5CEIB

Crystal structure of cdk8:cyclin c complex with compound 22
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
268
structure length
268
Chain Sequence
b'DDKAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title Development of a Potent, Specific CDK8 Kinase Inhibitor Which Phenocopies CDK8/19 Knockout Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transferase/inhibitor
total genus 104
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5ceiB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5ceiB01
1OI9B 1BU2A 2WMBB 3MI9B 4RODA 4EOIB 2QDJA 5LMKB 5HQ0B 4F7NB 4EOMB 3F5XB 1JKWA 1OGUB 2WFYB 2CJMB 1OIUB 4BCJB 1D3UB 1XO2A 2W2HA 4ELLA 1JSTB 3DDPB 4EOJB 3BHUB 5IDNB 3M03A 3BLHB 1H27B 3H4CA 5CYIB 4BCOB 1O9KA 1VOLA 1FVVB 2WMAB 2X1NB 2UZLB 3BLQB 5ACBA 3RGFB 5IDPB 3K7AM 2C5NB 1UNLD 1TFBA 1GY3B 4CFVB 5I5ZB 2I40B 2I53A 2UZEB 4F6WB 2IVXA 2C5OB 2EUFA 2UUEB 4ROCA 2WEVB 5EFQB 1N4MA 1VYWB 5CEIB 3TNWB 4I3ZB 4CRLB 2WIPB 2CCHB 3MIAB 2C4GB 2C6TB 4EONB 4F7JB 1AD6A 4EOPB 4F7LB 5HBEB 2WPAB 3TNHB 1O9KB 1OIYB 4KRDB 4OR5B 4ELJA 5IF1B 4BCHB 2C5XB 1UNGD 3EOCB 5HVYB 5HBHB 3BLRB 3O0GD 4CXAB 2W9ZA 1KXUA 3BHVB 4BCIB 1H1QB 5BNJB 4II5B 2IW9B 1H28B 4F70B 2B9RA 4BCPB 2R7GA 2WHBB 4OGRB 5L2WB 5LQFB 4TTHA 2UZBB 2WXVB 3BHTB 3MY5B 4CFXB 4BCNB 1OKWB 1VINA 4EOKB 1PKDB 1UNHD 1H24B 4EORB 1GH6B 4YOOA 1C9BA 4EC8B 3TNIB 1H1SB 4BCMB 4CFWB 2PMIB 4BCND 1FINB 3QHWB 1OL2B 2G9XB 4BCQB 1GUXA 2BKZB 2W96A 4NSTB 5FGKB 3TN8B 4UN0A 3QHRB 1E9HB 2F2CA 1URCB 1H25B 3EJ1B 1OL1B 3POMA 1H1RB 2WIHB 4G6LB 4YOSA 4BCFB 4BCMD 1QMZB 4KRCB 2C5VB 2CCIB 2W99A 4CFMB 1AISB 1JSUB 2IW8B 4BCQD 2PK9B 5HNBB 5ICPB 1W98B 1H1PB 4F6SB 4EOSB 2IW6B 1P5EB 4EC9B 4BCGB 4BCKB 4CFUB 3MY1B 1ZP2A 1H4LD 2W9FA 3DOGB 4IMYB 4YC3B 2JGZB 5HBJB 4ROEA 2BPMB 1G3NC 1H26B 4YOZA 4F6UB 2UZDB 3DDQB 4CFNB 4EOLB 4EOQB 3LQ5B 2PK2A 4EOOB 4CFUD 4F7SB 3EIDB 2V22B 3G33B 4FX3B 4Y72B 1GUXB 2PHGA 1F5QB 1JOWA 1OKVB
chains in the Genus database with same CATH superfamily
