5CECA

Bd3459 predatory endopeptidase from bdellovibrio bacteriovorus in complex with immunity protein bd3460
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
401
structure length
401
Chain Sequence
MVYLNSMCHMAANSKTQQIQGDDNKDDKFPLASISKVVTTLWAVDRLGPDYRFKTKLHVTPTANGSYDIHIEGSRDPLFGRNMSYFLISELNRMKITKIEKLTFDENFLLAWLAEEKPMIGGTTPKYDTVEQQASIVRATLTSSFATAISPGYYTILKTKAARIGVQMSNRPKIDVRTISFVKKAEFQKNEKSTTMVLMSAPLKTILKRMNNQSNNYIADNLYWNLGGTEAFNAYIAGKMQADTSDIEFHNGSGNNEGSVAKPVYNEATCEMMIKVLYSLDKSLSAKGYDLSDVMAVAAKDKASTVGSYGGVMAGSTTAKTGSVNKAKTLMGSVSTKNGEIYFAVLMHTDYDKSRSDWGVASQQIKNKVSQLINQNGGPKAIKYTEQLPLPFDKYSYLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bd3459
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus (strain atcc 15356 / dsm 50701 / ncib 9529 / hd100)
molecule tags Protein binding
total genus 146
structure length 401
sequence length 401
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5cecA01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 5cecA02
1W5DA 3VMAA 1ES3A 3Q07A 2B5RA 1NXYA 3C7UA 4QY6A 3V3RA 4JBFA 1ONGA 2QPNA 3IQAA 1FR6A 3ZNYA 3IXDA 4WM9A 3PBRA 4BJPA 1BLPA 3E2KA 4PMAA 3UY6A 3BFFA 1JVJA 3G34A 2QZ6A 4PM7A 1XP4A 2ZC3B 4LV1A 4WELA 1C3BA 4CPKA 3GMWA 1K6RA 4WZ4A 3MBZA 1FSWA 2V1ZA 4C75A 4R3BA 5FI6A 1MWUA 1IELA 3OPHA 3PTEA 1KDWA 1EWZA 1MWSA 2H5SA 4B4XA 1BUEA 2WKHA 2Y4AA 3I7JA 3BFGA 4R23A 1H5XA 5CHJA 3N4IA 2HDSA 2XLNA 1LL9A 1ESIA 5EVIB 4IBXA 5E2GA 3RJUA 3VP2A 4QY5A 2V20A 4E3KA 2I72A 5DTSA 5CGXA 4NETA 2IWCA 3FV7A 3MZEA 4KQOA 3VP0A 1FOFA 2WGWB 4OKPA 5EOOA 4FCFA 5FSRA 5CECA 4L0LA 3IXGA 1BULA 2PU2A 4KZBA 4OP8A 5FA7A 1TDGA 4WBGA 2WYXA 4DRTA 3ZCZA 5KMWA 4GD6A 2P9VB 2XFTA 4EQIA 2J9PA 1MY8A 3UDIA 4EV4A 1L2SA 3NI9A 1CI8A 4KZ3A 4PM6A 4PPRA 5EOEA 1LHYA 1MBLA 1YMXA 4LCLA 1XGJA 4ZTKA 5EVID 1IYOA 5DVAA 3Q7VA 3NBLA 2Y2HA 3A3IA 1KGFA 4UAAA 4EBNA 1ES5A 3O86A 2XD5A 2WAEA 3O88A 1OMEA 4JXWA 1JWPA 3GV9A 4N92A 4E3LA 2PBYA 2ZQ9A 1W7FA 5G18A 2XK1A 2XF3A 1XA7A 1TVFA 1K38A 3MZFA 5A92A 1PZPA 5EUAA 1ZC2A 3AGEA 3FYZA 4LV3A 5GLCA 4OPQA 5CERA 3BFEA 5FQMA 1KE3A 4R0QA 1LI9A 3HUOA 4ZDXA 2Q9NA 2HDRA 1XKZA 3MKFA 4KZ8A 1YT4A 1S0WA 4IBRA 4RX3A 3HLGA 3S4XA 5GL9A 1E3UA 2ZM8A 3LEZA 3WS5A 4HBUA 4DDYA 4EWFA 2Y59A 2V2FF 2EX8A 3W8KA 1YMSA 3N8RA 4WEKA 1LLBA 4E6XA 4KQQA 4YINA 5CEDA 1SKFA 4DKIA 4B88A 1M6KA 2G2WA 1KVMA 3OZHA 5GHYA 4DXCA 2XGNA 1K55A 2WKEA 5AQAA 3A3DA 4KZ7A 3VOZA 5HL1A 4E3IA 5EE8A 4EBLA 1IYSA 2ZC7A 4R4SA 1VM1A 1I5QA 3HL9A 4X56A 5CTNA 5M18A 2BLSA 1K57C 2Q9MA 3HLCA 2PU4A 3IF6C 1BLCA 2A3UA 2ZM0A 3CMZA 5HX9A 4OP5A 1K57A 2ZLYA 4BD0A 4BENA 5DTKA 3ITBA 4MBHA 4LENA 1WE4A 1BZAA 3HUMA 2DNSA 2J8YA 2Y91A 3MXRA 2H0YA 4FD8A 5F83A 2OSUA 2VGKA 4MBFA 4MNRA 5FQIA 4JF4A 4ZJ1A 3VP3A 3VP1A 5FAPA 1YLTA 1IKGA 4UHUA 4K91A 3C7VA 3NC8A 1FQGA 3G35A 4FH4A 4OQHA 1KVLA 3SH7A 1FCMA 5U47A 3VOYA 4WMCD 4E3NA 3HLEA 3IF5A 1HTZA 2OLVA 1RP5A 3VSKA 1L0FA 2ZQCA 3N7WA 4OQIA 3NDGA 3CG5A 1PW8A 2DRWA 5DF9A 1SDEA 4IEDA 1K4EA 2WGVA 2OV5A 3PBSA 1XPBA 4Y0UA 4DE3A 4CJNA 5E2EA 4GDNA 1FR1A 4A5RA 1Q2PA 1SCWA 3IHBA 4DE2A 4S2PA 4EBPA 1PIOA 1RCJA 1VQQA 3HUNA 3WRZA 4HBTA 4ID4A 4R4RA 4U0XA 2ZC5B 3IWIA 5HAQA 3GRJA 4Q8IA 1L0GA 1TDLA 1YM1A 2HP6A 3IH8A 3WWXA 5EVLA 5I94A 2WK0A 4KENB 1CK3A 1YLWA 3WS1A 3C4OA 3HLFA 4OLDA 4S2NC 5FQKA 3IF6B 5DF7A 4QB8A 3SS4A 3ZVWA 1MWRA 3OPRA 4S2NA 3BM6A 2ZC4B 3GR2A 3ZFZA 3O3VA 2Y2GA 3GQZA 5HFOA 3DTMA 5E2HA 1KE4A 1TEMA 3CJMA 5FDHA 3M6BA 5CHMA 3IWOA 3QNCA 1PWGA 1JWVA 3ZG9B 3VFFA 3SS5A 2Y55A 3ZG0A 4GB7A 5DTTA 3ZG5A 2WAFA 1MXOA 3O87A 2R9WA 4M3KA 1HZOA 3HVFA 2FFFB 2XDMA 3FKVA 5CHUA 1O07A 3DWKA 3AGDA 4HEFA 2HDUA 1DY6A 4KZ4A 3Q7ZA 4P87A 1GHPA 4K0XA 3PBNA 4OQGA 4LV2A 5CGSA 5TFQA 1N9BA 2EX2A 3BYDA 4DE0A 5JYOA 1W8YA 3RXWA 1HVBA 1NRFA 4OOLA 3W4OA 1J9MA 2XQZA 2EXBA 3UO9A 3MFDA 2G2UA 3NIAA 1YLJA 3Q82A 5AQBA 3IXBA 1Q2QA 4K0WA 3OCNA 4HESA 5AQ7A 5IHVA 4DXBA 4E3OA 4Z9QA 4X6TA 4S2MA 3BFCA 3V5MA 3FZCA 2C5WB 2X02A 1NYMA 4H8RA 3NDEA 4UA9A 5HARA 3ZG8B 3UPOA 1L0EA 3N8LA 1GHIA 4E3JA 2H10A 1IKIA 1QMEA 1ERQA 3GTCA 1JTGA 4GOGA 4FH2A 3GVBA 1K6SA 1K56A 3MXSA 4LCMA 2ZQAA 3RXXA 4QD4A 4JF5A 3BECA 1H8YA 1NZUA 5TGFA 3G32A 2GDNA 4P6BA 1DJAA 2HPBA 4KG5A 4RVAA 4YFMA 1S6RA 4NK3A 3Q1FA 4S2LA 4R1GA 3LY3A 3S1YA 1XGIA 1K55C 3P98A 5HW3A 3N8SA 4PM9A 5DF8A 4RA7A 1LL5A 3UPPA 1EROA 3BEBA 4P85A 2ZQDA 4OONA 4X53A 2BG1A 3BFDA 4N1HA 1CEGA 1XX2A 3SS3A 3Q7VB 5FASA 1ESUA 1WYBA 5EECA 5A91A 2ZMAA 3HBRA 1NZOA 4OVDA 2UWXA 4QJGA 2RCXA 5A90A 4GDBA 4IVKA 5GHXA 5TR7A 4FSFA 4ZJ3A 3MZDA 1PWCA 4RYEA 4X68A 1KGEA 2J9OA 1KGGA 2ZC6B 3PBQA 1K54C 2EX6A 3G2ZA 2IWBA 2EX9A 5BOHA 1PYYA 3A3EA 3V39A 1K54A 3NCKA 4GNUA 2Y2PA 1O7EA 5FI7A 5HAIA 3PBTA 3G30A 5E43A 2XD1A 2Z2MB 1BT5A 2ZM2A 3HLDA 4B4ZA 4C3QA 5HAPA 3FWLA 4GD8A 5FQ9A 5GLAA 2XFSA 4XUZA 2Z2LB 4P0MA 4Y7PA 3ZGAB 5FAQA 1GHMA 2ZQ7A 4N9KA 1PI5A 3NY4A 1DJCA 4QU3A 2JCHA 4KZ6A 1YQSA 1WYCA 4JXVA 4R3JA 1KE0A 1E4DA 3A3JA 4JLFA 3UPNA 1ZG6A 1AXBA 4WZ5A 5FAOA 5EVIC 1FSYA 1K56D 4N1XA 3HLWA 3LO7A 5EVIA 5M19A 3IWQA 4JXGA 1GA9A 4KZAA 5F1GA 5J8XA 1E3UD 3OPPA 1KDSA 2HDQA 3A3FA 3SOIA 2WGWA 3UE0A 2R9XA 3FKWA 1JWZA 1K25A 2Y2KA 3V3SA 1SDNA 1U60A 1YLYA 4ZAMA 3WRTA 3G4PA 4X55A 2XEPA 2Y2IA 3HLBA 4XUXA 3WS0A 2P9VA 3WS4A 4D2OA 5L2FA 4OOYA 2X71A 2ZD8A 3VSLA 3C5AA 5CRFA 4E6WA 1BSGA 2H0TA 4BLMA 3HREA 1N4OA 2HP9A 5FI2A 5GHZA 4S2KA 3MKEA 4WEJA 4OLGA 3QHYA 1EI5A 4S2JA 2ZQ8A 3CZDA 3ISGA 3DW0A 4DDSA 1IEMA 3VFHA 3ZDJA 3M6HA 4MEZA 5KSHA 1Y54A 2XH9A 1K4FA 2WZZA 1ZKJA 1JTDA 1YLPA 2EFUA 4OPYA 5EPHA 4ZJ2A 4BL2A 4F94A 2WADA 4QHCA 5F82A 2IWDA 2OLUA 4BL3A 1IYQA 5CGWA 5FATA 3EQVA 3IH9A 5CEBA 2JE5A 4JPMA 4OH0A 3W4QA 4BQMA 3UE3A 3UNWA 1QMFA 3G2YA 1PZOA 1PWDA 3IHAA 3P09A 1ONHA 4GKUA 2EXAA 2CC1A 5M1AA 1XA1A 1CEFA 1NJ4A 5CTMA 2JBFA 2EFXA 3IXHA 1PI4A 4GN2A 5KZHA 3PBOA 4C6YA 1RGYA 3UN7A 2FFYA 1PW1A 2WZXA 1GA0A 5D3OA 4GZBA 4WMCA 5KSCA 3AGFA 4KZ9A 1BTLA 4UA6A 3G31A 4U3TA 4OOMA 4OPRA 3E2LA 3DWZA 1RGZA 3OC2A 3M2KA 4KZ5A 3UDXA 4S2OA 2Y2JA 2J7VA 1SHVA 4LV0A 1BLHA 3ITAA 1HD8A 4MBKA 2Y2NA 3ZHHA 5CXWA 3S22A 5JYPA 3OPLA 5FQJA 3WS2A 1CI9A 2X01A 5F1FA 3LCEA 2JC7A 2E8IA 2HP5A 3M2JA 4PM8A 5AQ9A 4OQ0A 3ZVTA 4JXSA 5GLBA 1I2SA 3VP4A 3BLSA 1ES4A 4EUZA 4IVIA 1LI0A 1M40A 2WKIA 1NY0A 3SH9A 3PAEA 1MWTA 4BD1A 5A93A 3V50A 1L0DA 2RL3A 2P74A 1ALQA 3D4FA 2Y2LA 4WYYA 2A49A 3JYIA 1ERMA 2Y2MA 1IYPA 3BRMA 3SH8A 4KG2A 3N6IA 3OCLA 2QMIA 4KG6A 4ZBEA 3W4PA 4S2IA 1G6AA 1Z6FA 4Y0TA 4DF6A 3TOIA 3TSGA 4Y0OA 2DCFA 4DE1A 3UE1A 1FCOA 1NYYA 4PM5A 1MPLA 3IF6A 3GSGA 4U0TA 4MLLA 4N9LA 4RX2A 3EQUA 5GLDA 1MKIA 2Y2OA 4KQRA 3TG9A 1DJBA 4WZ5C 1ES2A 2WGIA 3C4PA 4UA7A 4JF6A 4O7DA 4XXRA 1GCEA 5FQQA 2ZJ9A 2C6WB 1ZG4A 3B3XA 3LY4A 2WUQA 1BLSA 3BLMA 4OPZA 1H8ZA 1W8QA 2VGJA 3ZNTA 3ZG7B 2Y2QA 2XR0A 3Q81A 1XXMA 1G68A 4E3MA 4JKTA 1I2WA 1E25A 1FCNA 1W79A 1YLZA 3QNBA 3UDFA 4X69A 3IT9A 5E2FA 3PAGA
chains in the Genus database with same CATH superfamily
