5CEIB

Crystal structure of cdk8:cyclin c complex with compound 22
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
268
structure length
268
Chain Sequence
DDKAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title Development of a Potent, Specific CDK8 Kinase Inhibitor Which Phenocopies CDK8/19 Knockout Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transferase/inhibitor
total genus 104
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5ceiB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5ceiB01
2UZEB 5EFQB 3RGFB 4F6UB 1GH6B 3QHWB 1P5EB 3TNWB 4CFUD 4CXAB 3BHTB 3MI9B 3QHRB 1FINB 5IDPB 1H1SB 1H1RB 1OKWB 2WMAB 4OGRB 2JGZB 1H1PB 4I3ZB 2UUEB 3H4CA 5I5ZB 4F7SB 2B9RA 5CYIB 4F7LB 5HVYB 1ZP2A 1N4MA 2I40B 4EOJB 4BCPB 1O9KA 1H26B 1GY3B 1QMZB 2CCHB 4YOSA 4ROEA 2V22B 5HNBB 5L2WB 5LMKB 1TFBA 2PHGA 3MY1B 1H28B 2WIHB 1UNHD 4ELJA 1H1QB 4EOPB 1JSUB 3DDQB 1OL1B 4BCOB 2G9XB 5ICPB 4EOSB 4CFNB 1BU2A 3BLHB 4EOMB 3BHVB 4BCIB 2IVXA 4IMYB 2C5VB 1PKDB 2W2HA 4F7NB 4EOLB 1W98B 1H25B 1OL2B 1VINA 4UN0A 3O0GD 5IF1B 2C5NB 3G33B 4CFXB 1GUXB 3TNHB 3MY5B 3EIDB 4YOZA 4CFMB 1JOWA 4EOKB 5BNJB 2UZDB 5LQFB 4EONB 5HBHB 4BCFB 4BCND 1OIUB 4ROCA 4BCMD 1OIYB 1G3NC 3DOGB 1URCB 2WPAB 4RODA 4KRDB 4CFVB 1D3UB 3BLRB 3M03A 1XO2A 2PK2A 3BLQB 2W96A 2WEVB 4CFWB 2PK9B 1F5QB 2F2CA 4BCNB 1H27B 4BCKB 1VOLA 4BCMB 4EOQB 2BKZB 4F7JB 1OGUB 3MIAB 2W9FA 2IW6B 2QDJA 1GUXA 2R7GA 2WIPB 1E9HB 2EUFA 4YC3B 2IW9B 4II5B 4EC8B 5HBEB 3K7AM 5IDNB 2W99A 3POMA 3BHUB 4OR5B 1JSTB 4CRLB 1H24B 1OKVB 4BCQD 2C5XB 3EOCB 2BPMB 4F70B 1VYWB 4FX3B 4KRCB 4NSTB 1C9BA 4BCJB 2CJMB 2W9ZA 3LQ5B 5FGKB 2CCIB 4ELLA 1UNLD 4BCHB 4F6WB 1AD6A 1JKWA 2WHBB 2WXVB 5HBJB 4F6SB 5ACBA 1UNGD 2PMIB 4BCQB 4BCGB 1KXUA 2WMBB 2UZBB 5CEIB 4TTHA 1FVVB 2IW8B 1AISB 4YOOA 1OI9B 4CFUB 2UZLB 4G6LB 4Y72B 4EC9B 1O9KB 4EOOB 1H4LD 4EOIB 2X1NB 3TN8B 4EORB 2C6TB 3EJ1B 3F5XB 5HQ0B 2WFYB 3DDPB 2C5OB 2C4GB 3TNIB 2I53A
chains in the Genus database with same CATH superfamily