2BS4A 4OB3B 4EOIB 1JKWA 2ZPEB 2CJMB 1OIUB 1D3UB 3HBLA 4EOJB 3M03A 3BLHB 5CYIB 1O9KA 2WMAB 3K7AM 1TFBA 3WVEB 3DTOA 2UZEB 4F6WB 3NDQA 2C5OB 2UUEB 4MFEA 1ENWA 1VYWB 2CCHB 4EONB 4F7JB 3TNHB 1O9KB 1OIYB 4KRDB 3KHIA 5HBHB 3O0GD 3HB9A 2QGSA 4BCIB 5BNJB 4BBRM 1H28B 2WHBB 3X28B 2UZBB 4OB2B 3BHTB 4NC6A 1UNHD 2QFZA 4EORB 4BCMB 2DPPB 2PMIB 3QHWB 1OL2B 5FGKB 3BG5A 3QHRB 4HL4A 1OL1B 2WIHB 3QYGB 1QMZB 2C5VB 4CFMB 2PK9B 3VYHB 4EOSB 2AHJB 1P5EB 4CFUB 4IMYB 1H26B 4YOZA 4EOLB 4EOQB 2PK2A 1OI9B 1BU2A 3A8OB 3MI9B 4MFDA 3X26B 3HHTB 4HLQA 4F7NB 1OGUB 2KR6A 3QZ9B 4BCJB 2DXBB 2ZPHB 3DDPB 4ZGEB 2WJ9A 3A8HB 4LOCA 4FM4B 5IDPB 5ACBA 3RGFB 1E7PA 3A8GB 4M6VA 2C5NB 5I5ZB 4ROCA 2QF7A 2ZPGB 4OB1B 3A8LB 3BG3A 4CRLB 3QWLA 3TW6A 2DMEA 4EOPB 4BCHB 2C5XB 3EOCB 2IN3A 2W9ZA 4II5B 2IW9B 3MY5B 1GH6B 4YOOA 4EC8B 3TNIB 1H1SB 4BCND 3QYEA 1FINB 2G9XB 4ZGDB 1GUXA 4NSTB 3EJ1B 3POMA 1H25B 1H1RB 2W99A 1AISB 2IW8B 4BCQD 5ICPB 2D0QB 2KMGA 4EC9B 3X20B 3MY1B 2W9FA 4JX4A 2JGZB 3HZJA 2QQ8A 4MIMA 1G3NC 3DDQB 4CFNB 4AKIA 3LQ5B 4AI6A 2ZPBB 4HNTA 3X25B 3G33B 4F6SB 3DJBA 1GUXB 1JOWA 1OKVB 2WMBB 4HNVA 4RODA 4ZGJB 5HQ0B 3X24B 4EOMB 3F5XB 2CYZB 3WVDB 1XO2A 3HO8A 3BHUB 5IDNB 4AKHA 4Z6YA 1H27B 4BCOB 1FVVB 2X1NB 4BXXX 1UNLD 2ZPFB 2I40B 1V29B 2IVXA 1UGSB 2DD4B 4JX5A 4BY1X 1N4MA 1TD6A 2WIPB 2C6TB 5HBEB 4OR5B 3QYHB 5IF1B 1IREB 1UNGD 2ZPIB 5HVYB 1KXUA 3BHVB 5IHYA 5L2WB 2B9RA 4BCPB 2R7GA 5LQFB 5DQVA 2WXVB 4CFXB 4BCNB 1VINA 4EOKB 1PKDB 5EJCA 1H24B 4BCQB 5DQWA 3TW7A 1E9HB 1URCB 4G6LB 2ZCFB 3VKHA 1JSUB 3B57A 1W98B 1QLBA 1H1PB 4BCKB 2CZ6B 1H4LD 3DOGB 5HBJB 4ROEA 3DL1A 1FKMA 1UGPB 4EOOB 3EIDB 2V22B 4Y72B 2PHGA 1F5QB 2UZLB 2QDYB 2CZ0B 2QDJA 5LMKB 1UGRB 2WFYB 2W2HA 4ELLA 1JSTB 3H4CA 1VOLA 3QYBA 3BLQB 2BS3A 1GY3B 4CFVB 4QSHA 4BY7X 2I53A 3PO3S 2EUFA 3VYGB 3A8MB 2WEVB 5EFQB 3VKGA 5CEIB 3TNWB 4I3ZB 3MIAB 2C4GB 3GTMS 2LW4A 1AD6A 4F7LB 2WPAB 4ELJA 4JX6A 3BLRB 4CXAB 1H1QB 1AHJB 4F70B 2G77A 4OGRB 4TTHA 2DXCB 1OKWB 3QXEB 2ZZDB 1C9BA 4CFWB 2BKZB 2W96A 3BG9A 4UN0A 2CZ1B 2F2CA 4BCFB 2BS2A 4YOSA 4BCMD 4KRCB 2CCIB 2DD5B 4AKGA 5HNBB 1UGQB 3QZ5B 4BBSM 2IW6B 4BCGB 4OB0B 1ZP2A 4HNUA 4YC3B 2BPMB 4F6UB 2CZ7B 2UZDB 2PJQA 4CFUD 4F7SB 4FX3B 3TN8B
chains in the Genus database with same CATH topology
