5CEAA

Bd3460 immunity protein from bdellovibrio bacteriovorus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
193
structure length
193
Chain Sequence
SGKSSKALNEAAEQGDLAKVKNLVQKNKIDLNAQDETGMTPLMNAAMGGNLDIVKFLLSKKVNLELKNNGGETALAFAVTNDAYDVAEELIKAGANVDIIVAGDEGDTLFMRAAQNNKKTAESILAKNKSLINKANTLGETALFAVARYGTPADIDFLIKKGADLKLKNKKGQTALDVAKEASNQDTAKALSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bd3460
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus (strain atcc 15356 / dsm 50701 / ncib 9529 / hd100)
molecule tags Protein binding
total genus 67
structure length 193
sequence length 193
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5ceaA00
2KXPC 4F6RD 5KNHD 4ZFHA 4J8YA 5EIDA 4DX2A 1MJ0A 4C48B 4DX5D 3UI2A 4HBDA 5EILA 2BKKB 2DZOA 3DEOA 2B0OE 2XENA 4GPMA 5ENPD 2ETCA 5AN8A 5KNGA 3TWVA 4HRLA 5ENQD 5ENTD 2A5EA 5ENRD 2XZDG 4HLLA 2DZNA 4DRXE 4DUIA 4DX1A 4BETA 5AQAA 1MX2A 4HI9A 1BI7B 3V31A 2ZGDA 2ZGGA 3JUEA 5CECB 1K1AA 1K3ZD 4U96D 1IKND 1AWCB 4OAVB 5FIOA 3HG0D 4K5BA 1YYHA 4QQIA 5AQ9A 4G8KA 1MX6A 3EHQA 5HRYA 3T8KA 5BXUA 1N11A 5KWDA 3NBNB 5BXOA 1DC2A 3W9FA 3EHRA 4O1OA 3HRAA 2KBXA 4BSZB 5CBOA 2J8SD 1MYOA 5CEDB 5EYPF 3AJIA 1BD8A 1K1BA 1WDYA 4J7WA 4YDWA 5HKPA 3ZNGA 4CYMD 5EN5D 3W9GA 3TWUA 4ZHBA 5JA4D 3UXGA 5FINA 5AAOA 4GMRA 2QC9A 3F6QA 3Q9NC 3SO8A 1NFIE 4UUCA 2RFMA 3V2XA 4JB8P 4A63B 1WG0A 2Y1LE 2XEEA 3ZKJA 4OAUC 2RFAA 1UOHA 3V30A 3LJNA 4HRNA 1OY3D 2ETBA 1N0QA 3JXIA 5CERB 1SW6A 3Q9UC 3AAAC 4K5AB 4LNUD 1S70B 2F8XK 1SVXA 4K5CA 3J5PA 3J5QB 4U8VD 4G8LA 3TWWA 2L6BA 4BESA 4BERA 2JABA 1QYMA 2DWZA 5CBNA 3TWXA 3D9HA 1AP7A 4TUMA 4O60A 5AQ7A 2BKGA 2F37A 3TWSA 4LG6A 1BI8B 3TWQA 1BU9A 3V2OA 3C5RA 5KBAA 4F1PA 5ENSD 3TWTA 3TWRA 2AJAA 3JXJA 3EU9A 1TR4A 2V4HC 4HNAD 5AARA 1IHBA 1IXVA 3NOCD 5AQBA 2DVWA 3KEAA 3DEPA 4Z68A 4N5QA 3ZUVB 3ZU7B 5ITZF 3IXEA 3NOGD 4O1PA 1N0RA 5D66A 4ATZD 1OT8A 2MYOA 2VGEA 4YDYA 5CEAA 3B95A 5JMND 4U95D 1MX4A 1YMPA 4DX6D 1A5EA 5EIBE 2XEHA 1YCSB 2Y0BG 3UTMA 4HRMB 1D9SA 2XZTG 3B7BA 5EYLA 4DX7D 4U8YD 3V79K 3T9KA 4BEPA 4HI8A 4NIKA 2HE0A 2F8YA 2V5QC 2NYJA 4B93B 2PNNA 4QFVA 5HS0A 1BLXB 4HQDA 2ETAA 2P2CP 2FO1E 4HB5A 4CZ2D 1DCQA 5ENOD 1G3NB 4RLYA 4LSZE 2QYJA
chains in the Genus database with same CATH superfamily
2KXPC 3ULYA 1KPSB 3ZPJA 4UWLA 1NZNA 3CSFA 3D9MA 4FU3A 5ENPD 3SGHA 2JEKA 2ILRA 2CHZA 2I1KA 1JCQA 2E0IA 4W9RA 3PZ1A 3PNTB 1RW2A 4OVVA 2B6CA 1YYHA 4GYWA 4Q96A 2FO7A 4G8KA 4UWKA 5KWDA 2IQCA 3IHYA 5KJKA 1MYOA 2P9KG 2Y4UA 2P9SG 4JEUA 3S7BA 1ZU2A 3QJZA 1SW6A 4JHKA 3AAAC 1SVXA 3J5QB 2L6BA 3VTYA 3KSQA 2ZU6B 4F1PA 3FTZA 1UN9A 3EUVA 2I2OA 4AVXA 3URZA 3APCA 3NOGD 4U7EB 5D66A 3ZFWA 1OT8A 1KLXA 4XIFA 2QFCA 4YDYA 4CDMA 4A3TA 4NURA 1A5EA 3LY9A 4TXPA 2J9QA 1E8XA 3AS5A 4HRMB 1V54E 2H6GA 3IV0A 2GW1A 5E76A 3HYMB 3FHEA 4QFVA 4GZ5A 3BQOA 4J6IA 4ZFHA 3OTNA 3L22A 3DEOA 4AV7A 2J4BA 4V3IA 2LAIA 4JHRA 5KJMA 4BETA 3SFXA 1O5MA 2WXKA 1UJKA 4I2ZA 4K5BA 3T8KA 4I6GA 1N11A 3GZ1A 4JL0A 4FLBA 4GZ3A 2V8SE 3FUFA 4BX8A 4IRUA 4JA9A 1WDYA 3UXGA 3DSTA 3R7QA 4F1SA 3ZN3A 3FU6A 2XEEA 4P29A 3KAEA 3FTVA 4AY6A 3TWWA 4I6EA 5H7PA 3TWXA 4TUMA 4RG6A 2BKGA 4U0SA 3SHFA 2VGXA 3PUJA 2EIME 3EIJA 1OCRE 1TN7A 2X38A 3EU9A 1MHQA 4GYYA 5AQBA 2DVWA 1U3DA 5LOZA 2CFZA 4Z68A 4N5QA 5DBKA 4O1PA 3ESKA 4GB9A 5D0OD 1YMPA 3FH8A 4ILIA 4JZYA 4UWGA 4BEPA 2HM8A 4HI8A 3S7FA 3SI5A 3ZXSA 3BU8A 2P2CP 1FVFA 2F0YA 3CQGB 4RLYA 3ESLA 3APFA 4DX5D 4KYOB 4UI9C 5AN8A 3Q15A 4PS7A 4WUYA 3NB2A 2C2LA 4DUIA 3SFYA 1INZA 1O1SA 2ZGDA 1KZPA 2J07A 4BT8A 5CECB 3ZHEA 2NSZA 4UI9K 5BXUA 5CMYA 1TNBA 5G04C 3OXFA 3QNKA 2XRYA 4GTPA 4L1BA 2OEVA 1OWLA 4CYMD 3JCKC 1TNZA 3FEYA 4EBAG 2QC9A 1NFIE 3UM2A 3DWLG 3CVWA 3MGBA 3AG2E 1SZ9A 4ANUA 2AVPA 3PZDA 4U8VD 4G8LA 4TRQA 2XPZA 2YHEA 1GW6A 4KVOA 4EECA 2F37A 3V2OA 3I5PA 2FEZA 3QK0A 4BTAA 4DI4A 3ZYLA 2CG2A 4TXQA 5J90A 