5CEXB

Crystal structure of fab 32h+109l, a putative precursor of the pgt121 family of potent hiv-1 antibodies
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
233
structure length
233
Chain Sequence
QVQLQESGPGLVKPSETLSLTCSVSGASISDHYWSWIRQSPGKGLEWIGYVYDSGDTNYNPSLKSRVNLSLDTSKNQVSLSLTAVTAADSAIYYCARTQHGRRIYGIVAFREWFTYFYMDVWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 9H+3L Fab light chain
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 233
sequence length 233
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cexB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cexB01
4PRDA 4ZAKD 2AQ1A 1TNNA 1U58A 2Q6WB 4BYHA 1GIGH 4RFEA 4L8BA 4UB0H 2J1KA 1EEYA 1F3JB 3OJDA 1I7UA 4AEFA 4ZUTB 4JKKA 4MAUH 2JJUA 1RJYA 2DIJA 2DQEL 4JRYD 3GIVB 4GRLD 1JGVL 1A22B 2V17L 5HY9A 4M48L 1IAKA 1M1SA 3V0WL 1UKTA 1VENA 5J13B 3ZE1F 2OR9H 3AB0B 5HGDB 5D93C 5F9JA 2YSSB 2VQ1B 2W65B 3JWNC 4JFED 1C08A 3L3KA 2PW2A 3ARRA 4ONGH 3R8BB 4BFIB 1HH6B 4ACPA 1K3ZA 4MJ2A 5A2LH 1MVFA 5I9QB 4YPGB 1IGJA 3O4LA 1UM6L 2P8PB 1E28A 3RNKA 2BK8A 3HTLX 1CLYL 1L7TL 5IMMA 4XBEH 1NLDH 2FGWH 3U0TA 5MHSE 3JV6A 2DYPD 3KPSE 4OLZL 5EU5B 4BFEA 4DKEH 4P5KB 3PDDA 5HGHA 3G5YA 2AJUH 5BVPH 3BESR 3DX8B 1P7KA 4P59L 2RB8A 1JGVH 1AR1C 1SYVA 3FRUB 2JF1A 4UU9A 1T2QL 1RI8A 3S96B 3AS2A 4F7TA 5EPMB 1XCTB 3SDYL 1AO7D 4NWTL 5F97E 4PRAB 5JW5A 1A7RH 4U6VL 3OAYH 2CDGA 2ILLA 5C2UB 1A1OA 5ID0A 3IETB 2Z93A 2A6DB 2LVEA 2PO6B 4WCYH 2WAHA 5C08B 3FQRB 2DQUL 3MQIA 5K9QG 4NJ9L 3WKMH 3PP3K 4YQXL 3EDDA 5KAQG 4MXQD 4PJ7F 1I7ZA 2JELL 2XKUA 4P57B 1A6TA 5CSZA 1YQVL 2ATPB 5F8RC 4DZBA 1L7TH 3MCKA 1PZUB 1T0PB 4MNQE 4XP6H 2APWA 4XCYA 4GT7A 4TRPL 2R1XA 1JPSH 1S7WB 4M62L 2Q87A 4KI5D 5DK2A 3L3GA 1MCWW 1GGUA 3QA3B 3QUZC 3JV4B 5IQ7H 1AJ7L 2OJEB 4OZGA 4U1HB 1MFEH 3M17A 4JHAH 5JIKA 4EI6A 1EO8L 3EYSL 1A6UL 3ZZ1A 2AEWA 4QOKE 5DSCB 6CGTA 5C0EA 4U6VH 4X6BA 2AQ3A 4N9GB 1QBLL 2RFXB 3BXNA 4YHOL 2Z91B 1F02I 1P4BH 1D6EA 1MJUH 4K23L 3RZCB 3S3SA 3CH8A 5KW9L 3PQYA 3CFEB 2BOBB 3K8LA 1A5FL 2Y9RT 3JWDL 5DQJA 1ZT4B 4YQXH 2IPKA 4UT7L 1HHJA 5I74B 4MMZC 1WT5A 3LV3B 3KR3H 4OGAC 1KCSH 4WW1A 3CNKA 3REWB 4F7EB 1FDLL 2KQMA 1TQBB 3QIWD 2Q86A 1M7IA 4NQCE 5L2JB 3GBML 1T0NA 3G6AB 3DBXB 1OAYL 1DQJA 4JFHE 2Z0BA 5ACMA 5I66B 1JPST 3GMRB 3NVQA 4I48B 2OTPA 4TUJB 4Y19D 4G6ML 4NN5C 1NUGA 4GUPB 1QBLH 3PGDB 3GSNH 5CJXC 5GGTH 5D6DC 2DIBA 4K23H 3RWDB 3WIIL 3PP3H 1CVSC 1IAOB 3GBNL 1DEEB 5KW9H 3STLB 3UTOA 4XP1L 5DJZB 4L1HA 1A5FH 1QSFA 2AI0H 5EZOL 4WFFE 4BK5A 4QHMB 1U8IB 2AJ3B 5IIEB 3QRGH 4Y4HA 4Y16B 1MLBB 1J1XH 3VFRB 5DJDB 3QJHB 1MELA 3MRFA 4PJBB 5J6GA 4PV8A 5A16B 1FDLH 2FECL 4OIBA 5AWNL 1FJ1B 5DZOA 4HX1B 5C07A 2NY5C 4ODHL 1OAYH 4OCLC 3FQNA 2FX7L 4U1SB 4WNQB 1X7QA 2FD6H 2J4WL 4ODVL 3Q6GH 4R2GC 5HGAB 1XF5B 5J1SC 3LN4B 4XWGL 5ESQB 2DMBA 2XWTB 2R39A 5TH2A 1LK2A 2O5XL 3TJHD 2A1WL 2BVUA 4H5SB 4KXZH 5DF0A 4V2CB 2DLFL 4PJ9D 3MRMA 3GMOA 3FAXA 1D9KA 8FABB 3WIIH 1HXYA 3T8XA 2QKIA 3GBNH 1J05A 4BSWB 4MDIB 3RX8A 2HMIC 3TO4D 3FTGA 4FZEL 2DBLL 4IDLA 1G84A 5JHLL 1XCQA 1SJHB 4NC0B 4L4TB 1C12B 4WDIB 3DUSB 4ZFOA 4P2YA 4XPGL 3QUYB 4NQDE 2PKDA 5DYOA 4LSDA 5CAYB 5HHMD 5GRXG 4CVXB 1A1NA 4OCNC 3WHE0 4APQD 4LSQL 5I1GL 3ES6B 2MJWA 3DTXB 3QQNA 3MX0A 1BREA 4OSUL 4Y2DB 1IKFL 3KJ6H 2ZCLH 1L4IA 4BH7A 1MFBL 2J4WH 3CXHK 4QRRE 2Z4QB 3SKJH 4PY8J 5E7BA 4XWGH 1KULA 3V6ZB 1CLOL 1S7SA 1MCQA 2O5XH 2IC2A 2DLFH 5BRZA 5JNYA 1NC4D 3BPNB 4OKVA 3T4AA 5CSBA 4PJFE 1A6VH 2VE6A 4U49A 1A1MA 1IFHL 4WUUD 1I1YB 4EJ1C 5HHQA 4JJHA 4UQ3B 3RWJB 1MCNA 3QFJB 5IBUG 5DS8A 3MLXL 2DQIH 2RQ8A 3V6FB 4WTZG 5F9OH 4KK5C 3CDGB 3WBDA 4GQ9L 4NRXB 4GG6A 2SEBB 1FZJB 2GYSA 3IS1X 1XR8A 3SCMA 3CIQA 5E00B 1JN6B 1E4XH 1IE5A 2YUZA 4OSUH 4NNYB 4OQ1A 3U7YL 5ACZB 2DM7A 4QRUB 1KTLB 1MFBH 4F9LA 1FNSL 2X7LA 3VW3L 5EC2A 3SDDA 1F3DH 3QO0B 1JF1B 5FO9A 3WXWL 4G6KH 1KIRB 4PJGA 2VLJB 4WFHE 2CO7B 1RIHL 1KGCE 3BQUA 5K59E 3MJ8A 1TJIH 2CR3A 1IGIL 2E3VA 1G0YR 3GGWB 3S37L 2ATKB 5HTSA 3R06B 4NWUH 4QF1A 3CUPA 3QQ3A 4HW6A 3OX8A 1CDGA 3UAJD 3P77B 2O61B 2QBWA 3C60A 1PJ9A 2C7UB 4F9PA 4JGJA 3RFZC 5F7WC 3C2SA 5DRZB 5E9DE 3GSWB 1BAFL 3LQAL 4D9QE 1QKZL 3FO2A 3I75A 3BMWA 5F70A 3VWKC 5IHLB 1FNSH 4RRPA 2OJZH 4WWKD 3T0VA 1WWCA 1T2JA 3GB7B 5EULV 4KJWC 1I9JL 5J56B 4XVTL 5ISZA 1NANI 5E8DL 3WXWH 2YC1A 4M1DH 1ZOXA 4NNXB 4OKDA 3QFJD 5C0JB 5I1DB 3VD4A 3N1MC 3G08B 2Y07L 3HFMH 4JLRB 4WU7B 4DVRL 4UT6H 2R2CA 5E2VL 43CAA 1KJMA 3AU1A 3AREA 2C1PA 2A73B 3MRBB 5TDNA 1R5IA 3QG7H 1IGCH 2C4XA 5KVEL 5H37G 4UNTA 3REVB 4HUXB 3RVXD 1EEQA 4WW2A 3WJLA 3LQAH 1SY6L 2PR4L 3MA9L 1WC7B 4QTHA 1ORQA 5D6CB 3SGDH 1LNUA 3BKCL 1VPOH 3HI5L 2VLJD 2P5WE 1S7QB 1LEKB 2ZJSL 4XVTH 3TZVD 1G7IA 3EJJX 3L9RA 4KUZL 3QCTH 5H94A 1E4JA 4KQ4H 3MRJA 5IFJA 3SGKC 3U82B 4LDLB 3PXHA 1FAIH 2IF7A 3UTSD 1A6PA 1R3IL 3IDJA 1T1WA 1W8NA 1C5CL 4RAVB 4QTIH 2YPKB 4H26A 1FZKA 2Z31C 5E8NB 1YEEL 2CLVB 5BW7A 4FXLA 5KAQF 5B38B 1UH2A 2AXGB 4Q9BA 4CU6A 4PREA 3E3QE 2PR4H 3T2NH 2G5BB 5E03A 5GGVY 5DFWH 4NZRL 1T6VN 4NQUA 2ZJSH 3RU8L 5B39A 5T1MB 5DI8A 3QXAA 5IROC 3T2QA 1ZWIA 1U93B 1UKSA 3AMLA 4AG4H 3VG0H 2R1WB 4FFWD 2GT9B 3VE0B 5AYQA 3QXWA 5E6IB 1X5XA 