB 1AP7A 3LJNA 4NIKA 4F1PA 4DX1A 5AAOA 5HRYA 1G3NB 1MX6A 2F8XK 5AQAA 2V5QC 4U8VD 2XZDG 3T9KA 1AWCB 4DRXE 2QYJA 3J5PA 5JA4D 1SVXA 1D9SA 2DWZA 2DZOA 3TWQA 5AQ9A 1N0QA 1OT8A 1SW6A 3V2XA 1MX4A 1MX2A 3EHQA 2L6BA 3NOGD 4HB5A 4HQDA 3ZUVB 5CEAA 2KXPC 5CERB 5EYLA 3NOCD 2QC9A 3B7BA 3TWWA 5KBAA 1K1BA 4O60A 5ENTD 2BKGA 3NBNB 1TR4A 1A5EA 3EU9A 4HI8A 3JXJA 2HE0A 2XENA 2DVWA 4HRMB 3TWVA 4CYMD
chains in the Genus database with same CATH superfamily
3ESLA 2M63A 2WQ7A 3ZXSA 1BI8B 3F6QA 1BLXB 2WXPA 1V55E 1NP7A 1BPOA 5E76A 2DBAA 3PUKA 4JHRA 3FU5A 4EQFA 4I1MA 3FUHA 3JXIA 3QWWA 4WUYA 2WVIA 3RJVA 2R02A 4CDMA 5JMND 2I9CA 3AAAC 2CHZA 3UM0A 4EPZA 4B94A 3AG2E 2R2LA 1N4QA 3FU6A 3CVVA 4DX2A 3ZN3A 3S7FA 3PNLB 3CHMA 1WDYA 4GYOA 3IV0A 2QYUA 4H7XA 5ENSD 1HO8A 3UT7A 4L1BA 3I3NA 2YNQA 4TV3A 4N3CA 4K5BA 1OY3D 4N5CA 4D10C 2VSXE 3CIAA 3CHRA 4UUCA 3ULYA 2L0TB 3GZ1A 2B0OE 3PUJA 3FEYA 4J7WA 4OVVA 2WXJA 4O6FA 1E8XA 3CK7A 4ILIA 1IHBA 4ATGA 4BSZB 4FHKA 2WXLA 2EIKE 2F8XK 4RQIA 4KZCA 1LF8A 3ZPJA 2E0IA 3HVEA 3ZFWA 4JEUA 3FTZA 1D8EA 3PE4A 3AS5A 1V54E 3FTWA 2LSUA 1LTXA 2VJ8A 1EYHA 4FU3A 3TWVA 2GRNB 5HS0A 2DYSE 1WM5A 1WG0A 4OAUC 1OWMA 4BX8A 4M7CA 1FT1A 3KD7A 1UG3A 3FUDA 2R05A 4OAVB 2VQ2A 4DK5A 1SZAA 2X6JA 2BEDA 5AN8A 4JW1A 2R59A 3UPVA 2XPIA 3B7SA 3APCA 5CCMA 5LCWC 3GW4A 4I2WA 2CFZA 4AP2A 4GZDA 4YDEA 4KBQA 2L0IA 1MZCA 3ZRHA 3OXFA 3ZU7B 2V4HC 4OVUA 1QYMA 4Z68A 1JWFA 2EIJE 4BTBA 3DSWA 3W9FA 4TRQA 1K3ZD 3DPDA 3MYVA 3ASOE 4I1AA 4ILHB 3RRNB 3FH5A 4ANUA 3ZW3A 3QAQA 3L13A 2DIWA 3NOGD 5CEAA 2X6KA 2QC9A 5T8IA 5CRUA 2NC9A 3L82A 2OCCE 4Q96A 2XS1A 3RRUA 4K5CA 4CT0A 1FVFA 5D0OD 5FINA 2MRIA 4G11A 4AIFA 1RZ4A 1PC2A 1OCRE 3UINC 4G23A 1FT2A 5ENRD 3TXMA 3UM2A 3FY4A 4PDXA 2C0LA 4BESA 4A55A 2WXOA 2I1KA 5ENNA 4K0RA 4I43A 3L54A 4F53A 3E33A 3CR3A 3DEPA 3L9TA 3CKBA 3CVWA 4GTMA 4GA1A 3TWUA 5D66A 2XPYA 3TWTA 3LY7A 2QZAA 4GTRA 3RO2A 3Q75A 4YNDA 2PM7A 1VDYA 4F6RD 1S63A 2BUGA 3R7QA 1JUQA 2QFCA 4XIFA 2XZTG 5CHEE 3PDNA 1N11A 3B7UX 4LNGA 2L9BA 4TUUA 5JJ7A 3CK8A 3CVUA 4HRNA 4JXTA 1TEZA 3FH8A 3ONKA 5FZQA 3D9IA 3EHNA 3B7RL 3Q47B 3SNXA 3DXMG 4B0ZA 2LXMA 4ANXA 2P9PG 2R5SA 3AS8A 3DBSA 4B8CB 3B7BA 3C3QA 4LRZA 3DSTA 2WPVA 2IO3C 4PS7A 2H6GA 3FTSA 3Q5MA 2EQXA 2XHEA 2KCVA 3DSVA 4G8KA 1IQUA 1HG2A 4DX7D 2XRYA 3JYSA 3OTNA 4MBGA 1S64A 1QQEA 2HO1A 1OUVA 4XKCA 4FC8A 3ZYQA 3U9WA 5EILA 4HS2A 5KNHD 4AEZC 4DUIA 3UKRG 5T4YA 3B7TA 1MQSA 3G2WA 3HXEA 3NZSA 2J4BA 3KSLA 4G2VA 2ETBA 4A1SA 1E7UA 1MJ0A 2ZGGA 4U0SA 4IULA 4BWRA 2I1JA 1HZ4A 2LAHA 3ASHA 3L16A 3APFA 2H6IA 3BU8A 4TXQA 3RRMB 2F0YA 3LJ3A 3AG1E 4I17A 3T8KA 1W3BA 5CECB 4ZFHA 4U95D 1N4RA 2XPZA 1SA4A 4A63B 3BQOA 1E7VA 4JEHA 4G25A 4FJYA 2FO7A 2WB2A 2YINA 2IJGX 3CHQA 4EZLA 4LEUA 3T9KA 1HFAA 3SY2A 5HI7A 4XEIG 1ELWA 5EX3A 2FF4A 1ZB1A 3EHQA 4WWNA 1QBQA 2AVPA 3SZ7A 4L2YA 3APDA 4XX5A 4J0UA 2XQ0A 3VLEA 2ETCA 4CGWA 4L23A 5ARGA 5FJYA 3NB2A 3FU3A 1QNFA 2P9IG 4EHMA 4GMLA 3IKOB 2QY7A 5J90A 2R03A 1U3CA 3D3MA 5BPPA 4CRWA 1K8KG 5EIBE 4GCOA 2CFUA 5BV0A 3CV0A 1SQMA 4BFRA 3MA5A 4A1GA 5HKPA 1N94A 2OV8A 2AXVA 4AY6A 4NRHB 2RD0A 4AOFA 3FULA 2WXGA 3FUEA 2I2OA 3NZUA 3EUVA 1L5JA 1XGWA 1O1SA 3UXGA 1Q2ZA 3MV3B 4FLHA 5BNWA 3QOUA 3FP3A 3PZ3A 3U64A 3TG5A 5ENOD 1KT1A 4BY6A 3PE3A 1X81A 4FJZA 1H6OA 5JHAA 1XNFA 4ACLA 3UT4A 3LY9A 1MX4A 3CQCB 2X6HA 2KCLA 2XGMA 3CHPA 4GMJA 2C2LA 5AENA 1H19A 2Y0BG 5G04J 2ZIRA 3HDXA 5BV1A 1NL4A 1OCCE 3TGOA 3EHRA 4I6GA 3KS2A 2CHXA 2E2EA 3V30A 4C48B 1YCSB 1O1RA 3HRAA 4BTAA 4GMRA 3QDNA 4DX6D 5D0QD 1H2UA 5KJMA 4YDOA 4W9RA 5BXOA 3L08A 4GZ5A 2X6IA 3QKYA 2DCPA 2JEKA 1TN6A 3QJZA 3SGHA 4MKTA 4FHJA 2WXMA 4J8EA 2XEVA 