1OI9B 1BU2A 2WMBB 3MI9B 4RODA 4EOIB 2QDJA 5LMKB 5HQ0B 4F7NB 4EOMB 3F5XB 1JKWA 1OGUB 2WFYB 2CJMB 1OIUB 4BCJB 1D3UB 1XO2A 2W2HA 4ELLA 1JSTB 3DDPB 4EOJB 3BHUB 5IDNB 3M03A 3BLHB 1H27B 3H4CA 5CYIB 4BCOB 1O9KA 1VOLA 1FVVB 2WMAB 2X1NB 2UZLB 3BLQB 5ACBA 3RGFB 5IDPB 3K7AM 2C5NB 1UNLD 1TFBA 1GY3B 4CFVB 5I5ZB 2I40B 2I53A 2UZEB 4F6WB 2IVXA 2C5OB 2EUFA 2UUEB 4ROCA 2WEVB 5EFQB 1N4MA 1VYWB 5CEIB 3TNWB 4I3ZB 4CRLB 2WIPB 2CCHB 3MIAB 2C4GB 2C6TB 4EONB 4F7JB 1AD6A 4EOPB 4F7LB 5HBEB 2WPAB 3TNHB 1O9KB 1OIYB 4KRDB 4OR5B 4ELJA 5IF1B 4BCHB 2C5XB 1UNGD 3EOCB 5HVYB 5HBHB 3BLRB 3O0GD 4CXAB 2W9ZA 1KXUA 3BHVB 4BCIB 1H1QB 5BNJB 4II5B 2IW9B 1H28B 4F70B 2B9RA 4BCPB 2R7GA 2WHBB 4OGRB 5L2WB 5LQFB 4TTHA 2UZBB 2WXVB 3BHTB 3MY5B 4CFXB 4BCNB 1OKWB 1VINA 4EOKB 1PKDB 1UNHD 1H24B 4EORB 1GH6B 4YOOA 1C9BA 4EC8B 3TNIB 1H1SB 4BCMB 4CFWB 2PMIB 4BCND 1FINB 3QHWB 1OL2B 2G9XB 4BCQB 1GUXA 2BKZB 2W96A 4NSTB 5FGKB 3TN8B 4UN0A 3QHRB 1E9HB 2F2CA 1URCB 1H25B 3EJ1B 1OL1B 3POMA 1H1RB 2WIHB 4G6LB 4YOSA 4BCFB 4BCMD 1QMZB 4KRCB 2C5VB 2CCIB 2W99A 4CFMB 1AISB 1JSUB 2IW8B 4BCQD 2PK9B 5HNBB 5ICPB 1W98B 1H1PB 4F6SB 4EOSB 2IW6B 1P5EB 4EC9B 4BCGB 4BCKB 4CFUB 3MY1B 1ZP2A 1H4LD 2W9FA 3DOGB 4IMYB 4YC3B 2JGZB 5HBJB 4ROEA 2BPMB 1G3NC 1H26B 4YOZA 4F6UB 2UZDB 3DDQB 4CFNB 4EOLB 4EOQB 3LQ5B 2PK2A 4EOOB 4CFUD 4F7SB 3EIDB 2V22B 3G33B 4FX3B 4Y72B 1GUXB 2PHGA 1F5QB 1JOWA 1OKVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OI9 B;  1BU2 A;  2WMB B;  3MI9 B;  4ROD A;  4EOI B;  2QDJ A;  5LMK B;  5HQ0 B;  4F7N B;  4EOM B;  3F5X B;  1JKW A;  1OGU B;  2WFY B;  2CJM B;  1OIU B;  4BCJ B;  1D3U B;  1XO2 A;  2W2H A;  4ELL A;  1JST B;  3DDP B;  4EOJ B;  3BHU B;  5IDN B;  3M03 A;  3BLH B;  1H27 B;  3H4C A;  5CYI B;  4BCO B;  1O9K A;  1VOL A;  1FVV B;  2WMA B;  2X1N B;  2UZL B;  3BLQ B;  5ACB A;  3RGF B;  5IDP B;  3K7A M;  2C5N B;  1UNL D;  1TFB A;  1GY3 B;  4CFV B;  5I5Z B;  2I40 B;  2I53 A;  2UZE B;  4F6W B;  2IVX A;  2C5O B;  2EUF A;  2UUE B;  4ROC A;  2WEV B;  5EFQ B;  1N4M A;  1VYW B;  5CEI B;  3TNW B;  4I3Z B;  4CRL B;  2WIP B;  2CCH B;  3MIA B;  2C4G B;  2C6T B;  4EON B;  4F7J B;  1AD6 A;  4EOP B;  4F7L B;  5HBE B;  2WPA B;  3TNH B;  1O9K B;  1OIY B;  4KRD B;  4OR5 B;  4ELJ A;  5IF1 B;  4BCH B;  2C5X B;  1UNG D;  3EOC B;  5HVY B;  5HBH B;  3BLR B;  3O0G D;  4CXA B;  2W9Z A;  1KXU A;  3BHV B;  4BCI B;  1H1Q B;  5BNJ B;  4II5 B;  