3PWVA 1L0QA 3CFKA 2NY4C 1MHHA 4EUPH 3B9KD 4NNPL 4YHKL 1XF4B 2EZ0D 1WK0A 4O58L 4CVWA 3UROR 2GUOB 1CGUA 2BNUB 3PF2A 4Y5VC 3X11A 2FLBT 2ENYA 2P49B 4O5LL 4KKNA 1KFAH 3MJ9A 1FL3B 1QVOB 5I8KH 1YEJL 1JYNA 1I8LC 2CQVA 4NZRH 1T03H 1VFMA 5C0RH 4X7CC 4JN2B 3KPSA 3VWJB 1DBML 2WBWB 4Q6YA 4ZXBB 4AYFA 5GZNC 4PJ5E 2V6HA 4HLJA 4C56B 3BIAX 3T0EE 5IBTL 2WBJD 2OL3A 4PD4J 2CXKA 2V5MA 5IJKA 4DGIL 2ZUVA 3C9NA 1MOEA 2PTUA 2GITA 3TWCH 5JW4R 1CU4H 4UQ2B 3VXRB 3W9EA 3P4MB 1KLFA 4HJGB 2X4SA 3DVGA 3RVUD 3TN0D 4O4YL 2FL5A 3IFPB 2E8ZA 1NFDF 3QNZB 4OQTL 3UJTH 2YA0A 2KUTA 4HIJA 4U1KB 3FN0L 3WO4C 4JHWH 4LL9A 4EVNA 5IESL 4JFZH 3BSZL 1ED3B 1MLCB 5IB1A 1BGXL 5JOPE 3FT2B 1IKNA 3DXAB 4W81A 3O8XD 4JDVB 2W9DL 4RMTA 1YUHA 5E6ID 1FN4A 1CDJA 1EUTA 5FIEA 4A2LA 4QWWC 1UWEH 4Z5RB 4QOKA 1Q9LB 5LBSL 3LS5H 3TF7C 4WHDA 4DGIH 4OUOA 4KK6C 4KDTC 2B7DT 2UWEE 1CGVA 1YJDL 1P84J 1GL4B 2HVJB 4P46A 1ZHKB 3D3VD 1XR9B 4HFWA 3MRDA 4O4YH 1MVUB 4R97B 4DN4H 1MFCL 1WZLA 3FN0H 4GBXB 2D7TH 1OP3K 5IESH 3QXUA 2X05A 4C56D 4Y1AE 2EDNA 1ZHNB 2YRZA 3DX9B 2W9DH 3QIUB 3ARWA 2VN4A 2E9IA 2MOVA 3ABZA 3IRZA 3T08A 2ZG3A 5LBSH 3ARGA 5KVGL 4OIIL 5KG9B 1GAFH 4P2RB 3RWGB 1IVLA 3DECA 1MHEA 3MRRA 5C6PB 4GW5B 4K2UL 4RX4A 1NUFA 4FTVB 1X5AA 1WZKA 4U6XB 4BSVB 1C5DB 1DVFB 4GKSA 3UTPD 4TTDD 3TV3H 5IQ9A 4F37F 2VWEC 1YN7A 3AGVA 1CXEA 4R0LB 5HI3D 5SWZB 1MFCH 3FOLA 2A77L 3DXAD 3TH4T 4D9LL 1KC5L 3N1PC 2DLHA 5C0IA 2L0DA 2QQLL 4CRPA 3WN5B 2VDLH 2NY7L 4AQ1B 1KEGH 3STZB 1CXLA 5CEYA 5GS2H 1KPRB 5BVJB 2XNAB 3VCLA 4XCFH 4YHPA 4LSTL 2IAMA 3NCFB 3SDXF 3ARUA 1K6QH 4E42A 3VRJB 3AROA 5HI5D 3DO7A 5KVGH 1U3HA 2G75A 2P44B 4DAGH 5F9DC 2OTUA 1IZKA 4R90L 1CE6B 2EYTB 1J5OH 5K9KB 5KANI 1ZEAL 4U1GB 1SEQL 3EOAA 5L7XL 1JGEA 3C6SA 5F6IC 1OP3H 3OXRB 4M4RA 4NQDA 2ZKHL 4JFYA 3HE6D 2FEEL 1FVEA 5HJ3A 4V1DD 4JO1H 1ND0B 5KN5B 1T21B 1DN0B 3ULUL 4PRPB 2QQLH 4OLXH 2FIKB 4HIEA 1XF2A 1XGQA 2NY7H 4K94L 1BM3L 1KUMA 1T04A 5F89A 1LEIB 5J3HD 1CIUA 2JIXB 3LN9A 3UEZA 4QRRA 5A2IH 4OLWL 5FYJL 4PB0L 1JK8B 4TSBL 4LSTH 5J7CC 4EUPB 2XTJB 4RGNC 1R24B 3BT2L 3KYKL 5E99L 4LVNC 1VFOA 2P8MA 4FTVD 4PJCB 3OV6A 4HK3N 1FPTL 4PJFA 4R90H 2A6KB 1CR9L 1MPAH 1P84K 4XVJL 1RZIA 3K81A 4G9FE 4AT6B 4LHUG 1FNFA 4YAQB 2ZOKA 2NYYD 1FL6A 1HIML 2P48B 3LHPL 2QQKH 1G7LA 1WGOA 1IQDB 4M61A 4AH2A 2O93L 4X4ZA 3DYOA 4HWBA 3PGFH 1MREL 4MJ6A 3ULUH 2HVKA 4Z7UE 3G5ZA 5JXAL 4Y4FA 2IEPA 5E7FA 2HFEA 1F58L 3H3BC 4ZUSB 3HC4L 4UOJA 3ILQC 3LZFH 1BM3H 4H8WL 1KPVA 3BRGC 5DUPH 1JZ8A 1CFBA 5D5MA 1MRCL 2Y7QA 3SKMA 1TZHB 3KVQA 5HYSB 4GMTH 3BT2H 1HDMB 1V3LA 1CDUA 1CL7I 4G6AD 4GMSL 3MLVL 3WYRA 3N06B 3VD7A 2FO4B 1LWRA 5C0GA 3N1FC 4LIQH 4XPHL 3LAFA 5GRJH 2Y25A 4C55A 1CD1B 1CR9H 2VQUA 1T1XA 2XZCH 3BEWB 3H3PH 5HHOE 3F7VA 5CBAB 2E9WA 4PJ8B 3ARFC 4RFNC 2MWCA 3W82A 2DL9A 5CWSA 4N0CC 1HIMH 1A7QL 5AYUL 3LPFA 1Q0YL 4M02A 3OGCB 2DTML 4HUWA 3VMPA 1XAUA 4NKMB 3EW3B 5JXAH 5E9DA 3V0VA 5T33H 5DEZA 1F58H 2AAVA 5I17A 3NIGF 2CIIB 1ZT7A 3CSBA 4ODUA 4RWYL 3Q6FB 4YUEH 1WITA 3SDCC 3VA2C 1VACB 4QRPE 2BCKB 4K7FA 4ZUWA 3U1SL 1FORL 1QEWB 3STBA 2DQFA 1MIEL 3NPSB 5I16B 4JZJB 4XI5C 4XPHH 1YYLL 1HINH 1QLRB 1BD2D 4OM0H 3QXDA 3CDCA 4GW1A 4O2EA 3WNOA 1AGBB 1UXWA 1OP5K 4ZTOL 5ENWA 2ZOLA 4LVEA 1LO5A 3X13A 4LCYA 2VIRB 3HAEH 1X44A 1A7QH 1T1ZB 1UA6L 3IJSB 3UO1H 1QPPA 3JUZA 1Q0YH 3E2HB 3PWPB 2DTMH 2ORBH 2AK4A 1B0WA 4MD5A 4WI4A 1MWAA 3OB8A 4K3HA 4RWYH 3BKYH 3EJZD 5C0NC 5DJXA 4MXWL 4GSDH 1QPXA 2BNRD 3KGRA 1QR1A 3VFSA 1D5IL 4RIRA 3HUJF 2P5WA 4AMKL 5JHDA 5F44A 1TTFA 2V7NB 2E7BA 5BS0B 3RGVC 3W9DA 3RTQC 1JE6A 3G6DL 3IXTB 4OLVH 4R7NB 3WHXA 3R1GH 4L5FH 3ZT5A 3V7AE 2VSCA 1YEKL 3OXSB 3KYAA 5FHBL 1QO3A 3O3AA 4OCYL 2Q20A 4U1JA 2ICWA 4I2XB 4YZFE 5CEZE 4E41D 3CGTA 3KLAB 4NO3B 4PJDB 4FFVC 1VADA 5C3TA 5LVEA 3RKDD 4PS4L 4WO4B 3UPCA 4MXWH 1MCCA 2NW2A 2Z92B 4QGTA 3C5SB 5T1DH 4EI5A 5DZNA 4AMKH 1WEJL 3FL7A 5HYJA 5L2KA 1S7XB 4U1MB 1XIWB 1J8HD 1YDPA 2DKUA 4M00A 1OP5H 1Z5LA 2VLKE 1MCOL 1BZ7B 3H42H 1I9EA 1NEZB 3G6DH 3NCBB 2C3GA 4OZHB 1QSZA 3S35L 3TVMD 1S9WA 5FYLH 4A6YA 5F1IB 3O3DA 4HPOH 3IDNA 4G43A 3CPLA 1YEKH 4DVBB 5FHBH 3I84A 4OCYH 4JFDB 3TNNA 4HWZB 2BMKB 1MCSA 1REIA 3ZTJH 3NCYS 3O0RL 3TBVA 5CGTA 1YMME 3FT4B 3D25B 4MB4A 1JPGA 3S4SB 1H8SA 1KB5A 1YNLH 1N3NB 4ONFL 5KS9F 3GHBH 4X6FB 1RZJH 4PJIB 4H1LA 1HCFX 3HZYB 3B43A 1G9EA 1JNLH 1AXTH 5CSGA 5A3IC 5I1JH 4PJ5A 3FKUS 3DMMD 4LSPL 4JKPH 3QI9A 4OJFH 3QXTA 3T0EA 5KANG 2EH8H 4OV5A 4OF0A 4ZTPL 1BVLA 3FZUD 4DGVL 1P1ZA 1RUQL 3EOBA 2JCCE 1TNMA 3IDIB 3AY4C 1FGNL 1K8DB 2AQ2A 5GS2D 4J8RB 4WTXA 5FECB 3HPLA 2XKSA 4P4KB 3O9WB 2CRYA 2AV7B 5F7DB 1F6FB 3FQTB 2C3VB 1E4WL 3C5JB 2CRZA 1VKXA 2V2XA 1MRFL 4M8QB 4WI3A 1CFQA 5DHYB 4GW4A 5JDSB 4BQBA 1MI5E 1PW3A 2QR0A 4ZS6C 4I18A 3HNTL 1HNFA 1FVDA 4Z7VF 2DWEB 1U6AH 2H2PC 3F7RA 4RMVA 1I1AA 1FH5H 4ZUUB 4CDHA 4IJ3C 3DRQB 2R2HB 5CIPA 1XH3A 3RWFB 3T1FA 4JN1L 1N7ML 2WIIA 1DQDL 2MKWA 1NGZA 1TTGA 3KPOB 4QNPF 5KJRL 2VXTL 4JCLA 4I0CC 1FGNH 1VFUA 3QWRD 2GY5A 5F7MC 3QDHA 4OI9A 3ZE0E 2UWEA 4NRZA 2HYMA 3W0WA 5DT1L 3ZLQC 2UYLB 1T22B 3LSOA 5J12C 1IC5L 1NMCB 5JORB 3GUTA 5F3HA 5IMKA 1WTGT 4YPJA 2Y5EA 3P0YH 2MNUA 5D72L 3EAKA 2OI9B 3NGBB 