2W0NA 3C7UA 3MF0A 3V3RA 5L07A 1VEUB 1ONGA 2A2LA 3KO3A 2GNXA 3ZNYA 3E2KA 3G34A 2QZ6A 4PM7A 4LV1A 3GMWA 5EFWA 1FSWA 4LRYC 1KDWA 4MMNA 1MWSA 1BUEA 2WKHA 2Y4AA 5AVEA 4IUHA 5CHJA 3SW1A 2UV0E 2HDSA 1LL9A 1ESIA 5E2GA 1W63Q 5DTSA 4NETA 2IWCA 3MZEA 2PR5A 4FCFA 1BULA 3NECA 4OP8A 4Y2FA 2PYRA 1YSPA 3ZCZA 5KMWA 4AFIA 4GD6A 4EV4A 4PPRA 1YMXA 4LCLA 3Q7VA 3NBLA 2XRNA 2Y2HA 4EBNA 3KSGA 4P6ZS 4N92A 3B33A 2ZQ9A 5G18A 2PDRA 3LIFA 2XK1A 5A92A 5EUAA 3AGEA 3LMTA 3S7PA 1OJGA 1YT4A 1V9YA 3LEZA 4HBUA 4EWFA 2V2FF 4EU0A 4E6XA 3N8RA 4WEKA 1DP9A 5CEDA 4B88A 3K2NA 1KVMA 1S67L 3OZHA 4DXCA 5AQAA 2WKEA 3A3DA 4KZ7A 4EBLA 1IYSA 3HLCA 2A3UA 2ZLYA 2ZOIA 3ITBA 4MBHA 4LENA 1WE4A 3HUMA 2J8YA 4FD8A 5F83A 2VGKA 2A24B 3CHWP 3VP1A 3NC8A 4FH4A 2QHKA 3SH7A 4E3NA 3DBAA 3F1NA 3U2AA 5IS1A 2OLVA 3VSKA 5LBRA 5DF9A 2WGVA 4R6LA 3PBSA 5E2EA 4A5RA 5L09A 1VQQA 1RCJA 4ID4A 3BWLA 4Q8IA 1N9NA 4RRLA 3IH8A 5C5KA 3C4OA 3HLFA 3T4JA 5DF7A 5IU1A 1MWRA 5HFOA 1TEMA 1IFQA 4I38A 3M6BA 1JWVA 2ZL1B 3ZG9B 5MC7A 3KYEA 2PD8A 1YKDA 4GB7A 1MXOA 2R9WA 1HZOA 2FFFB 2XDMA 1DRMA 4KZ4A 1GHPA 2B95A 4K0XA 4OQGA 5TFQA 2VGLM 4HH2A 3RXWA 1NRFA 4NXFA 1J9MA 3UO9A 3LIDA 3MFDA 4K0WA 4ZRRA 4HESA 5IHVA 4HI4A 3V5MA 3KOCA 3U4LP 5HARA 4H8RA 3NDEA 5J7EA 3UPOA 3N8LA 3QP1A 1GHIA 1SKOB 4F3LA 3TE8A 1JTGA 4FTXA 3GVBA 1K6SA 1K56A 1TS0A 4JF5A 3G6OA 3JVVA 3BECA 1NZUA 2QJ5A 4WUJA 2GDNA 1DJAA 4RRBA 4KG5A 3H7WB 3LY3A 3SZTA 3KNFA 3HJIA 3F1PB 4RA7A 1LL5A 4P85A 2ZQDA 1CEGA 2VJWA 3SS3A 5FASA 2XROA 3KX0X 4EW7A 4IVKA 3T12B 4IUKA 2L4RA 1BYWA 2W3FA 3MJQA 2IWBA 5BOHA 1T19A 3V39A 4GNUA 1VEUA 1O7EA 5FI7A 5HAIA 3PBTA 2ZBBA 4RRDA 5HAPA 4HJ4A 4P0MA 2O99A 4N9KA 5HD5A 3MMHA 4JLFA 5FAOA 2OOLA 4N1XA 1T1AA 3HLWA 3LO7A 1CF0A 3KODA 4KZAA 3QP6A 3KO4A 3SOIA 3UE0A 4LGWA 4M4XA 2Y2KA 1SDNA 1U60A 4JGQA 2ZOHA 3VSLA 3C5AA 2VV8A 2H0TA 1J7GA 1ZTUA 3CZDA 2QWSA 2VX8A 1Y54A 2XH9A 2WZZA 2EFUA 4PKYA 4OPYA 5FL3A 5DKKA 4F94A 2WADA 2VEAA 2VKSA 3QP8A 4S0JA 2VGLS 3UNWA 4MN6A 5HDDA 2Z6DA 1PWDA 1ONHA 5CTMA 5KZHA 3PBOA 1RGYA 4R70A 4X1MA 2PYPA 5EV0A 2HL0A 4U3TA 1ZHHB 3E2LA 1UWPX 3M2KA 2Y2JA 2J7VA 4LV0A 2J3TC 1TS6A 2A24A 5KIZA 4Y13A 4HOIA 4PHTA 3S22A 5JYPA 3UB6A 3OPLA 4GHIB 1CI9A 3CWFA 2JC7A 2W1RA 3PXPA 2E8IA 3M2JA 2VLGA 4G3KA 4EUVA 2HJ9C 4BBUA 1I2SA 1XFQA 4EUZA 4IVIA 1M40A 1P9RA 3PAEA 4BD1A 2RL3A 3LR5A 3D4FA 2Y2LA 1OTAA 3BRMA 3SH8A 3N6IA 3OCLA 1G6AA 1Z6FA 3TSGA 3BY8A 2HGVA 3L9KA 4IHQA 4N9LA 4DN0A 2V8CA 2Y2OA 4KQRA 3LIBA 4WZ5C 3C4PA 2ZL1A 3E4QA 3B3XA 3BLMA 4OPZA 1OTEA 1H8ZA 1OTDA 3ZNTA 1XXMA 1FCNA 3V67A 3PAGA 1W5DA 3Q07A 3OOVA 4ME4A 3IQAA 3QP5A 3C30A 4WELA 4WZ4A 3EGXC 3MBZA 3KSHA 5HPIA 1S1YA 5FI6A 1MWUA 1IELA 3PTEA 3PD5A 1EWZA 1SKOA 3T1XA 3T4KA 3CUEC 4R23A 5EVIB 4IBXA 4QY5A 2V20A 5CGXA 1GSVA 3VP0A 2WGWB 1FILA 4OKPA 5EOOA 3FPWA 5FSRA 5CECA 3H7WA 3IXGA 4WBGA 4DRTA 3F1PA 2WKPA 2E8JA 3W2ZA 3VOLA 4EQIA 3UDIA 4KZ3A 4Q0JA 3ULFA 1XGJA 4PAUA 1IYOA 5DVAA 4UAAA 1ES5A 2WAEA 3H82B 3VV4A 4ESPA 1W7FA 1XA7A 2W3HA 1K38A 3T4TA 4LFUA 5FQMA 2HDRA 1XKZA 3MKFA 2KLIA 4KZ8A 4O8GA 3S4XA 3HLGA 3WS5A 2BASA 2J3WA 5EVEA 1LLBA 4YINA 1SKFA 1M6KA 4I39A 4E3IA 4WN5A 1LSXA 4X56A 1I5QA 5M18A 3R7WB 3IF6C 4CQHA 2ZM0A 4FUWA 4S03A 4BENA 3LIEA 1H8MA 2DNSA 3MXRA 4MNRA 3T4QA 2GJ3A 3UB5P 1IKGA 3KYZA 3C7VA 3MXQA 2W3DA 1FQGA 4OQHA 4I3JA 5AVFA 3VOYA 1RP5A 1PW8A 1SDEA 4IEDA 1K4EA 2OV5A 1K0KA 4Y0UA 2KX6A 4DE3A 1FR1A 2J3TD 3HUNA 4U0XA 3C8CA 4Y5FA 2K2NA 5HAQA 1TDLA 2HP6A 4I3IA 3WWXA 5I94A 1YLWA 1T18A 3UMDA 2PAVP 5HSQA 2ZC4B 3O3VA 3DTMA 4O0PA 1KE4A 4EQ1A 1N9LA 3IWOA 4HIAA 3OLOA 2WAFA 2HZ5A 3MFXA 3O87A 4I3AA 2PRFA 3CLOA 3FKVA 5J4EA 1O07A 3AGDA 1DY6A 3Q7ZA 2EX2A 3BYDA 1W8YA 4OOLA 3W4OA 4GHIA 3IXBA 1NLZA 4DJ3A 2V0UA 4Z9QA 4X6TA 4HJ6A 4HP4A 4S2MA 4S0LA 5L10A 1NYMA 2P7JA 2FZ0A 2V9AA 4E3JA 2H10A 1IKIA 1QMEA 3GTCA 4RRIA 4FH2A 3MXSA 4O01A 3K3CA 4EETB 2Y79A 5TGFA 3G32A 3GDIA 4QWOA 3K3DA 4K08A 3Q1FA 3LR0A 5HW3A 4PM9A 4RR8A 5DF8A 4RRQA 3TW8A 3UPPA 4OONA 2BG1A 1UWNX 4L9EA 5IT5A 1XJ4A 1ESUA 1WYBA 5EECA 5A91A 1OTIA 1NZOA 2RCXA 4FSFA 4RYEA 1KGEA 3PBQA 3LIAA 3E0YA 4YOFA 3A3EA 3C2WA 4B9OA 1F98A 3C38A 3HLDA 4B4ZA 5FQ9A 4XUZA 2Z2LB 4Y7PA 2ZQ7A 3NY4A 5DFXA 5DJTA 4ETXA 2D02A 1XFNA 4R3JA 4JXVA 3PYPA 4HQAA 3NOTC 5EVIC 4KUOA 3MSHA 5TJJA 4R38A 1XJ2A 5EVIA 3DTIA 3IWQA 4Q0HA 5J8XA 2LB9A 3EGDC 3OPPA 2O9CA 2ACGA 2WGWA 2PR6A 2O9AA 1JWZA 1K25A 3V3SA 2L1MA 1YLYA 5K5BA 3G4PA 4RRHA 3WS0A 2HKZA 2ZD8A 3LR3A 3KSIA 1AWIA 5CRFA 5HWTA 1N4OA 3DTKA 5FI2A 4S2KA 3MKEA 3QHYA 5FEFA 2V1AA 1EI5A 3JVUA 2ZQ8A 3QP4A 3H82A 4WL9A 4DDSA 3M6HA 5KSHA 4X25A 5G4YA 2W27A 4BL2A 5AJGA 4QHCA 5F82A 2OLUA 4WLAA 4L9GA 5CGWA 5I5LA 1VETB 5CEBA 4JPMA 4RRJA 4FOFA 3IHAA 2HJEA 1OT6A 5M1AA 4UQIM 2GX5A 2JBFA 4C6YA 3KOBA 5KSCA 4KZ9A 1BTLA 4G3WA 3R7WA 4OOMA 3KO5A 1RGZA 4KZ5A 2PD7A 1BLHA 5FQJA 3FG8A 3LCEA 2PT7A 5AQ9A 3ZVTA 3T4OA 3VP4A 3BLSA 2K31A 4DMZA 1LI0A 3EEHA 5A93A 3V50A 1L0DA 2P74A 3IS2B 4WYYA 1G6OA 4KG6A 1IOUA 4Y0TA 3TOIA 2V8FA 4Y0OA 2DCFA 2HL1A 4MN7A 5J61A 3LI8A 3CAXA 4DJ2A 3TG9A 3MS6A 4UA7A 4RRGA 4O7DA 4XXRA 1GCEA 1H3QA 5FQQA 2C6WB 1ZG4A 4S0KA 3UMEA 2VGJA 3ZG7B 1G68A 5DKLA 3EWKA 1E25A 4X69A 1W63M 3IT9A 1UGUA 2D01A 3VMAA 3MQQA 2B5RA 5HZHA 2QPNA 1FR6A 3IX8A 4BJPA 1BLPA 3UY6A 4PMAA 3LICA 1G5UA 2OKVA 2L0WA 1C3BA 4C75A 3ZQ5A 3OPHA 4HH3A 4B4XA 1H5XA 5DJUA 2XLNA 3UB7A 2PBDP 4E3KA 4CLCD 1OTBA 3FV7A 2W3EA 2EA9A 1OPXA 4KZBA 5FA7A 3D3OA 3PD2A 4R3AA 2WYXA 4PKYG 5A8BA 2P9VB 2XFTA 2J9PA 1CI8A 3IBRA 4PM6A 5EOEA 1LHYA 1MBLA 1Z09A 4ZTKA 5EVID 4UQIS 1KGFA 4EESA 3O86A 2XD5A 1H0MA 3O88A 4JXWA 1STZA 1N9OA 3GV9A 4E3LA 2XF3A 1TVFA 1T1BA 1ZC2A 3FYZA 5GLCA 3BFEA 1KE3A 2O9BA 3O5YA 1LI9A 4ZDXA 2Q9NA 4EEUA 4RRMA 1GSXA 4RX3A 1S0WA 4IBRA 3KSFA 1E3UA 2ZM8A 3BY9A 1S4SA 2Y59A 3LYXA 3W8KA 4EXOA 2ZMFA 2JKTM 2K7SA 4DKIA 2G2WA 3S7NA 5GHYA 1K55A 1TF1A 4NXBA 5F6AA 3VOZA 4RR7A 2ZC7A 4R4SA 1VM1A 1S1ZA 2Q9MA 3KO7A 3CMZA 4OP5A 2XSSA 4BD0A 3NOUC 1OJ5A 1BZAA 2Y91A 2H0YA 5FQIA 4MBFA 3VP3A 4JF4A 3T1RA 1S66L 4K91A 3D9YA 3G35A 4GLQA 1FCMA 1V9ZA 3IF5A 2QKPA 1HTZA 2B02A 1L0FA 2ZQCA 3N7WA 3DAVA 2DRWA 2QYBA 1XPBA 4YWZA 4GDNA 1Q2PA 3LFVA 4EBPA 4EEPA 1PIOA 5F68A 5FDSA 4R4RA 2ZC5B 1L0GA 1VETA 4KENB 4CLCE 4OLDA 4CLCB 3SS4A 4RRAA 1SZVA 3ZVWA 1XJ6A 3F1OB 3BM6A 3CJMA 5FDHA 5CHMA 3VFFA 2Y55A 5EM0A 4JGRA 4HY8A 4M3KA 4GS9B 3HVFA 5CHUA 3A0RA 2WKRA 4HEFA 3PBNA 2FH5A 4DE0A 4II7A 4MDZA 4D60A 2H28A 2XQZA 2G2UA 5DFYA 3NIAA 1YLJA 2EWWA 5AQBA 3OCNA 1WA9A 3EOIA 4DXBA 4NXGA 2VA0A 3IS2A 5HDCA 4UA9A 1F9IA 2NUPC 1L0EA 3LEQA 2JKGA 2W3GA 2VV6A 3B42A 4GOGA 4LCMA 3RXXA 3E4OA 1H8YA 4RVAA 2JKFA 3MR0A 4YFMA 1S6RA 4NK3A 4S2LA 4R1GA 3P98A 3OBFA 1ACFA 1EROA 2KOIA 3BFDA 4N1HA 3B47A 3NULA 3HBRA 2UWXA 5A90A 4GDBA 5GHXA 1XJ3A 1PWCA 1NRJA 2J9OA 3G2ZA 3A0SA 2IA2A 4LPZA 4EERA 2Y2PA 5E43A 2Z2MB 2ZM2A 4S0IA 4C3QA 5GLAA 2XFSA 1PI5A 2YKFA 1DJCA 4QU3A 2JCHA 4KZ6A 4BWIA 4GJ4A 1WYCA 3LMVA 2P04A 1E4DA 3T50A 3UPNA 1NLYA 1AXBA 2M7VA 5M19A 5F1GA 1E3UD 4H6JB 1KDSA 2M7UA 3KYQA 3CITA 3MQOA 3FKWA 4MN5A 4ZAMA 3WRTA 3ZYTA 2Q0OA 4X55A 1VHMA 3HLBA 2P9VA 3WS4A 4D2OA 5L2FA 2G7UA 3UB8A 4E6WA 4BLMA 4WEJA 2JKRM 4OLGA 3P01A 1T1CA 3IX4A 1IEMA 3VFHA 4HNBA 3S7QA 2HF6A 1JTDA 1YLPA 4ZJ2A 2IWDA 1LT0A 1LL8A 5FATA 3EQVA 1HLUP 2YKHA 2JE5A 4OH0A 2EWVA 4BQMA 1D06A 3TRCA 1PZOA 2EXAA 2CC1A 1YSQA 5EM1A 1PI4A 4GN2A 1P0ZA 1PW1A 2WZXA 4GZBA 4WMCA 4NEED 1PFLA 1MZUA 4NXEA 1Y4OA 3LGOA 3ITAA 3ZHHA 2WKQA 5HWWA 3KNPA 2X01A 2HP5A 1F2KA 1MWTA 3A0VA 4RR9A 1ALQA 2Y2MA 4RRRA 1IYPA 