2P58C 5AJDA 3AG3E 3FP3A 3C3OA 4FA6A 4C9BB 5G05C 2R17C 2WVIA 2IONA 3FTSA 2H6IA 4DX2A 2XS8A 5AIJA 4A1SA 2AW6A 4I9CA 4EZJA 3HXEA 1V55E 2J49A 3Q73A 2ZGGA 3PRZA 3ULEG 3CIAA 3E32A 3ASOE 1AWCB 4KZCA 1S63A 3NQPA 1FT2A 5EKQD 5FQ7A 3UMVA 4BSZB 1HE8A 1K1BA 2VSOE 2Q7FA 3FU0A 4GMRA 3EHMA 4JB8P 5AJLA 5LCWC 4G25A 1XNFA 2I9CA 2JABA 2DWZA 5CBNA 2HR2A 1BI8B 3FUIA 4H7XA 1ELKA 1UW4B 1IXVA 1N52A 3O4ZA 4EBAA 3B95A 2GRQB 3B7TA 3CKBA 2WXRA 3UTMA 3BUAA 1E8WA 2HE0A 4GTRA 2F8YA 3G2SA 2CHWA 3T8MA 3C3RA 3DBSA 3CSTA 3N71A 4UQYA 2Y69E 4ANVA 4C48B 1IQUA 4IULA 2DZOA 3IBEA 3UKUG 2Y3AA 4RQIA 3U64A 3NF1A 2A5EA 2VQ2A 4N3BA 5J08A 3LDZA 3CVPA 2I1JA 3GYZA 3UM0A 3MEKA 1IKND 1SZAA 4UQZA 3L08A 5AENA 3T5XA 3W9FA 5BPPA 2GRPB 1L5JA 1TNUA 5EYPF 3L16A 3WXXA 1BD8A 1S0PA 4YDWA 4N2QA 2V4LA 5AYWD 3PEUB 1TEZA 4JA7A 1UG3A 1UN8A 3UKRG 2C0MA 3JUIA 3UM3A 3GW4A 1NL4A 3TWSA 1O1RA 4I2WA 4BFRA 3CLJA 4XI0A 2KCLA 2XQ0A 4TV3A 3AG4E 3ZRHA 3CHPA 3D9LA 4WNEA 3ASFA 5G2NA 2KZTB 1TJFA 4GYOA 3ZUVB 3OXGA 2WQHA 2VGEA 5ARFA 4GTQA 5EIBE 5EDSA 1OCCE 4GA1A 4HOTA 4XEIG 4B93B 1FT1A 4L7TA 2C0LA 2EINE 4LSZE 3RO2A 3D9KA 4L9PA 3FEXA 2GRLA 3Q5MA 4EPZA 5B3SE 2VTBB 1SA5A 3Q79A 1HX8A 5D0QD 4O6FA 4I6JA 5FQ4A 4HOQA 1H6PA 2WXMA 4N3AA 4GTTA 2FI7A 3ASHA 2OCCE 5HRYA 4GU5A 3CK9A 4WAFA 4J8FA 1KZOA 5CEDB 3G2TA 3LEWA 4KT6B 3QKYA 5AAOA 4JPSA 3F6QA 1TNYA 2WPVA 1WAO1 5KCMA 2L6JA 4RG9A 3CK7A 2DCPA 2XHEA 4U63A 4GCNA 5HQ8A 2WXOA 5FZQA 3HDXA 3PZ3A 4JHJA 5E75A 3CHMA 3EJNA 3TWQA 3ZEFA 2WXNA 2V4HC 3KEAA 2P9UG 3ZU7B 4EZKA 1E7UA 4NQ0A 4Y6CA 2RG8A 3LKUA 3DSUA 3V79K 2IOSA 3ZIMA 1NI1A 1Z5SC 2WQ6A 3CVLA 2WQ7A 2XCCA 3C72A 3L13A 3AU4A 1DCQA 3CHQA 2L0IA 2X6FA 2FBNA 4J8YA 3WG7E 5EIDA 2PL2A 2XENA 1N54A 3OXLA 4D10C 3CVQA 3MZLB 3RJVA 1XGWA 1SQMA 2EIJE 4GA0A 1EDUA 5BNWA 4KZ0A 5B1AE 3Q47B 4ATGA 5FZSA 4I17A 2VSNA 3MV2B 4XE0A 3EHRA 2J8SD 5T4YA 4L2YA 1PC2A 5C1DA 3DXKG 3JQ1A 3W9GA 4ZHBA 5FINA 3G2VA 1N9AA 3TGOA 4U07A 4N3CA 4ILGA 3LCAA 4JVSA 1UOHA 2L0TB 1TJCA 4M7CA 1TN6A 2XGOA 4CDNA 4L2LA 4BERA 4U8HA 3SY2A 4FJYA 2FF4A 2QY7A 3KSLA 3U4TA 5JHBA 5ENSD 3DSSA 2DBAA 2IF4A 4WNDA 1HH8A 5IY5E 5HI7A 3CV0A 1HU3A 3EIQC 3UT7A 1H2TC 4CCAA 4MS6A 3B7BA 3FULA 2MHKA 3T5VA 2P9NG 2LUHA 3AG1E 1K8KG 5HS0A 4CZ2D 5ENOD 1ZBPA 2UWJG 5EX0A 5BT1A 3JYSA 1S64A 1E8ZA 5FT9A 2BEDA 5CRVA 3ONKA 3RRMB 1A17A 1X5BA 1Q2ZA 1MX2A 1BI7B 3CQCB 4U96D 1HF8A 3FY4A 4AXHA 4NRHB 4FULA 4B8AA 3QARA 1DC2A 1NA3A 3QWPA 2GRMA 4AEZC 4ACLA 4DPRA 3CR3A 3QB2A 4I43A 1DNPA 3ENEA 2AXVA 2RFMA 4BTBA 2CHXA 2FULA 2Y1LE 4OAUC 3P1UA 2NXPA 3FTUA 1EF1C 1N0QA 3JXIA 2WXQA 2H6HA 4WWPA 3MX3A 1QYMA 1MZCA 1AP7A 2PQRA 4G26A 3C5RA 3D9JA 1TR4A 3FUEA 3ML8A 5KJNA 2VJ8A 3CVNA 4RSYA 4EZLA 1D8EA 2P9PG 4U04A 4ATZD 4URKA 4DX7D 4U8YD 3T9KA 3NZSA 4R7LA 3RRUA 3RAUA 2ETAA 5T3RA 2FO1E 1EYHA 2XPYA 1MJ0A 3JQ0A 4OYSA 2JLBA 4AP2A 4HRLA 2GROB 3PE3A 4KMOA 4DX1A 2XRZA 4J8DA 3V31A 2LO6A 3Q7AA 2IO3C 5FIOA 2KZTA 3TXNA 3SBTB 2KBXA 4GTSA 5EN5D 3QOUA 4B8CB 1HS6A 4G1TA 4X8QA 3TXMA 3SO8A 2IEJA 3E4BA 3DPDA 1E90A 1S70B 3PREA 3D9HA 3DPYA 4LG6A 1X81A 3UIOC 2YHCA 4YNDA 1QNFA 2PZIA 3TWTA 2VTBA 1HFAA 1ELWA 4I9EA 3D9OA 5LP0A 3RIBA 5ITZF 2E2EA 4UWHA 5CCLA 2BF0X 3PEVB 1MX4A 3LPZA 2Y0BG 1H2VC 3ISMC 4PS8A 1H2UA 3FFLA 2WB2A 3FUHA 1BLXB 2L9BA 1JWGA 2I6HA 4NACA 2XEVA 3NAWA 3RKVA 4FJZA 3KS2A 5CRUA 4AOFA 1LTXA 3R9AB 2ETCA 2LXMA 5G55A 3ASGA 4LERA 5ENRD 3UQ3A 4HLLA 4JEHA 2H6FA 3U66A 3RSEG 1QZ2A 1Y6IA 1Y8MA 2WM9A 3MA5A 2WXPA 1K1AA 5T8IA 1K3ZD 3PNLB 3S2AA 4QQIA 3EHQA 1Z6TA 5ANRA 2XS1A 3FU5A 4UI9J 5CBOA 2ONDA 2J4DA 1TNOA 3UINC 1N4SA 3DSXA 2P9LG 3KD7A 1TYQG 2YNQA 4HVBA 4A63B 2PM6A 5FQ6A 2RFAA 3VTXA 1QBQA 4J0UA 2ZXWE 5CERB 1H0AA 3J5PA 1OWMA 4BESA 2EQXA 4U0UA 1WY6A 3RO3A 3S7DA 2IOLA 4TXRA 2IU1A 3JXJA 1JPLA 3LVRE 3QWVA 2PQNA 1D8DA 5C2YA 2MYOA 2KM4A 5EX3A 5EYLA 3L54A 2V5QC 2OVFA 1IYGA 2DYSE 4FC8A 3L17A 3EDTB 