2IW9 B;  1H28 B;  4F70 B;  2B9R A;  4BCP B;  2R7G A;  2WHB B;  4OGR B;  5L2W B;  5LQF B;  4TTH A;  2UZB B;  2WXV B;  3BHT B;  3MY5 B;  4CFX B;  4BCN B;  1OKW B;  1VIN A;  4EOK B;  1PKD B;  1UNH D;  1H24 B;  4EOR B;  1GH6 B;  4YOO A;  1C9B A;  4EC8 B;  3TNI B;  1H1S B;  4BCM B;  4CFW B;  2PMI B;  4BCN D;  1FIN B;  3QHW B;  1OL2 B;  2G9X B;  4BCQ B;  1GUX A;  2BKZ B;  2W96 A;  4NST B;  5FGK B;  3TN8 B;  4UN0 A;  3QHR B;  1E9H B;  2F2C A;  1URC B;  1H25 B;  3EJ1 B;  1OL1 B;  3POM A;  1H1R B;  2WIH B;  4G6L B;  4YOS A;  4BCF B;  4BCM D;  1QMZ B;  4KRC B;  2C5V B;  2CCI B;  2W99 A;  4CFM B;  1AIS B;  1JSU B;  2IW8 B;  4BCQ D;  2PK9 B;  5HNB B;  5ICP B;  1W98 B;  1H1P B;  4F6S B;  4EOS B;  2IW6 B;  1P5E B;  4EC9 B;  4BCG B;  4BCK B;  4CFU B;  3MY1 B;  1ZP2 A;  1H4L D;  2W9F A;  3DOG B;  4IMY B;  4YC3 B;  2JGZ B;  5HBJ B;  4ROE A;  2BPM B;  1G3N C;  1H26 B;  4YOZ A;  4F6U B;  2UZD B;  3DDQ B;  4CFN B;  4EOL B;  4EOQ B;  3LQ5 B;  2PK2 A;  4EOO B;  4CFU D;  4F7S B;  3EID B;  2V22 B;  3G33 B;  4FX3 B;  4Y72 B;  1GUX B;  2PHG A;  1F5Q B;  1JOW A;  1OKV B; 
#chains in the Genus database with same CATH topology
 2BS4 A;  4OB3 B;  4EOI B;  1JKW A;  2ZPE B;  2CJM B;  1OIU B;  1D3U B;  3HBL A;  4EOJ B;  3M03 A;  3BLH B;  5CYI B;  1O9K A;  2WMA B;  3K7A M;  1TFB A;  3WVE B;  3DTO A;  2UZE B;  4F6W B;  3NDQ A;  2C5O B;  2UUE B;  4MFE A;  1ENW A;  1VYW B;  2CCH B;  4EON B;  4F7J B;  3TNH B;  1O9K B;  1OIY B;  4KRD B;  3KHI A;  5HBH B;  3O0G D;  3HB9 A;  2QGS A;  4BCI B;  5BNJ B;  4BBR M;  1H28 B;  2WHB B;  3X28 B;  2UZB B;  4OB2 B;  3BHT B;  4NC6 A;  1UNH D;  2QFZ A;  4EOR B;  4BCM B;  2DPP B;  2PMI B;  3QHW B;  1OL2 B;  5FGK B;  3BG5 A;  3QHR B;  4HL4 A;  1OL1 B;  2WIH B;  3QYG B;  1QMZ B;  2C5V B;  4CFM B;  2PK9 B;  3VYH B;  4EOS B;  2AHJ B;  1P5E B;  4CFU B;  4IMY B;  1H26 B;  4YOZ A;  4EOL B;  4EOQ B;  2PK2 A;  1OI9 B;  1BU2 A;  3A8O B;  3MI9 B;  4MFD A;  3X26 B;  3HHT B;  4HLQ A;  4F7N B;  1OGU B;  2KR6 A;  3QZ9 B;  4BCJ B;  2DXB B;  2ZPH B;  3DDP B;  4ZGE B;  2WJ9 A;  3A8H B;  4LOC A;  4FM4 B;  5IDP B;  5ACB A;  3RGF B;  1E7P A;  3A8G B;  4M6V A;  2C5N B;  5I5Z B;  4ROC A;  2QF7 A;  