5CEDA

Penicillin g acylated bd3459 predatory endopeptidase from bdellovibrio bacteriovorus in complex with immunity protein bd3460
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
401
structure length
381
Chain Sequence
MVYLNSMCHMAANSKTQQIQGDDNKDDKFPLASISKVVTTLWAVDRLGPDYRFKTKLHVTPTANGSYDIHIEGSRDPLFGRNMSYFLISELNRMKITKIEKLTFDENFLLAWQASIVRATLTSSFATAISPGYYTILKTKAARIGVQMSNRPKIDVRTISFVKKAEFQKNEKSTTMVLMSAPLKTILKRMNNQSNNYIADNLYWNLGGTEAFNAYIAGKMQADTSDIEFHNGSGNNEGSVAKPVYNEATCEMMIKVLYSLDKSLSAKGYDLSDVMAVAAKDKASTVGSYGGVMAGSTTAKTGSVNKAKTLMGSVSTKNGEIYFAVLMHTDYDKSRSDWGVASQQIKNKVSQLINQNGGPKAIKYTEQLPLPFDKYSYLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bd3459
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus hd100
molecule tags Hydrolase
total genus 132
structure length 381
sequence length 401
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5cedA01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 5cedA02
4X68A 4WZ5C 3BLSA 3A3DA 1H8YA 5KZHA 4LV0A 3WS0A 3VP0A 1DJBA 4C3QA 4PMAA 3HLEA 5DTKA 3FYZA 4OPRA 1IYSA 2FFFB 3NDEA 3BFDA 3NY4A 4E3MA 4OQHA 1CEGA 1BUEA 3AGDA 5CRFA 4BENA 4E6WA 2B5RA 3FZCA 1E3UD 4UHUA 5EVLA 3GTCA 2HDQA 4Y0TA 3ZG9B 5CHMA 3CG5A 5AQAA 1WYCA 4Z9QA 3GR2A 4KZ3A 2FFYA 4CPKA 4KZAA 3Q07A 4D2OA 4QY5A 5FQKA 1KGGA 1XX2A 5HAPA 2WGWB 4FCFA 4IVIA 2XFSA 4OPQA 1L0EA 4KZ5A 3O86A 3DTMA 4WMCD 5IHVA 1MWUA 4S2JA 3GQZA 3UE1A 1L2SA 3UPPA 3MZFA 1KVLA 2V20A 1FQGA 1K57C 1K55A 4UAAA 4XUZA 1ES3A 4R4RA 2ZJ9A 3OZHA 5L2FA 3OCLA 3CZDA 3MZDA 1K6RA 2HP5A 3ISGA 2WK0A 3A3EA 3MXRA 3W8KA 1LL5A 3V5MA 1ERQA 2EXAA 2WGWA 3NC8A 4ZJ1A 1XPBA 3ZG7B 3VP3A 3VOZA 4E3IA 4KG6A 5FI2A 3UPNA 2OLUA 4E3NA 4BL3A 1CI9A 4X55A 2JBFA 1YLYA 1NXYA 4OH0A 5U47A 2WZZA 3SS5A 5FAQA 3OC2A 3MKFA 2WUQA 5AQ7A 1L0FA 1TEMA 3O88A 1GA9A 4OLGA 3PBRA 2P9VB 3IQAA 2A49A 2ZQAA 1MWSA 2Z2LB 5GHYA 5EECA 3GMWA 2PU4A 3V3RA 1O7EA 5HX9A 3BFGA 4OKPA 1E4DA 3IXGA 4QD4A 1M6KA 4S2NC 3EQUA 2XD1A 4DE2A 4S2PA 2IWDA 1NYMA 2VGKA 5EOEA 2PBYA 4JXVA 4X6TA 3W4PA 5FI6A 4S2KA 3ZCZA 1K38A 2Y2KA 5FA7A 4DE0A 4R1GA 5KSHA 1ESIA 3ZG8B 4JF4A 1KDWA 2OLVA 3C4PA 3UNWA 1PI5A 2H0TA 3AGEA 1HTZA 4L0LA 4N1HA 4E3LA 4S2OA 4ID4A 1CK3A 1J9MA 1GA0A 4MBHA 5JYPA 1E25A 2Y2JA 4EQIA 4OP5A 4OVDA 4MLLA 1FSWA 3G4PA 5EVIC 1O07A 3VP2A 2X71A 5EE8A 2HP9A 3HUNA 3MXSA 4E3KA 3C7VA 1DJAA 3PAGA 2WYXA 4LV1A 1KGFA 2V2FF 3HLCA 5AQ9A 5HAIA 4F94A 3C4OA 4O7DA 4KZBA 1S0WA 1XGIA 2J7VA 2R9WA 3DWKA 1K4EA 1ONHA 2XD5A 5FQ9A 1FOFA 5TGFA 4EV4A 4ZJ2A 5GLAA 5FASA 5HAQA 3ZG0A 2XK1A 3HBRA 5A92A 1QMEA 2ZC5B 1GHMA 1LI9A 1PWCA 1PZPA 1Z6FA 2H5SA 3IF5A 1HVBA 3HLBA 2QZ6A 4KQRA 3PBQA 5FQQA 4EBLA 3LCEA 3NI9A 5CGWA 4QY6A 3BFEA 3ZDJA 1IKGA 1HD8A 4ZAMA 3PBOA 4QB8A 3IXHA 1FR1A 1NRFA 3UO9A 1SKFA 3MFDA 1QMFA 1EWZA 4KZ9A 1OMEA 2JE5A 3HUOA 3ZGAB 3NBLA 3IWQA 3S4XA 5I94A 2WAFA 2ZM0A 3ITAA 4PPRA 3IHBA 1ZKJA 1DJCA 4JPMA 1K56A 2HDSA 4U3TA 3VP4A 1K54C 2XF3A 3LO7A 4QHCA 1ESUA 1FSYA 2Y2GA 4E6XA 2DNSA 1ZG4A 4OQIA 4GZBA 3WS5A 1L0DA 4FH2A 1MKIA 4WZ5A 5CGXA 2IWCA 2DCFA 4GB7A 4X53A 1W5DA 1ERMA 2EX6A 4JXSA 4QJGA 3G34A 1K54A 4JXWA 1BLPA 5EPHA 1KGEA 1ONGA 1IYOA 1FR6A 5GHXA 1BLCA 3FKWA 1I2WA 3E2KA 4XUXA 3MZEA 3FWLA 4GNUA 2WKEA 5HW3A 1IEMA 4LV2A 2ZC4B 4OP8A 1YLTA 3NDGA 4PM7A 1YLWA 4EWFA 4BQMA 4JF6A 1PWGA 3M6BA 4ZDXA 1PIOA 4GDBA 2OSUA 1JWPA 1PZOA 3N4IA 2R9XA 4R4SA 3M2JA 1IELA 1XGJA 3QNBA 4P6BA 2BG1A 1MXOA 5GHZA 1BZAA 4NETA 4KZ7A 3OPLA 4GN2A 4GD8A 3MBZA 3S22A 1K57A 1RCJA 5CHUA 4N9LA 1L0GA 5A91A 4IVKA 4OPZA 2X02A 4MBFA 3GSGA 1MWRA 4IBXA 1I5QA 1RP5A 2GDNA 4NK3A 1YM1A 2IWBA 4HBTA 1E3UA 4X69A 1Y54A 5FQJA 5CERA 1PWDA 3VSKA 1H5XA 2XQZA 3BFFA 4OPYA 4RVAA 3ZNTA 4M3KA 5GLBA 5M1AA 4CJNA 3G32A 4IBRA 4PM6A 1YMXA 2EX9A 3BM6A 5G18A 1WYBA 3SS4A 3HVFA 5DVAA 5KSCA 4GKUA 2Y2PA 3Q81A 5CECA 4JF5A 4OOMA 1GCEA 3ITBA 1SDNA 4KQQA 2J8YA 1FCOA 2Y59A 3OPRA 4YINA 3G31A 3NCKA 3IT9A 1EROA 4PM8A 3RXWA 4GOGA 3TOIA 3WS1A 2HPBA 3OPPA 4S2NA 3IH9A 5FSRA 5EOOA 5F83A 4FH4A 2QPNA 4S2IA 4Q8IA 4OLDA 5EVIB 1IYPA 3G35A 3PBNA 1BLHA 3I7JA 1H8ZA 1FCNA 4BLMA 3PTEA 4C75A 2H10A 1Q2QA 2CC1A 1BULA 2WZXA 2ZC6B 2H0YA 2Y2IA 2ZQ8A 4B4ZA 3G2ZA 4KG5A 5E2FA 2Y91A 4HBUA 4WM9A 3W4QA 4P87A 4A5RA 3TG9A 1YT4A 1YLPA 2G2UA 4X56A 2EFXA 1YMSA 2V1ZA 5CEBA 2Y2NA 4OOYA 1PW1A 5EVIA 3SH8A 3GRJA 3SS3A 4BJPA 3HUMA 3Q7VA 3VSLA 4LCLA 1LI0A 1KE4A 3HLGA 4OOLA 3DWZA 1RGYA 1S6RA 1W8YA 1LLBA 1ZG6A 5CTNA 2HDUA 1M40A 4JKTA 2HDRA 2G2WA 1CI8A 1KE0A 2ZMAA 3AGFA 3G30A 4RYEA 3SOIA 4E3OA 3LY4A 1AXBA 1BT5A 4WZ4A 2Q9NA 2XR0A 1HZOA 3CJMA 3LY3A 3RXXA 3PBSA 2JCHA 5FATA 1TDGA 1MPLA 3VFHA 1JWVA 4BD0A 3WRZA 4DDSA 3C5AA 3O3VA 1ES4A 1NZOA 4ZTKA 2E8IA 3IHAA 5HL1A 2Z2MB 1DY6A 5E2EA 3HREA 1YLJA 2C5WB 2I72A 5E2GA 4LENA 1ES5A 4K0XA 4WBGA 5D3OA 4RX2A 3ZHHA 2XGNA 1C3BA 4S2MA 1NJ4A 2WADA 2EFUA 4KZ4A 3ZVWA 3QNCA 5DF7A 4K91A 1YQSA 4S2LA 3EQVA 5FDHA 3VFFA 4N92A 3MKEA 3BEBA 4RA7A 3V50A 3ZFZA 4H8RA 4PM9A 5DF9A 2Y55A 1JWZA 1ES2A 3IF6C 2EX8A 1BTLA 3D4FA 3CMZA 1ALQA 5CTMA 4R3BA 2ZC7A 4JLFA 4MNRA 3N8SA 1YLZA 2ZM2A 4N1XA 3WWXA 3ZG5A 1IYQA 4P85A 3M2KA 3UY6A 2J9OA 4UA7A 5M18A 5F1GA 3HLWA 3IF6A 4BL2A 4DRTA 2ZQCA 4JBFA 1EI5A 4Y0OA 1N9BA 3UDIA 5CEDA 4B4XA 3GV9A 1KDSA 4IEDA 3ZNYA 4KZ8A 1TVFA 1W8QA 4DF6A 3BYDA 3BFCA 3BRMA 3O87A 1CEFA 2ZQDA 1NYYA 1BLSA 4OQGA 1GHIA 5DTSA 1MBLA 5AQBA 1G6AA 2WGVA 2XLNA 5CXWA 5FAPA 3FV7A 3A3IA 1JTDA 2RL3A 2UWXA 4HEFA 4KQOA 1W7FA 2P74A 2EXBA 4ZBEA 1K55C 4DE1A 1VM1A 4LV3A 4DXCA 5A90A 5EUAA 4R23A 5DF8A 1XA1A 2X01A 5HARA 2DRWA 3Q82A 1K4FA 3BECA 1SHVA 3LEZA 3UE3A 2OV5A 1BSGA 4UA9A 4C6YA 1XA7A 2XFTA 3N6IA 4KENB 1NY0A 2BLSA 2Y4AA 4OQ0A 3NIAA 4GD6A 4DKIA 2WKHA 2J9PA 4R0QA 4U0TA 3SH9A 1K25A 1FCMA 4EUZA 4KZ6A 5A93A 4R3JA 2Y2OA 3UDFA 3IXDA 3A3JA 4WMCA 1LHYA 1I2SA 1MWTA 5TR7A 3WRTA 4N9KA 1NZUA 3VMAA 3UN7A 3JYIA 5FI7A 5F82A 5TFQA 3E2LA 3Q1FA 3OCNA 3M6HA 4P0MA 4PM5A 4RX3A 2C6WB 2HP6A 5EVID 3N7WA 4UA6A 3Q7VB 4WEJA 1RGZA 5JYOA 4YFMA 1XKZA 1G68A 2WGIA 2Y2MA 5E43A 3C7UA 1SCWA 3IWOA 2XH9A 5DTTA 4Y7PA 4EBNA 3OPHA 1LL9A 1U60A 4DDYA 1W79A 2ZLYA 4E3JA 4GDNA 1GHPA 3IWIA 4WYYA 2Y2LA 4HESA 3B3XA 3ZVTA 3S1YA 5FQIA 2RCXA 5F1FA 1K6SA 5CGSA 4WELA 4EBPA 3N8LA 5BOHA 3G2YA 3IH8A 3PAEA 4Y0UA 4DE3A 2QMIA 3HLFA 4LCMA 2ZD8A 2P9VA 2VGJA 1ZC2A 4OONA 1TDLA 2Q9MA 3GVBA 3BLMA 4K0WA 3V39A 2XDMA 1N4OA 2WKIA 3WS2A 1PYYA 1JVJA 1K56D 2Y2QA 5M19A 5GLCA 3FKVA 5CHJA 3P98A 4DXBA 5KMWA 1PI4A 3PBTA 1Q2PA 5FAOA 4FSFA 3V3SA 2PU2A 3WS4A 2A3UA 1XXMA 3VP1A 2WAEA 4ZJ3A 4JXGA 3P09A 3QHYA 4U0XA 1WE4A 1SDEA 2EX2A 2ZQ9A 5E2HA 5GL9A 4B88A 3HL9A 3IXBA 3UPOA 5FQMA 4BD1A 3W4OA 3HLDA 2ZM8A 4FD8A 3RJUA 1KVMA 3Q7ZA 2ZQ7A 3N8RA 2ZC3B 3SH7A 3A3FA 1IKIA 1KE3A 4MEZA 3UDXA 3VOYA 5GLDA 2Y2HA 4MBKA 1VQQA 2JC7A 3IF6B 3TSGA 1JTGA 5HFOA 4QU3A 2XEPA 4KG2A 1XP4A 1MY8A 5J8XA 3UE0A 1PW8A 4XXRA 4WEKA 3DW0A
chains in the Genus database with same CATH superfamily