4W6XB 4M6OL 1EERB 3WIHL 4NQEA 1HHKA 1IGYB 3HNTH 1A47A 4MQ7A 4Y1AA 3ZDXE 4DQOL 3RP1A 2NZIA 4DOHB 2WINA 4L3AA 5AZEL 1EZVX 3HAEB 4FP8L 4LLQB 3ULUD 4KH2A 2H8PA 4MS8C 4L3CB 4PP1C 3HNVL 4RFOH 5TF1L 5J1TC 4G42B 4ZOBA 5C09B 5IEKB 1EFXB 2ARJA 2B5IB 5KJRH 2R9HC 1TQCC 4P4KD 4GXUM 5FKAB 3AAZA 4RCAA 3UPRB 2EDOA 4G6FB 1CFSA 5DT1H 4PRNA 2EH7L 5D7JC 3WLBB 5IFHL 2OZ4L 4HIIB 1UZ8A 1YC8A 2PYEA 1LMKA 3SGJA 4TQEH 5GGSB 1DE4A 5D72H 1HZHL 3CVIL 2XZZA 2NY2C 2AEQL 5DMGC 4HC1A 3LKSB 4M6OH 4W6WB 4ZAKC 4IMLB 4IRJB 5TF0A 1D6VL 2CPCA 2CRIA 1FFRA 3FQWB 1F4YL 2YPLA 3AFLA 5AZEH 1EIBA 2R2BB 2NX5D 1OQOA 5J57B 3U4EB 3HNVH 1QFUH 2ZPKL 3PGCA 4FFYH 4RMSA 4R26L 3VH8G 2HLFC 5IB2B 5DJ0B 5CD5C 3IU3A 2ARJQ 4P5MA 3MFFA 4DWHA 1INDL 5D2NB 4OGYL 1OHQA 3NIFE 4G8FB 2VKWA 3PP4L 4X9GA 5AG8A 1ZV5A 1CD0A 1Q9WA 5IFHH 4P2OA 1CDIA 4ZFZB 5D70H 5LCVH 3AXLB 3PHOA 3TFKD 1TIUA 1BQHA 4HGWA 1I1FA 1HZHH 3EYUL 3GO1H 1ODAA 1O7VA 2YD9A 5DUML 2NXZB 1FZMA 8CGTA 3TPKA 1IARB 2VC2L 3MBEA 5DRWA 5JQHC 1PLGL 2BSRA 2FNBA 4UOW1 3BWUC 1X4ZA 3U0PA 5SWQA 1EFXD 4HIHB 4QHUA 4AIXA 4G3YH 4MJ5B 4R26H 4IRSD 1RIVL 4D8PA 3LRSA 4G6FD 2UZIL 3CD4A 5ETUA 4JFQB 2VZOA 4MJID 1INDH 1PKQE 3EO9L 5DVMA 2Q8AL 1DUYA 3LEXA 3S34L 4NRYB 4U2ZA 2X4OB 3HCVA 4GAJL 3MYJB 1NCTA 2VAAB 4NN6B 4ODWA 2ZCKL 1L7IL 3SE9H 4Z7UA 4OZFH 1RZ8A 2Z31A 1AXSB 2OCFD 3T3ME 5C8JA 3IS0X 3UTTB 1WFNA 1YY8A 2R0LL 1P7QB 1TLKA 3GSQA 3WLWC 4KI5C 2P7TB 4MA1B 1V7ML 2IPUG 3AB0C 2F54B 5E8EB 2IBZY 5GIRB 1ZE3C 4ISVB 1RIVH 2IJ0C 2UZIH 5TE7L 3VXUD 4CVZA 5GJSH 4MNGA 3EO9H 1Y6KR 2EYSA 5C0AE 3RDTD 5D9SA 3BWAB 5I9QC 3S34H 2GSIA 3ETBF 5ALBH 4HKBA 4WFGE 3DSNA 4I77H 2ED7A 4FQ2H 3M8OH 3BP5B 1OF2B 2L7UA 5EUOF 1W0VB 1E6JL 1L7IH 4R96A 1E6OH 4ONHB 5FYLD 3RWIA 2CLRA 4QYOA 2BNQE 3MROB 1OAQL 4U7KA 4XP4H 2HFGL 4FABL 2VZ1A 1TMCB 4M1GH 3UBXB 2GK2A 4QRPA 3QP3A 1G0DA 5F7LB 3MV9E 5CFHA 5CHNB 3JTSB 1XF3B 4ODTH 1HHIB 5TE7H 4NSKA 4XVUC 3L3OB 2ICCA 2A9NH 1I9RL 1T5XB 3D69A 4HS3A 4TTGA 1MCKA 1XFPA 3BW9A 4UUJB 2XPGB 5FUOL 5EBLB 5EU4A 2HKHL 4KTDL 1JZ6A 2IMMA 2PO6C 3KDMA 2YMXL 4IDJL 4G80B 4Z0XA 2VXSL 2J3SA 3HNSL 4KJYA 2R4RL 5LKNA 5MERA 5DO2C 5BO1L 1W72A 2HJKA 2IMNA 3HLAA 4XH2B 4X9FA 5I8CB 1HH9A 1UXSB 4QRTB 2N7BA 3OKYA 1BOGB 4X7SH 1A3RL 3HC3H 3DVFA 3VXTA 5M95B 2HFGH 4XPTL 3ESVF 3I9GL 5EU3A 3DHJA 4ZQKB 4FABH 2D3VA 1S9YB 3PWNA 1HCVA 4MX7B 4EN3A 5HVHB 3ME0A 5ADPL 1WIPA 2FRGP 2B0SL 4F80A 4BELD 1MCFA 3U30B 3T77A 1Z2KA 4Z6AT 1ZVSB 1DDHA 3RZCC 3RY6C 2VZTA 4AEHL 3PWUA 4KTDH 3ULVL 4UDTA 2YMXH 3DRTA 4JG1L 5ISZD 3KAAA 4XPAL 3UXFA 5JO5B 5IM7B 5I74C 2NZ9D 3SJVB 2DQDL 1R3KB 3MOQA 1TQBC 1HNGA 2C5DC 3GKWL 3IF1B 4U6YB 4ETQB 4PGBA 3CSYB 3TT1L 2CIKA 1A3RH 1YPZE 3B2UD 4JM2A 4XPTH 5E5UB 4AEEA 2J6EL 1RQ5A 1QNZL 2GSGA 3TBYA 3UDWA 4I0PD 1R5VA 2VYRE 5DMKA 5ADPH 4NQXB 1EAPB 1A4JA 4P0DA 1PQZB 1MY5A 4Y8DC 3O45B 3FFDB 4JHBA 2XZAL 2VLKA 4PRHE 5A1AA 5BV7L 4JAMA 3O2DL 3D6GA 1M7DB 4I0KA 2VDML 2CLZA 4XPAH 1I3UA 3FB5B 4Y16C 3IDYB 2GCYB 4ZOCA 2D9QB 4KPHL 1JZ4A 3QDGA 5JOFB 3CFJA 5DJ2B 3G9AB 5JW4N 2FECI 1ZGLB 4MD0A 4LCWD 1N8ZB 5FM4A 1OAKL 4P3CL 3TBTB 3QEQE 2DI9A 5D1XD 3EYOB 4XNZB 2VAJA 4AM0A 5D7IF 1U41A 2J6EH 1QBMH 4MAYB 3VI3F 2F5AL 3B8YA 3H7LA 3K4DA 1FYTB 1OTSD 3WFCL 4CDGC 3Q1SH 4P23A 2BVTA 3NZ8B 1U8QB 2XV6B 5T1KB 1IGTA 1R0AH 1S5HB 4Z7VA 3QDJB 3QSKB 1HSAB 3O6FA 4M1CC 1HQ4A 1R3LB 5BV7H 1IM9A 1MF2H 4LP5A 3TCXA 5CZVL 1UZ6E 3PWJA 4TULL 4YHMH 2X10A 4XNMA 4MQXD 4JRYE 5FV1L 3QUYC 2F9BT 1GJIA 2BJML 2W0KA 3HRZB 3DVNB 4LQFL 4S1SL 1U36A 3MGAA 1BQSA 4XPFL 1AQDB 1V7NL 2WWMD 3MGTA 5FUCE 4Y2DC 4OAWB 1NGXA 4ELMB 4UV7L 4Z76B 3JTTB 2CKBA 3VXOA 1NGYB 3GK8L 2QSCL 2VLRD 1PEZA 3VMOA 5EFIA 2WWKO 3MNZA 2YPVL 4HKJA 3V4UL 3HZMB 7FABH 4CBPA 4Y7MA 3MV7D 5HBBA 5C0BB 1Q9KA 2I24N 1MH5B 1D5XB 1RFDL 1I75A 2WP3T 3BPNC 2X4NA 1LP9B 2Y36L 1DQQA 3GIZH 3P9WB 2GTWA 4IMKA 5CP7A 1IEBA 1ORSA 5I1LB 2J12B 1UM5H 4OM1H 5JOEA 2CR6A 4TULH 1JJUA 2BOCB 1FAKT 4HPYL 3QULB 1HEZB 2BJMH 3L3DA 3MRQB 4LQFH 4QHKJ 3ZYZA 4OFKA 1AD9B 2RIKA 3ARTA 4MLIA 3E8UH 5EH1A 2IADB 5EZJA 1SJEB 5EORL 4KZDH 2PXYB 1AO7E 1TETL 2QQNH 1IQWH 4LLWB 4OD1L 2BRRH 3GJEB 3K4AA 3RWEB 3LB6D 3X12B 3TJEH 3QZWB 5INDB 5CBEB 3DIFB 1P69B 2YPVH 2LTQB 2FHCA 2W91A 1A6AB 4LHQB 1UWXK 3BH8B 3EYFB 3WE6A 2XKNA 3RPIB 1BX2B 3LIZL 4PGZA 5DD1H 2W0FA 4MCYA 3BH9A 2GFBA 1MY7A 5FOBA 4D9RD 4NJAH 1BJ1J 1BMGA 3KPMB 4G8IA 3VFOB 2PN5A 3FB8B 1EUUA 4HPYH 5EZIL 2HLAA 1M6OA 1RV6X 2JJSA 4CJ1A 5D2LE 3BUYA 1TZIB 2OTWA 3UTZB 3Q5YA 4BH8A 4NN7B 4FQXB 4D0DB 3HR5A 5IW6A 2DJUA 5FUZL 1M05A 1RZKL 1YECL 1ZVYA 4D3CL 1EEUA 1CK0L 3BIKB 1AY1L 1S8DA 2NTFB 1DLHB 5T1LA 1I9IL 4O2CA 5FO8A 2DOCA 5HPOA 2OXGA 4P46D 3RWCA 5K9OB 3TC9A 1AH1A 4AY0A 4AENA 4DCQB 4CGTA 4JFFB 1I7TB 4K3DL 3KLSA 4LLVB 4MA8L 2YD4A 3GMPA 2P46B 2XT1B 3G04B 2QADC 3TH3T 1U91A 4NO0B 1XF1A 4KI5F 5KBNC 3BGMB 2PXYD 2VSDA 5EZIH 2FZ3B 3B6SA 3JZ7A 4JVPA 2G9HA 5FA3B 3UYRL 4ZOEA 1L6XA 4Y19E 4MSWB 3DGCR 1YECH 1JHTB 3WUZA 2H32H 2IH1B 3T2OA 1AY1H 1CICA 2AERT 2X4TA 4Q9QH 1I9IH 1MAML 1I8KA 3O4OC 1UWXH 4JQVC 1LO2L 5I19H 3TA3B 2FATH 1U8JB 4KKLD 4WHYH 1SJXA 1LILA 5DR5H 3MLSL 4JVUA 2AKRB 3JWDC 2C1OB 4OTXH 5FDWA 4P2QD 2K9UA 1IC4L 