4IJGA 3S7OA 3T4SA 4YNRA 4ZBEA 3W4PA 4DF6A 3RFBA 1DP8A 2XA7S 4CLCC 3UE1A 1FCOA 4PM5A 1MPLA 4CLCA 3CPTB 3NOPC 3GSGA 4U0TA 4MLLA 3F1OA 2VV7A 1ES2A 2WGIA 4JF6A 1GSWA 2WUQA 1BLSA 2JN7A 2J80A 5F69A 4GS9A 2Y2QA 2XR0A 3E4PA 2Z6CA 3Q81A 1EW0A 2OWJA 4JKTA 3QNBA 1YLZA 4GCZA 3H9WA 1CJFA 3CI6A 4B93A 1TC5A 5E2FA 1ES3A 1NXYA 4QY6A 3ICYA 4JBFA 4BMWA 2V0WA 3IXDA 4WM9A 3PBRA 3BFFA 1JVJA 5HDSA 1XP4A 2ZC3B 3GECA 4WF0A 5TBMB 3HJKA 4CPKA 5HL6A 1K6RA 2V1ZA 4R3BA 4NBJA 2H5SA 4ARZB 2NUTC 3T1SA 3I7JA 3BFGA 3N4IA 3RJUA 3VP2A 4HP9A 2KDKA 3R4KA 2I72A 4MCWA 4KQOA 1FOFA 4L0LA 2PU2A 1TDGA 1D1JA 1MKMA 2W1TB 1MY8A 1L2SA 3NI9A 2DMWA 3BJNA 3A3IA 1OMEA 1JWPA 4Z1WA 2PBYA 1J3WA 4S02A 2LB5A 3MZFA 1PZPA 4LV3A 4OPQA 5CERA 3QP2A 1TS8A 3KO6A 4R0QA 3HUOA 2AVXA 1JKEA 5GL9A 4DDYA 4E04A 2EX8A 3IBJA 3VE4A 1YMSA 4KQQA 3UB9A 5FEGA 2HV1A 2XGNA 5HL1A 5EE8A 3HL9A 5CTNA 1MC0A 1P9WA 2BLSA 1K57C 1TS7A 2PU4A 1BLCA 5HX9A 1K57A 4H6JA 2CMNA 5DTKA 2OSUA 4ZJ1A 5FAPA 1YLTA 1FIKA 4UHUA 3IX3A 1KVLA 4JGOA 5U47A 4WMCD 3HLEA 3BW6A 4XT2B 4OQIA 3NDGA 3CG5A 3PD4A 1ODVA 2DBOA 4KQDA 3HCYA 4CJNA 1SCWA 3IHBA 3NJAA 4DE2A 4S2PA 3E98A 3WRZA 4HBTA 1LSWA 5L8MA 2JKTI 3IWIA 3D72A 5HWVA 3GRJA 1YM1A 5EVLA 2WK0A 3LI9A 1CK3A 4LLOB 5CX7A 3WS1A 4S2NC 5FQKA 3IF6B 4QB8A 1VB6A 3OPRA 4S2NA 3GR2A 3ZFZA 2Y2GA 3GQZA 5E2HA 5HD3A 3LR4A 3QNCA 1PWGA 3SS5A 3ZG0A 1X0OA 5DTTA 3ZG5A 4NKPA 1JNUA 3DWKA 3L7HA 4Y3IA 2HDUA 3KO9A 2PHYA 1G28A 4P87A 2R78A 1P97A 4LV2A 5CGSA 1N9BA 5JYOA 3LMUA 4Y17A 1HVBA 2EXBA 4UEYA 1A0KA 1PRQA 3Q82A 1Q2QA 5AQ7A 2VZWA 4E3OA 1PNEA 3BFCA 3FZCA 4ETZA 2C5WB 2X02A 3ZG8B 1ERQA 2ZQAA 4QD4A 4P6BA 3CPTA 2HPBA 2VK3A 4NG2A 1CQAA 2OAP1 3S1YA 1XGIA 1Y2QA 1K55C 3N8SA 3UE6A 2QJ7A 3BEBA 1Y28A 4GW9A 4X53A 1XX2A 4LRXC 2HL2A 3Q7VB 2ZMAA 4QJGA 4OVDA 5TR7A 4ZJ3A 3MZDA 2GZAA 2O0YA 4NBIA 2ZMVA 4X68A 2ZC6B 1KGGA 1K54C 2EX6A 2EX9A 4RR6A 1OT9A 1PYYA 1K54A 3NCKA 3G30A 3PD3A 2XD1A 1BT5A 4BBVA 3FWLA 3FPVA 4GD8A 3ZGAB 5FAQA 1GHMA 5TBMA 1YQSA 1KE0A 3A3JA 1ZG6A 4ARZA 4L9FA 2JHEA 4WZ5A 1FSYA 1K56D 4JXGA 1GA9A 4G3VA 2OWHA 1S4RA 2HDQA 3A3FA 2R9XA 4Y15A 3MQ0A 2XEPA 2Y2IA 4HJ3A 4LRZE 4XUXA 2W1TA 4OOYA 2X71A 1BSGA 3F1NB 3HREA 3T4LA 2HP9A 5GHZA 4Q0IA 4RRCA 2M1CA 1YAXA 4S2JA 4RRFA 3ISGA 3JPUA 3DW0A 1YPRA 3ZDJA 3NHQA 4QPRA 4MEZA 1K4FA 1ZKJA 5EPHA 1NWZA 3PHYA 2INWA 1IYQA 4BL3A 3CUEA 4BBTA 2I9VA 3IH9A 3W4QA 5HPFA 3UE3A 3RH8B 1QMFA 1D7EA 3DTEA 3G2YA 5F5YA 3P09A 4GKUA 2OAQ1 1XA1A 1CEFA 1NJ4A 2Y8HA 2EFXA 3IXHA 4P6ZM 3UN7A 2FFYA 4I5SA 3TJZC 1GA0A 5D3OA 3T1QB 3AGFA 4UA6A 3G31A 4OPRA 4RRKA 3DWZA 3OC2A 3UDXA 2B18A 4S2OA 1SHVA 2JKRI 3LUQA 1HD8A 1TD5A 4MBKA 2Y2NA 3VE3A 5CXWA 3WS2A 5F1FA 5G4ZA 4PM8A 4OQ0A 4JXSA 4X1LA 5GLBA 4RQ9A 4HHDA 1ES4A 4XT2A 3PR6A 2WKIA 1NY0A 3SH9A 2V1BA 2XA7M 2A49A 3JYIA 1ERMA 3RTYA 4KG2A 2QMIA 4F3LB 4S2IA 5J3WA 3BQAA 4DE1A 1NYYA 4KUKA 3IF6A 2MJ6A 4RX2A 3EQUA 2BTFP 1LSVA 5GLDA 1MKIA 3P7NA 1DJBA 1KOUA 1DP6A 3EEAA 3FC7A 2ZJ9A 3LY4A 4JGPA 2P08A 1W8QA 3BQ8A 4E3MA 1I2WA 1F5MA 1W79A 3UDFA 1L3LA
chains in the Genus database with same CATH topology
1W5DA 3VMAA 1ES3A 3Q07A 2B5RA 1NXYA 3C7UA 4QY6A 3V3RA 4JBFA 1ONGA 2QPNA 3IQAA 1FR6A 3ZNYA 3KO3A 3IXDA 4WM9A 3PBRA 4BJPA 1BLPA 3E2KA 4PMAA 3UY6A 3BFFA 1JVJA 3G34A 2QZ6A 4PM7A 1XP4A 2ZC3B 2OKVA 4LV1A 4WELA 1C3BA 4CPKA 3GMWA 1K6RA 4WZ4A 3MBZA 1FSWA 2V1ZA 4C75A 4R3BA 5FI6A 1MWUA 1IELA 3OPHA 3PTEA 3PD5A 1KDWA 4NBJA 1EWZA 1MWSA 2H5SA 4B4XA 1BUEA 2WKHA 2Y4AA 3I7JA 3BFGA 4R23A 1H5XA 5CHJA 3N4IA 2HDSA 2XLNA 1LL9A 1ESIA 5EVIB 4IBXA 5E2GA 3RJUA 3VP2A 4QY5A 2V20A 4E3KA 2I72A 5DTSA 5CGXA 4NETA 2IWCA 3FV7A 3MZEA 4KQOA 3VP0A 1FOFA 2WGWB 4OKPA 5EOOA 4FCFA 5FSRA 5CECA 4L0LA 3IXGA 1BULA 2PU2A 4KZBA 4OP8A 5FA7A 3PD2A 1TDGA 4WBGA 2WYXA 4DRTA 3ZCZA 5KMWA 4GD6A 2P9VB 2XFTA 4EQIA 2J9PA 1MY8A 3UDIA 4EV4A 1L2SA 3NI9A 1CI8A 4KZ3A 4PM6A 4PPRA 5EOEA 1LHYA 1MBLA 1YMXA 4LCLA 1XGJA 4ZTKA 5EVID 1IYOA 5DVAA 3Q7VA 3NBLA 2Y2HA 3A3IA 1KGFA 4UAAA 4EBNA 1ES5A 3O86A 2XD5A 2WAEA 3O88A 1OMEA 4JXWA 1JWPA 3GV9A 4N92A 4E3LA 2PBYA 2ZQ9A 1W7FA 5G18A 4S02A 2XK1A 2XF3A 1XA7A 1TVFA 1K38A 3MZFA 5A92A 1PZPA 5EUAA 1ZC2A 3AGEA 3FYZA 4LV3A 5GLCA 4OPQA 5CERA 3LMTA 3BFEA 5FQMA 1KE3A 4R0QA 1LI9A 3HUOA 4ZDXA 2Q9NA 2HDRA 1XKZA 3MKFA 4KZ8A 4RRMA 1JKEA 1YT4A 1S0WA 4IBRA 4RX3A 3HLGA 3S4XA 5GL9A 1E3UA 2ZM8A 3LEZA 3WS5A 4HBUA 4DDYA 4EWFA 2Y59A 2V2FF 2EX8A 3W8KA 1YMSA 3N8RA 4WEKA 1LLBA 4E6XA 4KQQA 4YINA 5CEDA 1SKFA 4DKIA 4B88A 1M6KA 2G2WA 1KVMA 3OZHA 5GHYA 4DXCA 2XGNA 1K55A 2WKEA 5AQAA 3A3DA 4KZ7A 3VOZA 5HL1A 4E3IA 5EE8A 4EBLA 4RR7A 1IYSA 2ZC7A 4R4SA 1VM1A 1I5QA 3HL9A 4X56A 5CTNA 5M18A 2BLSA 1K57C 2Q9MA 3HLCA 2PU4A 3IF6C 3KO7A 1BLCA 2A3UA 2ZM0A 3CMZA 5HX9A 4OP5A 1K57A 2ZLYA 4S03A 4BD0A 4BENA 5DTKA 3ITBA 4MBHA 4LENA 1WE4A 1BZAA 3HUMA 2DNSA 2J8YA 2Y91A 3MXRA 2H0YA 4FD8A 5F83A 2OSUA 2VGKA 4MBFA 4MNRA 5FQIA 4JF4A 4ZJ1A 3VP3A 3VP1A 5FAPA 1YLTA 1IKGA 4UHUA 4K91A 3C7VA 3NC8A 1FQGA 3G35A 4FH4A 4OQHA 1KVLA 3SH7A 1FCMA 5U47A 3VOYA 4WMCD 4E3NA 3HLEA 3IF5A 1HTZA 2OLVA 1RP5A 3VSKA 1L0FA 2ZQCA 3N7WA 4OQIA 3NDGA 3CG5A 1PW8A 2DRWA 5DF9A 1SDEA 4IEDA 3PD4A 1K4EA 2WGVA 2OV5A 3PBSA 1XPBA 2DBOA 4Y0UA 4DE3A 4CJNA 5E2EA 4GDNA 1FR1A 4A5RA 1Q2PA 1SCWA 3IHBA 4DE2A 4S2PA 4EBPA 1PIOA 1RCJA 1VQQA 3HUNA 3WRZA 4HBTA 4ID4A 4R4RA 4U0XA 2ZC5B 3IWIA 5HAQA 3GRJA 4Q8IA 1L0GA 1TDLA 1YM1A 2HP6A 3IH8A 3WWXA 4RRLA 5EVLA 5I94A 2WK0A 4KENB 1CK3A 1YLWA 3WS1A 3C4OA 3HLFA 4OLDA 4S2NC 5FQKA 3IF6B 5DF7A 4QB8A 3SS4A 4RRAA 3ZVWA 1MWRA 3OPRA 4S2NA 3BM6A 2ZC4B 3GR2A 3ZFZA 3O3VA 2Y2GA 3GQZA 5HFOA 3DTMA 5E2HA 1KE4A 1TEMA 3CJMA 5FDHA 3M6BA 5CHMA 3IWOA 3QNCA 1PWGA 1JWVA 3ZG9B 3VFFA 3SS5A 2Y55A 3ZG0A 4GB7A 5DTTA 3ZG5A 2WAFA 1MXOA 3O87A 2R9WA 4M3KA 1HZOA 3HVFA 2FFFB 2XDMA 3FKVA 5CHUA 1O07A 3DWKA 3AGDA 4HEFA 2HDUA 3KO9A 1DY6A 4KZ4A 3Q7ZA 4P87A 1GHPA 4K0XA 3PBNA 4OQGA 4LV2A 5CGSA 5TFQA 1N9BA 2EX2A 3BYDA 4DE0A 5JYOA 3LMUA 1W8YA 3RXWA 1HVBA 1NRFA 4OOLA 3W4OA 1J9MA 2XQZA 2EXBA 3UO9A 3MFDA 2G2UA 3NIAA 1YLJA 3Q82A 5AQBA 3IXBA 1Q2QA 4K0WA 3OCNA 4HESA 5AQ7A 5IHVA 4DXBA 4E3OA 4Z9QA 4X6TA 4S2MA 4S0LA 3BFCA 3V5MA 3KOCA 3FZCA 2C5WB 2X02A 1NYMA 4H8RA 3NDEA 4UA9A 5HARA 3ZG8B 3UPOA 1L0EA 3N8LA 1GHIA 4E3JA 2H10A 1IKIA 1QMEA 1ERQA 3GTCA 1JTGA 4RRIA 4GOGA 4FH2A 3GVBA 1K6SA 1K56A 3MXSA 4LCMA 2ZQAA 3RXXA 4QD4A 4JF5A 3BECA 1H8YA 1NZUA 5TGFA 3G32A 2GDNA 4P6BA 1DJAA 4RRBA 2HPBA 4KG5A 4RVAA 4YFMA 1S6RA 4NK3A 3Q1FA 4S2LA 4R1GA 3LY3A 3S1YA 1Y2QA 1XGIA 3KNFA 1K55C 3P98A 5HW3A 3N8SA 4PM9A 4RR8A 5DF8A 4RRQA 4RA7A 1LL5A 3UPPA 1EROA 3BEBA 4P85A 2ZQDA 4OONA 4X53A 2BG1A 3BFDA 4N1HA 1CEGA 1XX2A 3SS3A 2HL2A 3Q7VB 5FASA 1ESUA 1WYBA 5EECA 5A91A 2ZMAA 3HBRA 1NZOA 4OVDA 2UWXA 4QJGA 2RCXA 5A90A 4GDBA 4IVKA 5GHXA 5TR7A 4FSFA 4ZJ3A 3MZDA 4NBIA 1PWCA 4RYEA 4X68A 1KGEA 2J9OA 1KGGA 2ZC6B 3PBQA 1K54C 2EX6A 3G2ZA 2IWBA 2EX9A 5BOHA 4RR6A 1PYYA 3A3EA 3V39A 1K54A 3NCKA 4GNUA 2Y2PA 1O7EA 5FI7A 5HAIA 3PBTA 3G30A 5E43A 3PD3A 2XD1A 2Z2MB 1BT5A 2ZM2A 3HLDA 4B4ZA 4S0IA 4RRDA 4C3QA 5HAPA 3FWLA 4GD8A 5FQ9A 5GLAA 2XFSA 4XUZA 2Z2LB 4P0MA 4Y7PA 3ZGAB 5FAQA 1GHMA 2ZQ7A 4N9KA 1PI5A 3NY4A 1DJCA 4QU3A 2JCHA 4KZ6A 1YQSA 1WYCA 4JXVA 4R3JA 3LMVA 1KE0A 1E4DA 3A3JA 4JLFA 3UPNA 