2UZEB 4F6UB 3QHWB 1P5EB 4AKGA 5IDPB 1H1PB 2QF7A 4I3ZB 5I5ZB 1FKMA 2B9RA 3WVDB 3TW7A 5HVYB 1E7PA 1QMZB 5L2WB 5HNBB 2PHGA 1H28B 3A8OB 1H1QB 3HO8A 2WJ9A 4BCOB 5DQWA 2G9XB 4MFEA 2IVXA 4BY7X 1PKDB 2W2HA 1W98B 2QDYB 4BXXX 1JOWA 2ZZDB 1G3NC 3HHTB 3A8LB 4KRDB 2BS2A 1D3UB 4HNVA 4LOCA 1H27B 4BCKB 4EOQB 1OGUB 2WIPB 2EUFA 4YC3B 2IW9B 4EC8B 1IREB 2W99A 4QSHA 3KHIA 4BCQD 2CYZB 4NSTB 3DJBA 2CJMB 3LQ5B 4JX5A 2CCIB 1UNLD 1JKWA 2WHBB 3X24B 5ACBA 4BCQB 2DXBB 5CEIB 1FVVB 1AISB 4YOOA 4EOOB 1H4LD 2X1NB 2C6TB 2AHJB 3PO3S 3B57A 3TNIB 5EFQB 2DD4B 1GH6B 4CFUD 4BBRM 3MI9B 2WMAB 2JGZB 2UUEB 5EJCA 4BCPB 3BG3A 5IHYA 2ZPFB 5LMKB 4EOPB 1JSUB 3DDQB 5ICPB 1QLBA 4EOSB 3VKGA 3BHVB 3WVEB 2C5VB 4F7NB 3VYHB 2QFZA 3GTMS 4OB2B 1GUXB 3TNHB 4ZGDB 5HBHB 3HZJA 1OIYB 3DOGB 2WPAB 3BLRB 2PK2A 2WEVB 2CZ6B 3QYGB 2F2CA 4OB0B 4F7JB 2QDJA 2R7GA 2KMGA 3X25B 4OB3B 3POMA 4AI6A 1OKVB 4F70B 4KRCB 4M6VA 2BS4A 4BCJB 4F6WB 2WXVB 2CZ0B 5HBJB 2PMIB 2UZBB 2IW8B 1UGQB 1OI9B 3NDQA 4EC9B 2DMEA 4EOIB 5HQ0B 2WFYB 2DD5B 3QZ5B 2C4GB 1TD6A 3X20B 4JX6A 3RGFB 2PJQA 3BHTB 3QHRB 3QYEA 3VYGB 4F7SB 5CYIB 4F7LB 4EOJB 1N4MA 2I40B 4AKIA 1O9KA 2CCHB 1H26B 4ROEA 2QQ8A 3DL1A 2WIHB 1UNHD 4JX4A 3DTOA 3BLHB 2ZPEB 3VKHA 4IMYB 4EOLB 1H25B 1OL2B 1VINA 3O0GD 3G33B 2ZCFB 1UGRB 3MY5B 1V29B 3EIDB 1UGSB 4YOZA 2C5OB 4EOKB 2DPPB 2ZPIB 5LQFB 4BCND 4ZGJB 1OIUB 2LW4A 2CZ1B 3M03A 3BLQB 2W96A 4BY1X 2PK9B 1F5QB 4BCNB 2BKZB 3MIAB 2W9FA 4FM4B 1AHJB 5HBEB 4HLQA 2CZ7B 4OR5B 1JSTB 4CRLB 1H24B 3QZ9B 2C5XB 3EOCB 3HBLA 1VYWB 3X26B 3QYBA 3QWLA 2W9ZA 2IN3A 1AD6A 4F6SB 1UNGD 4MIMA 3BG9A 4BCGB 1KXUA 2WMBB 2D0QB 4Z6YA 2UZLB 3QXEB 3TN8B 3EJ1B 3A8GB 2I53A 4MFDA 3TNWB 4CXAB 1FINB 1H1SB 1H1RB 1OKWB 4OGRB 3HB9A 4HNTA 3H4CA 3BG5A 1ZP2A 1GY3B 4YOSA 2V22B 1TFBA 3MY1B 4ELJA 2ZPGB 2DXCB 1OL1B 4CFNB 1BU2A 4EOMB 4BCIB 3A8HB 4UN0A 5IF1B 2C5NB 4CFXB 2KR6A 2ZPHB 5DQVA 4CFMB 4AKHA 5BNJB 2UZDB 4EONB 2BS3A 4BCFB 4NC6A 4ROCA 4BCMD 1URCB 4RODA 4HL4A 3X28B 4CFVB 1XO2A 4CFWB 4OB1B 2ZPBB 1VOLA 4BCMB 2G77A 2IW6B 3TW6A 1GUXA 1E9HB 4II5B 3K7AM 5IDNB 3BHUB 2QGSA 4ZGEB 2BPMB 4FX3B 4BBSM 1C9BA 5FGKB 4ELLA 4BCHB 4HNUA 3A8MB 4TTHA 1ENWA 4CFUB 4G6LB 4Y72B 1O9KB 1UGPB 4EORB 3F5XB 3DDPB 3QYHB
chains in the Genus database with same CATH topology