4YNYA 2NY5H 3IU4L 1YNTA 1A4KB 4X99A 1BF2A 2MQCA 3DX6A 5H8DA 3DPBA 1XGTA 1X5IA 3HI1B 5I8EB 4JZNA 1OGTA 2HT3C 3FN9A 1F4HA 3QQ4A 1PKQA 1JV5A 5IHUL 2J8UB 1RJLA 1ZTXH 1G0XA 1WICA 4PLJD 3RGVA 3F5WB 4PJEE 3SE3C 2QQQA 3BRFA 4PY8I 4NOBA 1MAMH 3S8WA 5B38G 5IW1B 4MA7H 3SKNB 2R0KL 1M4KA 3MREA 2GK0A 5BV7B 1KIQB 2ITCB 3DI3B 1MNUL 3OAUL 4I4WA 4JFFD 4CMMA 3KYNA 5I71C 4M9PA 2HTKD 3MJ7A 4X7TA 3WS3A 3HI6L 3PG2A 4G8EA 4NM4H 4NO0D 4PJXB 4FQQA 3FQUA 5HHME 4L9LA 3LEVL 1VHPA 4XXDA 4C54A 4NGHL 3F65A 2VR4A 5D4QA 4L3EE 4DW2L 3FB6A 4YDVA 4Z7OF 4LLMB 2L7JA 4Y4KA 5TQ0H 1FL5B 1UEYA 1ADQA 1A9BB 4RSVA 4H20L 5IHZB 1H3GA 4LGPB 2GAZB 3GI9L 3MGOA 3TA3D 1KTDB 4FQPA 5IW3A 4XCNA 3V7AG 5FO7A 4WUUE 4J4PC 3VWJC 4JRXB 4OFIA 2BNQA 3EFDH 4ZXBC 1Y18A 4HV8A 2HKFH 3D18B 3ZL4L 3HI6H 4P5TC 25C8L 2DLTA 4UV4L 2BHZA 1NBZB 1NCBL 4JPWH 4RMWA 4LAJH 4Y4FD 3FQXA 3MV9A 4DW2H 3Q5OA 3C5ZB 3EO0A 4N8CL 2PW1A 5C9JA 5JUEL 4LPUA 4ZS7H 3UJJL 3X3FH 3L7EB 1R3HA 4XMLH 4OT1H 3QEGL 2MHAA 3MTRA 4H25B 3MACL 1Q9OB 1DSFL 1UCBH 1AIFA 3SE4A 2DWDB 2ESVB 3QDMA 5DURB 1BIIA 3VXNA 4YO0B 2HRLA 4PJBF 3RAJH 1PG7X 3IDGA 4X8JA 1T7YA 5MEPB 1RUML 1BJ1H 2ICEB 3GMMA 4KWUA 5DJAA 1NEUA 1A6WH 3ARDB 4OD3H 4PGDB 4XNYH 5C0CB 3DOSA 2R0ZL 5EIVA 3DV6A 5HYEA 4W4OC 4X6EA 2P5EA 4X7EC 3CC5A 1DSFH 3GSVA 4QT5A 3MNWA 3U0WL 5ABDE 3PDOA 5HDOA 3UZQA 3MV8B 2A83B 3OG6B 1W0WA 3OTTA 4R97C 5H37H 4IIQA 1S7TB 1AR1D 4A2MA 4GBXC 3ROLA 3MRGB 3OJVC 4GRWE 4P4RA 2IANB 3RL2B 2XN9B 1TFHA 1YQ2A 1QFWL 1H3XA 5D7IA 1YPZA 4U4BA 5I2IA 4M7KL 2UY6A 3MOAL 5BZWA 4OZIB 1K8IB 2YWYA 1NSNL 3QIUC 4NM8L 3QNXB 1RJZB 1S9VB 3G9VA 4WU5B 2AABL 2AJXH 4JDZA 5ELIA 3CX5J 5DHVH 3NN8B 5GS1A 5KSBB 5HHNA 4BSJA 1U8KA 3UTQA 3VRLE 4FQIL 4NCC1 1S3KL 2E9BA 3LQAC 5F7UA 2AXFA 4X4YB 2R0ZH 2MCPH 4PBVC 1IILE 3GHEL 3ZKQD 5JHDD 2ADGB 1ZKAA 1DVFC 3KXFB 4J6RL 2W60B 2EC8A 2F53B 3T4YB 4POZC 3QUZD 3SBWC 1S9XA 5IKCB 3MA7A 4R4FL 4OCSH 1UB5A 5EOQL 3UTSE 2WWKT 4QCIB 4PR5B 3MOAH 3ECBA 3QIBB 1A9EB 2VDRH 5DEGA 5ANMB 3WSQL 1NSNH 5FB8A 5I1IH 4NM8H 3U2SA 1JGLH 1AGDB 3WXVL 1F97A 2EYRB 4WJ5B 3T2PA 2VN7A 3VG9B 1F2XK 4F15B 2G60L 4ZAKA 5HHPA 4J1UB 4FQIH 4XNUL 1AFVL 1S3KH 4OGAD 1JMXA 4JGUA 3MV8D 4U1GC 1A7OH 1FNHA 5EUKB 5IR1A 1TDQA 4KMQA 3V5KB 4J6RH 4XP9L 3QQ9D 3QCUL 3BP7B 2X44D 2HTLC 4GRLA 4Y5XB 1EJOH 4R6UA 1G7MA 1LQSR 3QHFL 2FEEI 2E7LC 2HFFB 3E0GA 1S7UB 4OB5L 4RAUA 4FQHB 3OKLB 3D39B 2HWZL 4R4FH 2C3XA 1MJ7L 5DD3H 5EOQH 4JFEA 1QSED 4MVBC 4HH9B 4LF3B 1VFBB 1OWRM 4DUVA 2V9RA 5SWSB 4NQSA 5D1ZC 1AQKH 4TSAL 2XTJC 3PABA 1UACH 4GOSA 3BKML 5GSVB 1H15A 4X0KB 1RPQA 3F12B 3VXSB 5I8OH 2HRPH 1U8HB 2Q76B 1AFVH 2VXVH 3K8MA 4CW1B 2VQTA 1U8PA 2VDNL 3CVHA 1OSPL 3K3QA 3FCTA 2DYPA 3TYGH 2EDDA 1RUAL 3HZKA 4M43L 1NKRA 1BBDL 5DQ9A 3EYQC 1KENL 1MRDH 3ULSA 1GGBL 3X14B 4NYLA 3Q3GA 5E1AB 1CXFA 1MFAL 4OB5H 4PGEB 5L6YH 2NY0C 4R2GD 1MJJB 1JFQL 1I3RA 1AO7A 1WAAE 1MJ7H 5DRXB 1VESA 4GAFB 1RU9H 2P42B 3B2VH 5F1NA 1RHHA 1TJGL 4K9EL 1H5BB 2GHWB 5JDJA 1MUJB 1X5HA 4ZSOB 1PBYA 3U6RB 3U7AA 4MQSB 3PL6B 3RI5K 1UJ3C 2Q3AA 4BQ8A 3HG1E 4ZFFB 4WI7A 1GC1L 1B0RA 4LU5L 3EJZC 2Q6WA 2HMID 4XZUB 3S88H 4X6DE 1F3JA 1CXHA 4ERSL 5F7KC 2VDNH 2XRAH 3MRKA 5H2BA 5EBWB 2B4CC 4IM8A 1BLNB 4YIQA 1FBIL 1U8NA 4PJ8C 2XQYK 1BBDH 2W92A 3UPAA 4JR9L 2E5EA 2Q7YA 5HGDA 4IOIB 4O02H 2YSSA 5D2LA 2VQ1A 3EHBC 4YGVB 1MFAH 1UYWL 4LSVH 1FFOA 3IJHB 3OKOB 1JFQH 4DKAA 1J0JA 4BFIA 1U58B 4K9EH 1JWSA 2YD6A 4RFEB 3CK0H 4WEMB 3ULVE 1EEYB 3VGAB 1QYGL 1P6FA 3OJDB 1OB1A 4YPGA 5DJ8A 4HXBL 4KHTH 4LRNH 4PBXA 1BFTA 1Z9OA 1GPOL 1H3TA 4LU5H 3BDXA 3D3VE 2CH8A 4OCRL 5HY9B 1IAKB 4NZTL 3NPSC 4JB9L 4JZJC 3EO1B 5EU5A 3JUYA 5F9JB 3QIWA 4NQED 4Z7WE 4JFOB 4KK5D 3FRUA 4JPVL 1NL0L 4R4NC 2PW2B 1UADC 4EZMA 5EPMA 1N59A 2D7QA 4JR9H 5GSRA 3QH3A 4CNIB 2AJYH 4PRAA 5F96L 2BXZA 1IGJB 3E2HC 3L5HA 2E8YA 5KSAC 1YEGL 4EIZC 3IETA 3U7WL 4Y19A 5IMMB 5T3XH 1X4XA 3U0TB 3JV6B 3P0GB 1QYGH 4Z0BL 5B4MC 2A74B 4BFGA 5HGHB 3G5YB 5JPMA 3IFLH 4HT1L 1OGAE 4KU1A 1JGDB 2DM4A 3FB7A 1NANH 1YJDC 3HMWL 3UTPE 2ED9A 2PYED 2CUMA 5GGVL 4F7TB 3LKNA 4UTBL 4JB9H 4M7ZC 1N2RB 4X4ME 2BFVL 5DXWA 1S7WA 4MHHI 4M93B 2FJFA 3RJQB 1T89C 3GMQB 2CDGB 3QA3A 4BA8A 4ELKA 3K74B 3TO2B 1A1OB 1L9MA 5ID0B 3VD5A 1CGSL 4U1HA 2Z93B 1VFAA 2YPLD 1I8IA 4U33A 3NFPB 4HJJL 5EIIB 4KZEL 4N9GA 5JA8B 1TZGL 3VWKD 1I7ZB 4RBPK 2Z91A 4WUKH 1KELL 3MCKB 4KJWD 2BOBA 1J87A 4PJ9A 2D7NA 4YFLI 5I1HL 1ZT4A 4XCYB 4PV9A 4WO4C 2X1QA 2R1XB 1ZSDB 4HJ0C 3TO4A 3CLFH 1PZ5A 3IB4A 4X7FC 5DRNA 4XB8A 5GGVH 3M17B 4EI6B 1XIWC 2BFVH 3H9SB 3H2WA 3G6AA 1E4KA 4JJ5A 3DBXA 5FYKU 5C0EB 2VDOH 4V1DE 4X6BB 4KK8C 4APQA 5KTEH 4XMPL 1D6EB 4M6NL 4I48A 1VGKB 1BVZA 4HJJH 1CGXA 5GRZA 2IPKB 3GMNA 1QLEL 4GUPA 1HHJB 1SHMA 1TZGH 1W2KT 3PGDA 4YEFA 4IOFC 3RWDA 5T5NF 1IAOA 1B0GB 2R2EA 1DEEA 3STLA 5DJZA 1NC4A 1M7IB 2DM3A 2Q86B 1T0NB 4QHMA 1U8IA 4X98A 4CN6A 4Y16A 1MLBA 3VFRA 3W81A 1X5FA 1JPTH 1DQJB 2V2WA 1RJCA 5E08H 4DFIA 2APTA 1FJ1A 4HG4J 4HX1A 4LEXL 3HE7C 5CJQL 4OCWL 5I1EH 2F5BH 2ZUWA 1B4JH 2Z31D 1IL1B 4JKMA 4GJTB 3DNKA 1K4CA 1UEMA 1O0VA 4M6NH 5DUBA 4FQCH 4RBPH 1QSFB 1CWVA 1C1EH 4KJPC 5EBGA 1H0DA 1QLEH 4K94C 2XG4A 4P4KC 4HIXH 8FABA 3O9WC 2VITA 