1ZG6A 1AXBA 4WZ5A 5FAOA 5EVIC 1FSYA 1K56D 4N1XA 3HLWA 3LO7A 5EVIA 3KODA 5M19A 3IWQA 4JXGA 1GA9A 4KZAA 5F1GA 5J8XA 1E3UD 3KO4A 3OPPA 1KDSA 2HDQA 3A3FA 3SOIA 2WGWA 3UE0A 2R9XA 3FKWA 1JWZA 1K25A 2Y2KA 3V3SA 1SDNA 1U60A 1YLYA 4ZAMA 3WRTA 3G4PA 4X55A 2XEPA 2Y2IA 3HLBA 4XUXA 3WS0A 2P9VA 3WS4A 4D2OA 5L2FA 4RRHA 2HKZA 4OOYA 2X71A 2ZD8A 3VSLA 3C5AA 5CRFA 4E6WA 1BSGA 2H0TA 4BLMA 3HREA 1N4OA 2HP9A 5FI2A 5GHZA 4S2KA 3MKEA 4WEJA 1J7GA 4RRCA 4OLGA 3QHYA 1EI5A 4S2JA 2ZQ8A 3CZDA 4RRFA 3ISGA 3DW0A 4DDSA 1IEMA 3VFHA 3ZDJA 3M6HA 4MEZA 5KSHA 1Y54A 2XH9A 1K4FA 2WZZA 1ZKJA 1JTDA 1YLPA 2EFUA 4OPYA 5EPHA 4ZJ2A 4BL2A 4F94A 2WADA 4QHCA 5F82A 2IWDA 2OLUA 4BL3A 1IYQA 5CGWA 5FATA 3EQVA 3IH9A 5CEBA 2JE5A 4JPMA 4OH0A 3W4QA 4BQMA 4S0JA 4RRJA 3UE3A 3UNWA 1QMFA 3G2YA 1PZOA 1PWDA 3IHAA 3P09A 1ONHA 4GKUA 2EXAA 2CC1A 5M1AA 1XA1A 1CEFA 1NJ4A 5CTMA 2JBFA 2EFXA 3IXHA 1PI4A 4GN2A 5KZHA 3PBOA 4C6YA 1RGYA 3UN7A 2FFYA 1PW1A 2WZXA 3KOBA 1GA0A 5D3OA 4GZBA 4WMCA 5KSCA 2HL0A 3AGFA 4KZ9A 1BTLA 4UA6A 3G31A 4U3TA 4OOMA 3KO5A 4OPRA 3E2LA 3DWZA 4RRKA 1RGZA 3OC2A 3M2KA 4KZ5A 3UDXA 4S2OA 2Y2JA 2J7VA 1SHVA 4LV0A 1BLHA 3ITAA 1HD8A 4MBKA 2Y2NA 3ZHHA 5CXWA 3S22A 5JYPA 3OPLA 5FQJA 3WS2A 1CI9A 2X01A 3KNPA 5F1FA 3LCEA 2JC7A 2E8IA 2HP5A 3M2JA 4PM8A 5AQ9A 4OQ0A 3ZVTA 4JXSA 5GLBA 1I2SA 3VP4A 3BLSA 1ES4A 4EUZA 4IVIA 1LI0A 1M40A 2WKIA 1NY0A 3SH9A 3PAEA 1MWTA 4BD1A 5A93A 3V50A 1L0DA 4RR9A 2RL3A 2P74A 1ALQA 3D4FA 2Y2LA 4WYYA 2A49A 3JYIA 1ERMA 2Y2MA 4RRRA 1IYPA 3BRMA 3SH8A 4KG2A 3N6IA 3OCLA 2QMIA 4KG6A 4ZBEA 3W4PA 4S2IA 1G6AA 1Z6FA 4Y0TA 4DF6A 3TOIA 3TSGA 4Y0OA 2DCFA 2HL1A 4DE1A 3UE1A 1FCOA 1NYYA 4PM5A 5J61A 1MPLA 3IF6A 3GSGA 4U0TA 4MLLA 4N9LA 4RX2A 3EQUA 5GLDA 1MKIA 2Y2OA 4KQRA 3TG9A 1DJBA 4WZ5C 1ES2A 2WGIA 3C4PA 4UA7A 4RRGA 4JF6A 4O7DA 4XXRA 1GCEA 5FQQA 2ZJ9A 2C6WB 1ZG4A 3B3XA 3LY4A 2WUQA 1BLSA 3BLMA 4S0KA 4OPZA 1H8ZA 1W8QA 2VGJA 3ZNTA 3ZG7B 2Y2QA 2XR0A 3Q81A 1XXMA 1G68A 4E3MA 4JKTA 1I2WA 1E25A 1FCNA 1W79A 1YLZA 3QNBA 3UDFA 4X69A 3IT9A 1TC5A 5E2FA 3PAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W5D A;  3VMA A;  1ES3 A;  3Q07 A;  2B5R A;  1NXY A;  3C7U A;  4QY6 A;  3V3R A;  4JBF A;  1ONG A;  2QPN A;  3IQA A;  1FR6 A;  3ZNY A;  3IXD A;  4WM9 A;  3PBR A;  4BJP A;  1BLP A;  3E2K A;  4PMA A;  3UY6 A;  3BFF A;  1JVJ A;  3G34 A;  2QZ6 A;  4PM7 A;  1XP4 A;  2ZC3 B;  4LV1 A;  4WEL A;  1C3B A;  4CPK A;  3GMW A;  1K6R A;  4WZ4 A;  3MBZ A;  1FSW A;  2V1Z A;  4C75 A;  4R3B A;  5FI6 A;  1MWU A;  1IEL A;  3OPH A;  3PTE A;  1KDW A;  1EWZ A;  1MWS A;  2H5S A;  4B4X A;  1BUE A;  2WKH A;  2Y4A A;  3I7J A;  3BFG A;  4R23 A;  1H5X A;  5CHJ A;  3N4I A;  2HDS A;  2XLN A;  1LL9 A;  1ESI A;  5EVI B;  4IBX A;  5E2G A;  3RJU A;  3VP2 A;  4QY5 A;  2V20 A;  4E3K A;  2I72 A;  5DTS A;  5CGX A;  4NET A;  2IWC A;  3FV7 A;  3MZE A;  4KQO A;  3VP0 A;  1FOF A;  2WGW B;  4OKP A;  5EOO A;  4FCF A;  5FSR A;  5CEC A;  4L0L A;  3IXG A;  1BUL A;  2PU2 A;  4KZB A;  4OP8 A;  5FA7 A;  1TDG A;  4WBG A;  2WYX A;  4DRT A;  3ZCZ A;  5KMW A;  4GD6 A;  2P9V B;  2XFT A;  4EQI A;  2J9P A;  1MY8 A;  3UDI A;  4EV4 A;  1L2S A;  3NI9 A;  1CI8 A;  4KZ3 A;  4PM6 A;  4PPR A;  5EOE A;  1LHY A;  1MBL A;  1YMX A;  4LCL A;  1XGJ A;  4ZTK A;  5EVI D;  1IYO A;  5DVA A;  3Q7V A;  3NBL A;  2Y2H A;  3A3I A;  1KGF A;  4UAA A;  4EBN A;  1ES5 A;  3O86 A;  2XD5 A;  2WAE A;  3O88 A;  1OME A;  4JXW A;  1JWP A;  3GV9 A;  4N92 A;  4E3L A;  2PBY A;  2ZQ9 A;  1W7F A;  5G18 A;  2XK1 A;  2XF3 A;  1XA7 A;  1TVF A;  1K38 A;  3MZF A;  5A92 A;  1PZP A;  5EUA A;  1ZC2 A;  3AGE A;  3FYZ A;  4LV3 A;  5GLC A;  4OPQ A;  5CER A;  3BFE A;  5FQM A;  1KE3 A;  4R0Q A;  1LI9 A;  3HUO A;  4ZDX A;  2Q9N A;  2HDR A;  1XKZ A;  3MKF A;  4KZ8 A;  1YT4 A;  1S0W A;  4IBR A;  4RX3 A;  3HLG A;  3S4X A;  5GL9 A;  1E3U A;  2ZM8 A;  3LEZ A;  3WS5 A;  4HBU A;  4DDY A;  4EWF A;  2Y59 A;  2V2F F;  2EX8 A;  3W8K A;  1YMS A;  3N8R A;  4WEK A;  1LLB A;  4E6X A;  4KQQ A;  4YIN A;  5CED A;  1SKF A;  4DKI A;  4B88 A;  1M6K A;  2G2W A;  1KVM A;  3OZH A;  5GHY A;  4DXC A;  2XGN A;  1K55 A;  2WKE A;  5AQA A;  3A3D A;  4KZ7 A;  3VOZ A;  5HL1 A;  4E3I A;  5EE8 A;  4EBL A;  1IYS A;  2ZC7 A;  4R4S A;  1VM1 A;  1I5Q A;  3HL9 A;  4X56 A;  5CTN A;  5M18 A;  2BLS A;  1K57 C;  2Q9M A;  3HLC A;  2PU4 A;  3IF6 C;  1BLC A;  2A3U A;  2ZM0 A;  3CMZ A;  5HX9 A;  4OP5 A;  1K57 A;  2ZLY A;  4BD0 A;  4BEN A;  5DTK A;  3ITB A;  4MBH A;  4LEN A;  1WE4 A;  1BZA A;  3HUM A;  2DNS A;  2J8Y A;  2Y91 A;  3MXR A;  2H0Y A;  4FD8 A;  5F83 A;  2OSU A;  2VGK A;  4MBF A;  4MNR A;  5FQI A;  4JF4 A;  4ZJ1 A;  3VP3 A;  3VP1 A;  5FAP A;  1YLT A;  1IKG A;  4UHU A;  4K91 A;  3C7V A;  3NC8 A;  1FQG A;  3G35 A;  4FH4 A;  4OQH A;  1KVL A;  3SH7 A;  1FCM A;  5U47 A;  3VOY A;  4WMC D;  4E3N A;  3HLE A;  3IF5 A;  1HTZ A;  2OLV A;  1RP5 A;  3VSK A;  1L0F A;  2ZQC A;  3N7W A;  4OQI A;  3NDG A;  3CG5 A;  1PW8 A;  2DRW A;  5DF9 A;  1SDE A;  4IED A;  1K4E A;  2WGV A;  2OV5 A;  3PBS A;  1XPB A;  4Y0U A;  4DE3 A;  4CJN A;  5E2E A;  4GDN A;  1FR1 A;  4A5R A;  1Q2P A;  1SCW A;  3IHB A;  4DE2 A;  4S2P A;  4EBP A;  1PIO A;  1RCJ A;  1VQQ A;  3HUN A;  3WRZ A;  4HBT A;  4ID4 A;  4R4R A;  4U0X A;  2ZC5 B;  3IWI A;  5HAQ A;  3GRJ A;  4Q8I A;  1L0G A;  1TDL A;  1YM1 A;  2HP6 A;  3IH8 A;  3WWX A;  5EVL A;  5I94 A;  2WK0 A;  4KEN B;  1CK3 A;  1YLW A;  3WS1 A;  3C4O A;  3HLF A;  4OLD A;  4S2N C;  5FQK A;  3IF6 B;  5DF7 A;  4QB8 A;  3SS4 A;  3ZVW A;  1MWR A;  3OPR A;  4S2N A;  3BM6 A;  2ZC4 B;  3GR2 A;  3ZFZ A;  3O3V A;  2Y2G A;  3GQZ A;  5HFO A;  3DTM A;  5E2H A;  1KE4 A;  1TEM A;  3CJM A;  5FDH A;  3M6B A;  5CHM A;  3IWO A;  3QNC A;  1PWG A;  1JWV A;  3ZG9 B;  3VFF A;  3SS5 A;  2Y55 A;  3ZG0 A;  4GB7 A;  5DTT A;  3ZG5 A;  2WAF A;  1MXO A;  3O87 A;  2R9W A;  4M3K A;  1HZO A;  3HVF A;  2FFF B;  2XDM A;  3FKV A;  5CHU A;  1O07 A;  3DWK A;  3AGD A;  4HEF A;  2HDU A;  1DY6 A;  4KZ4 A;  3Q7Z A;  4P87 A;  1GHP A;  4K0X A;  3PBN A;  4OQG A;  4LV2 A;  5CGS A;  5TFQ A;  1N9B A;  2EX2 A;  3BYD A;  4DE0 A;  5JYO A;  1W8Y A;  3RXW A;  1HVB A;  1NRF A;  4OOL A;  3W4O A;  1J9M A;  2XQZ A;  2EXB A;  3UO9 A;  3MFD A;  2G2U A;  3NIA A;  1YLJ A;  3Q82 A;  5AQB A;  3IXB A;  1Q2Q A;  4K0W A;  3OCN A;  4HES A;  5AQ7 A;  5IHV A;  4DXB A;  4E3O A;  4Z9Q A;  4X6T A;  4S2M A;  3BFC A;  3V5M A;  3FZC A;  2C5W B;  2X02 A;  1NYM A;  4H8R A;  3NDE A;  4UA9 A;  5HAR A;  3ZG8 B;  3UPO A;  1L0E A;  3N8L A;  1GHI A;  4E3J A;  2H10 A;  1IKI A;  1QME A;  1ERQ A;  3GTC A;  1JTG A;  4GOG A;  4FH2 A;  3GVB A;  1K6S A;  1K56 A;  3MXS A;  4LCM A;  2ZQA A;  3RXX A;  4QD4 A;  4JF5 A;  3BEC A;  1H8Y A;  1NZU A;  5TGF A;  3G32 A;  2GDN A;  4P6B A;  1DJA A;  2HPB A;  4KG5 A;  4RVA A;  4YFM A;  1S6R A;  4NK3 A;  3Q1F A;  4S2L A;  4R1G A;  3LY3 A;  3S1Y A;  1XGI A;  1K55 C;  3P98 A;  5HW3 A;  3N8S A;  4PM9 A;  5DF8 A;  4RA7 A;  1LL5 A;  3UPP A;  1ERO A;  3BEB A;  4P85 A;  2ZQD A;  4OON A;  4X53 A;  2BG1 A;  3BFD A;  4N1H A;  1CEG A;  1XX2 A;  3SS3 A;  3Q7V B;  5FAS A;  1ESU A;  1WYB A;  5EEC A;  5A91 A;  