3FDHA 4PS8A 3PZ1A 3QK0A 4KYOB 5FZRA 2J8SD 3SD5A 4YVQC 4LERA 3MKRA 3HXBA 2XEEA 5AAOA 3DSXA 4JL0A 1Y6IA 2IU1A 5G05C 4CEMA 2WQ6A 5D2MC 5C1DA 5FZSA 3FEXA 4GTPA 3FTUA 3Q15A 4P29A 2GRLA 1RW2A 3SFZA 2UY1B 2KM4A 1IXVA 4GYWA 2C0MA 3ZHEB 4F3VA 5AQBA 4RG9A 4GU5A 3ABLE 3D9KA 1D8DA 3DSUA 4HLEA 3P1UA 1B89A 3CK9A 2BTDA 4B89A 2IEJA 5LOZA 5CRVA 4O1OA 1DC2A 4AXHA 3UT8A 2WQHA 3T5VA 4EZJA 3QC1A 1A17A 2VSOE 3E34A 4U7EB 2LSVA 3QARA 1YMPA 5FT9A 3I4RB 4NACA 4NQ0A 4EBAG 3Q79A 2Y1LE 1N4SA 4LNUD 3Q9UC 2IQCA 3ML8A 4ME2A 3CVXA 4N5QA 4LUNU 2PZIA 4BT8A 5G05J 3CKCA 5ITZF 1DNPA 2GRRB 2WXQA 3UI2A 4J8FA 1FVHA 1AP7A 2V4LA 1G3NB 1UJKA 1AWCB 3I5PA 2IO2C 2OVBA 3ML9A 3PEUB 2PQRA 3CSFA 2MHKA 3BEEA 1LD8A 4A3VA 4ILGA 2KATA 1OT8A 3O4ZA 3ZUVB 1TNZA 3ZYKA 4EZKA 3TWWA 3ULQA 1OWLA 4U04A 3JXJA 1TNOA 2WXHA 4DI4A 2VTBB 3V79K 4CZ2D 3KEAA 1N9AA 2MYOA 4N3AA 4TXPA 4AY5A 3GYZA 3MZLB 3KSQA 2FI7A 4QFVA 2VYIA 4LSZE 4HFGA 1N0RA 4UI9J 4UWLA 4Q69A 2PQNA 4BX9A 1TNUA 2DZNA 4HNAD 4GTVA 2FBNA 2RFMA 4HOTA 4BERA 2F37A 3ZEFA 5BW8C 2VTBA 3ESKA 4I9EA 1DCQA 5AIJA 3D9JA 3AJIA 3JUEA 3PNTB 1YYHA 2ZU6B 3ASFA 1H0AA 1TN8A 4DLQA 2I6HA 4YDWA 4UWGA 3MKQA 1NA3A 3CVQA 2P9LG 4WNFA 3Q73A 4U07A 1NFIE 4I2ZA 1OXJA 2J9QA 4Y6CA 2WXRA 2OEWA 4F1PA 3T5XA 4GTSA 4APFA 3S2AA 1SVXA 2DZOA 2GRMA 3L22A 1N52A 5CERB 4GTOA 3CHSA 5IY5E 4R7LA 4XI0A 3S7DA 3JQ0A 3NAWA 4ZHBA 2VSNA 3CEQA 3EU5A 4JA7A 3DSSA 5JJTA 4FULA 2Y69E 5BT1A 5BUZA 3V31A 3EDTB 3W9GA 3K9IA 4N3BA 1LD7A 2PL2A 2UWJG 3TWSA 4BETA 3NF1A 2AXUA 1INZA 2V5FA 5LCWJ 4BT9A 3UQ3A 2P9NG 3S7BA 5KJLA 4BEPA 3FTVA 1IYGA 4PUCA 3SI5A 2DYRE 2GROB 3GZ2A 1N54A 3WXXA 3E30A 4KVOA 2V8SE 3PZ4A 3CVYA 4C9BB 3VTXA 4AJWA 5KCMA 5DBKA 1KZPA 2ZGDA 3UKUG 4GB9A 3VLFA 1UN8A 2AJAA 3AU4A 5FQ7A 2IFUA 1P5QA 1O5MA 4NIKA 3B13A 4DRXE 2L6JA 4KZ0A 3Q4AB 1TNYA 1N0QA 3C3OA 4L2LA 3NOCD 4PH4B 3ZYLA 1K1BA 4UI9C 2Y3AA 2DVWA 1KT0A 4UQXA 4B8AA 5B1AE 4N2SA 4EECA 4IN3B 3KAEA 4OYSA 4M3OA 5H7PA 3LKUA 4ATZD 2WXIA 3FUFA 4JVSA 2P9KG 1BD8A 4FA6A 4HORA 3ABME 4DX5D 1BI7B 3OXLA 2XCBA 3UTMA 4UQZA 3TG4A 3AG4E 4CDRA 1WY6A 2LAIA 5G55A 2NSZA 5AJDA 2PM6A 4GZ6A 1TNBA 3L6AA 4JZYA 3C3RA 3X2QE 3HYMB 3AG3E 4HRLA 3FU0A 3ASDA 4LNBA 4O1PA 1MYOA 3PVLA 3FUJA 4F1SA 1HX8A 3C5RA 2GRQB 3EHMA 4UWFA 5JHBA 4UWHA 2LO6A 2YHCA 3CGHA 4TUMA 5EX0A 3D9LA 1IHGA 3FUNA 3G2VA 4N39A 3D9MA 1MX6A 4XE0A 3UX4A 1TJCA 3SBTB 2XZDG 2CG2A 5ANRA 4GTQA 1OWOA 5KJKA 3EIJA 3JUIA 1D9SA 2CHWA 4HQDA 4E85A 4PS3A 1E90A 2XENA 2KZTB 3ASGA 1DCEA 1KZOA 3Q78A 3LVRE 3PH0C 5AJLA 3G2TA 4MRUA 2LNIA 3E32A 2FULA 2VSYA 3G2SA 5FQ4A 2NYJA 4APOA 4JHKA 3WG7E 5AQ7A 1IKND 1QZ2A 3ZGQA 1U2VG 3PS6A 3PREA 5C2YA 2PNNA 3FUKA 4K5AB 3D9PA 5A7DB 2RKKA 3UMVA 5B1BE 3CQGB 2EINE 1FCHA 4YDYA 3RU0A 4V3IA 3V2OA 3QWVA 4WWPA 2V0PA 3DWLG 4XZ4A 4J8SA 5EKQD 1UN9A 3EIQC 5EIDA 1TN7A 1BU9A 2KC7A 2XEHA 4UQYA 4Y6WA 1E8WA 5CMWA 3VTYA 4DX1A 5HRYA 4U8VD 3LCAA 1U3DA 2GW1A 4FADA 5LP0A 1UJJA 4KVMA 4I6JA 1E8YA 5FTPA 3SQVA 2KCKA 4JC8A 2XRZA 2KXPC 1HS6A 2J4DA 2Y4TA 2YHEA 1TR4A 3EU9A 4HRMB 2IONA 2ZXWE 4G1TA 1JCSA 3TJPA 3HXCA 5AYWD 1S70B 4DLOA 3MX3A 4AM9A 1Z3YA 3QB2A 1O1TA 2BF0X 2ONDA 4C0MA 3IBEA 3FTXA 3SFYA 3IHVA 4I9CA 1H6PA 4QQIA 4G24A 2P9SG 3S7JA 3DRAA 2XGOA 3SBSA 4K03A 2XCCA 4U8YD 1GW6A 2VGXA 5CEDB 3FHEA 2WXNA 3SFXA 2A4ZA 1NZNA 1SZ9A 2P58C 3HIZA 2IF4A 3MJWA 4J8DA 3FUIA 4XKBA 4EBAA 1ELRA 1N4PA 5HQ8A 4AV7A 3TWRA 3MKQB 2EILE 2V5QC 1OCZE 2VGYA 2J08A 3LPZA 3OXGA 4RVBA 3HHMA 2DWZA 3LEWA 3Q7FA 4GYYA 1MX2A 4L7TA 4JA9A 3EJNA 4TXRA 3R7RA 1ZBPA 4O60A 5CCLA 3UIOC 2BKGA 3TL5A 4F7AA 4CYMD 3CVPA 4WNGA 1HXIA 4U0ZA 4YVOA 4CGVA 1E8ZA 4U96D 3JQ1A 5KWDA 1E96B 1NA0A 4ACKA 