3T4QA 4CLCE 4X68A 2P08A 3BLSA 3JPUA 4GLQA 2UV0E 1WA9A 4ARZB 1DJBA 4C3QA 3HLEA 3LIEA 2W3FA 1T1AA 3O5YA 2Q0OA 3DTEA 1CEGA 2B5RA 1E3UD 4UHUA 2W3DA 3CG5A 4GS9A 3S7OA 4QY5A 1CJFA 1XX2A 3CPTB 4MN7A 4FCFA 1ZHHB 4KZ5A 3E0YA 3O86A 3MQQA 5IHVA 2BASA 3GQZA 4HY8A 5F68A 3UB7A 4XUZA 1ES3A 3TW8A 4LRXC 3MZDA 3ISGA 2PYPA 4L9FA 2WGWA 4ZJ1A 3VOZA 3KNPA 3UPNA 2OLUA 1NWZA 4EQ1A 4BL3A 4X55A 5F6AA 3S7QA 5U47A 4GJ4A 4AFIA 3PD2A 3NOTC 1L0FA 1V9ZA 3QP8A 2P9VB 3IQAA 2Z2LB 3GMWA 3MMHA 3VE3A 5HX9A 3BFGA 4OKPA 1E4DA 4S2NC 1M6KA 1AWIA 2V8FA 2PBYA 3DTIA 4JXVA 4X6TA 1K38A 3TE8A 1ESIA 3KSGA 4L0LA 1HTZA 4S2OA 4WN5A 1E25A 2Y2JA 4HQAA 1TC5A 4OVDA 4MLLA 4PHTA 1FSWA 3G4PA 3W2ZA 1IOUA 2X71A 1S1ZA 2HP9A 4Y13A 3MXSA 4ME4A 1D06A 1KGFA 2V2FF 2G7UA 1D1JA 3DWKA 4EV4A 4UQIS 2JKTI 3HBRA 1Z6FA 2H5SA 1HVBA 3UB8A 3QP4A 4IUKA 1HD8A 4ZAMA 3PBOA 3IXHA 3UO9A 3MFDA 2VGLS 5I94A 4HJ6A 3S4XA 2WAFA 2ZM0A 2WKRA 5I5LA 1ZKJA 3VP4A 2XF3A 3BY9A 1ESUA 4FH2A 3H82A 2EX6A 4BBUA 1BLCA 1LSWA 2EA9A 5IU1A 2A24A 4KQDA 4XT2A 3VV4A 3T4TA 1PIOA 3M2JA 4DJ3A 1XGJA 3L9KA 3E4OA 2BG1A 4KZ7A 3KO7A 4WL9A 4JGPA 4N9LA 3JVUA 3L7HA 2X02A 1MWRA 1YM1A 2IWBA 1E3UA 4X69A 3VSKA 4LLOB 4RR8A 2XQZA 2EX9A 3BM6A 5J7EA 3HVFA 4JF5A 2Y59A 2VX8A 4K08A 3RXWA 1S67L 2PR5A 2ZOHA 4S2NA 3IH9A 4PKYA 5EOOA 4FH4A 4Q8IA 5EVIB 1IYPA 1H8ZA 2VJWA 4I3IA 1BULA 2H0YA 4B4ZA 1T1BA 4BMWA 3W4QA 3D9YA 2ZBBA 2W3HA 1PW1A 2GNXA 3HLGA 3DWZA 1VEUA 1S6RA 1W8YA 1XJ3A 4JKTA 3CI6A 2YKFA 1KE0A 3AGFA 2CMNA 3SOIA 2HJ9C 5FL3A 1TS8A 3PBSA 2JCHA 5FATA 1TDGA 2GZAA 5HL1A 1N9OA 3OBFA 1ACFA 1YLJA 4LENA 4WBGA 4KZ4A 3C8CA 3KX0X 1J3WA 4K91A 1YQSA 1S4RA 3VFFA 3A0SA 3KSHA 3BW6A 3ZFZA 1XFNA 4NBIA 1ES2A 4BBTA 3D4FA 3KO3A 1ALQA 4R3BA 4F3LB 4MNRA 3N8SA 4P85A 2J9OA 4UA7A 2K31A 3PD5A 4NXGA 2ZQCA 1V9YA 3LMTA 4JBFA 4Y0OA 5KIZA 5EVEA 4B4XA 3GV9A 4KZ8A 4DF6A 3CWFA 1GHIA 3LIFA 3KODA 1MBLA 2B18A 2HGVA 2WGVA 1KOUA 2XLNA 5FAPA 4O8GA 4ARZA 2UWXA 2XA7M 4HEFA 4KQOA 3NOUC 4ZBEA 4DXCA 4LV3A 3KSIA 5HPFA 1SHVA 2OV5A 3MR0A 2Z6DA 3N6IA 2BLSA 1TS0A 3NIAA 4GD6A 2WKHA 2J9PA 5L8MA 2J3WA 3SH9A 2GJ3A 2VKSA 3CPTA 2EWVA 3IXDA 2FZ0A 4JGOA 4WMCA 1LHYA 4R3AA 5TR7A 3WRTA 4N9KA 3TRCA 1NZUA 3VMAA 3Q1FA 3M6HA 2I9VA 2C6WB 3F1OB 1OJ5A 5EVID 3RFBA 2WGIA 5E43A 3IWOA 3OPHA 4P6ZS 1N9LA 1W79A 1YPRA 2ZLYA 1GHPA 4RRIA 1P9WA 3BQ8A 4HESA 3S1YA 4EBPA 2NUTC 3N8LA 3G2YA 4RRKA 4DE3A 2ZD8A 2P9VA 2R78A 2VGJA 1MC0A 2O9BA 1XJ2A 4K0WA 3V39A 1N4OA 1JVJA 1K56D 2Y2QA 5HWVA 5M19A 4E04A 2Y79A 3PBTA 1MZUA 1Q2PA 1L3LA 5FAOA 4FSFA 1T19A 3QHYA 4U0XA 5LBRA 2EX2A 2JKTM 4FUWA 4NXFA 3VOYA 2JC7A 1JTGA 1XP4A 3ZQ5A 4I38A 2LB5A 3DW0A 3IS2A 5TJJA 2P04A 5AJGA 3A3DA 1H8YA 2OAQ1 4PMAA 3FYZA 4OPRA 2FFFB 3NDEA 3NY4A 2H28A 4S0JA 4BENA 3A0VA 3AGDA 5CRFA 4HI4A 4LRZE 5EVLA 2HDQA 2HV1A 5AQAA 1WYCA 1YSQA 3GR2A 4KZ3A 4KZAA 4D2OA 4Q0JA 4YOFA 4IVIA 2XFSA 1L0EA 2W3GA 1L2SA 3MZFA 1KVLA 5CX7A 1K57C 2HL2A 5G4YA 4R4RA 3OCLA 1LL5A 2IA2A 4JGRA 3NC8A 3ZG7B 1XPBA 3VP3A 2OOLA 3CAXA 4E3NA 3JVVA 3LMUA 1NXYA 2WZZA 3LIAA 3SS5A 4DJ2A 2JKRI 3OC2A 5AQ7A 1GA9A 4OLGA 2A49A 2ZQAA 5GHYA 4R6LA 5EECA 4WF0A 1O7EA 5EM0A 3EQUA 2XD1A 4DE2A 1S4SA 4S2PA 5EOEA 3W4PA 4ETXA 5FI6A 2Y2KA 4DE0A 4WLAA 5KSHA 2YKHA 3ZG8B 2OLVA 5TBMA 4RRDA 2H0TA 4NXEA 3LEQA 4ID4A 1CK3A 1GA0A 4MBHA 1LSXA 2KOIA 3B47A 5HSQA 5EE8A 1DJAA 4LV1A 5HAIA 1SKOB 5AQ9A 4F94A 4O7DA 1XGIA 2J7VA 4MN6A 1DP6A 1FOFA 2K2NA 4RRMA 3ZG0A 3PYPA 1QMEA 2ZC5B 1GHMA 3IF5A 3EEAA 2QZ6A 3CUEC 1Y4OA 4EBLA 3NI9A 5AVFA 5CGWA 4QY6A 3BFEA 1FR1A 1SKFA 2EWWA 1QMFA 2JHEA 3ZGAB 4KZ9A 4CLCB 3NBLA 4PPRA 3IHBA 1DJCA 1K56A 1UGUA 4QHCA 1ODVA 2VV6A 4Y5FA 4GZBA 1L0DA 1MKIA 4JGQA 4GB7A 4JXSA 1DRMA 3OLOA 3G34A 4QJGA 4JXWA 1P0ZA 1KGEA 2K7SA 1IYOA 4QPRA 5GHXA 2AVXA 2O0YA 3MZEA 4M4XA 3FWLA 5HW3A 4LV2A 5MC7A 2ZC4B 4PM7A 4BQMA 3IX3A 4G3WA 4JF6A 4HJ3A 2OSUA 1N9NA 2R9XA 4HH3A 2OWHA 1TF1A 3KOBA 1BZAA 2L4RA 4NETA 3MBZA 3S22A 1K57A 1RCJA 5CHUA 4OPZA 4D60A 4MBFA 3GSGA 5FEFA 1I5QA 1RP5A 2GDNA 5CERA 1PWDA 1H5XA 4CJNA 5M1AA 4IBRA 1P97A 3BQAA 5G18A 5KSCA 5DVAA 3EEHA 3Q81A 3LYXA 3ITBA 3EGDC 4KQQA 3E4PA 1J7GA 3G31A 3NCKA 3IT9A 4PM8A 3BWLA 4GOGA 3WS1A 2HPBA 5HDDA 3E98A 3VOLA 4S2IA 2QPNA 4NG2A 4BLMA 3PTEA 4C75A 3KO5A 3CLOA 3G2ZA 4A5RA 4P87A 4II7A 1YT4A 2G2UA 4X56A 1UWPX 2WKQA 2V1ZA 5CEBA 3GRJA 4R70A 4GHIB 3KYQA 3VSLA 4MN5A 1M40A 2HDRA 2G2WA 2ZMAA 4RYEA 3LR5A 1HZOA 3RXXA 1MPLA 1JWVA 4BD0A 4PKYG 3O3VA 3CUEA 4CLCD 3T50A 1G28A 3IHAA 3HREA 1ES5A 4K0XA 5D3OA 2XGNA 4G3VA 1NJ4A 3F1NA 3T1QB 4N92A 1YKDA 4S03A 3ULFA 2Y55A 1DP9A 2EX8A 1BTLA 5CTMA 4IHQA 3MF0A 4JLFA 2KDKA 1YLZA 2ZM2A 4RRGA 3UY6A 2V8CA 4BL2A 1N9BA 4IEDA 3ZNYA 1GSVA 1W8QA 3O87A 2V0WA 5DTSA 2JKFA 2QYBA 3FV7A 1JTDA 3BJNA 4ESPA 4EXOA 2P74A 1K55C 5EFWA 1GSWA 5DF8A 2X01A 5IS1A 5HARA 2DRWA 3Q82A 3BECA 4NEED 1ZTUA 3T4KA 1TS7A 3RTYA 4R0QA 4U0TA 2V0UA 4KZ6A 5A93A 5C5KA 2Y2OA 3UDFA 3A3JA 2XA7S 1G5UA 5FI7A 2PDRA 5F82A 5TFQA 2JKRM 4RX3A 4EETB 2HP6A 1OT6A 1VETB 3Q7VB 1UWNX 3IBJA 5FDSA 1YSPA 4EBNA 2XH9A 4Y7PA 4DDYA 4E3JA 2Y2LA 4LGWA 3PAEA 2QMIA 4LCMA 2PRFA 1ZC2A 2XSSA 2PD7A 2XDMA 1NRJA 5HDCA 3UB9A 2WKIA 1PRQA 3GDIA 4DXBA 3P98A 4LPZA 5KMWA 4RRQA 1PI4A 3NJAA 2PU2A 3WS4A 2A3UA 2WAEA 4ZJ3A 3B42A 4JXGA 3P09A 5GL9A 3HJIA 2VEAA 5E2HA 3HL9A 5AVEA 3T4LA 3SH7A 3A3FA 1IKIA 1KE3A 1IFQA 5GLDA 4MBKA 1F5MA 3IF6B 2PR6A 1SKOA 4QU3A 2ZL1B 4HH2A 1MY8A 2D01A 5J8XA 3UE0A 1PW8A 4WEKA 3FPVA 5KZHA 1JKEA 3WS0A 3VP0A 5DTKA 3H9WA 1OTEA 2ZL1A 2DBOA 1BUEA 4E6WA 4CLCA 5J4EA 4RRFA 3FZCA 4Y0TA 2PYRA 5FEGA 2M7VA 4LFUA 1OTAA 4O01A 3PD3A 4EUVA 3Q07A 3R7WB 2PT7A 5FQKA 1VHMA 3CITA 2WGWB 4OPQA 4RR6A 1MWUA 4S2JA 1FQGA 1K55A 4UAAA 2ZJ9A 3OZHA 3CZDA 2HP5A 3A3EA 3MXRA 3W8KA 5DKLA 3V5MA 1ERQA 2EXAA 3OOVA 4E3IA 5HZHA 4KG6A 5FI2A 1XJ4A 2QJ5A 3LIDA 2V9AA 2JBFA 3KSFA 3O88A 1TEMA 4L9EA 3B33A 3PBRA 1MWSA 4YNRA 3V3RA 3IXGA 4QD4A 2O9AA 3U2AA 3K3CA 3ZCZA 2PAVP 4JF4A 3UNWA 1J9MA 3VE4A 4OP5A 2Y8HA 2ZMFA 5EVIC 1TD5A 4IUHA 1T1CA 3HUNA 3PAGA 1S66L 4KZBA 2R9WA 1ONHA 2XD5A 4Y2FA 4ZJ2A 5HAQA 2XK1A 5A92A 1PWCA 1LI9A 1PZPA 3HLBA 4S0IA 3PBQA 3LCEA 5K5BA 3ZDJA 4X1MA 3TJZC 3E4QA 4I3JA 1NRFA 4GHIA 1EWZA 3HUOA 3IWQA 3ITAA 3S7NA 4JPMA 2HDSA 3LO7A 4E6XA 2DNSA 1ZG4A 5J3WA 3WS5A 5DKKA 2A24B 5CGXA 1W5DA 2OKVA 1MKMA 1K54A 1FR6A 3FKWA 1I2WA 3E2KA 4QWOA 4Q0IA 1IEMA 3NDGA 3PXPA 3LI8A 2QKPA 1YLWA 4EWFA 1PWGA 3M6BA 4ZDXA 2VLGA 1F98A 3F1PB 4B93A 4UEYA 1IELA 4EU0A 4MDZA 3QP2A 3QNBA 3KNFA 5L10A 1MXOA 2M7UA 2BTFP 4GD8A 2FH5A 1OTBA 1L0GA 5A91A 3C30A 4HBTA 1Y54A 5FQJA 3ZYTA 3C38A 4OPYA 4M3KA 3G32A 4RRLA 1YMXA 4P6ZM 3SS4A 1NLZA 4OOMA 1GCEA 1SDNA 4HP4A 2J8YA 1FCOA 4EW7A 3EGXC 5HD3A 4YINA 4GCZA 1EROA 2L1MA 3TOIA 4ZRRA 4R38A 5IT5A 5FSRA 3G35A 1BLHA 3I7JA 2H10A 1Q2QA 2CC1A 2ZQ8A 4RR9A 4KG5A 2Y91A 4YWZA 4HBUA 4WM9A 1S1YA 3TG9A 3GECA 2J3TD 3K3DA 2EFXA 1YMSA 2Y2NA 4OOYA 5EVIA 4EESA 2XROA 1VETA 3SS3A 4BJPA 3HUMA 3Q7VA 4LCLA 1A0KA 1LI0A 5DFYA 1ZG6A 3UMEA 2HDUA 1CI8A 3G30A 2PD8A 1AXBA 1XJ6A 2Q9NA 2XR0A 3T12B 3LY3A 2O99A 3KOCA 1GSXA 2J3TC 2VK3A 1NZOA 4ZTKA 2E8IA 1DY6A 5E2EA 2I72A 2C5WB 5E2GA 2J80A 3T1RA 4RX2A 4Y3IA 1C3BA 5DF7A 4S2LA 3EQVA 3V50A 4RA7A 1T18A 4PM9A 4BBVA 1JWZA 4RRHA 3CMZA 3PD4A 4N1XA 3ZG5A 3M2KA 5F1GA 3HLWA 3IF6A 1EI5A 3EWKA 3UDIA 2O9CA 1TVFA 3BYDA 1CEFA 2ZQDA 1NYYA 1BLSA 5AQBA 1G6AA 5CXWA 4F3LA 3KYZA 4MCWA 2RL3A 2DMWA 1VM1A 5A90A 5HPIA 5EUAA 4R23A 1LL8A 4L9GA 1K4FA 4RRCA 5L07A 1FIKA 1BSGA 2XFTA 4KENB 4WUJA 1NY0A 4GW9A 4OQ0A 2E8JA 1K25A 1FCMA 3V67A 3R7WA 4EUZA 4R3JA 1MWTA 3E2LA 4PAUA 3OCNA 3U4LP 3KO4A 