5CEXB

Crystal structure of fab 32h+109l, a putative precursor of the pgt121 family of potent hiv-1 antibodies
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
233
structure length
233
Chain Sequence
b'QVQLQESGPGLVKPSETLSLTCSVSGASISDHYWSWIRQSPGKGLEWIGYVYDSGDTNYNPSLKSRVNLSLDTSKNQVSLSLTAVTAADSAIYYCARTQHGRRIYGIVAFREWFTYFYMDVWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 9H+3L Fab light chain
molecule tags Immune system
source organism Homo sapiens
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
total genus 48
structure length 233
sequence length 233
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cexB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cexB01
2VXQL 3DHJA 3MFFA 3C5ZB 4LMQE 3QEHA 2VDPH 4TVPE 4XNUH 4GRWF 5T1LA 4PRIB 2FJGB 5DK0B 5T3ZE 3D18A 1U8HB 1W0WB 4GRMB 4HCRA 1BEYL 4WV1A 2BSRA 1IQDA 1ZLVK 3KVQA 5ADPL 5F9WB 5IMKB 1WZ1H 3QDGB 5DK2A 2DI9A 5MEOB 1BFTA 2X4RB 1LEGB 1X5JA 1I8LC 3NCJL 4FXGA 3U7AA 4DUXA 2CJUH 1WCBB 5HYSB 5LWYH 2ITCA 1RQ5A 2JLLA 4PJ8B 4JKLA 5C6PB 4OD1H 1U3HC 5GGRA 4XVUC 2CDEA 4YAQA 1MLBB 3T2OA 4BH7B 2E7BA 4P5KB 5JQHC 4RBPK 2VWEE 4DZBA 4X6FA 1YEKL 1QNZH 2UY7A 5AYUH 2YEZA 2HFFA 1UCBL 3W81A 1HINL 2YPLA 3KPQB 4PJHA 1UCTA 1H8SA 4NBZB 2FL5B 5TQ0H 3VGHA 5IOPA 3H3PL 4UTBH 4JFDD 2JB5H 4JY5H 1DBAL 1L6XA 1UZ6F 1UEYA 4X4XA 3WV0A 2VZOA 5DMIL 2ERJC 5T5NG 5J12B 3KNBB 4GOSA 5AWNH 2OR9H 5C0EA 1AFVL 4J23A 4LRNL 4M6MH 4I9WD 4CW1A 5EPMA 1RD6A 2B4CL 2E7LC 2NNAB 3KPSD 4MJ2A 4Z78B 2LU4A 1J7VR 4GAGL 4YXLH 2VJXA 1PX4A 5F6IB 2VH5H 3KPSA 3LPFA 5BXFB 3O3DB 3QEGH 4GW5A 3T77B 3MRQA 3QQ3A 4L8BB 4ZG1A 1E4WL 3MO1A 3QFDB 5FM4A 2JKXA 4XVUD 1ITCA 1MI5E 2NY6D 3QZWG 1QSED 4NOBA 1TQCB 3SDAC 1JPTH 4PJ8C 4GXVH 3VFRA 4LLVA 1RJZB 2JK5B 4PJFA 4MNQE 5B39A 4J6RL 4KI5D 4HD9A 1IM3B 3ARSA 5IMMB 1DQJB 5I1AA 3QXAA 5I1CH 2BOCB 1D5IL 5F9WC 4GRWE 4OLWH 2H26B 3OKMB 4Y5YA 4HKBA 5C0ND 4X9HA 4H1LA 1JPGB 3QT2A 