4ABNA 4WWOA 2FEZA 3D9HA 1ELKA 4KMOA 5E75A 2H6HA 3UIPC 3FH7A 2LXLA 3UM3A 3IXEA 3ONLA 4RG6A 3HXDA 5ENQD 3ZKJA 3UM1A 2J09A 4ANVA 2UY1A 3TAXA 4HXIA 3CVNA 3D9NA 1Z5SC 3HG0D 1TYQG 1PY1A 5EDSA 4BSXA 4RSYA 3GZSA 2F8YA 1JWGA 3VLDA 1K1AA 4CCAA 4L9PA 3MEKA 3MV2B 3G2UA 5ANLA 1N95A 3ULEG 4DPRA 3DXKG 3SF4A 3J5PA 2YQ8A 4I1OB 3CHOA 1PAQA 2L6BA 4HB5A 2KZTA 3C72A 2ZISA 5B3SE 4HOUA 2HE0A 3MCXA 3ZYMA 3B95A 1WAO1 2AW6A 4HOQA 5LX8A 5CMYA 3KEZA 4LCTA 4HBDA 1JCQA 3BG1B 4XI9A 4IRUA 2HM8A 2WMNA 4X8QA 4E6HA 2EIME 3CLJA 3TWXA 5FWQA 4IYPA 3ZHEA 1YA0A 4FLBA 3HVEB 3R9MA 2HYZA 1IQRA 4GTTA 5FQ8A 3MGBA 3OAWA 3ENEA 4JB8P 1Y8MA 3PEVB 4J6IA 3I4GA 3SO8A 2OOEA 2HR2A 3T8MA 1HE8A 5CBNA 5M72A 4GA2A 4URKA 1TJFA 2P9UG 1S0PA 1H2TC 1UW4B 4CT4A 1HH8A 4WAFA 3AS4A 5JJ6A 4MS6A 5ENPD 3NQPA 2OVFA 3IHYA 4GA0A 2WM9A 3LYAA 5LFAA 3QNKA 3U4TA 4G26A 3FFLA 1HF8A 2QYJA 1ZU2A 2J49A 5JA4D 2IOLA 3D9OA 3Q7AA 1SA5A 2R17C 3L17A 1KPSB 3LXUX 3O48A 5G2NA 5ENTD 4N2QA 4CDNA 2NXPA 1A5EA 2X3MA 2GRPB 3QWPA 4C0EA 4U0UA 1FPPA 4Q94A 5G04C 1NI1A 2IOSA 2Q7FA 2WXKA 1OWPA 1MHQA 5AARA 1H6KA 4HLLA 2H6FA 4GCNA 5EN5D 4HI9A 1KLXA 2KBXA 3N71A 2Y4UA 5ARFA 3LDZA 2J07A 3LY8A 3ISMC 2XS8A 4GPMA 3IEGA 4FP7A 2GGFA 2WXFA 3RO3A 2IY0C 1HU3A 2FO1E 5BXUA 4HOSA 3Q49B 3JCKC 4JD2G 4UI9K 3R9AB 5CBOA 3BG0B 3E37A 5FQ6A 2CG3A 4I6EA 4UWKA 3RAUA 2JABA 4H7YA 3P2BA 1JPLA 5A6CA 5A23A 2OEVA 3AU5A 3LJNA 2AXZA 3LVQE 3RIBA 2XGSA 3TWQA 3V2XA 4HVBA 3DPYA 1Z6TA 3PRZA 5KBAA 4GPKA 3NBNB 4HI8A 5AQ9A 4WNEA 2A5UA 3ASNE 4G8LA 3ZNGA 2ILRA 2MOWA 2RFAA 3CSTA 3CVLA 4GAAA 3HXFA 3RKVA 1HG5A 3ABKE 3SHFA 3FTYA 3URZA 3U66A 3DEOA 3C98A 3ZXPA 2ETAA 4AVXA 4J8YA 2A5EA 3J5QB 1EDUA 3RSEG 4NURA 4DI3A 3ZVVA 4ANWA 4U63A 3E4BA 4GZCA 1OCOE 5EYPF 2BKKB 4JHJA 2WMOA 3ZIMA 4JPSA 3Q9NC 4B93B 1DVPA 2X38A 2P2CP 2VGEA 1UOHA 3LS8A 5KNGA 4GZ3A 2X6FA 2AWIA 4KXKB 1H2VC 3U3WA 2B6CA 4LG6A 1OWNA 4DJAA 2RG8A 5FIOA 4RLYA 5T3RA 4WNDA 4A3TA 2JLBA 3BUAA 3TXNA 5AQAA 5DIZA 1X5BA 3PZ2A 3FWVA 2VGXB 5KJNA 3PZDA 3UUXA 1EPUA 4MLPA 1SW6A 5J08A 2LUHA 5EYLA 3FUMA 1EF1C 1Z3XA 4KT6B 4U8HA 3RK6A 1JCRA
chains in the Genus database with same CATH topology
5HS0A 4ZHBA 2ETCA 1WG0A 4K5CA 1IXVA 4OAUC 3B95A 4G8LA 1BI8B 5FINA 1S70B 3ZNGA 3F6QA 4HBDA 1BLXB 3V79K 2Y0BG 4G8KA 4CZ2D 3KEAA 5AQBA 2RFAA 4U96D 4DX7D 3V31A 5KWDA 2MYOA 3EHRA 4OAVB 3W9GA 4ATZD 4QFVA 5EIBE 2NYJA 3JXIA 5ENRD 3V30A 5AN8A 5AARA 4LSZE 3TWXA 1N0RA 3D9HA 1BD8A 4HLLA 4QQIA 3TWSA 5JMND 4C48B 4BETA 4BESA 3DEOA 1YCSB 5AQ7A 1IKND 4DX5D 1BI7B 5EILA 3HRAA 5EN5D 4GMRA 3AAAC 3UTMA 4HI9A 2DZNA 2ETAA 5KNHD 4DUIA 4J8YA 4U8YD 4HNAD 2KBXA 5HKPA 2A5EA 3J5QB 5CEDB 2PNNA 4DX2A 3IXEA 3DEPA 2RFMA 4O1OA 4K5AB 4DX6D 4BEPA 1DC2A 4BERA 2F37A 4GPMA 5ENQD 1WDYA 2ETBA 3TWUA 3ZKJA 5D66A 3TWTA 5BXOA 1MJ0A 4JB8P 2ZGGA 5ENSD 2FO1E 5BXUA 1DCQA 1YMPA 5EYPF 2BKKB 4F6RD 3ZU7B 3AJIA 3SO8A 4HRLA 3JUEA 2V4HC 4YDYA 1YYHA 2Y1LE 3Q9NC 5CBOA 3HG0D 4LNUD 3Q9UC 4K5BA 4B93B 1OY3D 2P2CP 2XZTG 3V2OA 1QYMA 4O1PA 1MYOA 1N11A 4Z68A 2VGEA 5CBNA 4N5QA 1UOHA 3UXGA 4YDWA 3C5RA 5KNGA 2JABA 2F8YA 3T8KA 4UUCA 5EIDA 2J8SD 5CECB 4ZFHA 5ITZF 2ZGDA 4LG6A 1BU9A 1K1AA 3W9FA 1NFIE 2B0OE 2XEHA 4TUMA 1K3ZD 4U95D 5ENOD 5FIOA 4J7WA 2AJAA 3UI2A 4A63B 4RLYA 3TWRA 5ENPD 2XEEA 1IHBA 4HRNA 4BSZB 1AP7A 3LJNA 4NIKA 4F1PA 4DX1A 5AAOA 5HRYA 1G3NB 1MX6A 2F8XK 5AQAA 2V5QC 4U8VD 2XZDG 3T9KA 1AWCB 4DRXE 2QYJA 3J5PA 5JA4D 1SVXA 1D9SA 2DWZA 2DZOA 3TWQA 5AQ9A 1N0QA 1OT8A 1SW6A 3V2XA 1MX4A 1MX2A 3EHQA 2L6BA 3NOGD 4HB5A 4HQDA 3ZUVB 5CEAA 2KXPC 5CERB 5EYLA 3NOCD 2QC9A 3B7BA 3TWWA 5KBAA 1K1BA 4O60A 5ENTD 2BKGA 3NBNB 1TR4A 1A5EA 3EU9A 4HI8A 3JXJA 2HE0A 