2ZMA A;  3HBR A;  1NZO A;  4OVD A;  2UWX A;  4QJG A;  2RCX A;  5A90 A;  4GDB A;  4IVK A;  5GHX A;  5TR7 A;  4FSF A;  4ZJ3 A;  3MZD A;  1PWC A;  4RYE A;  4X68 A;  1KGE A;  2J9O A;  1KGG A;  2ZC6 B;  3PBQ A;  1K54 C;  2EX6 A;  3G2Z A;  2IWB A;  2EX9 A;  5BOH A;  1PYY A;  3A3E A;  3V39 A;  1K54 A;  3NCK A;  4GNU A;  2Y2P A;  1O7E A;  5FI7 A;  5HAI A;  3PBT A;  3G30 A;  5E43 A;  2XD1 A;  2Z2M B;  1BT5 A;  2ZM2 A;  3HLD A;  4B4Z A;  4C3Q A;  5HAP A;  3FWL A;  4GD8 A;  5FQ9 A;  5GLA A;  2XFS A;  4XUZ A;  2Z2L B;  4P0M A;  4Y7P A;  3ZGA B;  5FAQ A;  1GHM A;  2ZQ7 A;  4N9K A;  1PI5 A;  3NY4 A;  1DJC A;  4QU3 A;  2JCH A;  4KZ6 A;  1YQS A;  1WYC A;  4JXV A;  4R3J A;  1KE0 A;  1E4D A;  3A3J A;  4JLF A;  3UPN A;  1ZG6 A;  1AXB A;  4WZ5 A;  5FAO A;  5EVI C;  1FSY A;  1K56 D;  4N1X A;  3HLW A;  3LO7 A;  5EVI A;  5M19 A;  3IWQ A;  4JXG A;  1GA9 A;  4KZA A;  5F1G A;  5J8X A;  1E3U D;  3OPP A;  1KDS A;  2HDQ A;  3A3F A;  3SOI A;  2WGW A;  3UE0 A;  2R9X A;  3FKW A;  1JWZ A;  1K25 A;  2Y2K A;  3V3S A;  1SDN A;  1U60 A;  1YLY A;  4ZAM A;  3WRT A;  3G4P A;  4X55 A;  2XEP A;  2Y2I A;  3HLB A;  4XUX A;  3WS0 A;  2P9V A;  3WS4 A;  4D2O A;  5L2F A;  4OOY A;  2X71 A;  2ZD8 A;  3VSL A;  3C5A A;  5CRF A;  4E6W A;  1BSG A;  2H0T A;  4BLM A;  3HRE A;  1N4O A;  2HP9 A;  5FI2 A;  5GHZ A;  4S2K A;  3MKE A;  4WEJ A;  4OLG A;  3QHY A;  1EI5 A;  4S2J A;  2ZQ8 A;  3CZD A;  3ISG A;  3DW0 A;  4DDS A;  1IEM A;  3VFH A;  3ZDJ A;  3M6H A;  4MEZ A;  5KSH A;  1Y54 A;  2XH9 A;  1K4F A;  2WZZ A;  1ZKJ A;  1JTD A;  1YLP A;  2EFU A;  4OPY A;  5EPH A;  4ZJ2 A;  4BL2 A;  4F94 A;  2WAD A;  4QHC A;  5F82 A;  2IWD A;  2OLU A;  4BL3 A;  1IYQ A;  5CGW A;  5FAT A;  3EQV A;  3IH9 A;  5CEB A;  2JE5 A;  4JPM A;  4OH0 A;  3W4Q A;  4BQM A;  3UE3 A;  3UNW A;  1QMF A;  3G2Y A;  1PZO A;  1PWD A;  3IHA A;  3P09 A;  1ONH A;  4GKU A;  2EXA A;  2CC1 A;  5M1A A;  1XA1 A;  1CEF A;  1NJ4 A;  5CTM A;  2JBF A;  2EFX A;  3IXH A;  1PI4 A;  4GN2 A;  5KZH A;  3PBO A;  4C6Y A;  1RGY A;  3UN7 A;  2FFY A;  1PW1 A;  2WZX A;  1GA0 A;  5D3O A;  4GZB A;  4WMC A;  5KSC A;  3AGF A;  4KZ9 A;  1BTL A;  4UA6 A;  3G31 A;  4U3T A;  4OOM A;  4OPR A;  3E2L A;  3DWZ A;  1RGZ A;  3OC2 A;  3M2K A;  4KZ5 A;  3UDX A;  4S2O A;  2Y2J A;  2J7V A;  1SHV A;  4LV0 A;  1BLH A;  3ITA A;  1HD8 A;  4MBK A;  2Y2N A;  3ZHH A;  5CXW A;  3S22 A;  5JYP A;  3OPL A;  5FQJ A;  3WS2 A;  1CI9 A;  2X01 A;  5F1F A;  3LCE A;  2JC7 A;  2E8I A;  2HP5 A;  3M2J A;  4PM8 A;  5AQ9 A;  4OQ0 A;  3ZVT A;  4JXS A;  5GLB A;  1I2S A;  3VP4 A;  3BLS A;  1ES4 A;  4EUZ A;  4IVI A;  1LI0 A;  1M40 A;  2WKI A;  1NY0 A;  3SH9 A;  3PAE A;  1MWT A;  4BD1 A;  5A93 A;  3V50 A;  1L0D A;  2RL3 A;  2P74 A;  1ALQ A;  3D4F A;  2Y2L A;  4WYY A;  2A49 A;  3JYI A;  1ERM A;  2Y2M A;  1IYP A;  3BRM A;  3SH8 A;  4KG2 A;  3N6I A;  3OCL A;  2QMI A;  4KG6 A;  4ZBE A;  3W4P A;  4S2I A;  1G6A A;  1Z6F A;  4Y0T A;  4DF6 A;  3TOI A;  3TSG A;  4Y0O A;  2DCF A;  4DE1 A;  3UE1 A;  1FCO A;  1NYY A;  4PM5 A;  1MPL A;  3IF6 A;  3GSG A;  4U0T A;  4MLL A;  4N9L A;  4RX2 A;  3EQU A;  5GLD A;  1MKI A;  2Y2O A;  4KQR A;  3TG9 A;  1DJB A;  4WZ5 C;  1ES2 A;  2WGI A;  3C4P A;  4UA7 A;  4JF6 A;  4O7D A;  4XXR A;  1GCE A;  5FQQ A;  2ZJ9 A;  2C6W B;  1ZG4 A;  3B3X A;  3LY4 A;  2WUQ A;  1BLS A;  3BLM A;  4OPZ A;  1H8Z A;  1W8Q A;  2VGJ A;  3ZNT A;  3ZG7 B;  2Y2Q A;  2XR0 A;  3Q81 A;  1XXM A;  1G68 A;  4E3M A;  4JKT A;  1I2W A;  1E25 A;  1FCN A;  1W79 A;  1YLZ A;  3QNB A;  3UDF A;  4X69 A;  3IT9 A;  5E2F A;  3PAG A; 
#chains in the Genus database with same CATH topology
 2W0N A;  3C7U A;  3MF0 A;  3V3R A;  5L07 A;  1VEU B;  1ONG A;  2A2L A;  3KO3 A;  2GNX A;  3ZNY A;  3E2K A;  3G34 A;  2QZ6 A;  4PM7 A;  4LV1 A;  3GMW A;  5EFW A;  1FSW A;  4LRY C;  1KDW A;  4MMN A;  1MWS A;  1BUE A;  2WKH A;  2Y4A A;  5AVE A;  4IUH A;  5CHJ A;  3SW1 A;  2UV0 E;  2HDS A;  1LL9 A;  1ESI A;  5E2G A;  1W63 Q;  5DTS A;  4NET A;  2IWC A;  3MZE A;  2PR5 A;  4FCF A;  1BUL A;  3NEC A;  4OP8 A;  4Y2F A;  2PYR A;  1YSP A;  3ZCZ A;  5KMW A;  4AFI A;  4GD6 A;  4EV4 A;  4PPR A;  1YMX A;  4LCL A;  3Q7V A;  3NBL A;  2XRN A;  2Y2H A;  4EBN A;  3KSG A;  4P6Z S;  4N92 A;  3B33 A;  2ZQ9 A;  5G18 A;  2PDR A;  3LIF A;  2XK1 A;  5A92 A;  5EUA A;  3AGE A;  3LMT A;  3S7P A;  1OJG A;  1YT4 A;  1V9Y A;  3LEZ A;  4HBU A;  4EWF A;  2V2F F;  4EU0 A;  4E6X A;  3N8R A;  4WEK A;  1DP9 A;  5CED A;  4B88 A;  3K2N A;  1KVM A;  1S67 L;  3OZH A;  4DXC A;  5AQA A;  2WKE A;  3A3D A;  4KZ7 A;  4EBL A;  1IYS A;  3HLC A;  2A3U A;  2ZLY A;  2ZOI A;  3ITB A;  4MBH A;  4LEN A;  1WE4 A;  3HUM A;  2J8Y A;  4FD8 A;  5F83 A;  2VGK A;  2A24 B;  3CHW P;  3VP1 A;  3NC8 A;  4FH4 A;  2QHK A;  3SH7 A;  4E3N A;  3DBA A;  3F1N A;  3U2A A;  5IS1 A;  2OLV A;  3VSK A;  5LBR A;  5DF9 A;  2WGV A;  4R6L A;  3PBS A;  5E2E A;  4A5R A;  5L09 A;  1VQQ A;  1RCJ A;  4ID4 A;  3BWL A;  4Q8I A;  1N9N A;  4RRL A;  3IH8 A;  5C5K A;  3C4O A;  3HLF A;  3T4J A;  5DF7 A;  5IU1 A;  1MWR A;  5HFO A;  1TEM A;  1IFQ A;  4I38 A;  3M6B A;  1JWV A;  2ZL1 B;  3ZG9 B;  5MC7 A;  3KYE A;  2PD8 A;  1YKD A;  4GB7 A;  1MXO A;  2R9W A;  1HZO A;  2FFF B;  2XDM A;  1DRM A;  4KZ4 A;  1GHP A;  2B95 A;  4K0X A;  4OQG A;  5TFQ A;  2VGL M;  4HH2 A;  3RXW A;  1NRF A;  4NXF A;  1J9M A;  3UO9 A;  3LID A;  3MFD A;  4K0W A;  4ZRR A;  4HES A;  5IHV A;  4HI4 A;  3V5M A;  3KOC A;  3U4L P;  5HAR A;  4H8R A;  3NDE A;  5J7E A;  3UPO A;  3N8L A;  3QP1 A;  1GHI A;  1SKO B;  4F3L A;  3TE8 A;  1JTG A;  4FTX A;  3GVB A;  1K6S A;  1K56 A;  1TS0 A;  4JF5 A;  3G6O A;  3JVV A;  3BEC A;  1NZU A;  2QJ5 A;  4WUJ A;  2GDN A;  1DJA A;  4RRB A;  4KG5 A;  3H7W B;  3LY3 A;  3SZT A;  3KNF A;  3HJI A;  3F1P B;  4RA7 A;  1LL5 A;  4P85 A;  2ZQD A;  1CEG A;  2VJW A;  3SS3 A;  5FAS A;  2XRO A;  3KX0 X;  4EW7 A;  4IVK A;  3T12 B;  4IUK A;  2L4R A;  1BYW A;  2W3F A;  3MJQ A;  2IWB A;  5BOH A;  1T19 A;  3V39 A;  4GNU A;  1VEU A;  1O7E A;  5FI7 A;  5HAI A;  3PBT A;  2ZBB A;  4RRD A;  5HAP A;  4HJ4 A;  4P0M A;  2O99 A;  4N9K A;  5HD5 A;  3MMH A;  4JLF A;  5FAO A;  2OOL A;  4N1X A;  1T1A A;  3HLW A;  3LO7 A;  1CF0 A;  3KOD A;  4KZA A;  3QP6 A;  3KO4 A;  3SOI A;  3UE0 A;  4LGW A;  4M4X A;  2Y2K A;  1SDN A;  1U60 A;  4JGQ A;  2ZOH A;  3VSL A;  3C5A A;  2VV8 A;  2H0T A;  1J7G A;  1ZTU A;  3CZD A;  2QWS A;  2VX8 A;  1Y54 A;  2XH9 A;  2WZZ A;  2EFU A;  4PKY A;  4OPY A;  5FL3 A;  5DKK A;  4F94 A;  2WAD A;  2VEA A;  2VKS A;  3QP8 A;  4S0J A;  2VGL S;  3UNW A;  4MN6 A;  5HDD A;  2Z6D A;  1PWD A;  1ONH A;  5CTM A;  5KZH A;  3PBO A;  1RGY A;  4R70 A;  4X1M A;  2PYP A;  5EV0 A;  2HL0 A;  4U3T A;  1ZHH B;  3E2L A;  1UWP X;  3M2K A;  2Y2J A;  2J7V A;  4LV0 A;  2J3T C;  1TS6 A;  2A24 A;  5KIZ A;  4Y13 A;  4HOI A;  4PHT A;  3S22 A;  5JYP A;  3UB6 A;  3OPL A;  4GHI B;  1CI9 A;  3CWF A;  2JC7 A;  2W1R A;  3PXP A;  2E8I A;  3M2J A;  2VLG A;  4G3K A;  4EUV A;  2HJ9 C;  4BBU A;  1I2S A;  1XFQ A;  4EUZ A;  4IVI A;  1M40 A;  1P9R A;  3PAE A;  4BD1 A;  2RL3 A;  3LR5 A;  