4HHDA 4Y17A 5JYOA 4YFMA 1XKZA 4HP9A 1G68A 2HL0A 2Y2MA 3C7UA 5DTTA 3LR4A 3H7WB 1LL9A 1VB6A 4WYYA 3ZVTA 3B3XA 5FQIA 5CGSA 5BOHA 2OWJA 4Y0UA 3F1OA 2W27A 3GVBA 1JNUA 3WS2A 1PYYA 3D72A 5GLCA 3FKVA 5CHJA 3LIBA 4DMZA 1FILA 2W1TB 3V3SA 1PFLA 3VP1A 1WE4A 1SDEA 4B88A 3IS2B 4DN0A 4S0LA 3W4OA 4FD8A 3RJUA 2Z6CA 2VV8A 2ZQ7A 4MEZA 1LSVA 1F2KA 1VQQA 1CQAA 3NECA 3EOIA 3SH8A 4I5SA 2ZOIA 2B02A 4WZ5C 4LV0A 1P9RA 3LGOA 5DJTA 4CLCC 4S0KA 3HJKA 4HIAA 1IYSA 3R4KA 1OTIA 3BFDA 4E3MA 4OQHA 3T4SA 3GTCA 3ZG9B 5CHMA 4H6JB 4Z9QA 3HCYA 3DAVA 2FFYA 4CPKA 2OAP1 3ICYA 3UMDA 2W0NA 1KGGA 5HAPA 3QP6A 1W63M 3C2WA 2P7JA 3UB6A 4RRBA 3DTMA 4WMCD 3UB5P 2VA0A 3UE1A 3UPPA 2V20A 4EEUA 1DP8A 5L2FA 3MXQA 1K6RA 2WK0A 4RQ9A 4I39A 1CI9A 3F1PA 5F69A 1YLYA 4X25A 4OH0A 1G6OA 5FAQA 3MKFA 2WUQA 5TBMB 2KLIA 2PU4A 2W3EA 3K2NA 4Q0HA 2IWDA 1NYMA 3P01A 2VGKA 2XRNA 3DBAA 4S2KA 5FA7A 4ETZA 2PBDP 4R1GA 4UQIM 1KDWA 3C4PA 1PI5A 3AGEA 4N1HA 4E3LA 3LI9A 3SW1A 1LT0A 1NLYA 5DJUA 5JYPA 4EQIA 1O07A 3VP2A 4S02A 5HD5A 4E3KA 3C7VA 2VGLM 2PHYA 2WYXA 3HLCA 1Y28A 3C4OA 2ACGA 1S0WA 3NHQA 1BYWA 1K4EA 5FQ9A 5TGFA 5GLAA 4G3KA 5EV0A 5FASA 4KQRA 5FQQA 3FG8A 4FTXA 1IKGA 4QB8A 1OMEA 2JE5A 3MQ0A 4NXBA 4U3TA 4GS9B 1K54C 3IX8A 1FSYA 2Y2GA 4OQIA 2D02A 2V1AA 3UE6A 4WZ5A 2IWCA 2DCFA 5F5YA 4RRJA 4X53A 3DTKA 1ERMA 1SZVA 1BLPA 5EPHA 1ONGA 1H3QA 1Z09A 3MS6A 4XUXA 4GNUA 2WKEA 2HL1A 3CHWP 3LR3A 4OP8A 1YLTA 1D7EA 3P7NA 4GDBA 1JWPA 1PZOA 2V1BA 3LICA 3N4IA 4R4SA 3T4JA 3FPWA 4P6BA 1XFQA 5GHZA 3OPLA 3IBRA 4GN2A 2JKGA 3BY8A 5EM1A 1YAXA 4IVKA 5DFXA 4IBXA 4NK3A 4HNBA 3BFFA 4RVAA 3ZNTA 5GLBA 4PM6A 1WYBA 3LUQA 2W1RA 4GKUA 2Y2PA 5CECA 2INWA 5HL6A 3OPRA 2QHKA 3OPPA 5F83A 1EW0A 4OLDA 3PBNA 4RR7A 1FCNA 2KX6A 3KO9A 2VZWA 2WZXA 2ZC6B 3PHYA 2Y2IA 5HDSA 1OJGA 5E2FA 1YLPA 4CQHA 4LRYC 4X1LA 1KE4A 1OTDA 4OOLA 1RGYA 1LLBA 5CTNA 3H7WA 4E3OA 3LY4A 1BT5A 4WZ4A 3G6OA 3CJMA 3H82B 3F1NB 2GX5A 1CF0A 4IJGA 3VFHA 3WRZA 4DDSA 3C5AA 1ES4A 5G4ZA 2Z2MB 1OPXA 3MJQA 3ZHHA 2HKZA 4S2MA 2QWSA 3KYEA 2W1TA 2EFUA 2WADA 4XT2B 3QNCA 3ZVWA 4KUKA 4O0PA 5FDHA 4MMNA 3FC7A 3MKEA 3BEBA 4H8RA 5DF9A 3IF6C 4HOIA 2L0WA 2ZC7A 4EERA 5HWWA 3WWXA 5M18A 1IYQA 4KUOA 4RRAA 3A0RA 1HLUP 4DRTA 5L09A 3QP5A 5CEDA 1KDSA 2A2LA 3BFCA 3BRMA 3MQOA 4OQGA 4NBJA 4RRRA 3KO6A 1H0MA 3A3IA 3LR0A 2HJEA 2WKPA 1W7FA 4Z1WA 2EXBA 3NULA 4DE1A 1XA1A 1H8MA 2B95A 3UE3A 3LEZA 5J61A 1Y2QA 3T1SA 4BWIA 4UA9A 4C6YA 1XA7A 1K0KA 2Y4AA 4H6JA 4DKIA 3QP1A 2VV7A 3T1XA 2M1CA 2MJ6A 2LB9A 3MSHA 1I2SA 1W63Q 3UN7A 3JYIA 4FOFA 5A8BA 4P0MA 2HZ5A 4PM5A 2QJ7A 3NOPC 1PNEA 3N7WA 4UA6A 4WEJA 1RGZA 1VEUB 1SCWA 4Y15A 1U60A 4GDNA 3IWIA 1TS6A 5F1FA 2RCXA 1K6SA 4WELA 3IH8A 3HLFA 4NKPA 4OONA 1TDLA 3LFVA 2Q9MA 3BLMA 3MFXA 3RH8B 4I3AA 1OT9A 2ZMVA 4EEPA 5HWTA 4B9OA 1F9IA 3PR6A 1XXMA 2HF6A 2ZQ9A 3UPOA 3IXBA 4HJ4A 5FQMA 4BD1A 3HLDA 2ZM8A 1KVMA 3Q7ZA 1X0OA 3N8RA 3SZTA 2ZC3B 3LMVA 1STZA 2JN7A 3UDXA 2Y2HA 3S7PA 3TSGA 2NUPC 5HFOA 2XEPA 4KG2A 3T4OA 3IX4A 3D3OA 4XXRA
chains in the Genus database with same CATH topology
4X68A 4WZ5C 3BLSA 3A3DA 1H8YA 5KZHA 4LV0A 1JKEA 3WS0A 3VP0A 1DJBA 4C3QA 4PMAA 4S0KA 3HLEA 5DTKA 3FYZA 4OPRA 1IYSA 2FFFB 3NDEA 3BFDA 3NY4A 4E3MA 4OQHA 1CEGA 2DBOA 4S0JA 1BUEA 3AGDA 5CRFA 4BENA 4E6WA 2B5RA 4RRFA 3FZCA 1E3UD 4UHUA 5EVLA 3GTCA 2HDQA 4Y0TA 3ZG9B 5CHMA 3CG5A 5AQAA 1WYCA 4Z9QA 3GR2A 4KZ3A 3PD3A 2FFYA 4CPKA 4KZAA 3Q07A 4D2OA 4QY5A 5FQKA 1KGGA 1XX2A 5HAPA 2WGWB 4FCFA 4IVIA 2XFSA 4RRBA 4OPQA 1L0EA 4KZ5A 3O86A 4RR6A 3DTMA 4WMCD 5IHVA 1MWUA 4S2JA 3GQZA 3UE1A 1L2SA 3UPPA 3MZFA 1KVLA 2V20A 1FQGA 1K57C 1K55A 4UAAA 4XUZA 1ES3A 2HL2A 4R4RA 2ZJ9A 3OZHA 5L2FA 3OCLA 3CZDA 3MZDA 1K6RA 2HP5A 3ISGA 2WK0A 3A3EA 3MXRA 3W8KA 1LL5A 3V5MA 1ERQA 2EXAA 2WGWA 3NC8A 4ZJ1A 1XPBA 3ZG7B 3VP3A 3VOZA 4E3IA 3KNPA 4KG6A 5FI2A 3UPNA 2OLUA 4E3NA 4BL3A 1CI9A 4X55A 2JBFA 3LMUA 1YLYA 1NXYA 4OH0A 5U47A 2WZZA 3SS5A 5FAQA 3OC2A 3MKFA 2WUQA 3PD2A 5AQ7A 1L0FA 1TEMA 3O88A 1GA9A 4OLGA 3PBRA 2P9VB 3IQAA 2A49A 2ZQAA 1MWSA 2Z2LB 5GHYA 5EECA 3GMWA 2PU4A 3V3RA 1O7EA 5HX9A 3BFGA 4OKPA 1E4DA 3IXGA 4QD4A 1M6KA 4S2NC 3EQUA 2XD1A 4DE2A 4S2PA 2IWDA 1NYMA 2VGKA 5EOEA 2PBYA 4JXVA 4X6TA 3W4PA 5FI6A 4S2KA 3ZCZA 1K38A 2Y2KA 5FA7A 4DE0A 4R1GA 5KSHA 1ESIA 3ZG8B 4JF4A 1KDWA 2OLVA 3C4PA 3UNWA 4RRDA 1PI5A 2H0TA 3AGEA 1HTZA 4L0LA 4N1HA 4E3LA 4S2OA 4ID4A 1CK3A 1J9MA 1GA0A 4MBHA 5JYPA 1E25A 2Y2JA 4EQIA 4OP5A 1TC5A 4OVDA 4MLLA 1FSWA 3G4PA 5EVIC 1O07A 3VP2A 4S02A 2X71A 5EE8A 2HP9A 3HUNA 3MXSA 4E3KA 3C7VA 1DJAA 3PAGA 2WYXA 4LV1A 1KGFA 2V2FF 3HLCA 5AQ9A 5HAIA 4F94A 3C4OA 4O7DA 4KZBA 1S0WA 1XGIA 2J7VA 2R9WA 3DWKA 1K4EA 1ONHA 2XD5A 5FQ9A 1FOFA 5TGFA 4EV4A 4ZJ2A 5GLAA 4RRMA 5FASA 5HAQA 3ZG0A 2XK1A 3HBRA 5A92A 1QMEA 2ZC5B 1GHMA 1LI9A 1PWCA 1PZPA 1Z6FA 2H5SA 3IF5A 1HVBA 3HLBA 2QZ6A 4S0IA 4KQRA 3PBQA 5FQQA 4EBLA 3LCEA 3NI9A 5CGWA 4QY6A 3BFEA 3ZDJA 1IKGA 1HD8A 4ZAMA 3PBOA 4QB8A 3IXHA 1FR1A 1NRFA 3UO9A 1SKFA 3MFDA 1QMFA 1EWZA 4KZ9A 1OMEA 2JE5A 3HUOA 3ZGAB 3NBLA 3IWQA 3S4XA 5I94A 2WAFA 2ZM0A 3ITAA 4PPRA 3IHBA 1ZKJA 1DJCA 4JPMA 1K56A 2HDSA 4U3TA 3VP4A 1K54C 2XF3A 3LO7A 4QHCA 1ESUA 1FSYA 2Y2GA 4E6XA 2DNSA 1ZG4A 4OQIA 4GZBA 3WS5A 1L0DA 4FH2A 1MKIA 4WZ5A 5CGXA 2IWCA 2DCFA 4GB7A 4RRJA 4X53A 1W5DA 1ERMA 2EX6A 4JXSA 2OKVA 4QJGA 3G34A 1K54A 4JXWA 1BLPA 5EPHA 1KGEA 1ONGA 1IYOA 1FR6A 5GHXA 1BLCA 3FKWA 1I2WA 3E2KA 4XUXA 3MZEA 3FWLA 4GNUA 2WKEA 5HW3A 2HL1A 1IEMA 4LV2A 2ZC4B 4OP8A 1YLTA 3NDGA 4PM7A 1YLWA 4EWFA 4BQMA 4JF6A 1PWGA 3M6BA 4ZDXA 1PIOA 4GDBA 2OSUA 1JWPA 1PZOA 3N4IA 2R9XA 4R4SA 3M2JA 1IELA 1XGJA 3QNBA 4P6BA 3KNFA 2BG1A 1MXOA 5GHZA 3KOBA 1BZAA 4NETA 4KZ7A 3KO7A 3OPLA 4GN2A 4GD8A 3MBZA 3S22A 1K57A 1RCJA 5CHUA 4N9LA 1L0GA 5A91A 4IVKA 4OPZA 2X02A 4MBFA 3GSGA 1MWRA 4IBXA 1I5QA 1RP5A 2GDNA 4NK3A 1YM1A 2IWBA 4HBTA 1E3UA 4X69A 1Y54A 5FQJA 5CERA 1PWDA 3VSKA 1H5XA 4RR8A 2XQZA 3BFFA 4OPYA 4RVAA 3ZNTA 4M3KA 5GLBA 5M1AA 4CJNA 3G32A 4IBRA 4RRLA 4PM6A 1YMXA 2EX9A 3BM6A 5G18A 1WYBA 3SS4A 3HVFA 5DVAA 5KSCA 4GKUA 2Y2PA 3Q81A 5CECA 4JF5A 4OOMA 1GCEA 3ITBA 1SDNA 4KQQA 2J8YA 1FCOA 2Y59A 3OPRA 4YINA 1J7GA 3G31A 3NCKA 3IT9A 1EROA 4PM8A 3RXWA 4GOGA 3TOIA 3WS1A 2HPBA 3OPPA 4S2NA 3IH9A 5FSRA 5EOOA 5F83A 4FH4A 2QPNA 4S2IA 4Q8IA 4OLDA 5EVIB 1IYPA 3G35A 3PBNA 4RR7A 1BLHA 3I7JA 1H8ZA 1FCNA 3KO9A 4BLMA 3PTEA 4C75A 2H10A 1Q2QA 2CC1A 1BULA 2WZXA 2ZC6B 2H0YA 3KO5A 2Y2IA 2ZQ8A 4B4ZA 4RR9A 3G2ZA 4KG5A 5E2FA 2Y91A 4HBUA 4WM9A 3W4QA 4P87A 4A5RA 3TG9A 1YT4A 1YLPA 2G2UA 4X56A 2EFXA 1YMSA 2V1ZA 5CEBA 2Y2NA 4OOYA 1PW1A 5EVIA 4RRGA 3SH8A 3GRJA 3SS3A 4BJPA 3HUMA 3Q7VA 3VSLA 4LCLA 1LI0A 1KE4A 3HLGA 4OOLA 3DWZA 1RGYA 1S6RA 1W8YA 1LLBA 1ZG6A 5CTNA 2HDUA 1M40A 4JKTA 2HDRA 2G2WA 1CI8A 1KE0A 2ZMAA 3AGFA 3G30A 4RYEA 3SOIA 4E3OA 3LY4A 1AXBA 1BT5A 4WZ4A 2Q9NA 2XR0A 1HZOA 3CJMA 3LY3A 3RXXA 3PBSA 2JCHA 5FATA 3KOCA 1TDGA 1MPLA 3VFHA 1JWVA 4BD0A 3WRZA 4DDSA 3C5AA 3O3VA 1ES4A 1NZOA 4ZTKA 2E8IA 3IHAA 5HL1A 2Z2MB 1DY6A 5E2EA 3HREA 1YLJA 2C5WB 2I72A 5E2GA 4LENA 1ES5A 4K0XA 4WBGA 5D3OA 4RX2A 3ZHHA 2HKZA 2XGNA 1C3BA 4S2MA 1NJ4A 2WADA 2EFUA 4KZ4A 3ZVWA 3QNCA 5DF7A 4K91A 1YQSA 4S2LA 3EQVA 5FDHA 3VFFA 4N92A 3MKEA 3BEBA 4RA7A 3V50A 3ZFZA 4H8RA 4S03A 4PM9A 