2XENA 2DVWA 4HRMB 3TWVA 4CYMD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HS0 A;  4ZHB A;  2ETC A;  1WG0 A;  4K5C A;  1IXV A;  4OAU C;  3B95 A;  4G8L A;  1BI8 B;  5FIN A;  1S70 B;  3ZNG A;  3F6Q A;  4HBD A;  1BLX B;  3V79 K;  2Y0B G;  4G8K A;  4CZ2 D;  3KEA A;  5AQB A;  2RFA A;  4U96 D;  4DX7 D;  3V31 A;  5KWD A;  2MYO A;  3EHR A;  4OAV B;  3W9G A;  4ATZ D;  4QFV A;  5EIB E;  2NYJ A;  3JXI A;  5ENR D;  3V30 A;  5AN8 A;  5AAR A;  4LSZ E;  3TWX A;  1N0R A;  3D9H A;  1BD8 A;  4HLL A;  4QQI A;  3TWS A;  5JMN D;  4C48 B;  4BET A;  4BES A;  3DEO A;  1YCS B;  5AQ7 A;  1IKN D;  4DX5 D;  1BI7 B;  5EIL A;  3HRA A;  5EN5 D;  4GMR A;  3AAA C;  3UTM A;  4HI9 A;  2DZN A;  2ETA A;  5KNH D;  4DUI A;  4J8Y A;  4U8Y D;  4HNA D;  2KBX A;  5HKP A;  2A5E A;  3J5Q B;  5CED B;  2PNN A;  4DX2 A;  3IXE A;  3DEP A;  2RFM A;  4O1O A;  4K5A B;  4DX6 D;  4BEP A;  1DC2 A;  4BER A;  2F37 A;  4GPM A;  5ENQ D;  1WDY A;  2ETB A;  3TWU A;  3ZKJ A;  5D66 A;  3TWT A;  5BXO A;  1MJ0 A;  4JB8 P;  2ZGG A;  5ENS D;  2FO1 E;  5BXU A;  1DCQ A;  1YMP A;  5EYP F;  2BKK B;  4F6R D;  3ZU7 B;  3AJI A;  3SO8 A;  4HRL A;  3JUE A;  2V4H C;  4YDY A;  1YYH A;  2Y1L E;  3Q9N C;  5CBO A;  3HG0 D;  4LNU D;  3Q9U C;  4K5B A;  4B93 B;  1OY3 D;  2P2C P;  2XZT G;  3V2O A;  1QYM A;  4O1P A;  1MYO A;  1N11 A;  4Z68 A;  2VGE A;  5CBN A;  4N5Q A;  1UOH A;  3UXG A;  4YDW A;  3C5R A;  5KNG A;  2JAB A;  2F8Y A;  3T8K A;  4UUC A;  5EID A;  2J8S D;  5CEC B;  4ZFH A;  5ITZ F;  2ZGD A;  4LG6 A;  1BU9 A;  1K1A A;  3W9F A;  1NFI E;  2B0O E;  2XEH A;  4TUM A;  1K3Z D;  4U95 D;  5ENO D;  5FIO A;  4J7W A;  2AJA A;  3UI2 A;  4A63 B;  4RLY A;  3TWR A;  5ENP D;  2XEE A;  1IHB A;  4HRN A;  4BSZ B;  1AP7 A;  3LJN A;  4NIK A;  4F1P A;  4DX1 A;  5AAO A;  5HRY A;  1G3N B;  1MX6 A;  2F8X K;  5AQA A;  2V5Q C;  4U8V D;  2XZD G;  3T9K A;  1AWC B;  4DRX E;  2QYJ A;  3J5P A;  5JA4 D;  1SVX A;  1D9S A;  2DWZ A;  2DZO A;  3TWQ A;  5AQ9 A;  1N0Q A;  1OT8 A;  1SW6 A;  3V2X A;  1MX4 A;  1MX2 A;  3EHQ A;  2L6B A;  3NOG D;  4HB5 A;  4HQD A;  3ZUV B;  5CEA A;  2KXP C;  5CER B;  5EYL A;  3NOC D;  2QC9 A;  3B7B A;  3TWW A;  5KBA A;  1K1B A;  4O60 A;  5ENT D;  2BKG A;  3NBN B;  1TR4 A;  1A5E A;  3EU9 A;  4HI8 A;  3JXJ A;  2HE0 A;  2XEN A;  2DVW A;  4HRM B;  3TWV A;  4CYM D; 
#chains in the Genus database with same CATH topology
 3ESL A;  2M63 A;  2WQ7 A;  3ZXS A;  1BI8 B;  3F6Q A;  1BLX B;  2WXP A;  1V55 E;  1NP7 A;  1BPO A;  5E76 A;  2DBA A;  3PUK A;  4JHR A;  3FU5 A;  4EQF A;  4I1M A;  3FUH A;  3JXI A;  3QWW A;  4WUY A;  2WVI A;  3RJV A;  2R02 A;  4CDM A;  5JMN D;  2I9C A;  3AAA C;  2CHZ A;  3UM0 A;  4EPZ A;  4B94 A;  3AG2 E;  2R2L A;  1N4Q A;  3FU6 A;  3CVV A;  4DX2 A;  3ZN3 A;  3S7F A;  3PNL B;  3CHM A;  1WDY A;  4GYO A;  3IV0 A;  2QYU A;  4H7X A;  5ENS D;  1HO8 A;  3UT7 A;  4L1B A;  3I3N A;  2YNQ A;  4TV3 A;  4N3C A;  4K5B A;  1OY3 D;  4N5C A;  4D10 C;  2VSX E;  3CIA A;  3CHR A;  4UUC A;  3ULY A;  2L0T B;  3GZ1 A;  2B0O E;  3PUJ A;  3FEY A;  4J7W A;  4OVV A;  2WXJ A;  4O6F A;  1E8X A;  3CK7 A;  4ILI A;  1IHB A;  4ATG A;  4BSZ B;  4FHK A;  2WXL A;  2EIK E;  2F8X K;  4RQI A;  4KZC A;  1LF8 A;  3ZPJ A;  2E0I A;  3HVE A;  3ZFW A;  4JEU A;  3FTZ A;  1D8E A;  3PE4 A;  3AS5 A;  1V54 E;  3FTW A;  2LSU A;  1LTX A;  2VJ8 A;  1EYH A;  4FU3 A;  3TWV A;  2GRN B;  5HS0 A;  2DYS E;  1WM5 A;  1WG0 A;  4OAU C;  1OWM A;  4BX8 A;  4M7C A;  1FT1 A;  3KD7 A;  1UG3 A;  3FUD A;  2R05 A;  4OAV B;  2VQ2 A;  4DK5 A;  1SZA A;  2X6J A;  2BED A;  5AN8 A;  