3GSNB 3SDCA 4NO0A 2Q8BH 4Y8DC 5F6IC 4GAGH 5GSRA 4Q2ZB 5HVHC 4PJAE 4MS8C 5DDHA 4MYWB 2HVJA 3MJGX 4DN4L 2PYEB 1UM4H 3D2UA 3U4BH 4JO2H 3MCKB 5JIPA 5L0QB 4M7LH 1FL6A 3NA9H 4LLWB 4KKBC 2AV1B 3MX0A 1H3GA 1IM3A 3MTRA 3RGVC 3UXFA 3CC5B 1F6FB 2CDEB 2YKLH 3KS0J 1SEBB 3ECBA 5KS9E 2FX8H 4QRUA 4DTGL 5H8DA 4NZRH 1FVEA 2V7HA 4K23H 2YXMA 3DMMC 3HNVH 2B2XH 4U6XA 2IPKA 5CJQL 4U1IB 4FQLL 3PABA 3ILQD 3FRPG 3E0GA 1JGDB 2BSRB 5F1IA 5GS0D 5K9QI 1S7VB 3MA9H 4NQCA 5DC4B 3WFEL 2B5IB 4JRYE 2P8PB 3KJ4B 4JGMA 2A74A 5D93C 3FQTA 4R2GD 3Q1SH 1GHFH 5MEND 3OX8B 3RA7L 1I8IB 3R1GH 4OKDA 1QLRA 4MD4B 5D6DA 3IAGC 1NGYB 3L3HA 2QSTA 5IHUH 5JW5A 3PV7A 1JL8A 2OTUA 1FBIH 2P8LB 4JPIB 3NA4A 1FYTD 3EYVB 4QLRA 2VQ1B 5FA3A 4Z7UA 2PW1B 2VDPL 8CGTA 4IRSA 1LP9E 1F4YL 3QJHB 1RJZA 4PJFB 3ALWA 5J1TC 3QDHA 5DJCA 3UTTD 3VXTA 2GEEA 3VFTB 2HAZA 2R0KL 5D1XD 1CE6A 1EFQA 3SE8H 4XB8A 1PG7H 4DJMA 2NW2B 1E6JL 5CGMA 2YR3A 1IBGL 1IKNA 1KTKE 4U6XB 3D0VB 3V5KB 1LQSR 1MFBH 2CKNA 3UTZA 2PUQT 3ZDXF 1MY7A 3G6JF 1JFQH 2P42B 5F9JA 4G8GD 4CBPA 3LKRA 5IT2H 5JDSB 4NBXB 4U33A 3P73B 4MJ5B 1XGUA 2W9DH 4UIMA 4RA3A 4YDLC 3MCKA 1HI6A 3H3PH 3K8MA 4UTBL 3INUL 4KK8D 4AYFA 4BQ8A 2J5LB 2XY1A 2OZ4H 2ZOLA 5CEYB 4PYHA 1YN6A 1QP1A 4Y4FA 3TIEA 4AH2B 2EYTB 3OKMA 4Y5YB 3ARBD 4YR6B 1WC7B 4LOUD 2HP4A 5J11C 3SKNA 4YHMH 3UTTB 5IHBA 3FO0L 3AU1B 2GJ6A 2ESVB 2QJDA 4U6YA 2E7LA 3L1OL 5CWSB 5C0AD 3C5ZD 3NCYS 1A1NB 1U8IB 1XGUB 3LEVL 1WT5A 4XPFH 1BQLL 2R23B 1WVZA 2E5EA 4JQIH 4RNRB 3CSGA 4U6TA 3S96A 3VH8B 4X6DB 3IYLW 1CBVL 1FDLH 2PYFB 1CE6B 5F1OB 1UH3A 1J10A 1DQQA 2HJLB 1G7IB 3K4ZA 3ZHKA 1LE5A 5B3JF 2NXYB 1CLZH 4RFNC 3D18B 2AJUH 1MCOH 4R0LA 3QG7H 4U6YB 3TJHD 1DBKH 2MMXA 5FKPA 5HI4D 1EBAA 1M71B 3SDAA 3EYSL 3HAEB 4I0PB 4JM2F 3FQWA 1ZVHA 4Z76B 5ICZB 1EAJA 1LO3L 1D6VH 4R97C 4OD3H 1JZ3A 2H2SC 1Q9OA 1RUQL 4CN4A 2IANA 4HIXL 1KJ2L 1MRCH 3SGKA 4R96B 1NPUA 3GJEB 5DHYB 4PJCB 8FABA 3ETBF 5E8PA 3GHEH 4HJGA 2FWOB 