2UZEB 5EFQB 3RGFB 4F6UB 1GH6B 3QHWB 1P5EB 3TNWB 4CFUD 4CXAB 3BHTB 3MI9B 3QHRB 1FINB 5IDPB 1H1SB 1H1RB 1OKWB 2WMAB 4OGRB 2JGZB 1H1PB 4I3ZB 2UUEB 3H4CA 5I5ZB 4F7SB 2B9RA 5CYIB 4F7LB 5HVYB 1ZP2A 1N4MA 2I40B 4EOJB 4BCPB 1O9KA 1H26B 1GY3B 1QMZB 2CCHB 4YOSA 4ROEA 2V22B 5HNBB 5L2WB 5LMKB 1TFBA 2PHGA 3MY1B 1H28B 2WIHB 1UNHD 4ELJA 1H1QB 4EOPB 1JSUB 3DDQB 1OL1B 4BCOB 2G9XB 5ICPB 4EOSB 4CFNB 1BU2A 3BLHB 4EOMB 3BHVB 4BCIB 2IVXA 4IMYB 2C5VB 1PKDB 2W2HA 4F7NB 4EOLB 1W98B 1H25B 1OL2B 1VINA 4UN0A 3O0GD 5IF1B 2C5NB 3G33B 4CFXB 1GUXB 3TNHB 3MY5B 3EIDB 4YOZA 4CFMB 1JOWA 4EOKB 5BNJB 2UZDB 5LQFB 4EONB 5HBHB 4BCFB 4BCND 1OIUB 4ROCA 4BCMD 1OIYB 1G3NC 3DOGB 1URCB 2WPAB 4RODA 4KRDB 4CFVB 1D3UB 3BLRB 3M03A 1XO2A 2PK2A 3BLQB 2W96A 2WEVB 4CFWB 2PK9B 1F5QB 2F2CA 4BCNB 1H27B 4BCKB 1VOLA 4BCMB 4EOQB 2BKZB 4F7JB 1OGUB 3MIAB 2W9FA 2IW6B 2QDJA 1GUXA 2R7GA 2WIPB 1E9HB 2EUFA 4YC3B 2IW9B 4II5B 4EC8B 5HBEB 3K7AM 5IDNB 2W99A 3POMA 3BHUB 4OR5B 1JSTB 4CRLB 1H24B 1OKVB 4BCQD 2C5XB 3EOCB 2BPMB 4F70B 1VYWB 4FX3B 4KRCB 4NSTB 1C9BA 4BCJB 2CJMB 2W9ZA 3LQ5B 5FGKB 2CCIB 4ELLA 1UNLD 4BCHB 4F6WB 1AD6A 1JKWA 2WHBB 2WXVB 5HBJB 4F6SB 5ACBA 1UNGD 2PMIB 4BCQB 4BCGB 1KXUA 2WMBB 2UZBB 5CEIB 4TTHA 1FVVB 2IW8B 1AISB 4YOOA 1OI9B 4CFUB 2UZLB 4G6LB 4Y72B 4EC9B 1O9KB 4EOOB 1H4LD 4EOIB 2X1NB 3TN8B 4EORB 2C6TB 3EJ1B 3F5XB 5HQ0B 2WFYB 3DDPB 2C5OB 2C4GB 3TNIB 2I53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZE B;  5EFQ B;  3RGF B;  4F6U B;  1GH6 B;  3QHW B;  1P5E B;  3TNW B;  4CFU D;  4CXA B;  3BHT B;  3MI9 B;  3QHR B;  1FIN B;  5IDP B;  1H1S B;  1H1R B;  1OKW B;  2WMA B;  4OGR B;  2JGZ B;  1H1P B;  4I3Z B;  2UUE B;  3H4C A;  5I5Z B;  4F7S B;  2B9R A;  5CYI B;  4F7L B;  5HVY B;  1ZP2 A;  1N4M A;  2I40 B;  4EOJ B;  4BCP B;  1O9K A;  1H26 B;  1GY3 B;  1QMZ B;  2CCH B;  4YOS A;  4ROE A;  2V22 B;  5HNB B;  5L2W B;  5LMK B;  1TFB A;  2PHG A;  3MY1 B;  1H28 B;  2WIH B;  1UNH D;  4ELJ A;  1H1Q B;  4EOP B;  1JSU B;  3DDQ B;  1OL1 B;  4BCO B;  2G9X B;  5ICP B;  4EOS B;  4CFN B;  1BU2 A;  3BLH B;  4EOM B;  3BHV B;  4BCI B;  2IVX A;  4IMY B;  2C5V B;  1PKD B;  2W2H A;  4F7N B;  4EOL B;  1W98 B;  1H25 B;  1OL2 B;  1VIN A;  4UN0 A;  3O0G D;  5IF1 B;  2C5N B;  3G33 B;  4CFX B;  1GUX B;  3TNH B;  3MY5 B;  3EID B;  4YOZ A;  4CFM B;  1JOW A;  4EOK B;  5BNJ B;  2UZD B;  5LQF B;  4EON B;  5HBH B;  4BCF B;  4BCN D;  1OIU B;  