3MRFB 5J6GB 3B83A 5DDHA 2FB4L 5FYKH 1QBBA 1SJHA 5C07B 1Q1JH 1Y6MR 4P9ML 3NACH 2OP4L 3BYTA 3H9SD 2Y6SC 5EO1A 1X7QB 3TCLB 4H88L 1HKLL 5DWUL 4HUNB 4G8GB 1I4FA 1P2CA 4LEXH 3HB3C 3MRHB 2JJTC 3DTXA 4JPIA 4AEIL 1LK2B 3MJ9L 4X5XA 1FO0H 2NY4D 4JQXC 1MCLA 3U9PL 1NGQH 1D9KB 1V3MA 4OLYL 4UILL 1PFCA 4TOYL 2Y1VA 2RGSA 1HXYB 3T8XB 2Y23A 4ALAL 4WWKA 1XCQB 4H8WC 1DQMH 2VDQL 2OL3L 2Q7NA 2F19H 5EOCJ 4CAGA 2C3WA 3I3EA 3ZKSD 1A1NB 3P0VL 3FMGH 5IEHA 3RWJA 3QFJA 2BY2A 3O6LH 5GZND 3NFNA 1BD2E 1GGIH 4J3OC 4LCIH 3C8KA 5HDQH 3L5WA 2YXMA 1FZJA 5FV2A 3GZKA 5E00A 1YEIL 5JW3H 3V52H 4KDWA 4AEIH 5IVZB 3U9PH 5BRZB 2I27N 5JNYB 4NOFA 1KTLA 4QRUA 4OKVB 4OLYH 4UILH 5IG7A 4N0UB 2LQRA 2BSSA 1A1MB 4L8DA 4ALAH 5HHQB 2E27H 2BNRE 2NY3B 3WNPA 5DS8B 4PJCF 2YK1H 2VLJA 1LD9B 4QXUL 3TZVA 3RUGE 3EOTH 3N85L 3P0VH 3SCMB 3L6FA 4LAQH 4N1CA 2R4SL 1YEHH 4KVNL 3S5LA 5GS0L 4IRJC 2KQNA 3TBSA 5I1KH 3P11H 4QWWD 1CGTA 3P77A 2O61A 1WFUA 3WDIA 3UTSA 5EC2B 2C7UA 3ZE2F 2I5YL 3GSWA 3SDDB 2QSQA 5DD0L 5JLZA 4TSCL 5MEND 4KK6D 4D0BA 43C9B 2GJ6B 3FAWA 4E41E 5IMLB 2KBGA 1AHWA 2FR4A 3BQUB 2MPAH 5HHVH 3MJ8B 1A0QH 5AG9A 5D2NC 3VXMD 4KV5F 4X4XB 3NIDF 4NNXA 2H9GB 4QF1B 3CUPB 3QQ3B 5I1DA 5EU6B 4MXVE 5FKPA 2DDQL 3ZYIA 3FFCB 1I8MB 1J8HE 3N50A 1C8PA 5H35A 2FLRT 4CADA 1Y0LB 12E8L 2A73A 3MRBA 1EV2E 4P9HL 3ZT7A 4WV1A 3VD3A 2NXZC 3FO2B 3LH2H 4MDJB 5C0DB 5GS0H 5C86A 5EZLA 4FXGA 2I9LB 3K46A 3QEHA 3REVA 2NW3B 4HUXA 1DANT 2I5YH 4MHHG 2GJJA 3B9KA 5ITBH 5DHXB 1YMHA 2EEBA 2Q3ZA 2YC1B 5BMFL 3BP6A 4OF3A 5T3XD 3GSNA 3D2UB 5GGTA 2BDNL 4NKQB 1EXUA 4PLKC 3WNLA 4AK1A 5DFTA 4LCCB 2D4DA 4NKDA 1NAKH 43CAB 2BVEA 2NNAB 1C7SA 4HQQH 1U8LB 3AU1B 3AREB 3G6JE 2OX5A 4YXKH 2R56H 2OLDA 1Z9MA 2VJXA 3GJFK 1UB6B 5MEOB 3QHTC 5FCUL 3P73A 4NN6C 2WBJA 4WFED 3OBAA 1WAAA 1ORQB 4Z78B 1P4LA 2GJ6D 4TUOA 3TBWB 2M2DA 4F57L 1RULL 3ARXA 1G7IB 4MA1C 1U92A 3L9RB 3DX7A 4KRNA 2X1XR 4LLYA 4FZ8H 3MRJB 3TN0A 5HSFA 3FO9A 4IS6A 5E94A 2ICWJ 5IFJB 3OPZH 3GSUA 5EU6D 3FFCD 2YZ1A 4D0CA 5T1MA 5EOCL 3ARFB 3O4LE 3MJGX 1UCTA 3IDJB 1T1WB 2X9WA 4X9IA 5IVXB 3O8XA 1NCCH 4KROC 5E6IA 5FCUH 1CYGA 4JFXA 1RK1B 1FE8H 3K4ZA 4NZUL 4PREB 4NZDA 1T6WA 1Z9SA 5F3BB 1FNGA 1XF4A 4RGND 4LKXB 2GUOA 2I60L 3U36A 4PJDF 3CMGA 3D2UD 2W9EL 2IALA 4L9DA 4LHUD 5B39B 1FL3A 1CL7H 5DI8B 3D3VA 3QXAB 4HWBL 1ZWIB 5I76A 4M3KB 1Q94A 1X6NA 2VR5A 4O51B 3P4OA 1FFPA 1NMBH 3WFDL 5DMIL 3GJFH 1Z6JT 4Q0XL 4Z7WA 3I6KB 3PWVB 4PJHE 3LN5A 3CFKB 4C56A 3NZHL 1MHHB 4L8SA 3INUH 2CMRL 4TVPE 4F33A 4BM7A 1D5BA 4OZHF 2EXWC 5I0ZA 3L7FA 1J1PL 3ILQD 3X11B 5B3JE 3OKEA 5CJBA 1N6QL 2NR6C 32C2B 1EFQA 1ES0B 2X4RA 3PIQA 3VXRA 3P4MA 4OZGE 3VDCA 4EQ3A 3V8CA 1NPUA 3KPSB 2I60H 4HJGA 4NKOA 1T7VA 3MUZ1 4XXCA 1ZANL 3W39B 1E27A 5HVHC 3QNZA 4JHZA 5FYKD 2XACC 2X6MA 1I7RB 3CFCL 4LIQE 4PJIF 3VFGL 1QRND 3SKOA 3ARFD 1OAXL 3RTQB 2OL3B 1A64A 1J0HA 2ZCHL 3SDAB 3PQYE 5ICXA 4N0CD 1FGVL 4HGKC 5D71H 3DXAA 3N9GL 3C9NB 4JDVA 4UIKL 3NZHH 2GITB 1EO5A 1HOCA 2IPUK 4J3XA 2F8OA 5CCKH 3W9EB 1DN2A 1J9CT 4GLRI 1A02N 1X5KA 2NX5E 2X4SB 3ULUF 1JWMA 2Z8VC 3QFDA 1N6QH 2Z8RA 3SDCD 1UQSA 2EC9T 3B3IB 4EKXA 5A2KH 1B2WL 4HIJB 5ERWA 1VEPA 1ZHKA 4MNQB 3I6GA 4XI5D 1MVUA 5GZOC 3THMH 3RA7L 4E9LA 3D87B 1NAMH 1YUHB 3HZVA 1Q72L 3VFGH 3CFCH 2BX5A 3T65B 1OAXH 5KZCB 1MWAL 4LRIC 4QOKB 1FGVH 4V1DA 3DX9A 4UNUA 1Q38A 4R8WH 3VMNA 4PJAE 3DETC 1FNLA 4L4VD 1EHLL 5DC9B 3JWOL 4EOWL 5IF0B 5C0ND 4HFWB 2VO5A 1PKOA 1G7JB 5SX4I 3RWGA 4XNZC 1OPGL 2R29H 4GW5A 4N90E 4FTVA 4NP4H 4NQCB 1QRKA 3DV4A 4MJIE 4MAYC 4U6XA 4BSVA 1KCVL 1KBGL 2WZPD 4PG9A 5CLTA 1RVFL 3RGVD 3KPTA 3RTQD 3SDAD 4R0LA 4WVRA 1J88A 5ICYB 3A6CL 5I18L 3U9UA 3V0AC 2A6JA 4PRID 2CK0H 1GH7A 3NCYP 3WN5A 1JZ3A 5C71A 1BBJA 1FFQA 3QPXL 3DYMA 3STZA 2AGJH 2PTTA 3MRRB 2XNAA 5BVJA 3WUWG 2CK2A 3BZFA 4F7MB 4HKZA 5GRYA 4FFVD 1LK3L 3QUKB 4G7YH 1EAJA 4GKSB 4G6JH 5IQ9B 2IG2L 1YN7B 2FX9H 2X4QA 4FG6C 4OGXH 2GI7A 2F74A 1DTUA 2EIZA 1CE6A 3VXUE 2EYTA 3D0LB 4W70A 4A6YL 4YR6A 1KCVH 1KBGH 5C0IB 5KZCD 3MLTA 3OXRA 3H3KA 1KJ2H 5CEYB 2OBGA 5FK9B 2R0WH 1MJ8H 3V6OE 3VCLB 5KN5A 4YHPB 2WQ8A 5TDPB 2IAMB 4PRPA 5EWIH 4E42B 2FIKA 3DO7B 3KHQA 2O5YL 1U3HB 2G75B 5FYLE 3QPXH 2BRQA 5INCB 5DK0B 4WHCA 4U31A 1JK8A 4J2XA 3IKCA 4EUPA 1C7TA 2QHRL 1OQXA 4F7PB 4GG6E 3MLZL 3EOAB 2V7HA 1NC2D 4NQCD 2PXYC 4I8DA 4S1DC 2A38A 4NQDB 3NCCB 1JHLL 2V9TA 4JVWA 5HJ3B 2H1PH 3T3PF 4Q6IA 4JFHD 4AT6A 4ZNEA 5A3ID 1BD2A 4HDIA 3B8SA 4YAQA 1XF2B 1XGQB 2LTQC 5F21B 1T04B 5F89B 1IQDA 3GJFB 1JWUA 4QRRB 2WV3A 3MLPA 2OK0L 3OHXA 3LDBB 4PJGE 2NY6B 1IC7L 1UM4L 4DZ8B 3GNMH 3VFUB 1JTTA 1AGEA 4XTRC 4Z7QE 5KOVC 2WUBH 3UP1A 4PJFB 1FZOB 5T3ZH 1EMTL 1KLGA 2P43B 1TZHA 1RZIB 1AKJB 5B8CA 1A3QA 1CTOA 1HDMA 1URLA 4CMHB 1N5AB 3VJ6B 1IAIL 2GEEA 2BNRA 4Q7DA 6FABL 2BSTB 2ZOKB 1W8OA 4FQXC 4NN7C 4M61B 4ZS6D 4YFLF 3RUGA 5HVWA 4RMRA 2HVKB 3G5ZB 1RZ7L 2C4FT 2H2PD 3B9EA 3ZHLA 3B9AA 5CINL 5ISZE 4UT9H 1OAZH 4Q9CA 1INEH 1PX4A 3V4PL 1HSBB 3I85A 1D5ZA 3SE8L 2Y7QB 4M6ML 3X3GH 2IH3A 4JO4L 2LU3A 3BIBX 4E41A 1F4WL 3Q6FA 3C08L 4F2MB 1DUZA 2PETA 5FA4A 3CU1A 1VACA 1EMTH 5J6HA 1B9ZA 2F58L 2DD8L 2HJLA 1NCDL 3F7VB 2LABA 2K7PA 3P30H 4K8RC 1RAMA 4XX1E 3EGSA 4JZJA 1BEYL 