4GZCA 2WXHA 3SF4A 1G3NB 3CGHA 3E37A 3ASNE 1UJJA 4EQFA 4H7YA 1FCHA 1QQEA 3I3NA 4Y6WA 3FTXA 4ME2A 3SQVA 1HG2A 5FZRA 5G05J 4HI9A 4FLHA 3TG5A 4GA2A 4IN3B 4ACKA 3L82A 5CMWA 2GGFA 2M63A 4OAVB 5A23A 1OXJA 1ELRA 3CEQA 3HXCA 4G24A 3FUDA 5BXOA 2QYUA 2LAHA 4G11A 3ZYQA 4AY5A 5M72A 4I1MA 5ANLA 4UUCA 3IHVA 2V5FA 3AS4A 5FTPA 3LJNA 3P2BA 2A4ZA 4HLEA 5FQ8A 4WNFA 5FJYA 5AQ7A 3PZ4A 1OCZE 2YINA 2WXIA 2ZISA 1W3BA 2XPIA 3D9PA 4PH4B 2UY1B 3DEPA 5LCWJ 4TUUA 1OCOE 4DJAA 4JXTA 4CT4A 3BEEA 2ZIRA 1YCSB 2OOEA 4BX9A 4YDEA 2A5UA 3G2UA 1IHGA 2MRIA 3LJ3A 4AM9A 1ZB1A 4LNGA 3PUKA 3G2WA 4EHMA 3HVEB 1JUQA 4FHJA 1OWOA 3RU0A 2QYJA 3ZVVA 5KNHD 1Z3XA 2KATA 4DLQA 2J08A 2R2LA 3I4GA 4HBDA 1HXIA 4GPMA 4GTMA 4KXKB 4APFA 2XZDG 4I1OB 3QAQA 3UM1A 2BTDA 2OV8A 2WXFA 2LXLA 1P5QA 4ILHB 3HG0D 4APOA 4KVMA 5AQ9A 5B1BE 3HXFA 3QC1A 3HIZA 3MYVA 4J8EA 3E33A 1B89A 3UPVA 2IY0C 3LVQE 3IKOB 4Q94A 3ZNGA 2NC9A 5JA4D 3E34A 3CVXA 3AU5A 4GTVA 3CVVA 3V30A 4JW1A 4GZDA 4MBGA 2KC7A 4C0MA 3ULQA 3MJWA 4O60A 2Y4TA 1KT1A 1E7VA 1KT0A 5AARA 4E85A 3B13A 3SFZA 4B89A 2GRNB 4FP7A 5DIZA 3FDHA 2VSXE 4K03A 4U95D 2WMOA 2XEHA 3L6AA 3CHRA 4RVBA 3Q7FA 1H19A 2X6KA 2KCKA 4DK5A 3APDA 4HQDA 4ANXA 4WNGA 4XZ4A 4LUNU 4HORA 1U2VG 5KNGA 1RZ4A 3QDNA 4G2VA 5ENQD 1WM5A 4LNBA 1LF8A 3DSWA 3ML9A 3UT4A 3JUEA 4MLPA 4UQXA 4BSXA 3SNXA 5FWQA 4CT0A 4ANWA 3CK8A 2WMNA 3U9WA 3R7RA 3RRNB 4CGVA 3TWUA 2P9IG 4C0EA 1VDYA 3MKQB 3V2XA 4WWOA 2X3MA 3EHNA 3HHMA 3LXUX 3PS6A 4HRNA 2R02A 3IEGA 4XKCA 3Q9UC 4K5CA 3ZYKA 4IYPA 4N2SA 2OVBA 3KEZA 3TJPA 3K9IA 4PS3A 2QZAA 5CHEE 3ABLE 4F3VA 2YQ8A 3NZUA 3SD5A 3O48A 1OWNA 4DLOA 2LNIA 3FH7A 1N94A 3QWWA 4XKBA 3R9MA 2DIWA 5CCMA 2LSUA 5JMND 2VSYA 5JJTA 1H6OA 3C98A 1PAQA 4WWNA 2HYZA 3LY7A 3CKCA 3DSVA 3HXDA 1BPOA 1O1TA 2DYRE 4HB5A 4GPKA 5JJ7A 5D2MC 5EILA 1PY1A 1YA0A 2BUGA 4CGWA 3DXMG 3TWVA 5KJLA 3FUNA 1NP7A 5ENTD 4F53A 4GTOA 3Q4AB 4DRXE 3D9IA 4CDRA 1N95A 2RKKA 4Q69A 1MX6A 3FUMA 3Q75A 3HRAA 3GZSA 2KCVA 2EIKE 4J7WA 5HKPA 2XCBA 3TG4A 4CRWA 1N4QA 4G23A 5A6CA 4A55A 3CVYA 3B7UX 1OY3D 2VGYA 3ABME 1N4RA 3CVUA 5JJ6A 4GMJA 3FWVA 3L9TA 3E30A 1BU9A 2VYIA 2AJAA 1IHBA 4LCTA 3PH0C 3FU3A 4YVOA 4PUCA 1IQRA 1N0RA 2WXGA 3DRAA 4M3OA 4OVUA 2LSVA 3MKRA 4GAAA 3PE4A 5BUZA 5LFAA 3UX4A 2XZTG 5BW8C 4E6HA 4NIKA 3VLDA 2PNNA 3RK6A 4BT9A 3FTWA 4L23A 2AXZA 3SBSA 4F6RD 5ARGA 5ENNA 2BKKB 2B0OE 4PDXA 4A1GA 3EU5A 2PM7A 2VGXB 1JCSA 4B94A 4MKTA 4UWFA 4ABNA 2J09A 2WXLA 1EPUA 1E8YA 3FTYA 4J8SA 3FUJA 4LRZA 5AQAA 3FUKA 1LD7A 3PDNA 2UY1A 4YDOA 3D9NA 3VLEA 3NBNB 4BY6A 3BG0B 3ABKE 4K0RA 3U3WA 3B7RL 3Q49B 3S7JA 3OAWA 1LD8A 2HO1A 3LY8A 3ZXPA 4JD2G 4BWRA 3ZKJA 3HVEA 2CFUA 3I4RB 2ETBA 2F8XK 4LNUD 2V0PA 3B7SA 3UUXA 1HO8A 4MRUA 2R59A 3CHSA 4FADA 5KBAA 2AXUA 3GZ2A 3ONLA 3Q78A 3ZHEB 1H6KA 2IFUA 3D3MA 3VLFA 3PZ2A 3IXEA 3C3QA 1TN8A 4LEUA 5G04J 2R5SA 4N5CA 3SZ7A 1OUVA 2MOWA 2GRRB 3FH5A 2X6IA 3ZGQA 3LYAA 1OWPA 4HXIA 4A3VA 3BG1B 3AS8A 1U3CA 4F7AA 3UI2A 1E96B 5JHAA 4B0ZA 3MV3B 4XI9A 2DZNA 4HS2A 4N39A 5LX8A 1DCEA 4JC8A 1N4PA 4GMLA 3CHOA 4I1AA 3LS8A 4FHKA 2R03A 2WXJA 3UIPC 4HOUA 2X6JA 4O1OA 1HZ4A 4GCOA 1FVHA 2XGMA 3AJIA 2CG3A 3Q9NC 2RD0A 4KBQA 3PVLA 4GZ6A 1WG0A 5BV1A 2AWIA 4HOSA 1NA0A 3TAXA 4DI3A 4K5AB 2IO2C 3ASDA 3TL5A 5BV0A 3TWRA 4HNAD 2R05A 3NOCD 1HG5A 4XX5A 3X2QE 2XGSA 2OEWA 4AIFA 1SA4A 5A7DB 5CEAA 3ZW3A 3ZYMA 1Z3YA 4DX6D 4HFGA 3MCXA 1D9SA 4AJWA 1JWFA 1JCRA 3UT8A 2X6HA 4U0ZA 2IJGX 3HXBA 2NYJA 1DVPA 1MQSA 3MKQA 1FPPA 2EILE 4CEMA 4YVQC
chains in the Genus database with same CATH topology