5DF9A 4NBIA 2Y55A 1JWZA 1ES2A 3IF6C 4RRHA 2EX8A 1BTLA 3D4FA 3KO3A 3CMZA 1ALQA 5CTMA 3PD4A 4R3BA 2ZC7A 4JLFA 4MNRA 3N8SA 1YLZA 2ZM2A 4N1XA 3WWXA 3ZG5A 1IYQA 4P85A 3M2KA 3UY6A 2J9OA 4UA7A 5M18A 4RRAA 5F1GA 3HLWA 3IF6A 4BL2A 3PD5A 4DRTA 2ZQCA 3LMTA 4JBFA 1EI5A 4Y0OA 1N9BA 3UDIA 5CEDA 4B4XA 3GV9A 1KDSA 4IEDA 3ZNYA 4KZ8A 1TVFA 1W8QA 4DF6A 3BYDA 3BFCA 3BRMA 3O87A 1CEFA 2ZQDA 1NYYA 1BLSA 4OQGA 1GHIA 5DTSA 3KODA 4NBJA 1MBLA 5AQBA 4RRRA 1G6AA 2WGVA 2XLNA 5CXWA 5FAPA 3FV7A 3A3IA 1JTDA 2RL3A 2UWXA 4HEFA 4KQOA 1W7FA 2P74A 2EXBA 4ZBEA 1K55C 4DE1A 1VM1A 4LV3A 4DXCA 5A90A 5EUAA 4R23A 5DF8A 1XA1A 2X01A 5HARA 2DRWA 3Q82A 1K4FA 3BECA 1SHVA 3LEZA 3UE3A 4RRCA 5J61A 2OV5A 1Y2QA 1BSGA 4UA9A 4C6YA 1XA7A 2XFTA 3N6IA 4KENB 1NY0A 2BLSA 2Y4AA 4OQ0A 3NIAA 4GD6A 4DKIA 2WKHA 2J9PA 4R0QA 4U0TA 3SH9A 1K25A 1FCMA 4EUZA 4KZ6A 5A93A 4R3JA 2Y2OA 3UDFA 3IXDA 3A3JA 4WMCA 1LHYA 1I2SA 1MWTA 5TR7A 3WRTA 4N9KA 1NZUA 3VMAA 3UN7A 3JYIA 5FI7A 5F82A 5TFQA 3E2LA 3Q1FA 3OCNA 3M6HA 4P0MA 4PM5A 3KO4A 4RX3A 2C6WB 2HP6A 5EVID 3N7WA 4UA6A 3Q7VB 4WEJA 1RGZA 5JYOA 4YFMA 1XKZA 1G68A 2WGIA 2HL0A 2Y2MA 5E43A 3C7UA 1SCWA 3IWOA 2XH9A 5DTTA 4Y7PA 4EBNA 3OPHA 1LL9A 1U60A 4DDYA 1W79A 2ZLYA 4E3JA 4GDNA 1GHPA 3IWIA 4WYYA 4RRIA 2Y2LA 4HESA 3B3XA 3ZVTA 3S1YA 5FQIA 2RCXA 5F1FA 1K6SA 5CGSA 4WELA 4EBPA 3N8LA 5BOHA 3G2YA 4RRKA 3IH8A 3PAEA 4Y0UA 4DE3A 2QMIA 3HLFA 4LCMA 2ZD8A 2P9VA 2VGJA 1ZC2A 4OONA 1TDLA 2Q9MA 3GVBA 3BLMA 4K0WA 3V39A 2XDMA 1N4OA 2WKIA 3WS2A 1PYYA 1JVJA 1K56D 2Y2QA 5M19A 5GLCA 3FKVA 5CHJA 3P98A 4DXBA 5KMWA 4RRQA 1PI4A 3PBTA 1Q2PA 5FAOA 4FSFA 3V3SA 2PU2A 3WS4A 2A3UA 1XXMA 3VP1A 2WAEA 4ZJ3A 4JXGA 3P09A 3QHYA 4U0XA 1WE4A 1SDEA 2EX2A 2ZQ9A 5E2HA 5GL9A 4B88A 3HL9A 3IXBA 3UPOA 5FQMA 4BD1A 4S0LA 3W4OA 3HLDA 2ZM8A 4FD8A 3RJUA 1KVMA 3Q7ZA 2ZQ7A 3N8RA 2ZC3B 3SH7A 3LMVA 3A3FA 1IKIA 1KE3A 4MEZA 3UDXA 3VOYA 5GLDA 2Y2HA 4MBKA 1VQQA 2JC7A 3IF6B 3TSGA 1JTGA 5HFOA 4QU3A 2XEPA 4KG2A 1XP4A 1MY8A 5J8XA 3UE0A 1PW8A 4XXRA 4WEKA 3DW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X68 A;  4WZ5 C;  3BLS A;  3A3D A;  1H8Y A;  5KZH A;  4LV0 A;  3WS0 A;  3VP0 A;  1DJB A;  4C3Q A;  4PMA A;  3HLE A;  5DTK A;  3FYZ A;  4OPR A;  1IYS A;  2FFF B;  3NDE A;  3BFD A;  3NY4 A;  4E3M A;  4OQH A;  1CEG A;  1BUE A;  3AGD A;  5CRF A;  4BEN A;  4E6W A;  2B5R A;  3FZC A;  1E3U D;  4UHU A;  5EVL A;  3GTC A;  2HDQ A;  4Y0T A;  3ZG9 B;  5CHM A;  3CG5 A;  5AQA A;  1WYC A;  4Z9Q A;  3GR2 A;  4KZ3 A;  2FFY A;  4CPK A;  4KZA A;  3Q07 A;  4D2O A;  4QY5 A;  5FQK A;  1KGG A;  1XX2 A;  5HAP A;  2WGW B;  4FCF A;  4IVI A;  2XFS A;  4OPQ A;  1L0E A;  4KZ5 A;  3O86 A;  3DTM A;  4WMC D;  5IHV A;  1MWU A;  4S2J A;  3GQZ A;  3UE1 A;  1L2S A;  3UPP A;  3MZF A;  1KVL A;  2V20 A;  1FQG A;  1K57 C;  1K55 A;  4UAA A;  4XUZ A;  1ES3 A;  4R4R A;  2ZJ9 A;  3OZH A;  5L2F A;  3OCL A;  3CZD A;  3MZD A;  1K6R A;  2HP5 A;  3ISG A;  2WK0 A;  3A3E A;  3MXR A;  3W8K A;  1LL5 A;  3V5M A;  1ERQ A;  2EXA A;  2WGW A;  3NC8 A;  4ZJ1 A;  1XPB A;  3ZG7 B;  3VP3 A;  3VOZ A;  4E3I A;  4KG6 A;  5FI2 A;  3UPN A;  2OLU A;  4E3N A;  4BL3 A;  1CI9 A;  4X55 A;  2JBF A;  1YLY A;  1NXY A;  4OH0 A;  5U47 A;  2WZZ A;  3SS5 A;  5FAQ A;  3OC2 A;  3MKF A;  2WUQ A;  5AQ7 A;  1L0F A;  1TEM A;  3O88 A;  1GA9 A;  4OLG A;  3PBR A;  2P9V B;  3IQA A;  2A49 A;  2ZQA A;  1MWS A;  2Z2L B;  5GHY A;  5EEC A;  3GMW A;  2PU4 A;  3V3R A;  1O7E A;  5HX9 A;  3BFG A;  4OKP A;  1E4D A;  3IXG A;  4QD4 A;  1M6K A;  4S2N C;  3EQU A;  2XD1 A;  4DE2 A;  4S2P A;  2IWD A;  1NYM A;  2VGK A;  5EOE A;  2PBY A;  4JXV A;  4X6T A;  3W4P A;  5FI6 A;  4S2K A;  3ZCZ A;  1K38 A;  2Y2K A;  5FA7 A;  4DE0 A;  4R1G A;  5KSH A;  1ESI A;  3ZG8 B;  4JF4 A;  1KDW A;  2OLV A;  3C4P A;  3UNW A;  1PI5 A;  2H0T A;  3AGE A;  1HTZ A;  4L0L A;  4N1H A;  4E3L A;  4S2O A;  4ID4 A;  1CK3 A;  1J9M A;  1GA0 A;  4MBH A;  5JYP A;  1E25 A;  2Y2J A;  4EQI A;  4OP5 A;  4OVD A;  4MLL A;  1FSW A;  3G4P A;  5EVI C;  1O07 A;  3VP2 A;  2X71 A;  5EE8 A;  2HP9 A;  3HUN A;  3MXS A;  4E3K A;  3C7V A;  1DJA A;  3PAG A;  2WYX A;  4LV1 A;  1KGF A;  2V2F F;  3HLC A;  5AQ9 A;  5HAI A;  4F94 A;  3C4O A;  4O7D A;  4KZB A;  1S0W A;  1XGI A;  2J7V A;  2R9W A;  3DWK A;  1K4E A;  1ONH A;  2XD5 A;  5FQ9 A;  1FOF A;  5TGF A;  4EV4 A;  4ZJ2 A;  5GLA A;  5FAS A;  5HAQ A;  3ZG0 A;  2XK1 A;  3HBR A;  5A92 A;  1QME A;  2ZC5 B;  1GHM A;  1LI9 A;  1PWC A;  1PZP A;  1Z6F A;  2H5S A;  3IF5 A;  1HVB A;  3HLB A;  2QZ6 A;  4KQR A;  3PBQ A;  5FQQ A;  4EBL A;  3LCE A;  3NI9 A;  5CGW A;  4QY6 A;  3BFE A;  3ZDJ A;  1IKG A;  1HD8 A;  4ZAM A;  3PBO A;  4QB8 A;  3IXH A;  1FR1 A;  1NRF A;  3UO9 A;  1SKF A;  3MFD A;  1QMF A;  1EWZ A;  4KZ9 A;  1OME A;  2JE5 A;  3HUO A;  3ZGA B;  3NBL A;  3IWQ A;  3S4X A;  5I94 A;  2WAF A;  2ZM0 A;  3ITA A;  4PPR A;  3IHB A;  1ZKJ A;  1DJC A;  4JPM A;  1K56 A;  2HDS A;  4U3T A;  3VP4 A;  1K54 C;  2XF3 A;  3LO7 A;  4QHC A;  1ESU A;  1FSY A;  2Y2G A;  4E6X A;  2DNS A;  1ZG4 A;  4OQI A;  4GZB A;  3WS5 A;  1L0D A;  4FH2 A;  1MKI A;  4WZ5 A;  5CGX A;  2IWC A;  2DCF A;  4GB7 A;  4X53 A;  1W5D A;  1ERM A;  2EX6 A;  4JXS A;  4QJG A;  3G34 A;  1K54 A;  4JXW A;  1BLP A;  5EPH A;  1KGE A;  1ONG A;  1IYO A;  1FR6 A;  5GHX A;  1BLC A;  3FKW A;  1I2W A;  3E2K A;  4XUX A;  3MZE A;  3FWL A;  4GNU A;  2WKE A;  5HW3 A;  1IEM A;  4LV2 A;  2ZC4 B;  4OP8 A;  1YLT A;  3NDG A;  4PM7 A;  1YLW A;  4EWF A;  4BQM A;  4JF6 A;  1PWG A;  3M6B A;  4ZDX A;  1PIO A;  4GDB A;  2OSU A;  1JWP A;  1PZO A;  3N4I A;  2R9X A;  4R4S A;  3M2J A;  1IEL A;  1XGJ A;  3QNB A;  4P6B A;  2BG1 A;  1MXO A;  5GHZ A;  1BZA A;  4NET A;  4KZ7 A;  3OPL A;  4GN2 A;  4GD8 A;  3MBZ A;  3S22 A;  1K57 A;  1RCJ A;  5CHU A;  4N9L A;  1L0G A;  5A91 A;  4IVK A;  4OPZ A;  2X02 A;  4MBF A;  3GSG A;  1MWR A;  4IBX A;  1I5Q A;  1RP5 A;  2GDN A;  4NK3 A;  1YM1 A;  2IWB A;  4HBT A;  1E3U A;  4X69 A;  1Y54 A;  5FQJ A;  5CER A;  1PWD A;  3VSK A;  1H5X A;  2XQZ A;  3BFF A;  4OPY A;  4RVA A;  3ZNT A;  4M3K A;  5GLB A;  5M1A A;  4CJN A;  3G32 A;  4IBR A;  4PM6 A;  1YMX A;  2EX9 A;  3BM6 A;  5G18 A;  1WYB A;  3SS4 A;  3HVF A;  5DVA A;  5KSC A;  4GKU A;  2Y2P A;  3Q81 A;  5CEC A;  4JF5 A;  4OOM A;  1GCE A;  3ITB A;  1SDN A;  4KQQ A;  2J8Y A;  1FCO A;  2Y59 A;  3OPR A;  4YIN A;  3G31 A;  3NCK A;  3IT9 A;  1ERO A;  4PM8 A;  3RXW A;  4GOG A;  3TOI A;  3WS1 A;  2HPB A;  3OPP A;  4S2N A;  3IH9 A;  5FSR A;  5EOO A;  5F83 A;  4FH4 A;  2QPN A;  4S2I A;  4Q8I A;  4OLD A;  5EVI B;  1IYP A;  3G35 A;  3PBN A;  1BLH A;  3I7J A;  1H8Z A;  1FCN A;  4BLM A;  3PTE A;  4C75 A;  2H10 A;  1Q2Q A;  2CC1 A;  1BUL A;  2WZX A;  2ZC6 B;  2H0Y A;  2Y2I A;  2ZQ8 A;  4B4Z A;  3G2Z A;  4KG5 A;  5E2F A;  2Y91 A;  4HBU A;  4WM9 A;  3W4Q A;  4P87 A;  4A5R A;  3TG9 A;  1YT4 A;  1YLP A;  2G2U A;  4X56 A;  2EFX A;  1YMS A;  2V1Z A;  5CEB A;  2Y2N A;  4OOY A;  1PW1 A;  5EVI A;  3SH8 A;  3GRJ A;  3SS3 A;  4BJP A;  3HUM A;  3Q7V A;  3VSL A;  4LCL A;  1LI0 A;  1KE4 A;  3HLG A;  4OOL A;  3DWZ A;  1RGY A;  1S6R A;  1W8Y A;  1LLB A;  1ZG6 A;  5CTN