4JW1 A;  2R59 A;  3UPV A;  2XPI A;  3B7S A;  3APC A;  5CCM A;  5LCW C;  3GW4 A;  4I2W A;  2CFZ A;  4AP2 A;  4GZD A;  4YDE A;  4KBQ A;  2L0I A;  1MZC A;  3ZRH A;  3OXF A;  3ZU7 B;  2V4H C;  4OVU A;  1QYM A;  4Z68 A;  1JWF A;  2EIJ E;  4BTB A;  3DSW A;  3W9F A;  4TRQ A;  1K3Z D;  3DPD A;  3MYV A;  3ASO E;  4I1A A;  4ILH B;  3RRN B;  3FH5 A;  4ANU A;  3ZW3 A;  3QAQ A;  3L13 A;  2DIW A;  3NOG D;  5CEA A;  2X6K A;  2QC9 A;  5T8I A;  5CRU A;  2NC9 A;  3L82 A;  2OCC E;  4Q96 A;  2XS1 A;  3RRU A;  4K5C A;  4CT0 A;  1FVF A;  5D0O D;  5FIN A;  2MRI A;  4G11 A;  4AIF A;  1RZ4 A;  1PC2 A;  1OCR E;  3UIN C;  4G23 A;  1FT2 A;  5ENR D;  3TXM A;  3UM2 A;  3FY4 A;  4PDX A;  2C0L A;  4BES A;  4A55 A;  2WXO A;  2I1K A;  5ENN A;  4K0R A;  4I43 A;  3L54 A;  4F53 A;  3E33 A;  3CR3 A;  3DEP A;  3L9T A;  3CKB A;  3CVW A;  4GTM A;  4GA1 A;  3TWU A;  5D66 A;  2XPY A;  3TWT A;  3LY7 A;  2QZA A;  4GTR A;  3RO2 A;  3Q75 A;  4YND A;  2PM7 A;  1VDY A;  4F6R D;  1S63 A;  2BUG A;  3R7Q A;  1JUQ A;  2QFC A;  4XIF A;  2XZT G;  5CHE E;  3PDN A;  1N11 A;  3B7U X;  4LNG A;  2L9B A;  4TUU A;  5JJ7 A;  3CK8 A;  3CVU A;  4HRN A;  4JXT A;  1TEZ A;  3FH8 A;  3ONK A;  5FZQ A;  3D9I A;  3EHN A;  3B7R L;  3Q47 B;  3SNX A;  3DXM G;  4B0Z A;  2LXM A;  4ANX A;  2P9P G;  2R5S A;  3AS8 A;  3DBS A;  4B8C B;  3B7B A;  3C3Q A;  4LRZ A;  3DST A;  2WPV A;  2IO3 C;  4PS7 A;  2H6G A;  3FTS A;  3Q5M A;  2EQX A;  2XHE A;  2KCV A;  3DSV A;  4G8K A;  1IQU A;  1HG2 A;  4DX7 D;  2XRY A;  3JYS A;  3OTN A;  4MBG A;  1S64 A;  1QQE A;  2HO1 A;  1OUV A;  4XKC A;  4FC8 A;  3ZYQ A;  3U9W A;  5EIL A;  4HS2 A;  5KNH D;  4AEZ C;  4DUI A;  3UKR G;  5T4Y A;  3B7T A;  1MQS A;  3G2W A;  3HXE A;  3NZS A;  2J4B A;  3KSL A;  4G2V A;  2ETB A;  4A1S A;  1E7U A;  1MJ0 A;  2ZGG A;  4U0S A;  4IUL A;  4BWR A;  2I1J A;  1HZ4 A;  2LAH A;  3ASH A;  3L16 A;  3APF A;  2H6I A;  3BU8 A;  4TXQ A;  3RRM B;  2F0Y A;  3LJ3 A;  3AG1 E;  4I17 A;  3T8K A;  1W3B A;  5CEC B;  4ZFH A;  4U95 D;  1N4R A;  2XPZ A;  1SA4 A;  4A63 B;  3BQO A;  1E7V A;  4JEH A;  4G25 A;  4FJY A;  2FO7 A;  2WB2 A;  2YIN A;  2IJG X;  3CHQ A;  4EZL A;  4LEU A;  3T9K A;  1HFA A;  3SY2 A;  5HI7 A;  4XEI G;  1ELW A;  5EX3 A;  2FF4 A;  1ZB1 A;  3EHQ A;  4WWN A;  1QBQ A;  2AVP A;  3SZ7 A;  4L2Y A;  3APD A;  4XX5 A;  4J0U A;  2XQ0 A;  3VLE A;  2ETC A;  4CGW A;  4L23 A;  5ARG A;  5FJY A;  3NB2 A;  3FU3 A;  1QNF A;  2P9I G;  4EHM A;  4GML A;  3IKO B;  2QY7 A;  5J90 A;  2R03 A;  1U3C A;  3D3M A;  5BPP A;  4CRW A;  1K8K G;  5EIB E;  4GCO A;  2CFU A;  5BV0 A;  3CV0 A;  1SQM A;  4BFR A;  3MA5 A;  4A1G A;  5HKP A;  1N94 A;  2OV8 A;  2AXV A;  4AY6 A;  4NRH B;  2RD0 A;  4AOF A;  3FUL A;  2WXG A;  3FUE A;  2I2O A;  3NZU A;  3EUV A;  1L5J A;  1XGW A;  1O1S A;  3UXG A;  1Q2Z A;  3MV3 B;  4FLH A;  5BNW A;  3QOU A;  3FP3 A;  3PZ3 A;  3U64 A;  3TG5 A;  5ENO D;  1KT1 A;  4BY6 A;  3PE3 A;  1X81 A;  4FJZ A;  1H6O A;  5JHA A;  1XNF A;  4ACL A;  3UT4 A;  3LY9 A;  1MX4 A;  3CQC B;  2X6H A;  2KCL A;  2XGM A;  3CHP A;  4GMJ A;  2C2L A;  5AEN A;  1H19 A;  2Y0B G;  5G04 J;  2ZIR A;  3HDX A;  5BV1 A;  1NL4 A;  1OCC E;  3TGO A;  3EHR A;  4I6G A;  3KS2 A;  2CHX A;  2E2E A;  3V30 A;  4C48 B;  1YCS B;  1O1R A;  3HRA A;  4BTA A;  4GMR A;  3QDN A;  4DX6 D;  5D0Q D;  1H2U A;  5KJM A;  4YDO A;  4W9R A;  5BXO A;  3L08 A;  4GZ5 A;  2X6I A;  3QKY A;  2DCP A;  2JEK A;  1TN6 A;  3QJZ A;  3SGH A;  4MKT A;  4FHJ A;  2WXM A;  4J8E A;  2XEV A;  3FDH A;  4PS8 A;  3PZ1 A;  3QK0 A;  4KYO B;  5FZR A;  2J8S D;  3SD5 A;  4YVQ C;  