2KXPC 4F6RD 5KNHD 4ZFHA 4J8YA 5EIDA 4DX2A 1MJ0A 4C48B 4DX5D 3UI2A 4HBDA 5EILA 2BKKB 2DZOA 3DEOA 2B0OE 2XENA 4GPMA 5ENPD 2ETCA 5AN8A 5KNGA 3TWVA 4HRLA 5ENQD 5ENTD 2A5EA 5ENRD 2XZDG 4HLLA 2DZNA 4DRXE 4DUIA 4DX1A 4BETA 5AQAA 1MX2A 4HI9A 1BI7B 3V31A 2ZGDA 2ZGGA 3JUEA 5CECB 1K1AA 1K3ZD 4U96D 1IKND 1AWCB 4OAVB 5FIOA 3HG0D 4K5BA 1YYHA 4QQIA 5AQ9A 4G8KA 1MX6A 3EHQA 5HRYA 3T8KA 5BXUA 1N11A 5KWDA 3NBNB 5BXOA 1DC2A 3W9FA 3EHRA 4O1OA 3HRAA 2KBXA 4BSZB 5CBOA 2J8SD 1MYOA 5CEDB 5EYPF 3AJIA 1BD8A 1K1BA 1WDYA 4J7WA 4YDWA 5HKPA 3ZNGA 4CYMD 5EN5D 3W9GA 3TWUA 4ZHBA 5JA4D 3UXGA 5FINA 5AAOA 4GMRA 2QC9A 3F6QA 3Q9NC 3SO8A 1NFIE 4UUCA 2RFMA 3V2XA 4JB8P 4A63B 1WG0A 2Y1LE 2XEEA 3ZKJA 4OAUC 2RFAA 1UOHA 3V30A 3LJNA 4HRNA 1OY3D 2ETBA 1N0QA 3JXIA 5CERB 1SW6A 3Q9UC 3AAAC 4K5AB 4LNUD 1S70B 2F8XK 1SVXA 4K5CA 3J5PA 3J5QB 4U8VD 4G8LA 3TWWA 2L6BA 4BESA 4BERA 2JABA 1QYMA 2DWZA 5CBNA 3TWXA 3D9HA 1AP7A 4TUMA 4O60A 5AQ7A 2BKGA 2F37A 3TWSA 4LG6A 1BI8B 3TWQA 1BU9A 3V2OA 3C5RA 5KBAA 4F1PA 5ENSD 3TWTA 3TWRA 2AJAA 3JXJA 3EU9A 1TR4A 2V4HC 4HNAD 5AARA 1IHBA 1IXVA 3NOCD 5AQBA 2DVWA 3KEAA 3DEPA 4Z68A 4N5QA 3ZUVB 3ZU7B 5ITZF 3IXEA 3NOGD 4O1PA 1N0RA 5D66A 4ATZD 1OT8A 2MYOA 2VGEA 4YDYA 5CEAA 3B95A 5JMND 4U95D 1MX4A 1YMPA 4DX6D 1A5EA 5EIBE 2XEHA 1YCSB 2Y0BG 3UTMA 4HRMB 1D9SA 2XZTG 3B7BA 5EYLA 4DX7D 4U8YD 3V79K 3T9KA 4BEPA 4HI8A 4NIKA 2HE0A 2F8YA 2V5QC 2NYJA 4B93B 2PNNA 4QFVA 5HS0A 1BLXB 4HQDA 2ETAA 2P2CP 2FO1E 4HB5A 4CZ2D 1DCQA 5ENOD 1G3NB 4RLYA 4LSZE 2QYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXP C;  4F6R D;  5KNH D;  4ZFH A;  4J8Y A;  5EID A;  4DX2 A;  1MJ0 A;  4C48 B;  4DX5 D;  3UI2 A;  4HBD A;  5EIL A;  2BKK B;  2DZO A;  3DEO A;  2B0O E;  2XEN A;  4GPM A;  5ENP D;  2ETC A;  5AN8 A;  5KNG A;  3TWV A;  4HRL A;  5ENQ D;  5ENT D;  2A5E A;  5ENR D;  2XZD G;  4HLL A;  2DZN A;  4DRX E;  4DUI A;  4DX1 A;  4BET A;  5AQA A;  1MX2 A;  4HI9 A;  1BI7 B;  3V31 A;  2ZGD A;  2ZGG A;  3JUE A;  5CEC B;  1K1A A;  1K3Z D;  4U96 D;  1IKN D;  1AWC B;  4OAV B;  5FIO A;  3HG0 D;  4K5B A;  1YYH A;  4QQI A;  5AQ9 A;  4G8K A;  1MX6 A;  3EHQ A;  5HRY A;  3T8K A;  5BXU A;  1N11 A;  5KWD A;  3NBN B;  5BXO A;  1DC2 A;  3W9F A;  3EHR A;  4O1O A;  3HRA A;  2KBX A;  4BSZ B;  5CBO A;  2J8S D;  1MYO A;  5CED B;  5EYP F;  3AJI A;  1BD8 A;  1K1B A;  1WDY A;  4J7W A;  4YDW A;  5HKP A;  3ZNG A;  4CYM D;  5EN5 D;  3W9G A;  3TWU A;  4ZHB A;  5JA4 D;  3UXG A;  5FIN A;  5AAO A;  4GMR A;  2QC9 A;  3F6Q A;  3Q9N C;  3SO8 A;  1NFI E;  4UUC A;  2RFM A;  3V2X A;  4JB8 P;  4A63 B;  1WG0 A;  2Y1L E;  2XEE A;  3ZKJ A;  4OAU C;  2RFA A;  1UOH A;  3V30 A;  3LJN A;  4HRN A;  1OY3 D;  2ETB A;  1N0Q A;  3JXI A;  5CER B;  1SW6 A;  3Q9U C;  3AAA C;  4K5A B;  4LNU D;  1S70 B;  2F8X K;  1SVX A;  4K5C A;  3J5P A;  3J5Q B;  4U8V D;  4G8L A;  3TWW A;  2L6B A;  4BES A;  4BER A;  2JAB A;  1QYM A;  2DWZ A;  5CBN A;  3TWX A;  3D9H A;  1AP7 A;  4TUM A;  4O60 A;  5AQ7 A;  2BKG A;  2F37 A;  3TWS A;  4LG6 A;  1BI8 B;  3TWQ A;  1BU9 A;  3V2O A;  3C5R A;  5KBA A;  4F1P A;  5ENS D;  3TWT A;  3TWR A;  2AJA A;  3JXJ A;  3EU9 A;  1TR4 A;  2V4H C;  4HNA D;  5AAR A;  1IHB A;  1IXV A;  3NOC D;  5AQB A;  2DVW A;  3KEA A;  3DEP A;  4Z68 A;  4N5Q A;  3ZUV B;  3ZU7 B;  5ITZ F;  3IXE A;  3NOG D;  4O1P A;  1N0R A;  5D66 A;  4ATZ D;  1OT8 A;  2MYO A;  2VGE A;  4YDY A;  5CEA A;  3B95 A;  5JMN D;  4U95 D;  1MX4 A;  1YMP A;  4DX6 D;  1A5E A;  5EIB E;  2XEH A;  1YCS B;  2Y0B G;  3UTM A;  4HRM B;  1D9S A;  2XZT G;  3B7B A;  5EYL A;  4DX7 D;  4U8Y D;  3V79 K;  3T9K A;  4BEP A;  4HI8 A;  4NIK A;  2HE0 A;  2F8Y A;  2V5Q C;  2NYJ A;  4B93 B;  2PNN A;  4QFV A;  5HS0 A;  1BLX B;  4HQD A;  2ETA A;  2P2C P;  2FO1 E;  4HB5 A;  4CZ2 D;  1DCQ A;  5ENO D;  1G3N B;  4RLY A;  4LSZ E;  2QYJ A; 
#chains in the Genus database with same CATH topology