A;  2HDU A;  1M40 A;  4JKT A;  2HDR A;  2G2W A;  1CI8 A;  1KE0 A;  2ZMA A;  3AGF A;  3G30 A;  4RYE A;  3SOI A;  4E3O A;  3LY4 A;  1AXB A;  1BT5 A;  4WZ4 A;  2Q9N A;  2XR0 A;  1HZO A;  3CJM A;  3LY3 A;  3RXX A;  3PBS A;  2JCH A;  5FAT A;  1TDG A;  1MPL A;  3VFH A;  1JWV A;  4BD0 A;  3WRZ A;  4DDS A;  3C5A A;  3O3V A;  1ES4 A;  1NZO A;  4ZTK A;  2E8I A;  3IHA A;  5HL1 A;  2Z2M B;  1DY6 A;  5E2E A;  3HRE A;  1YLJ A;  2C5W B;  2I72 A;  5E2G A;  4LEN A;  1ES5 A;  4K0X A;  4WBG A;  5D3O A;  4RX2 A;  3ZHH A;  2XGN A;  1C3B A;  4S2M A;  1NJ4 A;  2WAD A;  2EFU A;  4KZ4 A;  3ZVW A;  3QNC A;  5DF7 A;  4K91 A;  1YQS A;  4S2L A;  3EQV A;  5FDH A;  3VFF A;  4N92 A;  3MKE A;  3BEB A;  4RA7 A;  3V50 A;  3ZFZ A;  4H8R A;  4PM9 A;  5DF9 A;  2Y55 A;  1JWZ A;  1ES2 A;  3IF6 C;  2EX8 A;  1BTL A;  3D4F A;  3CMZ A;  1ALQ A;  5CTM A;  4R3B A;  2ZC7 A;  4JLF A;  4MNR A;  3N8S A;  1YLZ A;  2ZM2 A;  4N1X A;  3WWX A;  3ZG5 A;  1IYQ A;  4P85 A;  3M2K A;  3UY6 A;  2J9O A;  4UA7 A;  5M18 A;  5F1G A;  3HLW A;  3IF6 A;  4BL2 A;  4DRT A;  2ZQC A;  4JBF A;  1EI5 A;  4Y0O A;  1N9B A;  3UDI A;  5CED A;  4B4X A;  3GV9 A;  1KDS A;  4IED A;  3ZNY A;  4KZ8 A;  1TVF A;  1W8Q A;  4DF6 A;  3BYD A;  3BFC A;  3BRM A;  3O87 A;  1CEF A;  2ZQD A;  1NYY A;  1BLS A;  4OQG A;  1GHI A;  5DTS A;  1MBL A;  5AQB A;  1G6A A;  2WGV A;  2XLN A;  5CXW A;  5FAP A;  3FV7 A;  3A3I A;  1JTD A;  2RL3 A;  2UWX A;  4HEF A;  4KQO A;  1W7F A;  2P74 A;  2EXB A;  4ZBE A;  1K55 C;  4DE1 A;  1VM1 A;  4LV3 A;  4DXC A;  5A90 A;  5EUA A;  4R23 A;  5DF8 A;  1XA1 A;  2X01 A;  5HAR A;  2DRW A;  3Q82 A;  1K4F A;  3BEC A;  1SHV A;  3LEZ A;  3UE3 A;  2OV5 A;  1BSG A;  4UA9 A;  4C6Y A;  1XA7 A;  2XFT A;  3N6I A;  4KEN B;  1NY0 A;  2BLS A;  2Y4A A;  4OQ0 A;  3NIA A;  4GD6 A;  4DKI A;  2WKH A;  2J9P A;  4R0Q A;  4U0T A;  3SH9 A;  1K25 A;  1FCM A;  4EUZ A;  4KZ6 A;  5A93 A;  4R3J A;  2Y2O A;  3UDF A;  3IXD A;  3A3J A;  4WMC A;  1LHY A;  1I2S A;  1MWT A;  5TR7 A;  3WRT A;  4N9K A;  1NZU A;  3VMA A;  3UN7 A;  3JYI A;  5FI7 A;  5F82 A;  5TFQ A;  3E2L A;  3Q1F A;  3OCN A;  3M6H A;  4P0M A;  4PM5 A;  4RX3 A;  2C6W B;  2HP6 A;  5EVI D;  3N7W A;  4UA6 A;  3Q7V B;  4WEJ A;  1RGZ A;  5JYO A;  4YFM A;  1XKZ A;  1G68 A;  2WGI A;  2Y2M A;  5E43 A;  3C7U A;  1SCW A;  3IWO A;  2XH9 A;  5DTT A;  4Y7P A;  4EBN A;  3OPH A;  1LL9 A;  1U60 A;  4DDY A;  1W79 A;  2ZLY A;  4E3J A;  4GDN A;  1GHP A;  3IWI A;  4WYY A;  2Y2L A;  4HES A;  3B3X A;  3ZVT A;  3S1Y A;  5FQI A;  2RCX A;  5F1F A;  1K6S A;  5CGS A;  4WEL A;  4EBP A;  3N8L A;  5BOH A;  3G2Y A;  3IH8 A;  3PAE A;  4Y0U A;  4DE3 A;  2QMI A;  3HLF A;  4LCM A;  2ZD8 A;  2P9V A;  2VGJ A;  1ZC2 A;  4OON A;  1TDL A;  2Q9M A;  3GVB A;  3BLM A;  4K0W A;  3V39 A;  2XDM A;  1N4O A;  2WKI A;  3WS2 A;  1PYY A;  1JVJ A;  1K56 D;  2Y2Q A;  5M19 A;  5GLC A;  3FKV A;  5CHJ A;  3P98 A;  4DXB A;  5KMW A;  1PI4 A;  3PBT A;  1Q2P A;  5FAO A;  4FSF A;  3V3S A;  2PU2 A;  3WS4 A;  2A3U A;  1XXM A;  3VP1 A;  2WAE A;  4ZJ3 A;  4JXG A;  3P09 A;  3QHY A;  4U0X A;  1WE4 A;  1SDE A;  2EX2 A;  2ZQ9 A;  5E2H A;  5GL9 A;  4B88 A;  3HL9 A;  3IXB A;  3UPO A;  5FQM A;  4BD1 A;  3W4O A;  3HLD A;  2ZM8 A;  4FD8 A;  3RJU A;  1KVM A;  3Q7Z A;  2ZQ7 A;  3N8R A;  2ZC3 B;  3SH7 A;  3A3F A;  1IKI A;  1KE3 A;  4MEZ A;  3UDX A;  3VOY A;  5GLD A;  2Y2H A;  4MBK A;  1VQQ A;  2JC7 A;  3IF6 B;  3TSG A;  1JTG A;  5HFO A;  4QU3 A;  2XEP A;  4KG2 A;  1XP4 A;  1MY8 A;  5J8X A;  3UE0 A;  1PW8 A;  4XXR A;  4WEK A;  3DW0 A; 
#chains in the Genus database with same CATH topology
 3T4Q A;  4CLC E;  4X68 A;  2P08 A;  3BLS A;  3JPU A;  4GLQ A;  2UV0 E;  1WA9 A;  4ARZ B;  1DJB A;  4C3Q A;  3HLE A;  3LIE A;  2W3F A;  1T1A A;  3O5Y A;  2Q0O A;  3DTE A;  1CEG A;  2B5R A;  1E3U D;  4UHU A;  2W3D A;  3CG5 A;  4GS9 A;  3S7O A;  4QY5 A;  1CJF A;  1XX2 A;  3CPT B;  4MN7 A;  4FCF A;  1ZHH B;  4KZ5 A;  3E0Y A;  3O86 A;  3MQQ A;  5IHV A;  2BAS A;  3GQZ A;  4HY8 A;  5F68 A;  3UB7 A;  4XUZ A;  1ES3 A;  3TW8 A;  4LRX C;  3MZD A;  3ISG A;  2PYP A;  4L9F A;  2WGW A;  4ZJ1 A;  3VOZ A;  3KNP A;  3UPN A;  2OLU A;  1NWZ A;  4EQ1 A;  4BL3 A;  4X55 A;  5F6A A;  3S7Q A;  5U47 A;  4GJ4 A;  4AFI A;  3PD2 A;  3NOT C;  1L0F A;  1V9Z A;  3QP8 A;  2P9V B;  3IQA A;  2Z2L B;  3GMW A;  3MMH A;  3VE3 A;  5HX9 A;  3BFG A;  4OKP A;  1E4D A;  4S2N C;  1M6K A;  1AWI A;  2V8F A;  2PBY A;  3DTI A;  4JXV A;  4X6T A;  1K38 A;  3TE8 A;  1ESI A;  3KSG A;  4L0L A;  1HTZ A;  4S2O A;  4WN5 A;  1E25 A;  2Y2J A;  4HQA A;  1TC5 A;  4OVD A;  4MLL A;  4PHT A;  1FSW A;  3G4P A;  3W2Z A;  1IOU A;  2X71 A;  1S1Z A;  2HP9 A;  4Y13 A;  3MXS A;  4ME4 A;  1D06 A;  1KGF A;  2V2F F;  2G7U A;  1D1J A;  3DWK A;  4EV4 A;  4UQI S;  2JKT I;  3HBR A;  1Z6F A;  2H5S A;  1HVB A;  3UB8 A;  3QP4 A;  4IUK A;  1HD8 A;  4ZAM A;  3PBO A;  3IXH A;  3UO9 A;  3MFD A;  2VGL S;  5I94 A;  4HJ6 A;  3S4X A;  2WAF A;  2ZM0 A;  2WKR A;  5I5L A;  1ZKJ A;  3VP4 A;  2XF3 A;  3BY9 A;  1ESU A;  4FH2 A;  3H82 A;  2EX6 A;  4BBU A;  1BLC A;  1LSW A;  2EA9 A;  5IU1 A;  2A24 A;  4KQD A;  4XT2 A;  3VV4 A;  3T4T A;  1PIO A;  3M2J A;  4DJ3 A;  1XGJ A;  3L9K A;  3E4O A;  2BG1 A;  4KZ7 A;  3KO7 A;  4WL9 A;  4JGP A;  4N9L A;  3JVU A;  3L7H A;  2X02 A;  1MWR A;  1YM1 A;  2IWB A;  1E3U A;  4X69 A;  3VSK A;  4LLO B;  4RR8 A;  2XQZ A;  2EX9 A;  3BM6 A;  5J7E A;  3HVF A;  4JF5 A;  2Y59 A;  2VX8 A;  4K08 A;  3RXW A;  1S67 L;  2PR5 A;  2ZOH A;  4S2N A;  3IH9 A;  4PKY A;  5EOO A;  4FH4 A;  4Q8I A;  5EVI B;  1IYP A;  1H8Z A;  2VJW A;  4I3I A;  1BUL A;  2H0Y A;  4B4Z A;  1T1B A;  4BMW A;  3W4Q A;  3D9Y A;  2ZBB A;  2W3H A;  1PW1 A;  2GNX A;  3HLG A;  3DWZ A;  1VEU A;  1S6R A;  1W8Y A;  1XJ3 A;  4JKT A;  3CI6 A;  2YKF A;  1KE0 A;  3AGF A;  2CMN A;  3SOI A;  2HJ9 C;  5FL3 A;  1TS8 A;  3PBS A;  2JCH A;  5FAT A;  1TDG A;  2GZA A;  5HL1 A;  1N9O A;  3OBF A;  1ACF A;  1YLJ A;  4LEN A;  4WBG A;  4KZ4 A;  3C8C A;  3KX0 X;  1J3W A;  4K91 A;  1YQS A;  1S4R A;  3VFF A;  3A0S A;  3KSH A;  3BW6 A;  3ZFZ A;  1XFN A;  4NBI A;  1ES2 A;  4BBT A;  3D4F A;  3KO3 A;  1ALQ A;  4R3B A;  4F3L B;  4MNR A;  3N8S A;  4P85 A;  2J9O A;  4UA7 A;  2K31 A;  3PD5 A;  4NXG A;  2ZQC A;  1V9Y A;  3LMT A;  4JBF A;  4Y0O A;  5KIZ A;  5EVE A;  4B4X A;  3GV9 A;  4KZ8 A;  4DF6 A;  3CWF A;  1GHI A;  3LIF A;  3KOD A;  1MBL A;  2B18 A;  2HGV A;  2WGV A;  1KOU A;  2XLN A;  5FAP A;  4O8G A;  4ARZ A;  2UWX A;  2XA7 M;  4HEF A;  4KQO A;  3NOU C;  4ZBE A;  4DXC A;  4LV3 A;  3KSI A;  5HPF A;  1SHV A;  2OV5 A;  3MR0 A;  2Z6D A;  3N6I A;  2BLS A;  1TS0 A;  3NIA A;  4GD6 A;  2WKH A;  2J9P A;  5L8M A;  2J3W A;  3SH9 A;  2GJ3 A;  2VKS A;  3CPT A;  2EWV A;  3IXD A;  2FZ0 A;  4JGO A;  4WMC A;  1LHY A;  4R3A A;  5TR7 A;  3WRT A;  4N9K A;  3TRC A;  1NZU A;  3VMA A;  3Q1F A;  3M6H A;  2I9V A;  2C6W B;  3F1O B;  1OJ5 A;  5EVI D;  3RFB A;  2WGI A;  5E43 A;  3IWO A;  3OPH A;  4P6Z S;  1N9L A;  1W79 A;  1YPR A;  2ZLY A;  1GHP A;  4RRI A;  1P9W A;  3BQ8 A;  4HES A;  3S1Y A;  4EBP A;  2NUT C;  3N8L