1KIPB 1X4YA 3VI4F 1J8HA 4DN3H 1NAMB 3KPRD 3QO1B 4YFDB 1RZ7H 5E9DB 3V0VB 3MNVB 2EIBA 2VIRA 3BPCA 1ZT7B 5CINH 4ODUB 3TVMA 2FHFA 4MS8D 4PP1D 3ULVC 4WI8A 3V4PH 3I02B 1QQDA 4YDKL 4K7FB 2B1AL 2R9HD 1KOAA 1RUKL 4K7PH 4JO4H 2DQFB 4LCWE 5GGRA 5C92A 2PYFB 1PG7W 1AKJD 5TFSH 3WS6C 4HC1L 4NC1E 3DUHA 1V3KA 5D7JD 4GW1B 1NCDH 3RNQB 1HXMB 3RVVC 1BZQK 1UXWB 2DQCH 5ENWB 3G6JA 3JXAA 2V7NA 1BEYH 4LCYB 4U1IB 2VZ3A 1X5GA 2NY2D 5A2JH 5DMGD 4DK6A 4JANA 3LPWA 5JZ7C 3DMMA 3M1BB 3BE1L 3FRPA 3OZ9H 3DWTA 1KEMH 4GAYA 4MD5B 2W0PA 1MWAB 4MNHA 5JXEC 3P2TA 5BV7C 2I07B 1AXIB 5DJXB 1NBYB 4I2XA 2KKQA 1QR1B 4RIRB 4FNLH 4ZD3L 4YDKH 2HLFD 3JVGC 3D48R 3MXVH 4PJDA 5D7LD 4WFHD 2P5WB 3ZHKA 3BD5A 1KGCD 5CD5D 1WWBX 4RNRA 5DD6B 4HC1H 4QHKI 4S1RH 4QXWA 4IHOA 1S78C 5CGYC 2GKIA 5EBMA 5AZ2L 4WRLA 2VLRE 1NBVL 3I3DA 1XIWA 2XICA 5HGBA 2LV4A 3D9AH 3MV7E 4PJ7E 4FQ1L 3BISA 4Q9RL 1QO3B 3O3AB 1BZ7A 1WJ3A 4U1JB 1NEZA 3MSPA 4OV6F 4N0FB 1KJ2B 3BE1H 1VADB 4OCXL 4GKNA 4F3FA 1C16A 1IC1A 5B3NA 2DQEH 2V17H 1QLFA 3RHWF 4HWZA 4YK4B 2XTLA 3QWRA 4M48H 3KYOB 3V0WH 2CJUL 4EI5B 2QV2A 4N8PA 5F8QC 1NFIA 1MAJA 3S4SA 1H3WM 1T83A 4HUVB 1Z5LB 4KAQL 5DFVC 4PJIA 3C5ZC 3H6JA 5HVFB 4KKAC 3HZYA 4OZ4B 5GGRY 1WFTA 1XT5A 2EDWA 4A6YB 3O3DB 2OMBA 5F72S 1X5YA 4U1LA 2MQ3A 3CPLB 4PJHA 1UM6H 4Q9RH 4RAHA 5LGHL 1CLYH 2YR3A 2QTEA 2NXYC 1KXTB 4C83B 3R8QA 3TBVB 4OLZH 3IDIA 4NQVB 4XC3L 4D9RE 1K8DA 3WLWD 1NFKA 4P59H 4CU8A 5FECA 4AIOA 1DR9A 1T2QH 3F7YB 4P4KA 2UVEA 1KT2A 2AV7A 3QNYB 2AJZB 2CJUH 3V5DA 4OFYD 1OP9A 3SDYH 4NWTH 4DGYL 3CZFA 4M8QA 1T20A 4PJ5B 3QI9B 4CN4A 1RK0B 5JDSA 1K5NA 3LEYL 3T0EB 5ESVB 5GGQL 3ARDC 4OV5B 4N0YL 1KJ3L 1MHPL 3VFVB 4Z77A 3GI8L 2DQUH 3I6LD 4YJZL 2DWEA 5IOPA 1P1ZB 4NJ9H 4KRPB 5F71A 3UJIL 2A6IA 4NUJB 4ZUUA 2CRMA 2JELH 3QCVL 2OYPA 5E5MA 3P9LA 3HPLB 1YQVH 4L8CA 3RWFA 3BDYL 4X80L 5EG6C 4XC1L 2NX5A 2X89D 3QQ9C 4QY8A 3L3HB 4URTB 4TRPH 1VKXB 4M62H 2V2XB 5J1AA 4OLUL 1CFQB 1QFWI 3WNNA 3J7HA 1AJ7H 3DARA 1UH3A 2QR0B 3WIFB 3KLHC 1EO8H 2NY1C 5JORA 4XVUD 4ELMF 3EYSH 1A6UH 1FVDB 5JW4M 1W72L 4DGYH 2PO6D 4YHOH 5C08D 2OXHA 3C8DA 1XH3B 1RZKC 3T1FB 1XEDA 1KJ3H 2WIIB 3VXQA 3GI8H 4TUKL 1NGZB 3JWDH 2ZUSA 4U3XA 5DO2D 1D7FA 2H6PB 1KG0B 3UJIH 4UT7H 2DN7A 3SGEI 3L5XL 1LP9F 1RZGB 2ERJB 3HAEA 3QCVH 4PJAA 2M1KA 2UWEB 4LLQA 1KTKE 1T7XA 4L3CA 4NRZB 3BDYH 4Y5YA 1JRHL 4P2QE 4X80H 5IT2L 3LSOB 1N0LA 1EFXA 3GBMH 2DLEA 4YHLL 5BQ7A 4ORZC 4X6CF 4PIRF 5T3ZD 4IRSA 3O6ML 3UPRA 1XZ0B 4FQJL 2Y06L 3DO3A 4K3EL 3OG4B 3QIBC 4MJIA 1HHKB 1DL7L 3WLBA 1CDHA 4Y1AB 3SHSA 1W72H 3RZCD 1NCUA 4G6MH 4G5ZL 2JTDA 3ZDYF 2WINB 2J88L 3MRLA 4YXHL 3CJJA 3VG9C 5CEZL 4F15C 1IEAB 4IMLA 4XP1H 4PBWD 4FA8A 3PNWA 1CXIA 5EZOH 4TUKH 2DQJL 3FQWA 1BJMA 2DQGL 5IGXL 1JUFA 3BD3A 4XCCL 2I9TA 3MLRL 3ISWA 4Y5XC 3U4EA 1QBAA 4Q74A 4PRNB 5AWNH 4J3VA 4TN9A 5DJ0A 3RQ3A 3I2CL 1UZ8B 3FONA 4ODHH 3MLWL 4MJ4A 1JGUL 2RR3A 1CFVL 1DE4B 2FX7H 3O6MH 1BECA 4FQJH 3VXUA 5J06A 4ODVH 1V05A 5E8OA 1JYVA 4P3DB 4B7LA 1N5YL 3RDTA 3AXLA 4HMCA 4HHAB 3EYVB 2A1WH 2J88H 5CEZH 3V6OA 4JE4B 4Y16D 5D7KD 3PGCB 2X5PA 3CXDL 4FZEH 2DBLH 5JHLH 5L8LB 2VH5L 3LS4L 3IDUA 3RIFF 1KCUL 3IU3B 5IWLC 2ADIB 4XPGH 4HIHA 4XCCH 3MLRH 3U4BL 3BHBB 4MJ5A 5GGUB 1NUDA 1F8TL 4JO2L 1LEGB 1Q9WB 4LSQH 5I1GH 4JFQA 4FHBD 3MLWH 1BQHB 1IKFH 1CFVH 4HGWB 4KVCL 1LO4L 3BPLB 3T1WA 1H5BC 5LQBL 1LO0L 5D5ME 3VFMA 4ZDHB 1FZMB 2CUHA 3PL6C 3MBEB 2X4OA 5DRWB 2BSRB 2J5LB 1CLOH 4M1CD 4UDUA 1EA9C 3OF6D 4MQTB 2ZWLT 5SWQB 1F90L 5ECJE 4QHUB 1JCKA 4L4TD 5E70A 2G5RA 4XRCA 2CKBL 1IFHH 2YZ8A 3SQOL 4J12A 3QUYD 4D8PB 4MYWB 3LS4H 5ETUB 3MLXH 2OQJB 4MA3A 1CT8B 1DUYB 5FGCE 3QWOA 1EBPA 4Y2DD 4GQ9H 5GIRA 4ISVA 1CG9B 3LEXB 4G9FB 3UMTA 3PJSB 4QGYA 3HCVB 4ZO9A 5TE4L 3U7YH 4LVOB 3K7UA 2J8UF 5LQBH 1CE1L 3VGAC 4JQIL 3HS0B 3VW3H 4Z7UB 1XGPB 5DGQA 4Z8FL 4MD4A 4XPBL 1JIBA 1G7QA 2YN3A 4S0SD 1FLRL 4QHNB 2FJGB 5CKAA 1YY8B 1OCWL 5KVMC 3VFPA 4LNRA 1IM3B 1RIHH 3GMLA 2Y5TB 5JPNB 3LMJL 2IPTL 2QADB 1IGIH 3O2WL 2EKSA 3S37H 4QHLA 4PJXF 3UBXA 3QISA 3NOIA 2VOTA 2EYSB 5I75B 3HHRB 4YX2L 5HHOB 5CHNA 4HZLB 1WF5A 1XF3A 4I0PA 2GSIB 1QD0A 2AK4E 3L3OA 1BAFH 3DURA 1T5XA 1NLBL 5M94B 5L88L 4UUJA 2DMCA 1TVHA 1QKZH 2ZG2A 3O4OB 4R96B 1JPFB 1ZMYA 2JK5A 2CLRB 4Z8FH 5CGMA 1EGJL 1I9JH 5JHDE 5E8DH 2X9YA 2V5SA 4QRPB 1UXSA 1A6ZA 4QRTA 5MI0B 1WV7T 2Y07H 1KN2L 2KH2B 3LMJH 2IPTH 2COQA 4M93C 4DVRH 4LCWA 5E2VH 2HT2C 5D1XA 3BN9C 1GOFA 3D69B 4HS3B 1S9YA 1I85A 4G9FD 3BW9B 4K71C 4MX7A 3QEUB 4HK0B 3U46B 3O3BA 2WIMA 3BGFB 3KDMB 1OTUC 4ZUVA 4Z0XB 5KVEH 1MHCA 5GHWL 4ZPTA 4U1NB 1NLBH 5L88H 3R0NA 3F6IA 5AUMA 5MERB 1KXQE 1SY6H 1W72B 3I3BA 4Y0GA 3HLAB 3ARBB 3TESA 2IQAA 3MA9H 5C0FA 5TPWL 5JO5A 1FCCA 2EDYA 1A7BA 3BKCH 4WI5A 5IM7A 4MWFB 4NBXB 3HI5H 1ZGLM 3VXTB 1EGJH 1HYSC 3KWWB 3KYMA 3IKKA 4HD9A 5IV2A 5EU3B 2XWJA 5HYJE 5I71B 5L2KE 3Q5TA 3G5XB 3NA9L 4U6YA 2QADD 4KUZH 4MCZB 2YRLA 3WL9B 1S7VB 2UZYB 3CSYA 1U9KA 1KN2H 3KPPB 2AS5M 3C6LB 2CDFB 5FAAA 1A7NL 4DKFL 2DL2A 4RQQB 4HWEL 3BZDA 4PY7B 1IBGL 1R3IH 1QSEE 3TP4A 3PWUB 2VLME 1C5CH 1JI1A 2VLRA 4WENB 1YEEH 3RKPA 4UAOB 4BZ1L 5DVLA 5GHWH 5ICZB 1ETZA 1WT5C 3MV7A 4PJ7A 3IAQA 4LRIA 1CF8L 1BF8A 1NCAL 5TDOA 