 2KXP C;  3ULY A;  1KPS B;  3ZPJ A;  4UWL A;  1NZN A;  3CSF A;  3D9M A;  4FU3 A;  5ENP D;  3SGH A;  2JEK A;  2ILR A;  2CHZ A;  2I1K A;  1JCQ A;  2E0I A;  4W9R A;  3PZ1 A;  3PNT B;  1RW2 A;  4OVV A;  2B6C A;  1YYH A;  4GYW A;  4Q96 A;  2FO7 A;  4G8K A;  4UWK A;  5KWD A;  2IQC A;  3IHY A;  5KJK A;  1MYO A;  2P9K G;  2Y4U A;  2P9S G;  4JEU A;  3S7B A;  1ZU2 A;  3QJZ A;  1SW6 A;  4JHK A;  3AAA C;  1SVX A;  3J5Q B;  2L6B A;  3VTY A;  3KSQ A;  2ZU6 B;  4F1P A;  3FTZ A;  1UN9 A;  3EUV A;  2I2O A;  4AVX A;  3URZ A;  3APC A;  3NOG D;  4U7E B;  5D66 A;  3ZFW A;  1OT8 A;  1KLX A;  4XIF A;  2QFC A;  4YDY A;  4CDM A;  4A3T A;  4NUR A;  1A5E A;  3LY9 A;  4TXP A;  2J9Q A;  1E8X A;  3AS5 A;  4HRM B;  1V54 E;  2H6G A;  3IV0 A;  2GW1 A;  5E76 A;  3HYM B;  3FHE A;  4QFV A;  4GZ5 A;  3BQO A;  4J6I A;  4ZFH A;  3OTN A;  3L22 A;  3DEO A;  4AV7 A;  2J4B A;  4V3I A;  2LAI A;  4JHR A;  5KJM A;  4BET A;  3SFX A;  1O5M A;  2WXK A;  1UJK A;  4I2Z A;  4K5B A;  3T8K A;  4I6G A;  1N11 A;  3GZ1 A;  4JL0 A;  4FLB A;  4GZ3 A;  2V8S E;  3FUF A;  4BX8 A;  4IRU A;  4JA9 A;  1WDY A;  3UXG A;  3DST A;  3R7Q A;  4F1S A;  3ZN3 A;  3FU6 A;  2XEE A;  4P29 A;  3KAE A;  3FTV A;  4AY6 A;  3TWW A;  4I6E A;  5H7P A;  3TWX A;  4TUM A;  4RG6 A;  2BKG A;  4U0S A;  3SHF A;  2VGX A;  3PUJ A;  2EIM E;  3EIJ A;  1OCR E;  1TN7 A;  2X38 A;  3EU9 A;  1MHQ A;  4GYY A;  5AQB A;  2DVW A;  1U3D A;  5LOZ A;  2CFZ A;  4Z68 A;  4N5Q A;  5DBK A;  4O1P A;  3ESK A;  4GB9 A;  5D0O D;  1YMP A;  3FH8 A;  4ILI A;  4JZY A;  4UWG A;  4BEP A;  2HM8 A;  4HI8 A;  3S7F A;  3SI5 A;  3ZXS A;  3BU8 A;  2P2C P;  1FVF A;  2F0Y A;  3CQG B;  4RLY A;  3ESL A;  3APF A;  4DX5 D;  4KYO B;  4UI9 C;  5AN8 A;  3Q15 A;  4PS7 A;  4WUY A;  3NB2 A;  2C2L A;  4DUI A;  3SFY A;  1INZ A;  1O1S A;  2ZGD A;  1KZP A;  2J07 A;  4BT8 A;  5CEC B;  3ZHE A;  2NSZ A;  4UI9 K;  5BXU A;  5CMY A;  1TNB A;  5G04 C;  3OXF A;  3QNK A;  2XRY A;  4GTP A;  4L1B A;  2OEV A;  1OWL A;  4CYM D;  3JCK C;  1TNZ A;  3FEY A;  4EBA G;  2QC9 A;  1NFI E;  3UM2 A;  3DWL G;  3CVW A;  3MGB A;  3AG2 E;  1SZ9 A;  4ANU A;  2AVP A;  3PZD A;  4U8V D;  4G8L A;  4TRQ A;  2XPZ A;  2YHE A;  1GW6 A;  4KVO A;  4EEC A;  2F37 A;  3V2O A;  3I5P A;  2FEZ A;  3QK0 A;  4BTA A;  4DI4 A;  3ZYL A;  2CG2 A;  4TXQ A;  5J90 A;  2P58 C;  5AJD A;  3AG3 E;  3FP3 A;  3C3O A;  4FA6 A;  4C9B B;  5G05 C;  2R17 C;  2WVI A;  2ION A;  3FTS A;  2H6I A;  4DX2 A;  2XS8 A;  5AIJ A;  4A1S A;  2AW6 A;  4I9C A;  4EZJ A;  3HXE A;  1V55 E;  2J49 A;  3Q73 A;  2ZGG A;  3PRZ A;  3ULE G;  3CIA A;  3E32 A;  3ASO E;  1AWC B;  4KZC A;  1S63 A;  3NQP A;  1FT2 A;  5EKQ D;  5FQ7 A;  3UMV A;  4BSZ B;  1HE8 A;  1K1B A;  2VSO E;  2Q7F A;  3FU0 A;  4GMR A;  3EHM A;  4JB8 P;  5AJL A;  5LCW C;  4G25 A;  1XNF A;  2I9C A;  2JAB A;  2DWZ A;  5CBN A;  2HR2 A;  1BI8 B;  3FUI A;  4H7X A;  1ELK A;  1UW4 B;  1IXV A;  1N52 A;  3O4Z A;  4EBA A;  3B95 A;  2GRQ B;  3B7T A;  3CKB A;  2WXR A;  3UTM A;  3BUA A;  1E8W A;  2HE0 A;  4GTR A;  2F8Y A;  3G2S A;  2CHW A;  3T8M A;  3C3R A;  3DBS A;  3CST A;  3N71 A;  4UQY A;  2Y69 E;  4ANV A;  4C48 B;  1IQU A;  4IUL A;  2DZO A;  3IBE A;  3UKU G;  2Y3A A;  4RQI A;  3U64 A;  3NF1 A;  2A5E A;  2VQ2 A;  4N3B A;  5J08 A;  3LDZ A;  3CVP A;  2I1J A;  3GYZ A;  3UM0 A;  3MEK A;  1IKN D;  1SZA A;  4UQZ A;  3L08 A;  5AEN A;  3T5X A;  3W9F A;  5BPP A;  2GRP B;  1L5J A;  1TNU A;  5EYP F;  3L16 A;  3WXX A;  1BD8 A;  1S0P A;  4YDW A;  4N2Q A;  2V4L A;  5AYW D;  3PEU B;  1TEZ A;  4JA7 A;  1UG3 A;  1UN8 A;  3UKR G;  2C0M A;  3JUI A;  3UM3 A;  3GW4 A;  1NL4 A;  3TWS A;  1O1R A;  4I2W A;  4BFR A;  3CLJ A;  4XI0 A;  2KCL A;  2XQ0 A;  4TV3 A;  3AG4 E;  3ZRH A;  3CHP A;  3D9L A;  4WNE A;  3ASF A;  5G2N A;  2KZT B;  1TJF A;  4GYO A;  3ZUV B;  3OXG A;  2WQH A;  2VGE A;  5ARF A;  4GTQ A;  5EIB E;  5EDS A;  1OCC E;  4GA1 A;  4HOT A;  4XEI G;  4B93 B;  1FT1 A;  4L7T A;  2C0L A;  2EIN E;  4LSZ E;  3RO2 A;  3D9K A;  4L9P A;  3FEX A;  2GRL A;  3Q5M A;  4EPZ A;  5B3S E;  2VTB B;  1SA5 A;  3Q79 A;  1HX8 A;  5D0Q