A;  3G2Y A;  4RRK A;  4DE3 A;  2ZD8 A;  2P9V A;  2R78 A;  2VGJ A;  1MC0 A;  2O9B A;  1XJ2 A;  4K0W A;  3V39 A;  1N4O A;  1JVJ A;  1K56 D;  2Y2Q A;  5HWV A;  5M19 A;  4E04 A;  2Y79 A;  3PBT A;  1MZU A;  1Q2P A;  1L3L A;  5FAO A;  4FSF A;  1T19 A;  3QHY A;  4U0X A;  5LBR A;  2EX2 A;  2JKT M;  4FUW A;  4NXF A;  3VOY A;  2JC7 A;  1JTG A;  1XP4 A;  3ZQ5 A;  4I38 A;  2LB5 A;  3DW0 A;  3IS2 A;  5TJJ A;  2P04 A;  5AJG A;  3A3D A;  1H8Y A;  2OAQ 1;  4PMA A;  3FYZ A;  4OPR A;  2FFF B;  3NDE A;  3NY4 A;  2H28 A;  4S0J A;  4BEN A;  3A0V A;  3AGD A;  5CRF A;  4HI4 A;  4LRZ E;  5EVL A;  2HDQ A;  2HV1 A;  5AQA A;  1WYC A;  1YSQ A;  3GR2 A;  4KZ3 A;  4KZA A;  4D2O A;  4Q0J A;  4YOF A;  4IVI A;  2XFS A;  1L0E A;  2W3G A;  1L2S A;  3MZF A;  1KVL A;  5CX7 A;  1K57 C;  2HL2 A;  5G4Y A;  4R4R A;  3OCL A;  1LL5 A;  2IA2 A;  4JGR A;  3NC8 A;  3ZG7 B;  1XPB A;  3VP3 A;  2OOL A;  3CAX A;  4E3N A;  3JVV A;  3LMU A;  1NXY A;  2WZZ A;  3LIA A;  3SS5 A;  4DJ2 A;  2JKR I;  3OC2 A;  5AQ7 A;  1GA9 A;  4OLG A;  2A49 A;  2ZQA A;  5GHY A;  4R6L A;  5EEC A;  4WF0 A;  1O7E A;  5EM0 A;  3EQU A;  2XD1 A;  4DE2 A;  1S4S A;  4S2P A;  5EOE A;  3W4P A;  4ETX A;  5FI6 A;  2Y2K A;  4DE0 A;  4WLA A;  5KSH A;  2YKH A;  3ZG8 B;  2OLV A;  5TBM A;  4RRD A;  2H0T A;  4NXE A;  3LEQ A;  4ID4 A;  1CK3 A;  1GA0 A;  4MBH A;  1LSX A;  2KOI A;  3B47 A;  5HSQ A;  5EE8 A;  1DJA A;  4LV1 A;  5HAI A;  1SKO B;  5AQ9 A;  4F94 A;  4O7D A;  1XGI A;  2J7V A;  4MN6 A;  1DP6 A;  1FOF A;  2K2N A;  4RRM A;  3ZG0 A;  3PYP A;  1QME A;  2ZC5 B;  1GHM A;  3IF5 A;  3EEA A;  2QZ6 A;  3CUE C;  1Y4O A;  4EBL A;  3NI9 A;  5AVF A;  5CGW A;  4QY6 A;  3BFE A;  1FR1 A;  1SKF A;  2EWW A;  1QMF A;  2JHE A;  3ZGA B;  4KZ9 A;  4CLC B;  3NBL A;  4PPR A;  3IHB A;  1DJC A;  1K56 A;  1UGU A;  4QHC A;  1ODV A;  2VV6 A;  4Y5F A;  4GZB A;  1L0D A;  1MKI A;  4JGQ A;  4GB7 A;  4JXS A;  1DRM A;  3OLO A;  3G34 A;  4QJG A;  4JXW A;  1P0Z A;  1KGE A;  2K7S A;  1IYO A;  4QPR A;  5GHX A;  2AVX A;  2O0Y A;  3MZE A;  4M4X A;  3FWL A;  5HW3 A;  4LV2 A;  5MC7 A;  2ZC4 B;  4PM7 A;  4BQM A;  3IX3 A;  4G3W A;  4JF6 A;  4HJ3 A;  2OSU A;  1N9N A;  2R9X A;  4HH3 A;  2OWH A;  1TF1 A;  3KOB A;  1BZA A;  2L4R A;  4NET A;  3MBZ A;  3S22 A;  1K57 A;  1RCJ A;  5CHU A;  4OPZ A;  4D60 A;  4MBF A;  3GSG A;  5FEF A;  1I5Q A;  1RP5 A;  2GDN A;  5CER A;  1PWD A;  1H5X A;  4CJN A;  5M1A A;  4IBR A;  1P97 A;  3BQA A;  5G18 A;  5KSC A;  5DVA A;  3EEH A;  3Q81 A;  3LYX A;  3ITB A;  3EGD C;  4KQQ A;  3E4P A;  1J7G A;  3G31 A;  3NCK A;  3IT9 A;  4PM8 A;  3BWL A;  4GOG A;  3WS1 A;  2HPB A;  5HDD A;  3E98 A;  3VOL A;  4S2I A;  2QPN A;  4NG2 A;  4BLM A;  3PTE A;  4C75 A;  3KO5 A;  3CLO A;  3G2Z A;  4A5R A;  4P87 A;  4II7 A;  1YT4 A;  2G2U A;  4X56 A;  1UWP X;  2WKQ A;  2V1Z A;  5CEB A;  3GRJ A;  4R70 A;  4GHI B;  3KYQ A;  3VSL A;  4MN5 A;  1M40 A;  2HDR A;  2G2W A;  2ZMA A;  4RYE A;  3LR5 A;  1HZO A;  3RXX A;  1MPL A;  1JWV A;  4BD0 A;  4PKY G;  3O3V A;  3CUE A;  4CLC D;  3T50 A;  1G28 A;  3IHA A;  3HRE A;  1ES5 A;  4K0X A;  5D3O A;  2XGN A;  4G3V A;  1NJ4 A;  3F1N A;  3T1Q B;  4N92 A;  1YKD A;  4S03 A;  3ULF A;  2Y55 A;  1DP9 A;  2EX8 A;  1BTL A;  5CTM A;  4IHQ A;  3MF0 A;  4JLF A;  2KDK A;  1YLZ A;  2ZM2 A;  4RRG A;  3UY6 A;  2V8C A;  4BL2 A;  1N9B A;  4IED A;  3ZNY A;  1GSV A;  1W8Q A;  3O87 A;  2V0W A;  5DTS A;  2JKF A;  2QYB A;  3FV7 A;  1JTD A;  3BJN A;  4ESP A;  4EXO A;  2P74 A;  1K55 C;  5EFW A;  1GSW A;  5DF8 A;  2X01 A;  5IS1 A;  5HAR A;  2DRW A;  3Q82 A;  3BEC A;  4NEE D;  1ZTU A;  3T4K A;  1TS7 A;  3RTY A;  4R0Q A;  4U0T A;  2V0U A;  4KZ6 A;  5A93 A;  5C5K A;  2Y2O A;  3UDF A;  3A3J A;  2XA7 S;  1G5U A;  5FI7 A;  2PDR A;  5F82 A;  5TFQ A;  2JKR M;  4RX3 A;  4EET B;  2HP6 A;  1OT6 A;  1VET B;  3Q7V B;  1UWN X;  3IBJ A;  5FDS A;  1YSP A;  4EBN A;  2XH9 A;  4Y7P A;  4DDY A;  4E3J A;  2Y2L A;  4LGW A;  3PAE A;  2QMI A;  4LCM A;  2PRF A;  1ZC2 A;  2XSS A;  2PD7 A;  2XDM A;  1NRJ A;  5HDC A;  3UB9 A;  2WKI A;  1PRQ A;  3GDI A;  4DXB A;  3P98 A;  4LPZ A;  5KMW A;  4RRQ A;  1PI4 A;  3NJA A;  2PU2 A;  3WS4 A;  2A3U A;  2WAE A;  4ZJ3 A;  3B42 A;  4JXG A;  3P09 A;  5GL9 A;  3HJI A;  2VEA A;  5E2H A;  3HL9 A;  5AVE A;  3T4L A;  3SH7 A;  3A3F A;  1IKI A;  1KE3 A;  1IFQ A;  5GLD A;  4MBK A;  1F5M A;  3IF6 B;  2PR6 A;  1SKO A;  4QU3 A;  2ZL1 B;  4HH2 A;  1MY8 A;  2D01 A;  5J8X A;  3UE0 A;  1PW8 A;  4WEK A;  3FPV A;  5KZH A;  1JKE A;  3WS0 A;  3VP0 A;  5DTK A;  3H9W A;  1OTE A;  2ZL1 A;  2DBO A;  1BUE A;  4E6W A;  4CLC A;  5J4E A;  4RRF A;  3FZC A;  4Y0T A;  2PYR A;  5FEG A;  2M7V A;  4LFU A;  1OTA A;  4O01 A;  3PD3 A;  4EUV A;  3Q07 A;  3R7W B;  2PT7 A;  5FQK A;  1VHM A;  3CIT A;  2WGW B;  4OPQ A;  4RR6 A;  1MWU A;  4S2J A;  1FQG A;  1K55 A;  4UAA A;  2ZJ9 A;  3OZH A;  3CZD A;  2HP5 A;  3A3E A;  3MXR A;  3W8K A;  5DKL A;  3V5M A;  1ERQ A;  2EXA A;  3OOV A;  4E3I A;  5HZH A;  4KG6 A;  5FI2 A;  1XJ4 A;  2QJ5 A;  3LID A;  2V9A A;  2JBF A;  3KSF A;  3O88 A;  1TEM A;  4L9E A;  3B33 A;  3PBR A;  1MWS A;  4YNR A;  3V3R A;  3IXG A;  4QD4 A;  2O9A A;  3U2A A;  3K3C A;  3ZCZ A;  2PAV P;  4JF4 A;  3UNW A;  1J9M A;  3VE4 A;  4OP5 A;  2Y8H A;  2ZMF A;  5EVI C;  1TD5 A;  4IUH A;  1T1C A;  3HUN A;  3PAG A;  1S66 L;  4KZB A;  2R9W A;  1ONH A;  2XD5 A;  4Y2F A;  4ZJ2 A;  5HAQ A;  2XK1 A;  5A92 A;  1PWC A;  1LI9 A;  1PZP A;  3HLB A;  4S0I A;  3PBQ A;  3LCE A;  5K5B A;  3ZDJ A;  4X1M A;  3TJZ C;  3E4Q A;  4I3J A;  1NRF A;  4GHI A;  1EWZ A;  3HUO A;  3IWQ A;  3ITA A;  3S7N A;  4JPM A;  2HDS A;  3LO7 A;  4E6X A;  2DNS A;  1ZG4 A;  5J3W A;  3WS5 A;  5DKK A;  2A24 B;  5CGX A;  1W5D A;  2OKV A;  1MKM A;  1K54 A;  1FR6 A;  3FKW A;  1I2W A;  3E2K A;  4QWO A;  4Q0I A;  1IEM A;  3NDG A;  3PXP A;  3LI8 A;  2QKP A;  1YLW A;  4EWF A;  1PWG A;  3M6B A;  4ZDX A;  2VLG A;  1F98 A;  3F1P B;  4B93 A;  4UEY A;  1IEL A;  4EU0 A;  4MDZ A;  3QP2 A;  3QNB A;  3KNF A;  5L10 A;  1MXO A;  2M7U A;  2BTF P;  4GD8 A;  2FH5 A;  1OTB A;  1L0G A;  5A91 A;  3C30 A;  4HBT A;  1Y54 A;  5FQJ A;  3ZYT A;  3C38 A;  4OPY A;  4M3K A;  3G32 A;  4RRL A;  1YMX A;  4P6Z M;  3SS4 A;  1NLZ A;  4OOM A;  1GCE A;  1SDN A;  4HP4 A;  2J8Y A;  1FCO A;  4EW7 A;  3EGX C;  5HD3 A;  4YIN A;  4GCZ A;  1ERO A;  2L1M A;  3TOI A;  4ZRR A;  4R38 A;  5IT5 A;  5FSR A;  3G35 A;  1BLH A;  3I7J A;  2H10 A;  1Q2Q A;  2CC1 A;  2ZQ8 A;  4RR9 A;  4KG5 A;  2Y91 A;  4YWZ A;  4HBU A;  4WM9 A;  1S1Y A;  3TG9 A;  3GEC A;  2J3T D;  3K3D A;  2EFX A;  1YMS A;  2Y2N A;  4OOY A;  5EVI A;  4EES A;  2XRO A;  1VET A;  3SS3 A;  4BJP A;  3HUM A;  3Q7V A;  4LCL A;  1A0K A;  1LI0 A;  5DFY A;  1ZG6 A;  3UME A;  2HDU A;  1CI8 A;  3G30 A;  2PD8 A;  1AXB A;  1XJ6 A;  2Q9N A;  2XR0 A;  3T12 B;  3LY3 A;  2O99 A;  3KOC A;  1GSX A;  2J3T C;  2VK3 A;  1NZO A;  4ZTK A;  2E8I A;  1DY6 A;  5E2E A;  2I72 A;  2C5W B;  5E2G A;  2J80 A;  3T1R A;  4RX2 A;  4Y3I A;  1C3B A;  5DF7 A;  4S2L A;  3EQV A;  3V50 A;  4RA7 A;  1T18 A;  4PM9 A;  4BBV A;  1JWZ A;  4RRH A;  