2ZPG B;  4OB1 B;  3A8L B;  3BG3 A;  4CRL B;  3QWL A;  3TW6 A;  2DME A;  4EOP B;  4BCH B;  2C5X B;  3EOC B;  2IN3 A;  2W9Z A;  4II5 B;  2IW9 B;  3MY5 B;  1GH6 B;  4YOO A;  4EC8 B;  3TNI B;  1H1S B;  4BCN D;  3QYE A;  1FIN B;  2G9X B;  4ZGD B;  1GUX A;  4NST B;  3EJ1 B;  3POM A;  1H25 B;  1H1R B;  2W99 A;  1AIS B;  2IW8 B;  4BCQ D;  5ICP B;  2D0Q B;  2KMG A;  4EC9 B;  3X20 B;  3MY1 B;  2W9F A;  4JX4 A;  2JGZ B;  3HZJ A;  2QQ8 A;  4MIM A;  1G3N C;  3DDQ B;  4CFN B;  4AKI A;  3LQ5 B;  4AI6 A;  2ZPB B;  4HNT A;  3X25 B;  3G33 B;  4F6S B;  3DJB A;  1GUX B;  1JOW A;  1OKV B;  2WMB B;  4HNV A;  4ROD A;  4ZGJ B;  5HQ0 B;  3X24 B;  4EOM B;  3F5X B;  2CYZ B;  3WVD B;  1XO2 A;  3HO8 A;  3BHU B;  5IDN B;  4AKH A;  4Z6Y A;  1H27 B;  4BCO B;  1FVV B;  2X1N B;  4BXX X;  1UNL D;  2ZPF B;  2I40 B;  1V29 B;  2IVX A;  1UGS B;  2DD4 B;  4JX5 A;  4BY1 X;  1N4M A;  1TD6 A;  2WIP B;  2C6T B;  5HBE B;  4OR5 B;  3QYH B;  5IF1 B;  1IRE B;  1UNG D;  2ZPI B;  5HVY B;  1KXU A;  3BHV B;  5IHY A;  5L2W B;  2B9R A;  4BCP B;  2R7G A;  5LQF B;  5DQV A;  2WXV B;  4CFX B;  4BCN B;  1VIN A;  4EOK B;  1PKD B;  5EJC A;  1H24 B;  4BCQ B;  5DQW A;  3TW7 A;  1E9H B;  1URC B;  4G6L B;  2ZCF B;  3VKH A;  1JSU B;  3B57 A;  1W98 B;  1QLB A;  1H1P B;  4BCK B;  2CZ6 B;  1H4L D;  3DOG B;  5HBJ B;  4ROE A;  3DL1 A;  1FKM A;  1UGP B;  4EOO B;  3EID B;  2V22 B;  4Y72 B;  2PHG A;  1F5Q B;  2UZL B;  2QDY B;  2CZ0 B;  2QDJ A;  5LMK B;  1UGR B;  2WFY B;  2W2H A;  4ELL A;  1JST B;  3H4C A;  1VOL A;  3QYB A;  3BLQ B;  2BS3 A;  1GY3 B;  4CFV B;  4QSH A;  4BY7 X;  2I53 A;  3PO3 S;  2EUF A;  3VYG B;  3A8M B;  2WEV B;  5EFQ B;  3VKG A;  5CEI B;  3TNW B;  4I3Z B;  3MIA B;  2C4G B;  3GTM S;  2LW4 A;  1AD6 A;  4F7L B;  2WPA B;  4ELJ A;  4JX6 A;  3BLR B;  4CXA B;  1H1Q B;  1AHJ B;  4F70 B;  2G77 A;  4OGR B;  4TTH A;  2DXC B;  1OKW B;  3QXE B;  2ZZD B;  1C9B A;  4CFW B;  2BKZ B;  2W96 A;  3BG9 A;  4UN0 A;  2CZ1 B;  2F2C A;  4BCF B;  2BS2 A;  4YOS A;  4BCM D;  4KRC B;  2CCI B;  2DD5 B;  4AKG A;  5HNB B;  1UGQ B;  3QZ5 B;  4BBS M;  2IW6 B;  4BCG B;  4OB0 B;  1ZP2 A;  4HNU A;  4YC3 B;  2BPM B;  4F6U B;  2CZ7 B;  2UZD B;  2PJQ A;  4CFU D;  4F7S B;  4FX3 B;  3TN8 B; 