4ROC A;  4BCM D;  1OIY B;  1G3N C;  3DOG B;  1URC B;  2WPA B;  4ROD A;  4KRD B;  4CFV B;  1D3U B;  3BLR B;  3M03 A;  1XO2 A;  2PK2 A;  3BLQ B;  2W96 A;  2WEV B;  4CFW B;  2PK9 B;  1F5Q B;  2F2C A;  4BCN B;  1H27 B;  4BCK B;  1VOL A;  4BCM B;  4EOQ B;  2BKZ B;  4F7J B;  1OGU B;  3MIA B;  2W9F A;  2IW6 B;  2QDJ A;  1GUX A;  2R7G A;  2WIP B;  1E9H B;  2EUF A;  4YC3 B;  2IW9 B;  4II5 B;  4EC8 B;  5HBE B;  3K7A M;  5IDN B;  2W99 A;  3POM A;  3BHU B;  4OR5 B;  1JST B;  4CRL B;  1H24 B;  1OKV B;  4BCQ D;  2C5X B;  3EOC B;  2BPM B;  4F70 B;  1VYW B;  4FX3 B;  4KRC B;  4NST B;  1C9B A;  4BCJ B;  2CJM B;  2W9Z A;  3LQ5 B;  5FGK B;  2CCI B;  4ELL A;  1UNL D;  4BCH B;  4F6W B;  1AD6 A;  1JKW A;  2WHB B;  2WXV B;  5HBJ B;  4F6S B;  5ACB A;  1UNG D;  2PMI B;  4BCQ B;  4BCG B;  1KXU A;  2WMB B;  2UZB B;  5CEI B;  4TTH A;  1FVV B;  2IW8 B;  1AIS B;  4YOO A;  1OI9 B;  4CFU B;  2UZL B;  4G6L B;  4Y72 B;  4EC9 B;  1O9K B;  4EOO B;  1H4L D;  4EOI B;  2X1N B;  3TN8 B;  4EOR B;  2C6T B;  3EJ1 B;  3F5X B;  5HQ0 B;  2WFY B;  3DDP B;  2C5O B;  2C4G B;  3TNI B;  2I53 A; 
#chains in the Genus database with same CATH topology
 2UZE B;  4F6U B;  3QHW B;  1P5E B;  4AKG A;  5IDP B;  1H1P B;  2QF7 A;  4I3Z B;  5I5Z B;  1FKM A;  2B9R A;  3WVD B;  3TW7 A;  5HVY B;  1E7P A;  1QMZ B;  5L2W B;  5HNB B;  2PHG A;  1H28 B;  3A8O B;  1H1Q B;  3HO8 A;  2WJ9 A;  4BCO B;  5DQW A;  2G9X B;  4MFE A;  2IVX A;  4BY7 X;  1PKD B;  2W2H A;  1W98 B;  2QDY B;  4BXX X;  1JOW A;  2ZZD B;  1G3N C;  3HHT B;  3A8L B;  4KRD B;  2BS2 A;  1D3U B;  4HNV A;  4LOC A;  1H27 B;  4BCK B;  4EOQ B;  1OGU B;  2WIP B;  2EUF A;  4YC3 B;  2IW9 B;  4EC8 B;  1IRE B;  2W99 A;  4QSH A;  3KHI A;  4BCQ D;  2CYZ B;  4NST B;  3DJB A;  2CJM B;  3LQ5 B;  4JX5 A;  2CCI B;  1UNL D;  1JKW A;  2WHB B;  3X24 B;  5ACB A;  4BCQ B;  2DXB B;  5CEI B;  1FVV B;  1AIS B;  4YOO A;  4EOO B;  1H4L D;  2X1N B;  2C6T B;  2AHJ B;  3PO3 S;  3B57 A;  3TNI B;  5EFQ B;  2DD4 B;  1GH6 B;  4CFU D;  4BBR M;  3MI9 B;  2WMA B;  2JGZ B;  2UUE B;  5EJC A;  4BCP B;  3BG3 A;  5IHY A;  2ZPF B;  5LMK B;  4EOP B;  1JSU B;  3DDQ B;  5ICP B;  1QLB A;  4EOS B;  3VKG A;  3BHV B;  3WVE B;  2C5V