3CMZ A;  3PD4 A;  4N1X A;  3ZG5 A;  3M2K A;  5F1G A;  3HLW A;  3IF6 A;  1EI5 A;  3EWK A;  3UDI A;  2O9C A;  1TVF A;  3BYD A;  1CEF A;  2ZQD A;  1NYY A;  1BLS A;  5AQB A;  1G6A A;  5CXW A;  4F3L A;  3KYZ A;  4MCW A;  2RL3 A;  2DMW A;  1VM1 A;  5A90 A;  5HPI A;  5EUA A;  4R23 A;  1LL8 A;  4L9G A;  1K4F A;  4RRC A;  5L07 A;  1FIK A;  1BSG A;  2XFT A;  4KEN B;  4WUJ A;  1NY0 A;  4GW9 A;  4OQ0 A;  2E8J A;  1K25 A;  1FCM A;  3V67 A;  3R7W A;  4EUZ A;  4R3J A;  1MWT A;  3E2L A;  4PAU A;  3OCN A;  3U4L P;  3KO4 A;  4HHD A;  4Y17 A;  5JYO A;  4YFM A;  1XKZ A;  4HP9 A;  1G68 A;  2HL0 A;  2Y2M A;  3C7U A;  5DTT A;  3LR4 A;  3H7W B;  1LL9 A;  1VB6 A;  4WYY A;  3ZVT A;  3B3X A;  5FQI A;  5CGS A;  5BOH A;  2OWJ A;  4Y0U A;  3F1O A;  2W27 A;  3GVB A;  1JNU A;  3WS2 A;  1PYY A;  3D72 A;  5GLC A;  3FKV A;  5CHJ A;  3LIB A;  4DMZ A;  1FIL A;  2W1T B;  3V3S A;  1PFL A;  3VP1 A;  1WE4 A;  1SDE A;  4B88 A;  3IS2 B;  4DN0 A;  4S0L A;  3W4O A;  4FD8 A;  3RJU A;  2Z6C A;  2VV8 A;  2ZQ7 A;  4MEZ A;  1LSV A;  1F2K A;  1VQQ A;  1CQA A;  3NEC A;  3EOI A;  3SH8 A;  4I5S A;  2ZOI A;  2B02 A;  4WZ5 C;  4LV0 A;  1P9R A;  3LGO A;  5DJT A;  4CLC C;  4S0K A;  3HJK A;  4HIA A;  1IYS A;  3R4K A;  1OTI A;  3BFD A;  4E3M A;  4OQH A;  3T4S A;  3GTC A;  3ZG9 B;  5CHM A;  4H6J B;  4Z9Q A;  3HCY A;  3DAV A;  2FFY A;  4CPK A;  2OAP 1;  3ICY A;  3UMD A;  2W0N A;  1KGG A;  5HAP A;  3QP6 A;  1W63 M;  3C2W A;  2P7J A;  3UB6 A;  4RRB A;  3DTM A;  4WMC D;  3UB5 P;  2VA0 A;  3UE1 A;  3UPP A;  2V20 A;  4EEU A;  1DP8 A;  5L2F A;  3MXQ A;  1K6R A;  2WK0 A;  4RQ9 A;  4I39 A;  1CI9 A;  3F1P A;  5F69 A;  1YLY A;  4X25 A;  4OH0 A;  1G6O A;  5FAQ A;  3MKF A;  2WUQ A;  5TBM B;  2KLI A;  2PU4 A;  2W3E A;  3K2N A;  4Q0H A;  2IWD A;  1NYM A;  3P01 A;  2VGK A;  2XRN A;  3DBA A;  4S2K A;  5FA7 A;  4ETZ A;  2PBD P;  4R1G A;  4UQI M;  1KDW A;  3C4P A;  1PI5 A;  3AGE A;  4N1H A;  4E3L A;  3LI9 A;  3SW1 A;  1LT0 A;  1NLY A;  5DJU A;  5JYP A;  4EQI A;  1O07 A;  3VP2 A;  4S02 A;  5HD5 A;  4E3K A;  3C7V A;  2VGL M;  2PHY A;  2WYX A;  3HLC A;  1Y28 A;  3C4O A;  2ACG A;  1S0W A;  3NHQ A;  1BYW A;  1K4E A;  5FQ9 A;  5TGF A;  5GLA A;  4G3K A;  5EV0 A;  5FAS A;  4KQR A;  5FQQ A;  3FG8 A;  4FTX A;  1IKG A;  4QB8 A;  1OME A;  2JE5 A;  3MQ0 A;  4NXB A;  4U3T A;  4GS9 B;  1K54 C;  3IX8 A;  1FSY A;  2Y2G A;  4OQI A;  2D02 A;  2V1A A;  3UE6 A;  4WZ5 A;  2IWC A;  2DCF A;  5F5Y A;  4RRJ A;  4X53 A;  3DTK A;  1ERM A;  1SZV A;  1BLP A;  5EPH A;  1ONG A;  1H3Q A;  1Z09 A;  3MS6 A;  4XUX A;  4GNU A;  2WKE A;  2HL1 A;  3CHW P;  3LR3 A;  4OP8 A;  1YLT A;  1D7E A;  3P7N A;  4GDB A;  1JWP A;  1PZO A;  2V1B A;  3LIC A;  3N4I A;  4R4S A;  3T4J A;  3FPW A;  4P6B A;  1XFQ A;  5GHZ A;  3OPL A;  3IBR A;  4GN2 A;  2JKG A;  3BY8 A;  5EM1 A;  1YAX A;  4IVK A;  5DFX A;  4IBX A;  4NK3 A;  4HNB A;  3BFF A;  4RVA A;  3ZNT A;  5GLB A;  4PM6 A;  1WYB A;  3LUQ A;  2W1R A;  4GKU A;  2Y2P A;  5CEC A;  2INW A;  5HL6 A;  3OPR A;  2QHK A;  3OPP A;  5F83 A;  1EW0 A;  4OLD A;  3PBN A;  4RR7 A;  1FCN A;  2KX6 A;  3KO9 A;  2VZW A;  2WZX A;  2ZC6 B;  3PHY A;  2Y2I A;  5HDS A;  1OJG A;  5E2F A;  1YLP A;  4CQH A;  4LRY C;  4X1L A;  1KE4 A;  1OTD A;  4OOL A;  1RGY A;  1LLB A;  5CTN A;  3H7W A;  4E3O A;  3LY4 A;  1BT5 A;  4WZ4 A;  3G6O A;  3CJM A;  3H82 B;  3F1N B;  2GX5 A;  1CF0 A;  4IJG A;  3VFH A;  3WRZ A;  4DDS A;  3C5A A;  1ES4 A;  5G4Z A;  2Z2M B;  1OPX A;  3MJQ A;  3ZHH A;  2HKZ A;  4S2M A;  2QWS A;  3KYE A;  2W1T A;  2EFU A;  2WAD A;  4XT2 B;  3QNC A;  3ZVW A;  4KUK A;  4O0P A;  5FDH A;  4MMN A;  3FC7 A;  3MKE A;  3BEB A;  4H8R A;  5DF9 A;  3IF6 C;  4HOI A;  2L0W A;  2ZC7 A;  4EER A;  5HWW A;  3WWX A;  5M18 A;  1IYQ A;  4KUO A;  4RRA A;  3A0R A;  1HLU P;  4DRT A;  5L09 A;  3QP5 A;  5CED A;  1KDS A;  2A2L A;  3BFC A;  3BRM A;  3MQO A;  4OQG A;  4NBJ A;  4RRR A;  3KO6 A;  1H0M A;  3A3I A;  3LR0 A;  2HJE A;  2WKP A;  1W7F A;  4Z1W A;  2EXB A;  3NUL A;  4DE1 A;  1XA1 A;  1H8M A;  2B95 A;  3UE3 A;  3LEZ A;  5J61 A;  1Y2Q A;  3T1S A;  4BWI A;  4UA9 A;  4C6Y A;  1XA7 A;  1K0K A;  2Y4A A;  4H6J A;  4DKI A;  3QP1 A;  2VV7 A;  3T1X A;  2M1C A;  2MJ6 A;  2LB9 A;  3MSH A;  1I2S A;  1W63 Q;  3UN7 A;  3JYI A;  4FOF A;  5A8B A;  4P0M A;  2HZ5 A;  4PM5 A;  2QJ7 A;  3NOP C;  1PNE A;  3N7W A;  4UA6 A;  4WEJ A;  1RGZ A;  1VEU B;  1SCW A;  4Y15 A;  1U60 A;  4GDN A;  3IWI A;  1TS6 A;  5F1F A;  2RCX A;  1K6S A;  4WEL A;  3IH8 A;  3HLF A;  4NKP A;  4OON A;  1TDL A;  3LFV A;  2Q9M A;  3BLM A;  3MFX A;  3RH8 B;  4I3A A;  1OT9 A;  2ZMV A;  4EEP A;  5HWT A;  4B9O A;  1F9I A;  3PR6 A;  1XXM A;  2HF6 A;  2ZQ9 A;  3UPO A;  3IXB A;  4HJ4 A;  5FQM A;  4BD1 A;  3HLD A;  2ZM8 A;  1KVM A;  3Q7Z A;  1X0O A;  3N8R A;  3SZT A;  2ZC3 B;  3LMV A;  1STZ A;  2JN7 A;  3UDX A;  2Y2H A;  3S7P A;  3TSG A;  2NUP C;  5HFO A;  2XEP A;  4KG2 A;  3T4O A;  3IX4 A;  3D3O A;  4XXR A; 
#chains in the Genus database with same CATH homology
 4X68 A;  4WZ5 C;  3BLS A;  3A3D A;  1H8Y A;  5KZH A;  4LV0 A;  1JKE A;  3WS0 A;  3VP0 A;  1DJB A;  4C3Q A;  4PMA A;  4S0K A;  3HLE A;  5DTK A;  3FYZ A;  4OPR A;  1IYS A;  2FFF B;  3NDE A;  3BFD A;  3NY4 A;  4E3M A;  4OQH A;  1CEG A;  2DBO A;  4S0J A;  1BUE A;  3AGD A;  5CRF A;  4BEN A;  4E6W A;  2B5R A;  4RRF A;  3FZC A;  1E3U D;  4UHU A;  5EVL A;  3GTC A;  2HDQ A;  4Y0T A;  3ZG9 B;  5CHM A;  3CG5 A;  5AQA A;  1WYC A;  4Z9Q A;  3GR2 A;  4KZ3 A;  3PD3 A;  2FFY A;  4CPK A;  4KZA A;  3Q07 A;  4D2O A;  4QY5 A;  5FQK A;  1KGG A;  1XX2 A;  5HAP A;  2WGW B;  4FCF A;  4IVI A;  2XFS A;  4RRB A;  4OPQ A;  1L0E A;  4KZ5 A;  3O86 A;  4RR6 A;  3DTM A;  4WMC D;  5IHV A;  1MWU A;  4S2J A;  3GQZ A;  3UE1 A;  1L2S A;  3UPP A;  3MZF A;  1KVL A;  2V20 A;  1FQG A;  1K57 C;  1K55 A;  4UAA A;  4XUZ A;  1ES3 A;  2HL2 A;  4R4R A;  2ZJ9 A;  3OZH A;  5L2F A;  3OCL A;  3CZD A;  3MZD A;  1K6R A;  2HP5 A;  3ISG A;  2WK0 A;  3A3E A;  3MXR A;  3W8K A;  1LL5 A;  3V5M A;  1ERQ A;  2EXA A;  2WGW A;  3NC8 A;  4ZJ1 A;  1XPB A;  3ZG7 B;  3VP3 A;  3VOZ A;  4E3I A;  3KNP A;  4KG6 A;  5FI2 A;  3UPN A;  2OLU A;  4E3N A;  4BL3 A;  1CI9 A;  4X55 A;  2JBF A;  3LMU A;  1YLY A;  1NXY A;  4OH0 A;  5U47 A;  2WZZ A;  3SS5 A;  5FAQ A;  3OC2 A;  3MKF A;  2WUQ A;  3PD2 A;  5AQ7 A;  1L0F A;  1TEM A;  3O88 A;  1GA9 A;  4OLG A;  3PBR A;  2P9V B;  3IQA A;  2A49 A;  2ZQA A;  1MWS A;  2Z2L B;  5GHY A;  5EEC A;  3GMW A;  2PU4 A;  3V3R A;  1O7E A;  5HX9 A;  3BFG A;  4OKP A;  1E4D A;  3IXG A;  4QD4 A;  1M6K A;  4S2N C;  3EQU A;  2XD1 A;  4DE2 A;  4S2P A;  2IWD A;  1NYM A;  2VGK A;  5EOE A;  2PBY A;  4JXV A;  4X6T A;  3W4P A;  5FI6 A;  4S2K A;  3ZCZ A;  1K38 A;  2Y2K A;  5FA7 A;  4DE0 A;  4R1G A;  5KSH A;  1ESI A;  3ZG8 B;  4JF4 A;  1KDW A;  2OLV A;  3C4P A;  3UNW A;  4RRD A;  1PI5 A;  2H0T A;  3AGE A;  1HTZ A;  4L0L A;  4N1H A;  4E3L A;  4S2O A;  4ID4 A;  1CK3 A;  1J9M A;  1GA0 A;  4MBH A;  5JYP A;  1E25 A;  2Y2J A;  4EQI A;  4OP5 A;  1TC5 A;  4OVD A;  4MLL A;  1FSW A;  3G4P A;  5EVI C;  1O07 A;  3VP2 