#chains in the Genus database with same CATH homology
 1OI9 B;  1BU2 A;  2WMB B;  3MI9 B;  4ROD A;  4EOI B;  2QDJ A;  5LMK B;  5HQ0 B;  4F7N B;  4EOM B;  3F5X B;  1JKW A;  1OGU B;  2WFY B;  2CJM B;  1OIU B;  4BCJ B;  1D3U B;  1XO2 A;  2W2H A;  4ELL A;  1JST B;  3DDP B;  4EOJ B;  3BHU B;  5IDN B;  3M03 A;  3BLH B;  1H27 B;  3H4C A;  5CYI B;  4BCO B;  1O9K A;  1VOL A;  1FVV B;  2WMA B;  2X1N B;  2UZL B;  3BLQ B;  5ACB A;  3RGF B;  5IDP B;  3K7A M;  2C5N B;  1UNL D;  1TFB A;  1GY3 B;  4CFV B;  5I5Z B;  2I40 B;  2I53 A;  2UZE B;  4F6W B;  2IVX A;  2C5O B;  2EUF A;  2UUE B;  4ROC A;  2WEV B;  5EFQ B;  1N4M A;  1VYW B;  5CEI B;  3TNW B;  4I3Z B;  4CRL B;  2WIP B;  2CCH B;  3MIA B;  2C4G B;  2C6T B;  4EON B;  4F7J B;  1AD6 A;  4EOP B;  4F7L B;  5HBE B;  2WPA B;  3TNH B;  1O9K B;  1OIY B;  4KRD B;  4OR5 B;  4ELJ A;  5IF1 B;  4BCH B;  2C5X B;  1UNG D;  3EOC B;  5HVY B;  5HBH B;  3BLR B;  3O0G D;  4CXA B;  2W9Z A;  1KXU A;  3BHV B;  4BCI B;  1H1Q B;  5BNJ B;  4II5 B;  2IW9 B;  1H28 B;  4F70 B;  2B9R A;  4BCP B;  2R7G A;  2WHB B;  4OGR B;  5L2W B;  5LQF B;  4TTH A;  2UZB B;  2WXV B;  3BHT B;  3MY5 B;  4CFX B;  4BCN B;  1OKW B;  1VIN A;  4EOK B;  1PKD B;  1UNH D;  1H24 B;  4EOR B;  1GH6 B;  4YOO A;  1C9B A;  4EC8 B;  3TNI B;  1H1S B;  4BCM B;  4CFW B;  2PMI B;  4BCN D;  1FIN B;  3QHW B;  1OL2 B;  2G9X B;  4BCQ B;  1GUX A;  2BKZ B;  2W96 A;  4NST B;  5FGK B;  3TN8 B;  4UN0 A;  3QHR B;  1E9H B;  2F2C A;  1URC B;  1H25 B;  3EJ1 B;  1OL1 B;  3POM A;  1H1R B;  2WIH B;  4G6L B;  4YOS A;  4BCF B;  4BCM D;  1QMZ B;  4KRC B;  2C5V B;  2CCI B;  2W99 A;  4CFM B;  1AIS B;  1JSU B;  2IW8 B;  4BCQ D;  2PK9 B;  5HNB B;  5ICP B;  1W98 B;  1H1P B;  4F6S B;  4EOS B;  2IW6 B;  1P5E B;  4EC9 B;  4BCG B;  4BCK B;  4CFU B;  3MY1 B;  1ZP2 A;  1H4L D;  2W9F A;  3DOG B;  4IMY B;  4YC3 B;  2JGZ B;  5HBJ B;  4ROE A;  2BPM B;  1G3N C;  1H26 B;  4YOZ A;  4F6U B;  2UZD B;  3DDQ B;  4CFN B;  4EOL B;  4EOQ B;  3LQ5 B;  2PK2 A;  4EOO B;  4CFU D;  4F7S B;  3EID B;  2V22 B;  3G33 B;  4FX3 B;  4Y72 B;  1GUX B;  2PHG A;  1F5Q B;  1JOW A;  1OKV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...