D;  4O6F A;  4I6J A;  5FQ4 A;  4HOQ A;  1H6P A;  2WXM A;  4N3A A;  4GTT A;  2FI7 A;  3ASH A;  2OCC E;  5HRY A;  4GU5 A;  3CK9 A;  4WAF A;  4J8F A;  1KZO A;  5CED B;  3G2T A;  3LEW A;  4KT6 B;  3QKY A;  5AAO A;  4JPS A;  3F6Q A;  1TNY A;  2WPV A;  1WAO 1;  5KCM A;  2L6J A;  4RG9 A;  3CK7 A;  2DCP A;  2XHE A;  4U63 A;  4GCN A;  5HQ8 A;  2WXO A;  5FZQ A;  3HDX A;  3PZ3 A;  4JHJ A;  5E75 A;  3CHM A;  3EJN A;  3TWQ A;  3ZEF A;  2WXN A;  2V4H C;  3KEA A;  2P9U G;  3ZU7 B;  4EZK A;  1E7U A;  4NQ0 A;  4Y6C A;  2RG8 A;  3LKU A;  3DSU A;  3V79 K;  2IOS A;  3ZIM A;  1NI1 A;  1Z5S C;  2WQ6 A;  3CVL A;  2WQ7 A;  2XCC A;  3C72 A;  3L13 A;  3AU4 A;  1DCQ A;  3CHQ A;  2L0I A;  2X6F A;  2FBN A;  4J8Y A;  3WG7 E;  5EID A;  2PL2 A;  2XEN A;  1N54 A;  3OXL A;  4D10 C;  3CVQ A;  3MZL B;  3RJV A;  1XGW A;  1SQM A;  2EIJ E;  4GA0 A;  1EDU A;  5BNW A;  4KZ0 A;  5B1A E;  3Q47 B;  4ATG A;  5FZS A;  4I17 A;  2VSN A;  3MV2 B;  4XE0 A;  3EHR A;  2J8S D;  5T4Y A;  4L2Y A;  1PC2 A;  5C1D A;  3DXK G;  3JQ1 A;  3W9G A;  4ZHB A;  5FIN A;  3G2V A;  1N9A A;  3TGO A;  4U07 A;  4N3C A;  4ILG A;  3LCA A;  4JVS A;  1UOH A;  2L0T B;  1TJC A;  4M7C A;  1TN6 A;  2XGO A;  4CDN A;  4L2L A;  4BER A;  4U8H A;  3SY2 A;  4FJY A;  2FF4 A;  2QY7 A;  3KSL A;  3U4T A;  5JHB A;  5ENS D;  3DSS A;  2DBA A;  2IF4 A;  4WND A;  1HH8 A;  5IY5 E;  5HI7 A;  3CV0 A;  1HU3 A;  3EIQ C;  3UT7 A;  1H2T C;  4CCA A;  4MS6 A;  3B7B A;  3FUL A;  2MHK A;  3T5V A;  2P9N G;  2LUH A;  3AG1 E;  1K8K G;  5HS0 A;  4CZ2 D;  5ENO D;  1ZBP A;  2UWJ G;  5EX0 A;  5BT1 A;  3JYS A;  1S64 A;  1E8Z A;  5FT9 A;  2BED A;  5CRV A;  3ONK A;  3RRM B;  1A17 A;  1X5B A;  1Q2Z A;  1MX2 A;  1BI7 B;  3CQC B;  4U96 D;  1HF8 A;  3FY4 A;  4AXH A;  4NRH B;  4FUL A;  4B8A A;  3QAR A;  1DC2 A;  1NA3 A;  3QWP A;  2GRM A;  4AEZ C;  4ACL A;  4DPR A;  3CR3 A;  3QB2 A;  4I43 A;  1DNP A;  3ENE A;  2AXV A;  2RFM A;  4BTB A;  2CHX A;  2FUL A;  2Y1L E;  4OAU C;  3P1U A;  2NXP A;  3FTU A;  1EF1 C;  1N0Q A;  3JXI A;  2WXQ A;  2H6H A;  4WWP A;  3MX3 A;  1QYM A;  1MZC A;  1AP7 A;  2PQR A;  4G26 A;  3C5R A;  3D9J A;  1TR4 A;  3FUE A;  3ML8 A;  5KJN A;  2VJ8 A;  3CVN A;  4RSY A;  4EZL A;  1D8E A;  2P9P G;  4U04 A;  4ATZ D;  4URK A;  4DX7 D;  4U8Y D;  3T9K A;  3NZS A;  4R7L A;  3RRU A;  3RAU A;  2ETA A;  5T3R A;  2FO1 E;  1EYH A;  2XPY A;  1MJ0 A;  3JQ0 A;  4OYS A;  2JLB A;  4AP2 A;  4HRL A;  2GRO B;  3PE3 A;  4KMO A;  4DX1 A;  2XRZ A;  4J8D A;  3V31 A;  2LO6 A;  3Q7A A;  2IO3 C;  5FIO A;  2KZT A;  3TXN A;  3SBT B;  2KBX A;  4GTS A;  5EN5 D;  3QOU A;  4B8C B;  1HS6 A;  4G1T A;  4X8Q A;  3TXM A;  3SO8 A;  2IEJ A;  3E4B A;  3DPD A;  1E90 A;  1S70 B;  3PRE A;  3D9H A;  3DPY A;  4LG6 A;  1X81 A;  3UIO C;  2YHC A;  4YND A;  1QNF A;  2PZI A;  3TWT A;  2VTB A;  1HFA A;  1ELW A;  4I9E A;  3D9O A;  5LP0 A;  3RIB A;  5ITZ F;  2E2E A;  4UWH A;  5CCL A;  2BF0 X;  3PEV B;  1MX4 A;  3LPZ A;  2Y0B G;  1H2V C;  3ISM C;  4PS8 A;  1H2U A;  3FFL A;  2WB2 A;  3FUH A;  1BLX B;  2L9B A;  1JWG A;  2I6H A;  4NAC A;  2XEV A;  3NAW A;  3RKV A;  4FJZ A;  3KS2 A;  5CRU A;  4AOF A;  1LTX A;  3R9A B;  2ETC A;  2LXM A;  5G55 A;  3ASG A;  4LER A;  5ENR D;  3UQ3 A;  4HLL A;  4JEH A;  2H6F A;  3U66 A;  3RSE G;  1QZ2 A;  1Y6I A;  1Y8M A;  2WM9 A;  3MA5 A;  2WXP A;  1K1A A;  5T8I A;  1K3Z D;  3PNL B;  3S2A A;  4QQI A;  3EHQ A;  1Z6T A;  5ANR A;  2XS1 A;  3FU5 A;  4UI9 J;  5CBO A;  2OND A;  2J4D A;  1TNO A;  3UIN C;  1N4S A;  3DSX A;  2P9L G;  3KD7 A;  1TYQ G;  2YNQ A;  4HVB A;  4A63 B;  2PM6 A;  5FQ6 A;  2RFA A;  3VTX A;  1QBQ A;  4J0U A;  2ZXW E;  5CER B;  1H0A A;  3J5P A;  1OWM A;  4BES A;  2EQX A;  4U0U A;  1WY6 A;  3RO3 A;  3S7D A;  2IOL A;  4TXR A;  2IU1 A;  3JXJ A;  1JPL A;  3LVR E;  3QWV A;  2PQN A;  