B;  4F7N B;  3VYH B;  2QFZ A;  3GTM S;  4OB2 B;  1GUX B;  3TNH B;  4ZGD B;  5HBH B;  3HZJ A;  1OIY B;  3DOG B;  2WPA B;  3BLR B;  2PK2 A;  2WEV B;  2CZ6 B;  3QYG B;  2F2C A;  4OB0 B;  4F7J B;  2QDJ A;  2R7G A;  2KMG A;  3X25 B;  4OB3 B;  3POM A;  4AI6 A;  1OKV B;  4F70 B;  4KRC B;  4M6V A;  2BS4 A;  4BCJ B;  4F6W B;  2WXV B;  2CZ0 B;  5HBJ B;  2PMI B;  2UZB B;  2IW8 B;  1UGQ B;  1OI9 B;  3NDQ A;  4EC9 B;  2DME A;  4EOI B;  5HQ0 B;  2WFY B;  2DD5 B;  3QZ5 B;  2C4G B;  1TD6 A;  3X20 B;  4JX6 A;  3RGF B;  2PJQ A;  3BHT B;  3QHR B;  3QYE A;  3VYG B;  4F7S B;  5CYI B;  4F7L B;  4EOJ B;  1N4M A;  2I40 B;  4AKI A;  1O9K A;  2CCH B;  1H26 B;  4ROE A;  2QQ8 A;  3DL1 A;  2WIH B;  1UNH D;  4JX4 A;  3DTO A;  3BLH B;  2ZPE B;  3VKH A;  4IMY B;  4EOL B;  1H25 B;  1OL2 B;  1VIN A;  3O0G D;  3G33 B;  2ZCF B;  1UGR B;  3MY5 B;  1V29 B;  3EID B;  1UGS B;  4YOZ A;  2C5O B;  4EOK B;  2DPP B;  2ZPI B;  5LQF B;  4BCN D;  4ZGJ B;  1OIU B;  2LW4 A;  2CZ1 B;  3M03 A;  3BLQ B;  2W96 A;  4BY1 X;  2PK9 B;  1F5Q B;  4BCN B;  2BKZ B;  3MIA B;  2W9F A;  4FM4 B;  1AHJ B;  5HBE B;  4HLQ A;  2CZ7 B;  4OR5 B;  1JST B;  4CRL B;  1H24 B;  3QZ9 B;  2C5X B;  3EOC B;  3HBL A;  1VYW B;  3X26 B;  3QYB A;  3QWL A;  2W9Z A;  2IN3 A;  1AD6 A;  4F6S B;  1UNG D;  4MIM A;  3BG9 A;  4BCG B;  1KXU A;  2WMB B;  2D0Q B;  4Z6Y A;  2UZL B;  3QXE B;  3TN8 B;  3EJ1 B;  3A8G B;  2I53 A;  4MFD A;  3TNW B;  4CXA B;  1FIN B;  1H1S B;  1H1R B;  1OKW B;  4OGR B;  3HB9 A;  4HNT A;  3H4C A;  3BG5 A;  1ZP2 A;  1GY3 B;  4YOS A;  2V22 B;  1TFB A;  3MY1 B;  4ELJ A;  2ZPG B;  2DXC B;  1OL1 B;  4CFN B;  1BU2 A;  4EOM B;  4BCI B;  3A8H B;  4UN0 A;  5IF1 B;  2C5N B;  4CFX B;  2KR6 A;  2ZPH B;  5DQV A;  4CFM B;  4AKH A;  5BNJ B;  2UZD B;  4EON B;  2BS3 A;  4BCF B;  4NC6 A;  4ROC A;  4BCM D;  1URC B;  4ROD A;  4HL4 A;  3X28 B;  4CFV B;  1XO2 A;  4CFW B;  4OB1 B;  2ZPB B;  1VOL A;  4BCM B;  2G77 A;  2IW6 B;  3TW6 A;  1GUX A;  1E9H B;  4II5 B;  3K7A M;  5IDN B;  3BHU B;  2QGS A;  4ZGE B;  2BPM B;  4FX3 B;  4BBS M;  1C9B A;  5FGK B;  4ELL A;  4BCH B;  4HNU A;  3A8M B;  4TTH A;  1ENW A;  4CFU B;  4G6L B;  4Y72 B;  1O9K B;  1UGP B;  4EOR B;  3F5X B;  3DDP B;  3QYH B; 