4LER A;  3MKR A;  3HXB A;  2XEE A;  5AAO A;  3DSX A;  4JL0 A;  1Y6I A;  2IU1 A;  5G05 C;  4CEM A;  2WQ6 A;  5D2M C;  5C1D A;  5FZS A;  3FEX A;  4GTP A;  3FTU A;  3Q15 A;  4P29 A;  2GRL A;  1RW2 A;  3SFZ A;  2UY1 B;  2KM4 A;  1IXV A;  4GYW A;  2C0M A;  3ZHE B;  4F3V A;  5AQB A;  4RG9 A;  4GU5 A;  3ABL E;  3D9K A;  1D8D A;  3DSU A;  4HLE A;  3P1U A;  1B89 A;  3CK9 A;  2BTD A;  4B89 A;  2IEJ A;  5LOZ A;  5CRV A;  4O1O A;  1DC2 A;  4AXH A;  3UT8 A;  2WQH A;  3T5V A;  4EZJ A;  3QC1 A;  1A17 A;  2VSO E;  3E34 A;  4U7E B;  2LSV A;  3QAR A;  1YMP A;  5FT9 A;  3I4R B;  4NAC A;  4NQ0 A;  4EBA G;  3Q79 A;  2Y1L E;  1N4S A;  4LNU D;  3Q9U C;  2IQC A;  3ML8 A;  4ME2 A;  3CVX A;  4N5Q A;  4LUN U;  2PZI A;  4BT8 A;  5G05 J;  3CKC A;  5ITZ F;  1DNP A;  2GRR B;  2WXQ A;  3UI2 A;  4J8F A;  1FVH A;  1AP7 A;  2V4L A;  1G3N B;  1UJK A;  1AWC B;  3I5P A;  2IO2 C;  2OVB A;  3ML9 A;  3PEU B;  2PQR A;  3CSF A;  2MHK A;  3BEE A;  1LD8 A;  4A3V A;  4ILG A;  2KAT A;  1OT8 A;  3O4Z A;  3ZUV B;  1TNZ A;  3ZYK A;  4EZK A;  3TWW A;  3ULQ A;  1OWL A;  4U04 A;  3JXJ A;  1TNO A;  2WXH A;  4DI4 A;  2VTB B;  3V79 K;  4CZ2 D;  3KEA A;  1N9A A;  2MYO A;  4N3A A;  4TXP A;  4AY5 A;  3GYZ A;  3MZL B;  3KSQ A;  2FI7 A;  4QFV A;  2VYI A;  4LSZ E;  4HFG A;  1N0R A;  4UI9 J;  4UWL A;  4Q69 A;  2PQN A;  4BX9 A;  1TNU A;  2DZN A;  4HNA D;  4GTV A;  2FBN A;  2RFM A;  4HOT A;  4BER A;  2F37 A;  3ZEF A;  5BW8 C;  2VTB A;  3ESK A;  4I9E A;  1DCQ A;  5AIJ A;  3D9J A;  3AJI A;  3JUE A;  3PNT B;  1YYH A;  2ZU6 B;  3ASF A;  1H0A A;  1TN8 A;  4DLQ A;  2I6H A;  4YDW A;  4UWG A;  3MKQ A;  1NA3 A;  3CVQ A;  2P9L G;  4WNF A;  3Q73 A;  4U07 A;  1NFI E;  4I2Z A;  1OXJ A;  2J9Q A;  4Y6C A;  2WXR A;  2OEW A;  4F1P A;  3T5X A;  4GTS A;  4APF A;  3S2A A;  1SVX A;  2DZO A;  2GRM A;  3L22 A;  1N52 A;  5CER B;  4GTO A;  3CHS A;  5IY5 E;  4R7L A;  4XI0 A;  3S7D A;  3JQ0 A;  3NAW A;  4ZHB A;  2VSN A;  3CEQ A;  3EU5 A;  4JA7 A;  3DSS A;  5JJT A;  4FUL A;  2Y69 E;  5BT1 A;  5BUZ A;  3V31 A;  3EDT B;  3W9G A;  3K9I A;  4N3B A;  1LD7 A;  2PL2 A;  2UWJ G;  3TWS A;  4BET A;  3NF1 A;  2AXU A;  1INZ A;  2V5F A;  5LCW J;  4BT9 A;  3UQ3 A;  2P9N G;  3S7B A;  5KJL A;  4BEP A;  3FTV A;  1IYG A;  4PUC A;  3SI5 A;  2DYR E;  2GRO B;  3GZ2 A;  1N54 A;  3WXX A;  3E30 A;  4KVO A;  2V8S E;  3PZ4 A;  3CVY A;  4C9B B;  3VTX A;  4AJW A;  5KCM A;  5DBK A;  1KZP A;  2ZGD A;  3UKU G;  4GB9 A;  3VLF A;  1UN8 A;  2AJA A;  3AU4 A;  5FQ7 A;  2IFU A;  1P5Q A;  1O5M A;  4NIK A;  3B13 A;  4DRX E;  2L6J A;  4KZ0 A;  3Q4A B;  1TNY A;  1N0Q A;  3C3O A;  4L2L A;  3NOC D;  4PH4 B;  3ZYL A;  1K1B A;  4UI9 C;  2Y3A A;  2DVW A;  1KT0 A;  4UQX A;  4B8A A;  5B1A E;  4N2S A;  4EEC A;  4IN3 B;  3KAE A;  4OYS A;  4M3O A;  5H7P A;  3LKU A;  4ATZ D;  2WXI A;  3FUF A;  4JVS A;  2P9K G;  1BD8 A;  4FA6 A;  4HOR A;  3ABM E;  4DX5 D;  1BI7 B;  3OXL A;  2XCB A;  3UTM A;  4UQZ A;  3TG4 A;  3AG4 E;  4CDR A;  1WY6 A;  2LAI A;  5G55 A;  2NSZ A;  5AJD A;  2PM6 A;  4GZ6 A;  1TNB A;  3L6A A;  4JZY A;  3C3R A;  3X2Q E;  3HYM B;  3AG3 E;  4HRL A;  3FU0 A;  3ASD A;  4LNB A;  4O1P A;  1MYO A;  3PVL A;  3FUJ A;  4F1S A;  1HX8 A;  3C5R A;  2GRQ B;  3EHM A;  4UWF A;  5JHB A;  4UWH A;  2LO6 A;  2YHC A;  3CGH A;  4TUM A;  5EX0 A;  3D9L A;  1IHG A;  3FUN A;  3G2V A;  4N39 A;  3D9M A;  1MX6 A;  4XE0 A;  3UX4 A;  1TJC A;  3SBT B;  2XZD G;  2CG2 A;  5ANR A;  4GTQ A;  1OWO A;  5KJK A;  3EIJ A;  3JUI A;  1D9S A;  2CHW A;  4HQD A;  4E85 A;  4PS3 A;  1E90 A;  2XEN A;  2KZT B;  3ASG A;  1DCE