1D8D A;  5C2Y A;  2MYO A;  2KM4 A;  5EX3 A;  5EYL A;  3L54 A;  2V5Q C;  2OVF A;  1IYG A;  2DYS E;  4FC8 A;  3L17 A;  3EDT B;  4GZC A;  2WXH A;  3SF4 A;  1G3N B;  3CGH A;  3E37 A;  3ASN E;  1UJJ A;  4EQF A;  4H7Y A;  1FCH A;  1QQE A;  3I3N A;  4Y6W A;  3FTX A;  4ME2 A;  3SQV A;  1HG2 A;  5FZR A;  5G05 J;  4HI9 A;  4FLH A;  3TG5 A;  4GA2 A;  4IN3 B;  4ACK A;  3L82 A;  5CMW A;  2GGF A;  2M63 A;  4OAV B;  5A23 A;  1OXJ A;  1ELR A;  3CEQ A;  3HXC A;  4G24 A;  3FUD A;  5BXO A;  2QYU A;  2LAH A;  4G11 A;  3ZYQ A;  4AY5 A;  5M72 A;  4I1M A;  5ANL A;  4UUC A;  3IHV A;  2V5F A;  3AS4 A;  5FTP A;  3LJN A;  3P2B A;  2A4Z A;  4HLE A;  5FQ8 A;  4WNF A;  5FJY A;  5AQ7 A;  3PZ4 A;  1OCZ E;  2YIN A;  2WXI A;  2ZIS A;  1W3B A;  2XPI A;  3D9P A;  4PH4 B;  2UY1 B;  3DEP A;  5LCW J;  4TUU A;  1OCO E;  4DJA A;  4JXT A;  4CT4 A;  3BEE A;  2ZIR A;  1YCS B;  2OOE A;  4BX9 A;  4YDE A;  2A5U A;  3G2U A;  1IHG A;  2MRI A;  3LJ3 A;  4AM9 A;  1ZB1 A;  4LNG A;  3PUK A;  3G2W A;  4EHM A;  3HVE B;  1JUQ A;  4FHJ A;  1OWO A;  3RU0 A;  2QYJ A;  3ZVV A;  5KNH D;  1Z3X A;  2KAT A;  4DLQ A;  2J08 A;  2R2L A;  3I4G A;  4HBD A;  1HXI A;  4GPM A;  4GTM A;  4KXK B;  4APF A;  2XZD G;  4I1O B;  3QAQ A;  3UM1 A;  2BTD A;  2OV8 A;  2WXF A;  2LXL A;  1P5Q A;  4ILH B;  3HG0 D;  4APO A;  4KVM A;  5AQ9 A;  5B1B E;  3HXF A;  3QC1 A;  3HIZ A;  3MYV A;  4J8E A;  3E33 A;  1B89 A;  3UPV A;  2IY0 C;  3LVQ E;  3IKO B;  4Q94 A;  3ZNG A;  2NC9 A;  5JA4 D;  3E34 A;  3CVX A;  3AU5 A;  4GTV A;  3CVV A;  3V30 A;  4JW1 A;  4GZD A;  4MBG A;  2KC7 A;  4C0M A;  3ULQ A;  3MJW A;  4O60 A;  2Y4T A;  1KT1 A;  1E7V A;  1KT0 A;  5AAR A;  4E85 A;  3B13 A;  3SFZ A;  4B89 A;  2GRN B;  4FP7 A;  5DIZ A;  3FDH A;  2VSX E;  4K03 A;  4U95 D;  2WMO A;  2XEH A;  3L6A A;  3CHR A;  4RVB A;  3Q7F A;  1H19 A;  2X6K A;  2KCK A;  4DK5 A;  3APD A;  4HQD A;  4ANX A;  4WNG A;  4XZ4 A;  4LUN U;  4HOR A;  1U2V G;  5KNG A;  1RZ4 A;  3QDN A;  4G2V A;  5ENQ D;  1WM5 A;  4LNB A;  1LF8 A;  3DSW A;  3ML9 A;  3UT4 A;  3JUE A;  4MLP A;  4UQX A;  4BSX A;  3SNX A;  5FWQ A;  4CT0 A;  4ANW A;  3CK8 A;  2WMN A;  3U9W A;  3R7R A;  3RRN B;  4CGV A;  3TWU A;  2P9I G;  4C0E A;  1VDY A;  3MKQ B;  3V2X A;  4WWO A;  2X3M A;  3EHN A;  3HHM A;  3LXU X;  3PS6 A;  4HRN A;  2R02 A;  3IEG A;  4XKC A;  3Q9U C;  4K5C A;  3ZYK A;  4IYP A;  4N2S A;  2OVB A;  3KEZ A;  3TJP A;  3K9I A;  4PS3 A;  2QZA A;  5CHE E;  3ABL E;  4F3V A;  2YQ8 A;  3NZU A;  3SD5 A;  3O48 A;  1OWN A;  4DLO A;  2LNI A;  3FH7 A;  1N94 A;  3QWW A;  4XKB A;  3R9M A;  2DIW A;  5CCM A;  2LSU A;  5JMN D;  2VSY A;  5JJT A;  1H6O A;  3C98 A;  1PAQ A;  4WWN A;  2HYZ A;  3LY7 A;  3CKC A;  3DSV A;  3HXD A;  1BPO A;  1O1T A;  2DYR E;  4HB5 A;  4GPK A;  5JJ7 A;  5D2M C;  5EIL A;  1PY1 A;  1YA0 A;  2BUG A;  4CGW A;  3DXM G;  3TWV A;  5KJL A;  3FUN A;  1NP7 A;  5ENT D;  4F53 A;  4GTO A;  3Q4A B;  4DRX E;  3D9I A;  4CDR A;  1N95 A;  2RKK A;  4Q69 A;  1MX6 A;  3FUM A;  3Q75 A;  3HRA A;  3GZS A;  2KCV A;  2EIK E;  4J7W A;  5HKP A;  2XCB A;  3TG4 A;  4CRW A;  1N4Q A;  4G23 A;  5A6C A;  4A55 A;  3CVY A;  3B7U X;  1OY3 D;  2VGY A;  3ABM E;  1N4R A;  3CVU A;  5JJ6 A;  4GMJ A;  3FWV A;  3L9T A;  3E30 A;  1BU9 A;  2VYI A;  2AJA A;  1IHB A;  4LCT A;  3PH0 C;  3FU3 A;  4YVO A;  4PUC A;  1IQR A;  1N0R A;  2WXG A;  3DRA A;  4M3O A;  4OVU A;  2LSV A;  3MKR A;  4GAA A;  3PE4 A;  5BUZ A;  5LFA A;  3UX4 A;  2XZT G;  5BW8 C;  4E6H A;  4NIK A;  3VLD A;  2PNN A;  3RK6 A;  4BT9 A;  3FTW A;  4L23 A;  2AXZ A;  3SBS A;  4F6R D;  5ARG A;  5ENN A;  2BKK B;  2B0O E;  4PDX A;  4A1G A;  3EU5 A;  2PM7 A;  2VGX B;  1JCS A;  4B94 A;  4MKT A;  4UWF A;  4ABN A;  2J09 A;  2WXL A;  1EPU A;  1E8Y A;  3FTY A;  4J8S A;  3FUJ A;  4LRZ A;  5AQA A;  3FUK A;  1LD7 