A;  4S02 A;  2X71 A;  5EE8 A;  2HP9 A;  3HUN A;  3MXS A;  4E3K A;  3C7V A;  1DJA A;  3PAG A;  2WYX A;  4LV1 A;  1KGF A;  2V2F F;  3HLC A;  5AQ9 A;  5HAI A;  4F94 A;  3C4O A;  4O7D A;  4KZB A;  1S0W A;  1XGI A;  2J7V A;  2R9W A;  3DWK A;  1K4E A;  1ONH A;  2XD5 A;  5FQ9 A;  1FOF A;  5TGF A;  4EV4 A;  4ZJ2 A;  5GLA A;  4RRM A;  5FAS A;  5HAQ A;  3ZG0 A;  2XK1 A;  3HBR A;  5A92 A;  1QME A;  2ZC5 B;  1GHM A;  1LI9 A;  1PWC A;  1PZP A;  1Z6F A;  2H5S A;  3IF5 A;  1HVB A;  3HLB A;  2QZ6 A;  4S0I A;  4KQR A;  3PBQ A;  5FQQ A;  4EBL A;  3LCE A;  3NI9 A;  5CGW A;  4QY6 A;  3BFE A;  3ZDJ A;  1IKG A;  1HD8 A;  4ZAM A;  3PBO A;  4QB8 A;  3IXH A;  1FR1 A;  1NRF A;  3UO9 A;  1SKF A;  3MFD A;  1QMF A;  1EWZ A;  4KZ9 A;  1OME A;  2JE5 A;  3HUO A;  3ZGA B;  3NBL A;  3IWQ A;  3S4X A;  5I94 A;  2WAF A;  2ZM0 A;  3ITA A;  4PPR A;  3IHB A;  1ZKJ A;  1DJC A;  4JPM A;  1K56 A;  2HDS A;  4U3T A;  3VP4 A;  1K54 C;  2XF3 A;  3LO7 A;  4QHC A;  1ESU A;  1FSY A;  2Y2G A;  4E6X A;  2DNS A;  1ZG4 A;  4OQI A;  4GZB A;  3WS5 A;  1L0D A;  4FH2 A;  1MKI A;  4WZ5 A;  5CGX A;  2IWC A;  2DCF A;  4GB7 A;  4RRJ A;  4X53 A;  1W5D A;  1ERM A;  2EX6 A;  4JXS A;  2OKV A;  4QJG A;  3G34 A;  1K54 A;  4JXW A;  1BLP A;  5EPH A;  1KGE A;  1ONG A;  1IYO A;  1FR6 A;  5GHX A;  1BLC A;  3FKW A;  1I2W A;  3E2K A;  4XUX A;  3MZE A;  3FWL A;  4GNU A;  2WKE A;  5HW3 A;  2HL1 A;  1IEM A;  4LV2 A;  2ZC4 B;  4OP8 A;  1YLT A;  3NDG A;  4PM7 A;  1YLW A;  4EWF A;  4BQM A;  4JF6 A;  1PWG A;  3M6B A;  4ZDX A;  1PIO A;  4GDB A;  2OSU A;  1JWP A;  1PZO A;  3N4I A;  2R9X A;  4R4S A;  3M2J A;  1IEL A;  1XGJ A;  3QNB A;  4P6B A;  3KNF A;  2BG1 A;  1MXO A;  5GHZ A;  3KOB A;  1BZA A;  4NET A;  4KZ7 A;  3KO7 A;  3OPL A;  4GN2 A;  4GD8 A;  3MBZ A;  3S22 A;  1K57 A;  1RCJ A;  5CHU A;  4N9L A;  1L0G A;  5A91 A;  4IVK A;  4OPZ A;  2X02 A;  4MBF A;  3GSG A;  1MWR A;  4IBX A;  1I5Q A;  1RP5 A;  2GDN A;  4NK3 A;  1YM1 A;  2IWB A;  4HBT A;  1E3U A;  4X69 A;  1Y54 A;  5FQJ A;  5CER A;  1PWD A;  3VSK A;  1H5X A;  4RR8 A;  2XQZ A;  3BFF A;  4OPY A;  4RVA A;  3ZNT A;  4M3K A;  5GLB A;  5M1A A;  4CJN A;  3G32 A;  4IBR A;  4RRL A;  4PM6 A;  1YMX A;  2EX9 A;  3BM6 A;  5G18 A;  1WYB A;  3SS4 A;  3HVF A;  5DVA A;  5KSC A;  4GKU A;  2Y2P A;  3Q81 A;  5CEC A;  4JF5 A;  4OOM A;  1GCE A;  3ITB A;  1SDN A;  4KQQ A;  2J8Y A;  1FCO A;  2Y59 A;  3OPR A;  4YIN A;  1J7G A;  3G31 A;  3NCK A;  3IT9 A;  1ERO A;  4PM8 A;  3RXW A;  4GOG A;  3TOI A;  3WS1 A;  2HPB A;  3OPP A;  4S2N A;  3IH9 A;  5FSR A;  5EOO A;  5F83 A;  4FH4 A;  2QPN A;  4S2I A;  4Q8I A;  4OLD A;  5EVI B;  1IYP A;  3G35 A;  3PBN A;  4RR7 A;  1BLH A;  3I7J A;  1H8Z A;  1FCN A;  3KO9 A;  4BLM A;  3PTE A;  4C75 A;  2H10 A;  1Q2Q A;  2CC1 A;  1BUL A;  2WZX A;  2ZC6 B;  2H0Y A;  3KO5 A;  2Y2I A;  2ZQ8 A;  4B4Z A;  4RR9 A;  3G2Z A;  4KG5 A;  5E2F A;  2Y91 A;  4HBU A;  4WM9 A;  3W4Q A;  4P87 A;  4A5R A;  3TG9 A;  1YT4 A;  1YLP A;  2G2U A;  4X56 A;  2EFX A;  1YMS A;  2V1Z A;  5CEB A;  2Y2N A;  4OOY A;  1PW1 A;  5EVI A;  4RRG A;  3SH8 A;  3GRJ A;  3SS3 A;  4BJP A;  3HUM A;  3Q7V A;  3VSL A;  4LCL A;  1LI0 A;  1KE4 A;  3HLG A;  4OOL A;  3DWZ A;  1RGY A;  1S6R A;  1W8Y A;  1LLB A;  1ZG6 A;  5CTN A;  2HDU A;  1M40 A;  4JKT A;  2HDR A;  2G2W A;  1CI8 A;  1KE0 A;  2ZMA A;  3AGF A;  3G30 A;  4RYE A;  3SOI A;  4E3O A;  3LY4 A;  1AXB A;  1BT5 A;  4WZ4 A;  2Q9N A;  2XR0 A;  1HZO A;  3CJM A;  3LY3 A;  3RXX A;  3PBS A;  2JCH A;  5FAT A;  3KOC A;  1TDG A;  1MPL A;  3VFH A;  1JWV A;  4BD0 A;  3WRZ A;  4DDS A;  3C5A A;  3O3V A;  1ES4 A;  1NZO A;  4ZTK A;  2E8I A;  3IHA A;  5HL1 A;  2Z2M B;  1DY6 A;  5E2E A;  3HRE A;  1YLJ A;  2C5W B;  2I72 A;  5E2G A;  4LEN A;  1ES5 A;  4K0X A;  4WBG A;  5D3O A;  4RX2 A;  3ZHH A;  2HKZ A;  2XGN A;  1C3B A;  4S2M A;  1NJ4 A;  2WAD A;  2EFU A;  4KZ4 A;  3ZVW A;  3QNC A;  5DF7 A;  4K91 A;  1YQS A;  4S2L A;  3EQV A;  5FDH A;  3VFF A;  4N92 A;  3MKE A;  3BEB A;  4RA7 A;  3V50 A;  3ZFZ A;  4H8R A;  4S03 A;  4PM9 A;  5DF9 A;  4NBI A;  2Y55 A;  1JWZ A;  1ES2 A;  3IF6 C;  4RRH A;  2EX8 A;  1BTL A;  3D4F A;  3KO3 A;  3CMZ A;  1ALQ A;  5CTM A;  3PD4 A;  4R3B A;  2ZC7 A;  4JLF A;  4MNR A;  3N8S A;  1YLZ A;  2ZM2 A;  4N1X A;  3WWX A;  3ZG5 A;  1IYQ A;  4P85 A;  3M2K A;  3UY6 A;  2J9O A;  4UA7 A;  5M18 A;  4RRA A;  5F1G A;  3HLW A;  3IF6 A;  4BL2 A;  3PD5 A;  4DRT A;  2ZQC A;  3LMT A;  4JBF A;  1EI5 A;  4Y0O A;  1N9B A;  3UDI A;  5CED A;  4B4X A;  3GV9 A;  1KDS A;  4IED A;  3ZNY A;  4KZ8 A;  1TVF A;  1W8Q A;  4DF6 A;  3BYD A;  3BFC A;  3BRM A;  3O87 A;  1CEF A;  2ZQD A;  1NYY A;  1BLS A;  4OQG A;  1GHI A;  5DTS A;  3KOD A;  4NBJ A;  1MBL A;  5AQB A;  4RRR A;  1G6A A;  2WGV A;  2XLN A;  5CXW A;  5FAP A;  3FV7 A;  3A3I A;  1JTD A;  2RL3 A;  2UWX A;  4HEF A;  4KQO A;  1W7F A;  2P74 A;  2EXB A;  4ZBE A;  1K55 C;  4DE1 A;  1VM1 A;  4LV3 A;  4DXC A;  5A90 A;  5EUA A;  4R23 A;  5DF8 A;  1XA1 A;  2X01 A;  5HAR A;  2DRW A;  3Q82 A;  1K4F A;  3BEC A;  1SHV A;  3LEZ A;  3UE3 A;  4RRC A;  5J61 A;  2OV5 A;  1Y2Q A;  1BSG A;  4UA9 A;  4C6Y A;  1XA7 A;  2XFT A;  3N6I A;  4KEN B;  1NY0 A;  2BLS A;  2Y4A A;  4OQ0 A;  3NIA A;  4GD6 A;  4DKI A;  2WKH A;  2J9P A;  4R0Q A;  4U0T A;  3SH9 A;  1K25 A;  1FCM A;  4EUZ A;  4KZ6 A;  5A93 A;  4R3J A;  2Y2O A;  3UDF A;  3IXD A;  3A3J A;  4WMC A;  1LHY A;  1I2S A;  1MWT A;  5TR7 A;  3WRT A;  4N9K A;  1NZU A;  3VMA A;  3UN7 A;  3JYI A;  5FI7 A;  5F82 A;  5TFQ A;  3E2L A;  3Q1F A;  3OCN A;  3M6H A;  4P0M A;  4PM5 A;  3KO4 A;  4RX3 A;  2C6W B;  2HP6 A;  5EVI D;  3N7W A;  4UA6 A;  3Q7V B;  4WEJ A;  1RGZ A;  5JYO A;  4YFM A;  1XKZ A;  1G68 A;  2WGI A;  2HL0 A;  2Y2M A;  5E43 A;  3C7U A;  1SCW A;  3IWO A;  2XH9 A;  5DTT A;  4Y7P A;  4EBN A;  3OPH A;  1LL9 A;  1U60 A;  4DDY A;  1W79 A;  2ZLY A;  4E3J A;  4GDN A;  1GHP A;  3IWI A;  4WYY A;  4RRI A;  2Y2L A;  4HES A;  3B3X A;  3ZVT A;  3S1Y A;  5FQI A;  2RCX A;  5F1F A;  1K6S A;  5CGS A;  4WEL A;  4EBP A;  3N8L A;  5BOH A;  3G2Y A;  4RRK A;  3IH8 A;  3PAE A;  4Y0U A;  4DE3 A;  2QMI A;  3HLF A;  4LCM A;  2ZD8 A;  2P9V A;  2VGJ A;  1ZC2 A;  4OON A;  1TDL A;  2Q9M A;  3GVB A;  3BLM A;  4K0W A;  3V39 A;  2XDM A;  1N4O A;  2WKI A;  3WS2 A;  1PYY A;  1JVJ A;  1K56 D;  2Y2Q A;  5M19 A;  5GLC A;  3FKV A;  5CHJ A;  3P98 A;  4DXB A;  5KMW A;  4RRQ A;  1PI4 A;  3PBT A;  1Q2P A;  5FAO A;  4FSF A;  3V3S A;  2PU2 A;  3WS4 A;  2A3U A;  1XXM A;  3VP1 A;  2WAE A;  4ZJ3 A;  4JXG A;  3P09 A;  3QHY A;  4U0X A;  1WE4 A;  1SDE A;  2EX2 A;  2ZQ9 A;  5E2H A;  5GL9 A;  4B88 A;  3HL9 A;  3IXB A;  3UPO A;  5FQM A;  4BD1 A;  4S0L A;  3W4O A;  3HLD A;  2ZM8 A;  4FD8 A;  3RJU A;  1KVM A;  3Q7Z A;  2ZQ7 A;  3N8R A;  2ZC3 B;  3SH7 A;  3LMV A;  3A3F A;  1IKI A;  1KE3 A;  4MEZ A;  3UDX A;  3VOY A;  5GLD A;  2Y2H A;  4MBK A;  1VQQ A;  2JC7 A;  3IF6 B;  3TSG A;  1JTG A;  5HFO A;  4QU3 A;  2XEP A;  4KG2 A;  1XP4 A;  1MY8 A;  5J8X A;  3UE0 A;  1PW8 A;  4XXR A;  4WEK A;  3DW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...