A;  1KZO A;  3Q78 A;  3LVR E;  3PH0 C;  5AJL A;  3G2T A;  4MRU A;  2LNI A;  3E32 A;  2FUL A;  2VSY A;  3G2S A;  5FQ4 A;  2NYJ A;  4APO A;  4JHK A;  3WG7 E;  5AQ7 A;  1IKN D;  1QZ2 A;  3ZGQ A;  1U2V G;  3PS6 A;  3PRE A;  5C2Y A;  2PNN A;  3FUK A;  4K5A B;  3D9P A;  5A7D B;  2RKK A;  3UMV A;  5B1B E;  3CQG B;  2EIN E;  1FCH A;  4YDY A;  3RU0 A;  4V3I A;  3V2O A;  3QWV A;  4WWP A;  2V0P A;  3DWL G;  4XZ4 A;  4J8S A;  5EKQ D;  1UN9 A;  3EIQ C;  5EID A;  1TN7 A;  1BU9 A;  2KC7 A;  2XEH A;  4UQY A;  4Y6W A;  1E8W A;  5CMW A;  3VTY A;  4DX1 A;  5HRY A;  4U8V D;  3LCA A;  1U3D A;  2GW1 A;  4FAD A;  5LP0 A;  1UJJ A;  4KVM A;  4I6J A;  1E8Y A;  5FTP A;  3SQV A;  2KCK A;  4JC8 A;  2XRZ A;  2KXP C;  1HS6 A;  2J4D A;  2Y4T A;  2YHE A;  1TR4 A;  3EU9 A;  4HRM B;  2ION A;  2ZXW E;  4G1T A;  1JCS A;  3TJP A;  3HXC A;  5AYW D;  1S70 B;  4DLO A;  3MX3 A;  4AM9 A;  1Z3Y A;  3QB2 A;  1O1T A;  2BF0 X;  2OND A;  4C0M A;  3IBE A;  3FTX A;  3SFY A;  3IHV A;  4I9C A;  1H6P A;  4QQI A;  4G24 A;  2P9S G;  3S7J A;  3DRA A;  2XGO A;  3SBS A;  4K03 A;  2XCC A;  4U8Y D;  1GW6 A;  2VGX A;  5CED B;  3FHE A;  2WXN A;  3SFX A;  2A4Z A;  1NZN A;  1SZ9 A;  2P58 C;  3HIZ A;  2IF4 A;  3MJW A;  4J8D A;  3FUI A;  4XKB A;  4EBA A;  1ELR A;  1N4P A;  5HQ8 A;  4AV7 A;  3TWR A;  3MKQ B;  2EIL E;  2V5Q C;  1OCZ E;  2VGY A;  2J08 A;  3LPZ A;  3OXG A;  4RVB A;  3HHM A;  2DWZ A;  3LEW A;  3Q7F A;  4GYY A;  1MX2 A;  4L7T A;  4JA9 A;  3EJN A;  4TXR A;  3R7R A;  1ZBP A;  4O60 A;  5CCL A;  3UIO C;  2BKG A;  3TL5 A;  4F7A A;  4CYM D;  3CVP A;  4WNG A;  1HXI A;  4U0Z A;  4YVO A;  4CGV A;  1E8Z A;  4U96 D;  3JQ1 A;  5KWD A;  1E96 B;  1NA0 A;  4ACK A;  4ABN A;  4WWO A;  2FEZ A;  3D9H A;  1ELK A;  4KMO A;  5E75 A;  2H6H A;  3UIP C;  3FH7 A;  2LXL A;  3UM3 A;  3IXE A;  3ONL A;  4RG6 A;  3HXD A;  5ENQ D;  3ZKJ A;  3UM1 A;  2J09 A;  4ANV A;  2UY1 A;  3TAX A;  4HXI A;  3CVN A;  3D9N A;  1Z5S C;  3HG0 D;  1TYQ G;  1PY1 A;  5EDS A;  4BSX A;  4RSY A;  3GZS A;  2F8Y A;  1JWG A;  3VLD A;  1K1A A;  4CCA A;  4L9P A;  3MEK A;  3MV2 B;  3G2U A;  5ANL A;  1N95 A;  3ULE G;  4DPR A;  3DXK G;  3SF4 A;  3J5P A;  2YQ8 A;  4I1O B;  3CHO A;  1PAQ A;  2L6B A;  4HB5 A;  2KZT A;  3C72 A;  2ZIS A;  5B3S E;  4HOU A;  2HE0 A;  3MCX A;  3ZYM A;  3B95 A;  1WAO 1;  2AW6 A;  4HOQ A;  5LX8 A;  5CMY A;  3KEZ A;  4LCT A;  4HBD A;  1JCQ A;  3BG1 B;  4XI9 A;  4IRU A;  2HM8 A;  2WMN A;  4X8Q A;  4E6H A;  2EIM E;  3CLJ A;  3TWX A;  5FWQ A;  4IYP A;  3ZHE A;  1YA0 A;  4FLB A;  3HVE B;  3R9M A;  2HYZ A;  1IQR A;  4GTT A;  5FQ8 A;  3MGB A;  3OAW A;  3ENE A;  4JB8 P;  1Y8M A;  3PEV B;  4J6I A;  3I4G A;  3SO8 A;  2OOE A;  2HR2 A;  3T8M A;  1HE8 A;  5CBN A;  5M72 A;  4GA2 A;  4URK A;  1TJF A;  2P9U G;  1S0P A;  1H2T C;  1UW4 B;  4CT4 A;  1HH8 A;  4WAF A;  3AS4 A;  5JJ6 A;  4MS6 A;  5ENP D;  3NQP A;  2OVF A;  3IHY A;  4GA0 A;  2WM9 A;  3LYA A;  5LFA A;  3QNK A;  3U4T A;  4G26 A;  3FFL A;  1HF8 A;  2QYJ A;  1ZU2 A;  2J49 A;  5JA4 D;  2IOL A;  3D9O A;  3Q7A A;  1SA5 A;  2R17 C;  3L17 A;  1KPS B;  3LXU X;  3O48 A;  5G2N A;  5ENT D;  4N2Q A;  4CDN A;  2NXP A;  1A5E A;  2X3M A;  2GRP B;  3QWP A;  4C0E A;  4U0U A;  1FPP A;  4Q94 A;  5G04 C;  1NI1 A;  2IOS A;  2Q7F A;  2WXK A;  1OWP A;  1MHQ A;  5AAR A;  1H6K A;  4HLL A;  2H6F A;  4GCN A;  5EN5 D;  4HI9 A;  1KLX A;  2KBX A;  3N71 A;  2Y4U A;  5ARF A;  3LDZ A;  2J07 A;  3LY8 A;  3ISM C;  2XS8 A;  4GPM A;  3IEG A;  4FP7 A;  2GGF A;  2WXF A;  3RO3 A;  2IY0 C;  1HU3 A;  2FO1 E;  5BXU A;  4HOS A;  3Q49 B;  3JCK