A;  3PDN A;  2UY1 A;  4YDO A;  3D9N A;  3VLE A;  3NBN B;  4BY6 A;  3BG0 B;  3ABK E;  4K0R A;  3U3W A;  3B7R L;  3Q49 B;  3S7J A;  3OAW A;  1LD8 A;  2HO1 A;  3LY8 A;  3ZXP A;  4JD2 G;  4BWR A;  3ZKJ A;  3HVE A;  2CFU A;  3I4R B;  2ETB A;  2F8X K;  4LNU D;  2V0P A;  3B7S A;  3UUX A;  1HO8 A;  4MRU A;  2R59 A;  3CHS A;  4FAD A;  5KBA A;  2AXU A;  3GZ2 A;  3ONL A;  3Q78 A;  3ZHE B;  1H6K A;  2IFU A;  3D3M A;  3VLF A;  3PZ2 A;  3IXE A;  3C3Q A;  1TN8 A;  4LEU A;  5G04 J;  2R5S A;  4N5C A;  3SZ7 A;  1OUV A;  2MOW A;  2GRR B;  3FH5 A;  2X6I A;  3ZGQ A;  3LYA A;  1OWP A;  4HXI A;  4A3V A;  3BG1 B;  3AS8 A;  1U3C A;  4F7A A;  3UI2 A;  1E96 B;  5JHA A;  4B0Z A;  3MV3 B;  4XI9 A;  2DZN A;  4HS2 A;  4N39 A;  5LX8 A;  1DCE A;  4JC8 A;  1N4P A;  4GML A;  3CHO A;  4I1A A;  3LS8 A;  4FHK A;  2R03 A;  2WXJ A;  3UIP C;  4HOU A;  2X6J A;  4O1O A;  1HZ4 A;  4GCO A;  1FVH A;  2XGM A;  3AJI A;  2CG3 A;  3Q9N C;  2RD0 A;  4KBQ A;  3PVL A;  4GZ6 A;  1WG0 A;  5BV1 A;  2AWI A;  4HOS A;  1NA0 A;  3TAX A;  4DI3 A;  4K5A B;  2IO2 C;  3ASD A;  3TL5 A;  5BV0 A;  3TWR A;  4HNA D;  2R05 A;  3NOC D;  1HG5 A;  4XX5 A;  3X2Q E;  2XGS A;  2OEW A;  4AIF A;  1SA4 A;  5A7D B;  5CEA A;  3ZW3 A;  3ZYM A;  1Z3Y A;  4DX6 D;  4HFG A;  3MCX A;  1D9S A;  4AJW A;  1JWF A;  1JCR A;  3UT8 A;  2X6H A;  4U0Z A;  2IJG X;  3HXB A;  2NYJ A;  1DVP A;  1MQS A;  3MKQ A;  1FPP A;  2EIL E;  4CEM A;  4YVQ C; 
#chains in the Genus database with same CATH homology
 2KXP C;  4F6R D;  5KNH D;  4ZFH A;  4J8Y A;  5EID A;  4DX2 A;  1MJ0 A;  4C48 B;  4DX5 D;  3UI2 A;  4HBD A;  5EIL A;  2BKK B;  2DZO A;  3DEO A;  2B0O E;  2XEN A;  4GPM A;  5ENP D;  2ETC A;  5AN8 A;  5KNG A;  3TWV A;  4HRL A;  5ENQ D;  5ENT D;  2A5E A;  5ENR D;  2XZD G;  4HLL A;  2DZN A;  4DRX E;  4DUI A;  4DX1 A;  4BET A;  5AQA A;  1MX2 A;  4HI9 A;  1BI7 B;  3V31 A;  2ZGD A;  2ZGG A;  3JUE A;  5CEC B;  1K1A A;  1K3Z D;  4U96 D;  1IKN D;  1AWC B;  4OAV B;  5FIO A;  3HG0 D;  4K5B A;  1YYH A;  4QQI A;  5AQ9 A;  4G8K A;  1MX6 A;  3EHQ A;  5HRY A;  3T8K A;  5BXU A;  1N11 A;  5KWD A;  3NBN B;  5BXO A;  1DC2 A;  3W9F A;  3EHR A;  4O1O A;  3HRA A;  2KBX A;  4BSZ B;  5CBO A;  2J8S D;  1MYO A;  5CED B;  5EYP F;  3AJI A;  1BD8 A;  1K1B A;  1WDY A;  4J7W A;  4YDW A;  5HKP A;  3ZNG A;  4CYM D;  5EN5 D;  3W9G A;  3TWU A;  4ZHB A;  5JA4 D;  3UXG A;  5FIN A;  5AAO A;  4GMR A;  2QC9 A;  3F6Q A;  3Q9N C;  3SO8 A;  1NFI E;  4UUC A;  2RFM A;  3V2X A;  4JB8 P;  4A63 B;  1WG0 A;  2Y1L E;  2XEE A;  3ZKJ A;  4OAU C;  2RFA A;  1UOH A;  3V30 A;  3LJN A;  4HRN A;  1OY3 D;  2ETB A;  1N0Q A;  3JXI A;  5CER B;  1SW6 A;  3Q9U C;  3AAA C;  4K5A B;  4LNU D;  1S70 B;  2F8X K;  1SVX A;  4K5C A;  3J5P A;  3J5Q B;  4U8V D;  4G8L A;  3TWW A;  2L6B A;  4BES A;  4BER A;  2JAB A;  1QYM A;  2DWZ A;  5CBN A;  3TWX A;  3D9H A;  1AP7 A;  4TUM A;  4O60 A;  5AQ7 A;  2BKG A;  2F37 A;  3TWS A;  4LG6 A;  1BI8 B;  3TWQ A;  1BU9 A;  3V2O A;  3C5R A;  5KBA A;  4F1P A;  5ENS D;  3TWT A;  3TWR A;  2AJA A;  3JXJ A;  3EU9 A;  1TR4 A;  2V4H C;  4HNA D;  5AAR A;  1IHB A;  1IXV A;  3NOC D;  5AQB A;  2DVW A;  3KEA A;  3DEP A;  4Z68 A;  4N5Q A;  3ZUV B;  3ZU7 B;  5ITZ F;  3IXE A;  3NOG D;  4O1P A;  1N0R A;  5D66 A;  4ATZ D;  1OT8 A;  2MYO A;  2VGE A;  4YDY A;  5CEA A;  3B95 A;  5JMN D;  4U95 D;  1MX4 A;  1YMP A;  4DX6 D;  1A5E A;  5EIB E;  2XEH A;  1YCS B;  2Y0B G;  3UTM A;  4HRM B;  1D9S A;  2XZT G;  3B7B A;  5EYL A;  4DX7 D;  4U8Y D;  3V79 K;  3T9K A;  4BEP A;  4HI8 A;  4NIK A;  2HE0 A;  2F8Y A;  2V5Q C;  2NYJ A;  4B93 B;  2PNN A;  4QFV A;  5HS0 A;  1BLX B;  4HQD A;  2ETA A;  2P2C P;  2FO1 E;  4HB5 A;  4CZ2 D;  1DCQ A;  5ENO D;  1G3N B;  4RLY A;  4LSZ E;  2QYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...