#chains in the Genus database with same CATH homology
 2UZE B;  5EFQ B;  3RGF B;  4F6U B;  1GH6 B;  3QHW B;  1P5E B;  3TNW B;  4CFU D;  4CXA B;  3BHT B;  3MI9 B;  3QHR B;  1FIN B;  5IDP B;  1H1S B;  1H1R B;  1OKW B;  2WMA B;  4OGR B;  2JGZ B;  1H1P B;  4I3Z B;  2UUE B;  3H4C A;  5I5Z B;  4F7S B;  2B9R A;  5CYI B;  4F7L B;  5HVY B;  1ZP2 A;  1N4M A;  2I40 B;  4EOJ B;  4BCP B;  1O9K A;  1H26 B;  1GY3 B;  1QMZ B;  2CCH B;  4YOS A;  4ROE A;  2V22 B;  5HNB B;  5L2W B;  5LMK B;  1TFB A;  2PHG A;  3MY1 B;  1H28 B;  2WIH B;  1UNH D;  4ELJ A;  1H1Q B;  4EOP B;  1JSU B;  3DDQ B;  1OL1 B;  4BCO B;  2G9X B;  5ICP B;  4EOS B;  4CFN B;  1BU2 A;  3BLH B;  4EOM B;  3BHV B;  4BCI B;  2IVX A;  4IMY B;  2C5V B;  1PKD B;  2W2H A;  4F7N B;  4EOL B;  1W98 B;  1H25 B;  1OL2 B;  1VIN A;  4UN0 A;  3O0G D;  5IF1 B;  2C5N B;  3G33 B;  4CFX B;  1GUX B;  3TNH B;  3MY5 B;  3EID B;  4YOZ A;  4CFM B;  1JOW A;  4EOK B;  5BNJ B;  2UZD B;  5LQF B;  4EON B;  5HBH B;  4BCF B;  4BCN D;  1OIU B;  4ROC A;  4BCM D;  1OIY B;  1G3N C;  3DOG B;  1URC B;  2WPA B;  4ROD A;  4KRD B;  4CFV B;  1D3U B;  3BLR B;  3M03 A;  1XO2 A;  2PK2 A;  3BLQ B;  2W96 A;  2WEV B;  4CFW B;  2PK9 B;  1F5Q B;  2F2C A;  4BCN B;  1H27 B;  4BCK B;  1VOL A;  4BCM B;  4EOQ B;  2BKZ B;  4F7J B;  1OGU B;  3MIA B;  2W9F A;  2IW6 B;  2QDJ A;  1GUX A;  2R7G A;  2WIP B;  1E9H B;  2EUF A;  4YC3 B;  2IW9 B;  4II5 B;  4EC8 B;  5HBE B;  3K7A M;  5IDN B;  2W99 A;  3POM A;  3BHU B;  4OR5 B;  1JST B;  4CRL B;  1H24 B;  1OKV B;  4BCQ D;  2C5X B;  3EOC B;  2BPM B;  4F70 B;  1VYW B;  4FX3 B;  4KRC B;  4NST B;  1C9B A;  4BCJ B;  2CJM B;  2W9Z A;  3LQ5 B;  5FGK B;  2CCI B;  4ELL A;  1UNL D;  4BCH B;  4F6W B;  1AD6 A;  1JKW A;  2WHB B;  2WXV B;  5HBJ B;  4F6S B;  5ACB A;  1UNG D;  2PMI B;  4BCQ B;  4BCG B;  1KXU A;  2WMB B;  2UZB B;  5CEI B;  4TTH A;  1FVV B;  2IW8 B;  1AIS B;  4YOO A;  1OI9 B;  4CFU B;  2UZL B;  4G6L B;  4Y72 B;  4EC9 B;  1O9K B;  4EOO B;  1H4L D;  4EOI B;  2X1N B;  3TN8 B;  4EOR B;  2C6T B;  3EJ1 B;  3F5X B;  5HQ0 B;  2WFY B;  3DDP B;  2C5O B;  2C4G B;  3TNI B;  2I53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...