C;  4JD2 G;  4UI9 K;  3R9A B;  5CBO A;  3BG0 B;  3E37 A;  5FQ6 A;  2CG3 A;  4I6E A;  4UWK A;  3RAU A;  2JAB A;  4H7Y A;  3P2B A;  1JPL A;  5A6C A;  5A23 A;  2OEV A;  3AU5 A;  3LJN A;  2AXZ A;  3LVQ E;  3RIB A;  2XGS A;  3TWQ A;  3V2X A;  4HVB A;  3DPY A;  1Z6T A;  3PRZ A;  5KBA A;  4GPK A;  3NBN B;  4HI8 A;  5AQ9 A;  4WNE A;  2A5U A;  3ASN E;  4G8L A;  3ZNG A;  2ILR A;  2MOW A;  2RFA A;  3CST A;  3CVL A;  4GAA A;  3HXF A;  3RKV A;  1HG5 A;  3ABK E;  3SHF A;  3FTY A;  3URZ A;  3U66 A;  3DEO A;  3C98 A;  3ZXP A;  2ETA A;  4AVX A;  4J8Y A;  2A5E A;  3J5Q B;  1EDU A;  3RSE G;  4NUR A;  4DI3 A;  3ZVV A;  4ANW A;  4U63 A;  3E4B A;  4GZC A;  1OCO E;  5EYP F;  2BKK B;  4JHJ A;  2WMO A;  3ZIM A;  4JPS A;  3Q9N C;  4B93 B;  1DVP A;  2X38 A;  2P2C P;  2VGE A;  1UOH A;  3LS8 A;  5KNG A;  4GZ3 A;  2X6F A;  2AWI A;  4KXK B;  1H2V C;  3U3W A;  2B6C A;  4LG6 A;  1OWN A;  4DJA A;  2RG8 A;  5FIO A;  4RLY A;  5T3R A;  4WND A;  4A3T A;  2JLB A;  3BUA A;  3TXN A;  5AQA A;  5DIZ A;  1X5B A;  3PZ2 A;  3FWV A;  2VGX B;  5KJN A;  3PZD A;  3UUX A;  1EPU A;  4MLP A;  1SW6 A;  5J08 A;  2LUH A;  5EYL A;  3FUM A;  1EF1 C;  1Z3X A;  4KT6 B;  4U8H A;  3RK6 A;  1JCR A; 
#chains in the Genus database with same CATH homology
 5HS0 A;  4ZHB A;  2ETC A;  1WG0 A;  4K5C A;  1IXV A;  4OAU C;  3B95 A;  4G8L A;  1BI8 B;  5FIN A;  1S70 B;  3ZNG A;  3F6Q A;  4HBD A;  1BLX B;  3V79 K;  2Y0B G;  4G8K A;  4CZ2 D;  3KEA A;  5AQB A;  2RFA A;  4U96 D;  4DX7 D;  3V31 A;  5KWD A;  2MYO A;  3EHR A;  4OAV B;  3W9G A;  4ATZ D;  4QFV A;  5EIB E;  2NYJ A;  3JXI A;  5ENR D;  3V30 A;  5AN8 A;  5AAR A;  4LSZ E;  3TWX A;  1N0R A;  3D9H A;  1BD8 A;  4HLL A;  4QQI A;  3TWS A;  5JMN D;  4C48 B;  4BET A;  4BES A;  3DEO A;  1YCS B;  5AQ7 A;  1IKN D;  4DX5 D;  1BI7 B;  5EIL A;  3HRA A;  5EN5 D;  4GMR A;  3AAA C;  3UTM A;  4HI9 A;  2DZN A;  2ETA A;  5KNH D;  4DUI A;  4J8Y A;  4U8Y D;  4HNA D;  2KBX A;  5HKP A;  2A5E A;  3J5Q B;  5CED B;  2PNN A;  4DX2 A;  3IXE A;  3DEP A;  2RFM A;  4O1O A;  4K5A B;  4DX6 D;  4BEP A;  1DC2 A;  4BER A;  2F37 A;  4GPM A;  5ENQ D;  1WDY A;  2ETB A;  3TWU A;  3ZKJ A;  5D66 A;  3TWT A;  5BXO A;  1MJ0 A;  4JB8 P;  2ZGG A;  5ENS D;  2FO1 E;  5BXU A;  1DCQ A;  1YMP A;  5EYP F;  2BKK B;  4F6R D;  3ZU7 B;  3AJI A;  3SO8 A;  4HRL A;  3JUE A;  2V4H C;  4YDY A;  1YYH A;  2Y1L E;  3Q9N C;  5CBO A;  3HG0 D;  4LNU D;  3Q9U C;  4K5B A;  4B93 B;  1OY3 D;  2P2C P;  2XZT G;  3V2O A;  1QYM A;  4O1P A;  1MYO A;  1N11 A;  4Z68 A;  2VGE A;  5CBN A;  4N5Q A;  1UOH A;  3UXG A;  4YDW A;  3C5R A;  5KNG A;  2JAB A;  2F8Y A;  3T8K A;  4UUC A;  5EID A;  2J8S D;  5CEC B;  4ZFH A;  5ITZ F;  2ZGD A;  4LG6 A;  1BU9 A;  1K1A A;  3W9F A;  1NFI E;  2B0O E;  2XEH A;  4TUM A;  1K3Z D;  4U95 D;  5ENO D;  5FIO A;  4J7W A;  2AJA A;  3UI2 A;  4A63 B;  4RLY A;  3TWR A;  5ENP D;  2XEE A;  1IHB A;  4HRN A;  4BSZ B;  1AP7 A;  3LJN A;  4NIK A;  4F1P A;  4DX1 A;  5AAO A;  5HRY A;  1G3N B;  1MX6 A;  2F8X K;  5AQA A;  2V5Q C;  4U8V D;  2XZD G;  3T9K A;  1AWC B;  4DRX E;  2QYJ A;  3J5P A;  5JA4 D;  1SVX A;  1D9S A;  2DWZ A;  2DZO A;  3TWQ A;  5AQ9 A;  1N0Q A;  1OT8 A;  1SW6 A;  3V2X A;  1MX4 A;  1MX2 A;  3EHQ A;  2L6B A;  3NOG D;  4HB5 A;  4HQD A;  3ZUV B;  5CEA A;  2KXP C;  5CER B;  5EYL A;  3NOC D;  2QC9 A;  3B7B A;  3TWW A;  5KBA A;  1K1B A;  4O60 A;  5ENT D;  2BKG A;  3NBN B;  1TR4 A;  1A5E A;  3EU9 A;  4HI8 A;  3JXJ A;  2HE0 A;  2XEN A;  2DVW A;  4HRM B;  3TWV A;  4CYM D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...