3D4F A;  2Y2L A;  1OTA A;  3BRM A;  3SH8 A;  3N6I A;  3OCL A;  1G6A A;  1Z6F A;  3TSG A;  3BY8 A;  2HGV A;  3L9K A;  4IHQ A;  4N9L A;  4DN0 A;  2V8C A;  2Y2O A;  4KQR A;  3LIB A;  4WZ5 C;  3C4P A;  2ZL1 A;  3E4Q A;  3B3X A;  3BLM A;  4OPZ A;  1OTE A;  1H8Z A;  1OTD A;  3ZNT A;  1XXM A;  1FCN A;  3V67 A;  3PAG A;  1W5D A;  3Q07 A;  3OOV A;  4ME4 A;  3IQA A;  3QP5 A;  3C30 A;  4WEL A;  4WZ4 A;  3EGX C;  3MBZ A;  3KSH A;  5HPI A;  1S1Y A;  5FI6 A;  1MWU A;  1IEL A;  3PTE A;  3PD5 A;  1EWZ A;  1SKO A;  3T1X A;  3T4K A;  3CUE C;  4R23 A;  5EVI B;  4IBX A;  4QY5 A;  2V20 A;  5CGX A;  1GSV A;  3VP0 A;  2WGW B;  1FIL A;  4OKP A;  5EOO A;  3FPW A;  5FSR A;  5CEC A;  3H7W A;  3IXG A;  4WBG A;  4DRT A;  3F1P A;  2WKP A;  2E8J A;  3W2Z A;  3VOL A;  4EQI A;  3UDI A;  4KZ3 A;  4Q0J A;  3ULF A;  1XGJ A;  4PAU A;  1IYO A;  5DVA A;  4UAA A;  1ES5 A;  2WAE A;  3H82 B;  3VV4 A;  4ESP A;  1W7F A;  1XA7 A;  2W3H A;  1K38 A;  3T4T A;  4LFU A;  5FQM A;  2HDR A;  1XKZ A;  3MKF A;  2KLI A;  4KZ8 A;  4O8G A;  3S4X A;  3HLG A;  3WS5 A;  2BAS A;  2J3W A;  5EVE A;  1LLB A;  4YIN A;  1SKF A;  1M6K A;  4I39 A;  4E3I A;  4WN5 A;  1LSX A;  4X56 A;  1I5Q A;  5M18 A;  3R7W B;  3IF6 C;  4CQH A;  2ZM0 A;  4FUW A;  4S03 A;  4BEN A;  3LIE A;  1H8M A;  2DNS A;  3MXR A;  4MNR A;  3T4Q A;  2GJ3 A;  3UB5 P;  1IKG A;  3KYZ A;  3C7V A;  3MXQ A;  2W3D A;  1FQG A;  4OQH A;  4I3J A;  5AVF A;  3VOY A;  1RP5 A;  1PW8 A;  1SDE A;  4IED A;  1K4E A;  2OV5 A;  1K0K A;  4Y0U A;  2KX6 A;  4DE3 A;  1FR1 A;  2J3T D;  3HUN A;  4U0X A;  3C8C A;  4Y5F A;  2K2N A;  5HAQ A;  1TDL A;  2HP6 A;  4I3I A;  3WWX A;  5I94 A;  1YLW A;  1T18 A;  3UMD A;  2PAV P;  5HSQ A;  2ZC4 B;  3O3V A;  3DTM A;  4O0P A;  1KE4 A;  4EQ1 A;  1N9L A;  3IWO A;  4HIA A;  3OLO A;  2WAF A;  2HZ5 A;  3MFX A;  3O87 A;  4I3A A;  2PRF A;  3CLO A;  3FKV A;  5J4E A;  1O07 A;  3AGD A;  1DY6 A;  3Q7Z A;  2EX2 A;  3BYD A;  1W8Y A;  4OOL A;  3W4O A;  4GHI A;  3IXB A;  1NLZ A;  4DJ3 A;  2V0U A;  4Z9Q A;  4X6T A;  4HJ6 A;  4HP4 A;  4S2M A;  4S0L A;  5L10 A;  1NYM A;  2P7J A;  2FZ0 A;  2V9A A;  4E3J A;  2H10 A;  1IKI A;  1QME A;  3GTC A;  4RRI A;  4FH2 A;  3MXS A;  4O01 A;  3K3C A;  4EET B;  2Y79 A;  5TGF A;  3G32 A;  3GDI A;  4QWO A;  3K3D A;  4K08 A;  3Q1F A;  3LR0 A;  5HW3 A;  4PM9 A;  4RR8 A;  5DF8 A;  4RRQ A;  3TW8 A;  3UPP A;  4OON A;  2BG1 A;  1UWN X;  4L9E A;  5IT5 A;  1XJ4 A;  1ESU A;  1WYB A;  5EEC A;  5A91 A;  1OTI A;  1NZO A;  2RCX A;  4FSF A;  4RYE A;  1KGE A;  3PBQ A;  3LIA A;  3E0Y A;  4YOF A;  3A3E A;  3C2W A;  4B9O A;  1F98 A;  3C38 A;  3HLD A;  4B4Z A;  5FQ9 A;  4XUZ A;  2Z2L B;  4Y7P A;  2ZQ7 A;  3NY4 A;  5DFX A;  5DJT A;  4ETX A;  2D02 A;  1XFN A;  4R3J A;  4JXV A;  3PYP A;  4HQA A;  3NOT C;  5EVI C;  4KUO A;  3MSH A;  5TJJ A;  4R38 A;  1XJ2 A;  5EVI A;  3DTI A;  3IWQ A;  4Q0H A;  5J8X A;  2LB9 A;  3EGD C;  3OPP A;  2O9C A;  2ACG A;  2WGW A;  2PR6 A;  2O9A A;  1JWZ A;  1K25 A;  3V3S A;  2L1M A;  1YLY A;  5K5B A;  3G4P A;  4RRH A;  3WS0 A;  2HKZ A;  2ZD8 A;  3LR3 A;  3KSI A;  1AWI A;  5CRF A;  5HWT A;  1N4O A;  3DTK A;  5FI2 A;  4S2K A;  3MKE A;  3QHY A;  5FEF A;  2V1A A;  1EI5 A;  3JVU A;  2ZQ8 A;  3QP4 A;  3H82 A;  4WL9 A;  4DDS A;  3M6H A;  5KSH A;  4X25 A;  5G4Y A;  2W27 A;  4BL2 A;  5AJG A;  4QHC A;  5F82 A;  2OLU A;  4WLA A;  4L9G A;  5CGW A;  5I5L A;  1VET B;  5CEB A;  4JPM A;  4RRJ A;  4FOF A;  3IHA A;  2HJE A;  1OT6 A;  5M1A A;  4UQI M;  2GX5 A;  2JBF A;  4C6Y A;  3KOB A;  5KSC A;  4KZ9 A;  1BTL A;  4G3W A;  3R7W A;  4OOM A;  3KO5 A;  1RGZ A;  4KZ5 A;  2PD7 A;  1BLH A;  5FQJ A;  3FG8 A;  3LCE A;  2PT7 A;  5AQ9 A;  3ZVT A;  3T4O A;  3VP4 A;  3BLS A;  2K31 A;  4DMZ A;  1LI0 A;  3EEH A;  5A93 A;  3V50 A;  1L0D A;  2P74 A;  3IS2 B;  4WYY A;  1G6O A;  4KG6 A;  1IOU A;  4Y0T A;  3TOI A;  2V8F A;  4Y0O A;  2DCF A;  2HL1 A;  4MN7 A;  5J61 A;  3LI8 A;  3CAX A;  4DJ2 A;  3TG9 A;  3MS6 A;  4UA7 A;  4RRG A;  4O7D A;  4XXR A;  1GCE A;  1H3Q A;  5FQQ A;  2C6W B;  1ZG4 A;  4S0K A;  3UME A;  2VGJ A;  3ZG7 B;  1G68 A;  5DKL A;  3EWK A;  1E25 A;  4X69 A;  1W63 M;  3IT9 A;  1UGU A;  2D01 A;  3VMA A;  3MQQ A;  2B5R A;  5HZH A;  2QPN A;  1FR6 A;  3IX8 A;  4BJP A;  1BLP A;  3UY6 A;  4PMA A;  3LIC A;  1G5U A;  2OKV A;  2L0W A;  1C3B A;  4C75 A;  3ZQ5 A;  3OPH A;  4HH3 A;  4B4X A;  1H5X A;  5DJU A;  2XLN A;  3UB7 A;  2PBD P;  4E3K A;  4CLC D;  1OTB A;  3FV7 A;  2W3E A;  2EA9 A;  1OPX A;  4KZB A;  5FA7 A;  3D3O A;  3PD2 A;  4R3A A;  2WYX A;  4PKY G;  5A8B A;  2P9V B;  2XFT A;  2J9P A;  1CI8 A;  3IBR A;  4PM6 A;  5EOE A;  1LHY A;  1MBL A;  1Z09 A;  4ZTK A;  5EVI D;  4UQI S;  1KGF A;  4EES A;  3O86 A;  2XD5 A;  1H0M A;  3O88 A;  4JXW A;  1STZ A;  1N9O A;  3GV9 A;  4E3L A;  2XF3 A;  1TVF A;  1T1B A;  1ZC2 A;  3FYZ A;  5GLC A;  3BFE A;  1KE3 A;  2O9B A;  3O5Y A;  1LI9 A;  4ZDX A;  2Q9N A;  4EEU A;  4RRM A;  1GSX A;  4RX3 A;  1S0W A;  4IBR A;  3KSF A;  1E3U A;  2ZM8 A;  3BY9 A;  1S4S A;  2Y59 A;  3LYX A;  3W8K A;  4EXO A;  2ZMF A;  2JKT M;  2K7S A;  4DKI A;  2G2W A;  3S7N A;  5GHY A;  1K55 A;  1TF1 A;  4NXB A;  5F6A A;  3VOZ A;  4RR7 A;  2ZC7 A;  4R4S A;  1VM1 A;  1S1Z A;  2Q9M A;  3KO7 A;  3CMZ A;  4OP5 A;  2XSS A;  4BD0 A;  3NOU C;  1OJ5 A;  1BZA A;  2Y91 A;  2H0Y A;  5FQI A;  4MBF A;  3VP3 A;  4JF4 A;  3T1R A;  1S66 L;  4K91 A;  3D9Y A;  3G35 A;  4GLQ A;  1FCM A;  1V9Z A;  3IF5 A;  2QKP A;  1HTZ A;  2B02 A;  1L0F A;  2ZQC A;  3N7W A;  3DAV A;  2DRW A;  2QYB A;  1XPB A;  4YWZ A;  4GDN A;  1Q2P A;  3LFV A;  4EBP A;  4EEP A;  1PIO A;  5F68 A;  5FDS A;  4R4R A;  2ZC5 B;  1L0G A;  1VET A;  4KEN B;  4CLC E;  4OLD A;  4CLC B;  3SS4 A;  4RRA A;  1SZV A;  3ZVW A;  1XJ6 A;  3F1O B;  3BM6 A;  3CJM A;  5FDH A;  5CHM A;  3VFF A;  2Y55 A;  5EM0 A;  4JGR A;  4HY8 A;  4M3K A;  4GS9 B;  3HVF A;  5CHU A;  3A0R A;  2WKR A;  4HEF A;  3PBN A;  2FH5 A;  4DE0 A;  4II7 A;  4MDZ A;  4D60 A;  2H28 A;  2XQZ A;  2G2U A;  5DFY A;  3NIA A;  1YLJ A;  2EWW A;  5AQB A;  3OCN A;  1WA9 A;  3EOI A;  4DXB A;  4NXG A;  2VA0 A;  3IS2 A;  5HDC A;  4UA9 A;  1F9I A;  2NUP C;  1L0E A;  3LEQ A;  2JKG A;  2W3G A;  2VV6 A;  3B42 A;  4GOG A;  4LCM A;  3RXX A;  3E4O A;  1H8Y A;  4RVA A;  2JKF A;  3MR0 A;  4YFM A;  1S6R A;  4NK3 A;  4S2L A;  4R1G A;  3P98 A;  3OBF A;  1ACF A;  1ERO A;  2KOI A;  3BFD A;  4N1H A;  3B47 A;  3NUL A;  3HBR A;  2UWX A;  5A90 A;  4GDB A;  5GHX A;  1XJ3 A;  1PWC A;  1NRJ A;  2J9O A;  3G2Z A;  3A0S A;  2IA2 A;  4LPZ A;  4EER A;  2Y2P A;  5E43 A;  2Z2M B;  2ZM2 A;  4S0I A;  4C3Q A;  5GLA A;  2XFS A;  1PI5 A;  2YKF A;  1DJC A;  4QU3 A;  2JCH A;  4KZ6 A;  4BWI A;  4GJ4 A;  1WYC A;  3LMV A;  2P04 A;  1E4D A;  3T50 A;  3UPN A;  1NLY A;  1AXB A;  2M7V A;  5M19 A;  5F1G A;  1E3U D;  4H6J B;  1KDS A;  2M7U A;  3KYQ A;  3CIT A;  3MQO A;  3FKW A;  4MN5 A;  4ZAM A;  3WRT A;  3ZYT A;  2Q0O A;  4X55 A;  1VHM A;  3HLB A;  2P9V A;  3WS4 A;  4D2O A;  5L2F A;  2G7U A;  3UB8 A;  4E6W A;  4BLM A;  4WEJ A;  2JKR M;  4OLG A;  3P01 A;  1T1C A;  3IX4 A;  1IEM A;  3VFH