1SBSL 4XGZA 1NFDE 3DSFL 1MCJA 2B4CL 5AEAA 2BC4B 2MQ0A 1K3IA 1ZLWK 3BJLA 3BPOC 3MV01 4BZ2L 5TPWH 3FB5A 3A0OA 4KK9C 5SV3A 2GCYA 2VERN 3MV11 1MEXL 1WBXA 3RU8H 1IGFL 2GSGB 3TBYB 4BUHA 5FM5M 3NA9H 4P5TB 1L0XA 5EN2A 3TBTA 3BKJL 1WBYB 3RL1A 1FSKB 2HT3D 1NUNB 4UNVA 3V6BR 3TNMA 4OZIF 2H2SC 2WM0A 3DROA 4U6TA 4R7DB 2JB5L 2VLKB 4XCEA 1FYTA 4JAMB 4Z7NF 4NNPH 4YHKH 1RSFA 5KSUA 2OM5A 5KSBF 4O58H 4Y4HC 3WFHB 1HSAA 3AS0A 1JVKA 2HH0L 4E5XA 2FEDC 1ONQB 4O5LH 1R3LA 1X5JA 5GS3A 3DSFH 1FCGA 3OR6B 4MD0B 4PG2A 1WQVT 5CUSL 2B4CH 1YEJH 3GSOA 4YWGL 3ARYA 3GFUA 4BUGA 2YKLL 2HJFA 1DBMH 1YMMB 4OZFA 1MEXH 3VGFA 1ADQL 3DVNA 1GGTA 3CH1B 3I50L 4YHNA 5J11B 3ZHDA 4P23B 1Z3GL 5EC1A 3MODL 5IBTH 4ELMA 1KLUA 3JTTA 4JGMA 1D5MA 1P4IL 1D9KC 5E2UL 2EXYC 3O6FB 1ERNA 3VU2A 1HQ4B 4NUGL 5EDXA 2BVOB 5JIHA 4K9EC 1MH5A 3W0WE 1F13A 2HN7A 1D5XA 3PWJB 1V3JA 4TPRL 2HH0H 1YEDB 2X41A 2JCCB 4LBEA 1ZLWH 4J4PD 4MZ2A 1GC1C 4OQTH 3VWJD 5CUSH 1HI6A 5CS7A 3BAEL 4U0QB 4ZXBD 5ITFB 3QWQB 4P5TD 1DFBL 2YKLH 4NQEE 3TLRA 3BSZH 1BGXH 3VXOB 3QULA 5JQ6L 1JNNL 1HYRC 1AD9A 3MUGB 1GCFA 3GEWB 3S3JA 2R1YA 1SJEA 4L4JA 1K9TA 3MNZB 2PXYA 4HKJB 1MI5B 5JA9A 1Z3GH 3MODH 3HPJA 3WO3B 4YBQC 3GBLA 5J0BA 1Q9KB 3SDXE 3GJEA 5JIPA 1P6AB 2P1YA 3MRIA 3X12A 4UZGA 3LCYA 5E2UH 1AI1L 5INDA 5CBEA 3VXRD 3A6OA 1DQQB 5FFLA 1YJDH 1ORSB 2NY3C 4TPRH 1OTTC 3EYFA 3VFNA 1KJVA 3N1QC 2PYEE 3QG6B 2XZQL 1YMMD 5EZJB 2VISA 1EDQA 3SCMC 3V9FA 4P2QA 1T80A 2IGFL 2A9ML 3FB8A 3NAAL 4NFDA 1JNNH 3KPQB 4JKLA 4YH6A 4F9LC 2D31B 2YPLE 3UTZA 3GSXA 3WFEL 3SDDC 1WBZA 1RZFL 4S1QL 3C8HA 2EIDA 4PD4K 3BIKA 3VGHA 5E1HB 2NTFA 1DLHA 3WE6B 1AI1H 1Z0MA 2XKNB 4OIIH 3BQUC 2W0FB 1HE7A 1JL8A 3BH9B 1X9QA 2KZWA 4K2UH 5FOBB 2GTZB 1IT9L 1F3RB 5HHXL 1F45A 5ID1A 5FYJU 2HLAB 1M6OB 4GBXD 1GGYA 2XZQH 4JFFA 3V5HB 1I7TA 2OTWB 3C60C 3G04A 4BH8B 4F9PC 2NPLX 3VXPA 3HR5B 2IWGA 5IW6B 2A77H 4NO0A 2DJ4A 1M05B 5FF6A 4D9LH 1KC5H 3QIUD 1MI5D 2APVA 1DCLA 1S8DB 5E8PA 4RMUA 3WFZA 5T1LB 4O2CB 5FO8B 1VB9A 4LPTA 5F7NC 1OW0A 3NABL 4PTUB 3FO0L 4MSWA 3BVNA 5D1ZB 2GW5A 1RZFH 4P2RD 4RRPG 4S1QH 4R3SA 4JREB 1MIML 1DBJL 3WJJA 1FFNB 3TA3A 1DVFD 3GMPB 2V2TB 1JI2A 1U8JA 4LCCC 1U91B 1A7PL 1ZEAH 3AREC 4RDQG 15C8L 1SEQH 2C1OA 5SWZD 1C5BL 4POZD 5L7XH 1WIUA 3B6SB 1CS6A 4BQCA 1OARL 1R3JB 2ZKHH 5BJTB 1D3CA 1ACYL 4LPCA 2ZNWA 2NY0B 3WJLC 1CICB 1RURL 2YUVA 4K94H 1I8KB 1UGNA 5F93C 3OKKB 2YHGA 4O2FB 5D7SL 3NABH 4Z95L 4NO2B 2H3NA 2I26N 4OLWH 4KI1A 5FYJH 1UJ3B 4PB0H 4AZ8A 4TSBH 3KYKH 5E99H 3PHSA 3D5OF 1MIMH 5FDWB 3WD5L 1FV1A 1FPTH 2BY3A 4MNGE 4X7DC 2M26A 1A7PH 4JY6A 2HTLD 4XVJH 1X5LA 1S9KC 3NCEB 3EDJA 1NCWL 1OGTB 3CDFA 2BY0A 4M5ZL 4NC1C 1CXKA 4PJXA 3LHPH 1FIEA 1OARH 1PKQB 2EDJA 3QQ4B 1JV5B 2OS7A 1RJLB 4KGLA 4PRPD 5BW7C 2ZSWB 4MVBD 1MREH 4KKCC 3K0WA 2JIXD 1T5WA 3H0TA 2H26B 4LSRL 4LLMA 3CVHL 1NH6A 3HC4H 5CD3A 1RURH 5D1ZD 4H8WH 1J0ZA 2P47B 2XTJD 3DJ9A 4Z95H 3MREB 2GK0B 3E6HB 1MRCH 35C8L 3C87A 3HUJE 4CMMB 3S6CA 2EDXA 2W59A 3MJ7B 1H8NA 4GMSH 3MLVH 4G8EB 3C09B 4ZPVA 4FQQB 3FQUB 4L9LB 3WHE1 4XXDB 2ADJA 5B39G 1ZLSL 3EYQD 4I5BA 1M71A 2PNDA 3D18A 4M4PA 1FRGL 1NCWH 3FB6B 4YDVB 4EXKA 3BEVA 4Y4KB 2NY0D 5AYUH 3MCLL 3CU7A 5C0AB 1QG3A 2HP4A 4G9DA 5EO9A 5KSAB 1R5WA 2EE2A 2ZUQB 5TQ2L 2AK1L 1A3LL 1G6RL 2BXYA 4UTAL 4XCNB 3D85B 5FO7B 4H25A 35C8H 3CDYA 5IVOA 2BNQB 3U1SH 3QAZB 1FORH 1MIEH 4M7ZB 1BZ9B 1GSMA 3RJDA 1YYLH 4YO0A 4PJ8D 3SDAC 1F11A 3FQXB 3L3JA 1ZLSH 3LOWA 3MV9B 3QUZA 1I1RA 5IJKC 1FRGH 4ONOA 4ZTOH 3EO0B 3EHBD 2PW1B 5C9JB 4K07A 4LEOA 1UA6H 1R3HB 5F88A 2ID5A 3OQ3B 3DLQR 3BZ4B 2MHAB 3IAGC 5MENE 5ACLA 1AIFB 5TQ2H 4PGDA 1G6RH 1SMAA 5KS9E 3VXNB 3QUML 1D5IH 3VXME 4WIQA 1IZJA 1WCQA 3MV8A 1IKNC 1SVZA 1YYML 4X8JB 2AJSL 4YDLB 5CJ8A 5ILTL 4R4ND 3MRGA 2HT4C 3MFGB 3GMMB 1WWAX 4OUUA 1YNKL 1FG2A 5C0AD 4OZIA 3SY0B 4LSUL 3PWPD 3QHZL 1RJZA 3QNXA 4OI7A 2IFGA 5KSAD 1QSEA 3KPNB 3QDGE 5GS0C 4WFGD 3ZTNL 4OF5A 4TNWK 5CJXA 3CC5B 3GSVB 5D6DA 2DKSA 3D85D 3MNWB 5B4MD 4XVSL 3RZWA 4HMEA 3S36L 4HUMB 1W0WB 5T3XE 1VSCA 2H32A 5E6YA 4X4YA 3QPQC 4IIQB 1NFDA 1RIUL 1GZQB 4PS4H 4P4RB 5HDBF 2NLJA 3QUMH 5FHAL 1INQB 3KJ4C 1YPZB 5BS0D 5BZWB 1WEJH 2ICWI 4Z7VE 4HCRL 5ILTH 2YD3A 3L5IA 5IKCA 3HE7B 2YXFA 4JDZB 1WCBB 1MCOH 1G1CA 3MLUL 5E2WL 4YXLL 3ARGC 4PR5A 5GS1B 4WFEE 3S35H 1JMZA 4LSUH 5ANMA 1U8KB 3UTQB 4BJLA 4QNPE 1AP2B 4JZOA 1XGRA 4P9HC 2AXFB 4PRHB 3QXVA 2EYRA 1J0IA 4HS8L 3MRPA 3ZTNH 2X70A 3RIAF 3TGXA 1HQRB 4U6HB 3S36H 5L9DL 3O0RH 4WO4D 5LGJB 5IB4B 2VUOA 4J1UA 1ULVA 4HJ0D 3SO3B 4BQ6A 3RI5F 3GRWL 4UBDC 4LSSL 1RIUH 1S9XB 4ONFH 3MA7B 1OSZA 1BQLL 4S10A 3QEQB 5EUKA 5FHAH 1XIWD 3V5KA 1UB5B 2R69L 3HKFA 3H9HA 3ECBB 2D0FA 4LFHD 4HCRH 4KK8D 1DBAL 2HFFA 5SX5K 4LSPH 3U2SB 4ZO8A 2EDFA 3OKLA 2IAMC 3IYLW 4JY5L 1JTPA 3MMEB 4ZTPH 1LDPL 3RHWK 1U3HC 2FX8L 4I3GA 4LF3A 4DGVH 5HHPB 1RUQH 3F8UB 4JFDD 3ILPB 4IOFD 4RGNE 4HS8H 4PJGF 5GSVA 5JTWA 5IR1B 2JB6B 4X0KA 1CFTA 4JRYB 1OM3L 3EZJB 4X5WA 1E4WH 5F7EL 1G7MB 1U8HA 4WGVB 3H7BA 3GRWH 4WTZA 4LSSH 1MRFH 4RAUB 4CU7A 5F1KC 5C2BL 3VFWA 2R69H 5MEQB 3HE7D 4LNVA 5LXGL 4ZODA 1OOAA 1QA9A 3NMEA 4EDWL 4NIKB 3LDBC 5AD0A 1CZ8L 2NY6C 4NQSB 5DRXA 3IFNL 5FXCH 1LE9A 3CCHB 