A;  4HNB A;  3S7Q A;  2HF6 A;  1JTD A;  1YLP A;  4ZJ2 A;  2IWD A;  1LT0 A;  1LL8 A;  5FAT A;  3EQV A;  1HLU P;  2YKH A;  2JE5 A;  4OH0 A;  2EWV A;  4BQM A;  1D06 A;  3TRC A;  1PZO A;  2EXA A;  2CC1 A;  1YSQ A;  5EM1 A;  1PI4 A;  4GN2 A;  1P0Z A;  1PW1 A;  2WZX A;  4GZB A;  4WMC A;  4NEE D;  1PFL A;  1MZU A;  4NXE A;  1Y4O A;  3LGO A;  3ITA A;  3ZHH A;  2WKQ A;  5HWW A;  3KNP A;  2X01 A;  2HP5 A;  1F2K A;  1MWT A;  3A0V A;  4RR9 A;  1ALQ A;  2Y2M A;  4RRR A;  1IYP A;  4IJG A;  3S7O A;  3T4S A;  4YNR A;  4ZBE A;  3W4P A;  4DF6 A;  3RFB A;  1DP8 A;  2XA7 S;  4CLC C;  3UE1 A;  1FCO A;  4PM5 A;  1MPL A;  4CLC A;  3CPT B;  3NOP C;  3GSG A;  4U0T A;  4MLL A;  3F1O A;  2VV7 A;  1ES2 A;  2WGI A;  4JF6 A;  1GSW A;  2WUQ A;  1BLS A;  2JN7 A;  2J80 A;  5F69 A;  4GS9 A;  2Y2Q A;  2XR0 A;  3E4P A;  2Z6C A;  3Q81 A;  1EW0 A;  2OWJ A;  4JKT A;  3QNB A;  1YLZ A;  4GCZ A;  3H9W A;  1CJF A;  3CI6 A;  4B93 A;  1TC5 A;  5E2F A;  1ES3 A;  1NXY A;  4QY6 A;  3ICY A;  4JBF A;  4BMW A;  2V0W A;  3IXD A;  4WM9 A;  3PBR A;  3BFF A;  1JVJ A;  5HDS A;  1XP4 A;  2ZC3 B;  3GEC A;  4WF0 A;  5TBM B;  3HJK A;  4CPK A;  5HL6 A;  1K6R A;  2V1Z A;  4R3B A;  4NBJ A;  2H5S A;  4ARZ B;  2NUT C;  3T1S A;  3I7J A;  3BFG A;  3N4I A;  3RJU A;  3VP2 A;  4HP9 A;  2KDK A;  3R4K A;  2I72 A;  4MCW A;  4KQO A;  1FOF A;  4L0L A;  2PU2 A;  1TDG A;  1D1J A;  1MKM A;  2W1T B;  1MY8 A;  1L2S A;  3NI9 A;  2DMW A;  3BJN A;  3A3I A;  1OME A;  1JWP A;  4Z1W A;  2PBY A;  1J3W A;  4S02 A;  2LB5 A;  3MZF A;  1PZP A;  4LV3 A;  4OPQ A;  5CER A;  3QP2 A;  1TS8 A;  3KO6 A;  4R0Q A;  3HUO A;  2AVX A;  1JKE A;  5GL9 A;  4DDY A;  4E04 A;  2EX8 A;  3IBJ A;  3VE4 A;  1YMS A;  4KQQ A;  3UB9 A;  5FEG A;  2HV1 A;  2XGN A;  5HL1 A;  5EE8 A;  3HL9 A;  5CTN A;  1MC0 A;  1P9W A;  2BLS A;  1K57 C;  1TS7 A;  2PU4 A;  1BLC A;  5HX9 A;  1K57 A;  4H6J A;  2CMN A;  5DTK A;  2OSU A;  4ZJ1 A;  5FAP A;  1YLT A;  1FIK A;  4UHU A;  3IX3 A;  1KVL A;  4JGO A;  5U47 A;  4WMC D;  3HLE A;  3BW6 A;  4XT2 B;  4OQI A;  3NDG A;  3CG5 A;  3PD4 A;  1ODV A;  2DBO A;  4KQD A;  3HCY A;  4CJN A;  1SCW A;  3IHB A;  3NJA A;  4DE2 A;  4S2P A;  3E98 A;  3WRZ A;  4HBT A;  1LSW A;  5L8M A;  2JKT I;  3IWI A;  3D72 A;  5HWV A;  3GRJ A;  1YM1 A;  5EVL A;  2WK0 A;  3LI9 A;  1CK3 A;  4LLO B;  5CX7 A;  3WS1 A;  4S2N C;  5FQK A;  3IF6 B;  4QB8 A;  1VB6 A;  3OPR A;  4S2N A;  3GR2 A;  3ZFZ A;  2Y2G A;  3GQZ A;  5E2H A;  5HD3 A;  3LR4 A;  3QNC A;  1PWG A;  3SS5 A;  3ZG0 A;  1X0O A;  5DTT A;  3ZG5 A;  4NKP A;  1JNU A;  3DWK A;  3L7H A;  4Y3I A;  2HDU A;  3KO9 A;  2PHY A;  1G28 A;  4P87 A;  2R78 A;  1P97 A;  4LV2 A;  5CGS A;  1N9B A;  5JYO A;  3LMU A;  4Y17 A;  1HVB A;  2EXB A;  4UEY A;  1A0K A;  1PRQ A;  3Q82 A;  1Q2Q A;  5AQ7 A;  2VZW A;  4E3O A;  1PNE A;  3BFC A;  3FZC A;  4ETZ A;  2C5W B;  2X02 A;  3ZG8 B;  1ERQ A;  2ZQA A;  4QD4 A;  4P6B A;  3CPT A;  2HPB A;  2VK3 A;  4NG2 A;  1CQA A;  2OAP 1;  3S1Y A;  1XGI A;  1Y2Q A;  1K55 C;  3N8S A;  3UE6 A;  2QJ7 A;  3BEB A;  1Y28 A;  4GW9 A;  4X53 A;  1XX2 A;  4LRX C;  2HL2 A;  3Q7V B;  2ZMA A;  4QJG A;  4OVD A;  5TR7 A;  4ZJ3 A;  3MZD A;  2GZA A;  2O0Y A;  4NBI A;  2ZMV A;  4X68 A;  2ZC6 B;  1KGG A;  1K54 C;  2EX6 A;  2EX9 A;  4RR6 A;  1OT9 A;  1PYY A;  1K54 A;  3NCK A;  3G30 A;  3PD3 A;  2XD1 A;  1BT5 A;  4BBV A;  3FWL A;  3FPV A;  4GD8 A;  3ZGA B;  5FAQ A;  1GHM A;  5TBM A;  1YQS A;  1KE0 A;  3A3J A;  1ZG6 A;  4ARZ A;  4L9F A;  2JHE A;  4WZ5 A;  1FSY A;  1K56 D;  4JXG A;  1GA9 A;  4G3V A;  2OWH A;  1S4R A;  2HDQ A;  3A3F A;  2R9X A;  4Y15 A;  3MQ0 A;  2XEP A;  2Y2I A;  4HJ3 A;  4LRZ E;  4XUX A;  2W1T A;  4OOY A;  2X71 A;  1BSG A;  3F1N B;  3HRE A;  3T4L A;  2HP9 A;  5GHZ A;  4Q0I A;  4RRC A;  2M1C A;  1YAX A;  4S2J A;  4RRF A;  3ISG A;  3JPU A;  3DW0 A;  1YPR A;  3ZDJ A;  3NHQ A;  4QPR A;  4MEZ A;  1K4F A;  1ZKJ A;  5EPH A;  1NWZ A;  3PHY A;  2INW A;  1IYQ A;  4BL3 A;  3CUE A;  4BBT A;  2I9V A;  3IH9 A;  3W4Q A;  5HPF A;  3UE3 A;  3RH8 B;  1QMF A;  1D7E A;  3DTE A;  3G2Y A;  5F5Y A;  3P09 A;  4GKU A;  2OAQ 1;  1XA1 A;  1CEF A;  1NJ4 A;  2Y8H A;  2EFX A;  3IXH A;  4P6Z M;  3UN7 A;  2FFY A;  4I5S A;  3TJZ C;  1GA0 A;  5D3O A;  3T1Q B;  3AGF A;  4UA6 A;  3G31 A;  4OPR A;  4RRK A;  3DWZ A;  3OC2 A;  3UDX A;  2B18 A;  4S2O A;  1SHV A;  2JKR I;  3LUQ A;  1HD8 A;  1TD5 A;  4MBK A;  2Y2N A;  3VE3 A;  5CXW A;  3WS2 A;  5F1F A;  5G4Z A;  4PM8 A;  4OQ0 A;  4JXS A;  4X1L A;  5GLB A;  4RQ9 A;  4HHD A;  1ES4 A;  4XT2 A;  3PR6 A;  2WKI A;  1NY0 A;  3SH9 A;  2V1B A;  2XA7 M;  2A49 A;  3JYI A;  1ERM A;  3RTY A;  4KG2 A;  2QMI A;  4F3L B;  4S2I A;  5J3W A;  3BQA A;  4DE1 A;  1NYY A;  4KUK A;  3IF6 A;  2MJ6 A;  4RX2 A;  3EQU A;  2BTF P;  1LSV A;  5GLD A;  1MKI A;  3P7N A;  1DJB A;  1KOU A;  1DP6 A;  3EEA A;  3FC7 A;  2ZJ9 A;  3LY4 A;  4JGP A;  2P08 A;  1W8Q A;  3BQ8 A;  4E3M A;  1I2W A;  1F5M A;  1W79 A;  3UDF A;  1L3L A; 
#chains in the Genus database with same CATH homology
 1W5D A;  3VMA A;  1ES3 A;  3Q07 A;  2B5R A;  1NXY A;  3C7U A;  4QY6 A;  3V3R A;  4JBF A;  1ONG A;  2QPN A;  3IQA A;  1FR6 A;  3ZNY A;  3KO3 A;  3IXD A;  4WM9 A;  3PBR A;  4BJP A;  1BLP A;  3E2K A;  4PMA A;  3UY6 A;  3BFF A;  1JVJ A;  3G34 A;  2QZ6 A;  4PM7 A;  1XP4 A;  2ZC3 B;  2OKV A;  4LV1 A;  4WEL A;  1C3B A;  4CPK A;  3GMW A;  1K6R A;  4WZ4 A;  3MBZ A;  1FSW A;  2V1Z A;  4C75 A;  4R3B A;  5FI6 A;  1MWU A;  1IEL A;  3OPH A;  3PTE A;  3PD5 A;  1KDW A;  4NBJ A;  1EWZ A;  1MWS A;  2H5S A;  4B4X A;  1BUE A;  2WKH A;  2Y4A A;  3I7J A;  3BFG A;  4R23 A;  1H5X A;  5CHJ A;  3N4I A;  2HDS A;  2XLN A;  1LL9 A;  1ESI A;  5EVI B;  4IBX A;  5E2G A;  3RJU A;  3VP2 A;  4QY5 A;  2V20 A;  4E3K A;  2I72 A;  5DTS A;  5CGX A;  4NET A;  2IWC A;  3FV7 A;  3MZE A;  4KQO A;  3VP0 A;  1FOF A;  2WGW B;  4OKP A;  5EOO A;  4FCF A;  5FSR A;  5CEC A;  4L0L A;  3IXG A;  1BUL A;  2PU2 A;  4KZB A;  4OP8 A;  5FA7 A;  3PD2 A;  1TDG A;  4WBG A;  2WYX A;  4DRT A;  3ZCZ A;  5KMW A;  4GD6 A;  2P9V B;  2XFT A;  4EQI A;  2J9P A;  1MY8 A;  3UDI A;  4EV4 A;  1L2S A;  3NI9 A;  1CI8 A;  4KZ3 A;  4PM6 A;  4PPR A;  5EOE A;  1LHY A;  1MBL A;  1YMX A;  4LCL A;  1XGJ A;  4ZTK A;  5EVI D;  1IYO A;  5DVA A;  3Q7V A;  3NBL A;  2Y2H A;  3A3I A;  1KGF A;  4UAA A;  4EBN A;  1ES5 A;  3O86 A;  2XD5 A;  2WAE A;  3O88 A;  1OME A;  4JXW A;  1JWP A;  3GV9 A;  4N92 A;  4E3L A;  2PBY A;  2ZQ9 A;  1W7F A;  5G18 A;  4S02 A;  2XK1 A;  2XF3 A;  1XA7 A;  1TVF A;  1K38 A;  3MZF A;  5A92 A;  1PZP A;  5EUA A;  1ZC2 A;  3AGE A;  3FYZ A;  4LV3 A;  5GLC A;  4OPQ A;  5CER A;  3LMT A;  3BFE A;  5FQM A;  1KE3 A;  4R0Q A;  1LI9 A;  3HUO A;  4ZDX A;  2Q9N A;  2HDR A;  1XKZ A;  3MKF A;  4KZ8 A;  4RRM A;  1JKE A;  1YT4 A;  1S0W A;  4IBR A;  4RX3 A;  3HLG A;  3S4X A;  5GL9 A;  1E3U A;  2ZM8 A;  3LEZ A;  3WS5 A;  4HBU A;  4DDY A;  4EWF A;  2Y59 A;  2V2F F;  2EX8 A;  3W8K A;  1YMS A;  3N8R A;  4WEK A;  1LLB A;  4E6X A;  4KQQ A;  4YIN A;  5CED A;  1SKF A;  4DKI A;  4B88 A;  1M6K A;  2G2W A;  1KVM A;  3OZH A;  5GHY A;  4DXC A;  2XGN A;  1K55 A;  2WKE A;  5AQA A;  3A3D A;  4KZ7 A;  3VOZ A;  5HL1 A;  4E3I A;  5EE8 A;  4EBL A;  4RR7 A;  1IYS A;  2ZC7 A;  4R4S A;  1VM1 A;  1I5Q A;  3HL9 A;  4X56 A;  5CTN A;  5M18 A;  2BLS A;  1K57 C;  2Q9M A;  3HLC A;  2PU4 A;  3IF6 C;  3KO7 A;  1BLC A;  2A3U A;  2ZM0 A;  3CMZ A;  5HX9 A;  4OP5 A;  1K57 A;  2ZLY A;  4S03 A;  4BD0 A;  4BEN A;  5DTK A;  3ITB A;  4MBH A;  4LEN A;  1WE4 A;  1BZA A;  3HUM A;  2DNS A;  2J8Y A;  2Y91 A;  3MXR A;  2H0Y A;  4FD8 A;  5F83 A;  2OSU A;  2VGK A;  4MBF A;  4MNR A;  5FQI A;  4JF4 A;  4ZJ1 A;  3VP3 A;  3VP1 A;  5FAP A;  1YLT A;  1IKG A;  4UHU A;  4K91 A;  3C7V A;  3NC8 A;  1FQG A;  3G35 A;  4FH4 A;  4OQH A;  1KVL A;  3SH7 A;  1FCM A;  5U47 A;  3VOY A;  4WMC D;  4E3N A;  3HLE A;  3IF5 A;  1HTZ A;  2OLV A;  1RP5 A;  3VSK A;  1L0F A;  2ZQC A;  3N7W A;  4OQI A;  3NDG A;  3CG5 A;  1PW8 A;  2DRW A;  5DF9 A;  1SDE A;  4IED A;  3PD4 A;  1K4E A;  2WGV A;  2OV5 A;  3PBS A;  1XPB A;  2DBO A;  4Y0U A;  4DE3 A;  4CJN A;  5E2E A;  4GDN A;  1FR1 A;  4A5R A;  1Q2P A;  1SCW A;  3IHB A;  4DE2 A;  4S2P A;  4EBP A;  1PIO A;  1RCJ A;  1VQQ A;  3HUN A;  3WRZ A;  4HBT A;  4ID4 A;  4R4R A;  4U0X A;  2ZC5 B;  3IWI A;  5HAQ A;  3GRJ A;  4Q8I A;  1L0G A;  1TDL A;  1YM1 A;  2HP6 A;  3IH8 A;  3WWX A;  4RRL A;  5EVL A;  5I94 A;  2WK0 A;  4KEN B;  1CK3 A;  1YLW A;  3WS1 A;  3C4O A;  3HLF A;  4OLD A;  4S2N C;  5FQK A;  3IF6 B;  5DF7 A;  4QB8 A;  3SS4 A;  4RRA A;  3ZVW A;  1MWR A;  3OPR A;  4S2N A;  3BM6 A;  2ZC4 B;  3GR2 A;  3ZFZ A;  3O3V A;  2Y2G A;  3GQZ A;  5HFO A;  3DTM A;  5E2H A;  1KE4 A;  1TEM A;  3CJM A;  5FDH A;  3M6B A;  5CHM A;  3IWO A;  3QNC A;  1PWG A;  1JWV A;  3ZG9 B;  3VFF A;  3SS5 A;  2Y55 A;  3ZG0 A;  4GB7 A;  5DTT A;  3ZG5 A;  2WAF A;  1MXO A;  3O87 A;  2R9W A;  4M3K A;  1HZO A;  3HVF A;  2FFF B;  2XDM A;  3FKV A;  5CHU A;  1O07 A;  3DWK A;  3AGD A;  4HEF A;  2HDU A;  3KO9 A;  1DY6 A;  4KZ4 A;  3Q7Z A;  4P87 A;  1GHP A;  4K0X A;  3PBN A;  4OQG A;  4LV2 A;  5CGS A;  5TFQ A;  1N9B A;  2EX2 A;  3BYD A;  4DE0 A;  5JYO A;  3LMU A;  1W8Y A;  3RXW A;  1HVB A;  1NRF A;  4OOL A;  3W4O A;  1J9M A;  2XQZ A;  2EXB A;  3UO9 A;  3MFD A;  2G2U A;  3NIA A;  1YLJ A;  3Q82 A;  5AQB A;  3IXB A;  1Q2Q A;  4K0W A;  3OCN A;  4HES A;  5AQ7 A;  5IHV A;  4DXB A;  4E3O A;  4Z9Q A;  4X6T A;  4S2M A;  4S0L A;  3BFC A;  3V5M A;  3KOC A;  3FZC A;  2C5W B;  2X02 A;  1NYM A;  4H8R A;  3NDE A;  4UA9 A;  5HAR A;  3ZG8 B;  3UPO A;  1L0E A;  3N8L A;  1GHI A;  4E3J A;  2H10 A;  1IKI A;  1QME A;  1ERQ A;  3GTC A;  1JTG A;  4RRI A;  4GOG A;  4FH2 A;  3GVB A;  1K6S A;  1K56 A;  3MXS A;  4LCM A;  2ZQA A;  3RXX A;  4QD4 A;  4JF5 A;  3BEC A;  1H8Y A;  1NZU A;  5TGF A;  3G32 A;  2GDN A;  4P6B A;  1DJA A;  4RRB A;  2HPB A;  4KG5 A;  4RVA A;  4YFM A;  1S6R A;  4NK3 A;  3Q1F A;  4S2L A;  4R1G A;  3LY3 A;  3S1Y A;  1Y2Q A;  1XGI A;  3KNF A;  1K55 C;  3P98 A;  5HW3 A;  3N8S A;  4PM9 A;  4RR8 A;  5DF8 A;  4RRQ A;  4RA7 A;  1LL5 A;  3UPP A;  1ERO A;  3BEB A;  4P85 A;  2ZQD A;  4OON A;  4X53 A;  2BG1 A;  3BFD A;  4N1H A;  1CEG A;  1XX2 A;  3SS3 A;  2HL2 A;  3Q7V B;  5FAS A;  1ESU A;  1WYB A;  5EEC A;  5A91 A;  2ZMA A;  3HBR A;  1NZO A;  4OVD A;  2UWX A;  4QJG A;  2RCX A;  5A90 A;  4GDB A;  4IVK A;  5GHX A;  5TR7 A;  4FSF A;  4ZJ3 A;  3MZD A;  4NBI A;  1PWC A;  4RYE A;  4X68 A;  1KGE A;  2J9O A;  1KGG A;  2ZC6 B;  3PBQ A;  1K54 C;  2EX6 A;  3G2Z A;  2IWB A;  2EX9 A;  5BOH A;  4RR6 A;  1PYY A;  3A3E A;  3V39 A;  1K54 A;  3NCK A;  4GNU A;  2Y2P A;  1O7E A;  5FI7 A;  5HAI A;  3PBT A;  3G30 A;  5E43 A;  3PD3 A;  2XD1 A;  2Z2M B;  1BT5 A;  2ZM2 A;  3HLD A;  4B4Z A;  4S0I A;  4RRD A;  4C3Q A;  5HAP A;  3FWL A;  4GD8 A;  5FQ9 A;  5GLA A;  2XFS A;  4XUZ A;  2Z2L B;  4P0M A;  4Y7P A;  3ZGA B;  5FAQ A;  1GHM A;  2ZQ7 A;  4N9K A;  1PI5 A;  3NY4 A;  1DJC A;  4QU3 A;  2JCH A;  4KZ6 A;  1YQS A;  1WYC A;  4JXV A;  4R3J A;  3LMV A;  1KE0 A;  1E4D A;  3A3J A;  4JLF A;  3UPN A;  1ZG6 A;  1AXB A;  4WZ5 A;  5FAO A;  5EVI C;  1FSY A;  1K56 D;  4N1X A;  3HLW A;  3LO7 A;  5EVI A;  3KOD A;  5M19 A;  3IWQ A;  4JXG A;  1GA9 A;  4KZA A;  5F1G A;  5J8X A;  1E3U D;  3KO4 A;  3OPP A;  1KDS A;  2HDQ A;  3A3F A;  3SOI A;  2WGW A;  3UE0 A;  2R9X A;  3FKW A;  1JWZ A;  1K25 A;  2Y2K A;  3V3S A;  1SDN A;  1U60 A;  1YLY A;  4ZAM A;  3WRT A;  3G4P A;  4X55 A;  2XEP A;  2Y2I A;  3HLB A;  4XUX A;  3WS0 A;  2P9V A;  3WS4 A;  4D2O A;  5L2F A;  4RRH A;  2HKZ A;  4OOY A;  2X71 A;  2ZD8 A;  3VSL A;  3C5A A;  5CRF A;  4E6W A;  1BSG A;  2H0T A;  4BLM A;  3HRE A;  1N4O A;  2HP9 A;  5FI2 A;  5GHZ A;  4S2K A;  3MKE A;  4WEJ A;  1J7G A;  4RRC A;  4OLG A;  3QHY A;  1EI5 A;  4S2J A;  2ZQ8 A;  3CZD A;  4RRF A;  3ISG A;  3DW0 A;  4DDS A;  1IEM A;  3VFH A;  3ZDJ A;  3M6H A;  4MEZ A;  5KSH A;  1Y54 A;  2XH9 A;  1K4F A;  2WZZ A;  1ZKJ A;  1JTD A;  1YLP A;  2EFU A;  4OPY A;  5EPH A;  4ZJ2 A;  4BL2 A;  4F94 A;  2WAD A;  4QHC A;  5F82 A;  2IWD A;  2OLU A;  4BL3 A;  1IYQ A;  5CGW A;  5FAT A;  3EQV A;  3IH9 A;  5CEB A;  2JE5 A;  4JPM A;  4OH0 A;  3W4Q A;  4BQM A;  4S0J A;  4RRJ A;  3UE3 A;  3UNW A;  1QMF A;  3G2Y A;  1PZO A;  1PWD A;  3IHA A;  3P09 A;  1ONH A;  4GKU A;  2EXA A;  2CC1 A;  5M1A A;  1XA1 A;  1CEF A;  1NJ4 A;  5CTM A;  2JBF A;  2EFX A;  3IXH A;  1PI4 A;  4GN2 A;  5KZH A;  3PBO A;  4C6Y A;  1RGY A;  3UN7 A;  2FFY A;  1PW1 A;  2WZX A;  3KOB A;  1GA0 A;  5D3O A;  4GZB A;  4WMC A;  5KSC A;  2HL0 A;  3AGF A;  4KZ9 A;  1BTL A;  4UA6 A;  3G31 A;  4U3T A;  4OOM A;  3KO5 A;  4OPR A;  3E2L A;  3DWZ A;  4RRK A;  1RGZ A;  3OC2 A;  3M2K A;  4KZ5 A;  3UDX A;  4S2O A;  2Y2J A;  2J7V A;  1SHV A;  4LV0 A;  1BLH A;  3ITA A;  1HD8 A;  4MBK A;  2Y2N A;  3ZHH A;  5CXW A;  3S22 A;  5JYP A;  3OPL A;  5FQJ A;  3WS2 A;  1CI9 A;  2X01 A;  3KNP A;  5F1F A;  3LCE A;  2JC7 A;  2E8I A;  2HP5 A;  3M2J A;  4PM8 A;  5AQ9 A;  4OQ0 A;  3ZVT A;  4JXS A;  5GLB A;  1I2S A;  3VP4 A;  3BLS A;  1ES4 A;  4EUZ A;  4IVI A;  1LI0 A;  1M40 A;  2WKI A;  1NY0 A;  3SH9 A;  3PAE A;  1MWT A;  4BD1 A;  5A93 A;  3V50 A;  1L0D A;  4RR9 A;  2RL3 A;  2P74 A;  1ALQ A;  3D4F A;  2Y2L A;  4WYY A;  2A49 A;  3JYI A;  1ERM A;  2Y2M A;  4RRR A;  1IYP A;  3BRM A;  3SH8 A;  4KG2 A;  3N6I A;  3OCL A;  2QMI A;  4KG6 A;  4ZBE A;  3W4P A;  4S2I A;  1G6A A;  1Z6F A;  4Y0T A;  4DF6 A;  3TOI A;  3TSG A;  4Y0O A;  2DCF A;  2HL1 A;  4DE1 A;  3UE1 A;  1FCO A;  1NYY A;  4PM5 A;  5J61 A;  1MPL A;  3IF6 A;  3GSG A;  4U0T A;  4MLL A;  4N9L A;  4RX2 A;  3EQU A;  5GLD A;  1MKI A;  2Y2O A;  4KQR A;  3TG9 A;  1DJB A;  4WZ5 C;  1ES2 A;  2WGI A;  3C4P A;  4UA7 A;  4RRG A;  4JF6 A;  4O7D A;  4XXR A;  1GCE A;  5FQQ A;  2ZJ9 A;  2C6W B;  1ZG4 A;  3B3X A;  3LY4 A;  2WUQ A;  1BLS A;  3BLM A;  4S0K A;  4OPZ A;  1H8Z A;  1W8Q A;  2VGJ A;  3ZNT A;  3ZG7 B;  2Y2Q A;  2XR0 A;  3Q81 A;  1XXM A;  1G68 A;  4E3M A;  4JKT A;  1I2W A;  1E25 A;  1FCN A;  1W79 A;  1YLZ A;  3QNB A;  3UDF A;  4X69 A;  3IT9 A;  1TC5 A;  5E2F A;  3PAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...