1GIGL 4JN1H 1LDPH 2WLYA 4PRHD 3SDXA 1N7MH 2FX8H 4UB0L 1QFPA 4KJPD 1B6DA 1DQDH 4ZSOA 2VXTH 3PL6A 1U8PB 3O9WD 4ZFFA 2HG5A 2CDEB 5FYJD 3FCTB 2DYPB 3T0WA 2XA3A 4RDQF 3HZKB 1IAII 4CMHC 3CZJA 1OM3H 1IC5H 3QEQD 3ULSB 2VKXA 4NYLB 2Y6SD 1QRNE 5E95B 4YE4L 3G5VA 1BLNA 1AO7B 1I3RB 4ONGL 5A40E 5F1NB 3WIHH 1NDGA 1RHHB 5SX5H 5LXGH 3HB3D 4IOIA 4DQOH 4NZJA 4EDWH 4QO1A 3CSPA 5DZLA 2AVGA 1CZ8H 3OKOA 3P4NA 1B0RB 2VXQL 4FP8H 3IFNH 2K3TA 4XBEL 4QRQB 1NLDL 3VWKA 5TF1H 2FGWL 2V5YA 1L6ZA 2PCPA 5EOTA 4DKEL 2BVQA 2AJUL 5BVPL 3MRKB 1WWWX 3FHAA 1G6RB 5HD8C 5C7XL 5H2BB 3PV7A 4ORGA 4YIQB 3MR9A 1U8NB 5KSVA 3EO1A 2EH7H 4XAWL 3LKRA 5CJ5A 4KMTL 2Q7YB 2OZ4H 3AVEA 3P9MB 3O3EA 3RWHA 1EH9A 1A7RL 5D2LB 4O9HL 3OB0K 2DLGA 3RBSA 3CVIH 1FFOB 4JFOA 4DEPB 4YE4H 4KQ3L 2AEQH 1QFWM 5IVXF 1JWSB 3AM8C 1D6VH 4WCYL 4CNIA 3W11C 1OB1B 2VABA 3PWLB 3WKML 2CO6B 1F4YH 5DJ8B 3OJ2C 4L4VE 3B9VA 3VGDA 5C09D 3TIDA 2VXQH 4HUUB 4ODXA 1XGUA 2D2OA 5C6TL 5I15L 3MOBL 1F2QA 2ZPKH 3MCG1 4XP6L 2A74A 5DHVA 2EDEA 1KF9B 4GRWH 1JPSL 2RBLA 4ZNCD 3QIWB 1JGDA 5C7XH 1MCBA 4OGYH 5IQ7L 1FNEA 4PGCA 3NPZB 1MFEL 4JHAL 2ZUXA 1HN1A 1N2RA 3IXAB 3PP4H 4XAWH 4HWUA 1N59B 3QUMB 5GSRB 4KMTH 3QH3B 4L29A 5K93A 2JJVA 4W4NA 4O9HH 3SGKA 3GMQA 5D1QB 4NT6A 4IRJD 1F3DJ 3EYUH 3TO2A 4KQ3H 5EUOE 4PRIE 1P4BL 1MJUL 4Y19B 5DUMH 1U2HA 4LCUB 2XA8L 3NFPA 4KKBC 4YHIB 4K55A 2VC2H 2WNGA 1PLGH 5EIIA 4XNQB 4GG8B 5JPMB 3KR3L 1UH4A 3FB7B 1KCSL 1CDYA 2QSVA 5C6TH 5I15H 3JWOC 3MOBH 3LKNB 5I6XB 2LAGB 2CSPA 1ZSDA 2FJFB 4ELKB 3CXHJ 2Q8AH 5HPMB 1U8OB 1VFAB 5IROA 1I8IB 3OB0H 3H9SA 2K7QA 3MRNA 3ZDZE 4DTGL 4GAJH 3TIEA 2NXZD 1F6AB 4KROB 3GSNL 5GGTL 3RIFK 4HFUL 4LOUC 2QLVB 2ZCKH 1VGKA 3O11A 4PJEB 2XA8H 4PJ9B 2AI0L 3UYPA 2HAZA 3E3QC 4PV9B 3QRGL 3IGAB 5KOMC 4Y5VA 3TO4B 1PZ5B 1J1XL 2EDKA 4YK4C 2R0LH 4LGSB 1B0GA 4EI5C 4PLKD 1V7MH 5DRNB 3HUJA 4NFCA 1KCKA 4YDJB 1ZA3B 4N9OB 1I8LA 1T4KB 1ZT1B 4JJ5B 2WBKA 5HHMB 4APQB 2FD6L 1G9NL 3Q6GL 1EEZB 4L3EB 5D1QD 4GH7B 2UUDK 3DUUB 2BVYA 3BMVA 4DTGH 4X9BA 3GMNB 4HULB 3P40A 1MFDL 3QDME 1IL1A 4HFUH 3ARQA 1E6JH 4N68A 1JNHA 4AIZB 2R2EB 2X4PB 3ESUF 4R4BA 3UTTD 1K2DA 1UVQA 1NC4B 1S7RB 1P7QD 4K8RL 1OAQH 4X98B 4NCC2 1MFNA 2F54D 3TYFA 3CX2A 4WUUB 1PSKL 2V2WB 2RJMA 1KPUA 1TPXB 1Z9LA 4H1LG 2X09A 2FSEB 1B90A 3QI9C 4WHYG 1I9RH 3T0EC 3KJ6L 2ZCLL 5FUOH 1G9NH 3TCLA 2HKHH 3NTCL 3BP4B 2YBRA 2FYYB 3SKJL 1K4CB 2N56A 4IDJH 2VXSH 5DUBB 4G8GA 2P5EE 1AC0A 4KROD 4KRPC 3HNSH 3O6KL 3MRHA 2R4RH 2ITDB 1U95B 1H0DB 5BO1H 1MFDH 3MBXL 4TVSa 1JF5A 3N0PB 4RISL 2VITB 1A6VL 1U8MA 5MENA 5DDHB 4ZYKA 1EVTC 5C1MB 4LHJB 4KDTA 4AJ0A 1G7PB 5D7IE 5F9WB 4ODSL 4K8RH 3I9GH 3H8NA 2XFXA 2XXMB 3VI3E 4I1NB 2DQIL 5KS9A 1PSKH 5EO1B 1KACB 4I18C 5F9OL 3VXMA 3MXWL 2B0SH 2XY2A 3NH7L 4P2CG 4RZCB 1I4FB 1P2CB 4KJQC 1E4XL 1I1AC 4JPIB 4L3ED 4X5XB 2QEJA 5IB5B 2UUDH 3KPRE 4AEHH 1DBBL 3NTCH 5IBLC 3ULVH 3O41A 4JG1H 1G9ML 2FH6A 1UC6A 1IGML 1GHFL 2EXWD 1QTYT 3O6KH 4NHUB 2ZZUT 4GKZB 2AEPL 2ERJC 4WWKB 5IVZA 2DQDH 4C57C 1HHGA 2NR6D 4GLRH 3MBXH 4G6KL 1JRHI 3PUCA 5DGRA 5IVNA 3GKWH 4AQOA 4N0UA 4RISH 1ZA6A 4XBPA 4XWOC 5TGBA 3V4VL 3KPLB 3TT1H 1TJIL 4DFHA 4ODSH 4PGJA 5F9AC 5IEHB 1BFSA 1JHKL 1L9NA 5A2FA 3NFNB 1QNZH 1EX0A 4NWUL 3C8KB 4GRWB 4WHTB 5FCSH 1JYWA 1LD9A 1U0QA 3L5WB 3MXWH 2AJVL 5KVFL 3NH7H 1SMOA 5JR1L 2XZAH 3WUWB 1ZS8A 5BXFA 1DBBH 1AGCA 5IG7B 3O2DH 2OJZL 2A0LC 3SJVD 1G9MH 2J7LA 5HVGB 2VDMH 1IGMH 4HBCL 1GHFH 3ROOA 2BSSB 1BVKA 4L8DB 3VGBA 2AEPH 1NMAL 4KPHH 1U2CA 43C9A 2GJ6A 4M1DL 1CI5A 5IMLA 4GRMB 5D7LE 4PJFF 1OAKH 4P3CH 3V4VH 5SX4H 3TZVB 3HFML 3IAPA 1L0YA 3SGJC 2B1HL 4UT6L 3L6FB 4JFEE 3IJYB 3IVKB 2QL1A 1JHKH 3SEPA 5EA0L 5GZOD 3M45A 5ADOL 4X4XA 1DLFL 2H9GA 2F5AH 3B5HA 4QXTB 3QG7L 3S5LB 1IGCL 5EU6A 3TBSB 3FFCA 4XAKD 3WFCH 1I8MA 2AJVH 1QOKA 3F58L 3UTSB 5KVFH 1FVCB 1Y0LA 1IMHC 1PYWA 3ORJA 5JLZB 4RMQA 1VGEL 5AAWA 5DLML 5DJCA 4D0BB 5JR1H 5C0DA 1SEBA 4MDJA 2EKJA 3CFBA 1AHWB 3DETD 2I9LA 2FR4B 5D5MF 5DJ6B 4HBCH 5CZVH 2NW3A 1VPOL 2FCBA 3AMKA 3EUUA 1NMAH 2DTSA 3IRPX 4X6CB 3V8OA 4S1SH 4NO5B 3QCTL 3BZEA 3F7PC 2YD7A 1KCRL 4JY4B 3VFTA 3VRIB 2OMNA 3D2UA 4KQ4L 5FKPB 4XPFH 1V7NH 2FBOJ 3OKMA 4P2OC 5K59F 4MAYD 4LHUA 5CP3H 2B1HH 4LCCA 2NNAA 4N5UA 5H35B 1U8LA 2X1WL 4UV7H 4CADB 1FYTD 5EA0H 1FAIL 4EEEA 1T66C 3BPLC 5ADOH 1TVBA 5LAXA 3GK8H 2QSCH 1DLFH 2G2RB 4WV1B 4YC2C 5T1KD 1CDCA 2J8OA 3V4UH 3QDJD 4QTIL 5EZLB 1BQHG 4FXGB 4XHJC 3MBEC 3F58H 1UB6A 2J5LC 4HSQA 3QEHB 5MEOA 1RFDH 2APFA 3RY4A 3B9KB 1VGEH 3KNBA 5DLMH 1KV3A 1YMHB 3RPKA 2APXA 2NMSA 3ARPA 2Y36H 4CVUA 3T2NL 3BP6B 1EPFA 3GSNB 4Z78A 4S2SB 1EXUB 3MZGB 4KI5E 3TBWA 5L0QC 4LLUA 4NKDB 5A43C 5GXBB 4FG6D 4CUCA 2VR9A 3D1MC 1KCRH 4NDMB 4AG4L 5EORH 3VG0L 1TETH 4OD2A 4OD1H 4HKXB 4BK4A 3PDGA 3A6BL 4C58B 2FWOA 4D2NA 3P73B 3V95A 4LVOC 1QRNA 5C0BD 3X17A 3ARFA 2WBJB 1MCHA 2P24B 3I6LE 5IVXA 1UG9A 1P4LB 3OKNA 4TUOB 1EZVY 1RK1A 3EFFA 3WNMA 3LIZH 1U92B 3HG1B 3RVWC 1KFAL 3DX7B 1U42A 3NA4A 1FO0A 1ZHLA 4KDVA 4U0RB 5I8KL 2C3HA 5F3BA 3FT3B 4LLYB 2FO1A 1T03L 1ZHBB 3OR7B 3TN0B 5J9PB 1FIGL 3FO9B 4IS6B 4X6DB 5E94B 3SDCA 4LKXA 4J3TA 3WDHA 5C0RL 5CEXA 2F8XC 3LKOA 2W9LA 3GSUB 4S1DD 4D0CB 5I75C 1LE5A 4KRL