2XWJA 2WP3O 1MF2H 1DJSA 4N8VG 1AQKL 3QXVA 1G6RA 4LPXA 4QYOA 1G7HB 3WSQL 1XF5A 4ELMB 3THMH 2R8SH 4K3GA 5F9JB 4J7RA 4RFNB 4WIQA 4MHHI 1D6EB 2DM2A 3ZTJG 2H1PH 4OQTL 2YOCA 5IHZB 2WWKO 4I0PC 3ULUE 4BKLB 3NFNA 5EU3B 1NJ9B 5FKAB 4NNPH 5EPMB 5C07B 5T1KB 3Q1SL 1CFVL 4EI5C 1CGYA 1QFHA 2Q3ZA 3F5WA 3DV4A 4X80L 5HGDB 4WCYL 4CMMB 4QRPD 3FQXB 3M8OL 2HN7B 2H2SD 3UJTH 5DQ9B 4N8VA 3I75A 2ZZUT 2Y5TB 4R7DA 5C0IA 15C8L 4PG9B 1FV1A 1EFXD 2D4FA 1JPSH 2JTDA 5K9JH 3MC0A 4KTDL 3C6SA 4WTXA 5I8EA 3ZDZF 1YEDA 3L3GA 1JHLL 3QA3A 4C4KT 2PNDA 4HUKB 3BN9C 3AB0B 4GRLA 1ZGLA 2AJ3B 3QUYA 4KHXH 1RPQA 2IPTH 3ARFD 3IU4H 4HEPG 4DVRH 4OF8A 5GGSA 4JO2L 4O2FB 2CRMA 4L3EE 2AEPH 5JA8B 3O3AB 5TE6H 1CGXA 3FT3A 5KVFL 3B43A 3I6KA 4ESKA 1KTLA 1OARH 4GKNB 4XWGH 2P5EE 2RJMA 1RFDL 5BMFL 1RURL 4EXKA 1YEGL 3MO1B 4FQXD 4HWUA 4UDUB 3SDYH 4LDLB 2VB5A 5E8DH 1LGVA 2AV1A 1I9JL 3BQUB 4H8WH 1YMHB 3FRPA 1J1OL 2ADIA 5A16B 4OF7A 2I07A 2AJ3A 3QUYB 3RBSA 4GAJH 4FZ8L 4FFYH 1D6VL 1Y6MR 1AD9A 3X14B 1KEML 1NKOA 3QQ4A 1DBKL 1CDHA 2WWMC 3LRHA 4NQTA 4JZJC 3CK0H 4HT1H 3BH9A 2PKDA 3QFJD 3Q6FB 4GBXD 4DEPB 3MNZA 4OGAC 4P5MB 1HHIB 1YYLH 1NEZG 2JK5A 3QNZB 4HMCA 1DSFL 3BOVA 2OJEB 4LU5H 2XA8L 2FBJH 4IOSD 5FK9A 4HDIA 4G43A 1Q9LA 5JIKA 1A6ZB 1GAFL 4Y16C 1FGNL 3TN0A 4GO6B 2QSCH 2J1KA 1T1XB 3MV8A 4HIEA 1MCJA 5EIQA 5I73C 1IGCH 1JNLH 2IAND 1PGRB 5DEFA 4FQCH 5IM7B 5E2UH 1YN7B 5TFSL 4S1SL 4XNXL 1DFBH 3FN0L 5DJ0B 4U0QB 2BOBA 3IFLH 1IGYA 4NO3B 1HINH 4L1HA 2F54E 1RIHL 3K80A 3L3JB 4Z95H 1BZ9A 4ZXBD 2EDJA 1RZKH 1DEEB 3C60B 2QADD 4XCCL 1DEDA 4MQ7B 4G8GA 1PW3A 1WBXA 1MCNA 4F8TA 1Z3GH 5T5NF 3BGFC 4I3GA 3VXQA 4LSDA 2P49B 4HIIA 4RMUA 1D5XA 5DMGD 4DFHA 1S8DB 3ARVA 1PFCA 4DUVA 2KDGA 4C56E 3FFDA 2FL5A 3T4AB 3QQ4B 4AEIL 2H2PD 5I6XC 3GEWB 5E9DD 5CD5D 2Z93B 1YYMH 3KPRB 3DX6A 4P2OD 4HLZG 4XP6L 4YDIL 4ALAL 1U92B 4DW2H 3TYFA 1CTNA 5DZLA 4LP4A 4WWID 2FIKA 1UA6L 2ITCB 2NX5E 5SWQB 5FHBL 3MFGB 5HHOE 1S3KL 2AK4B 5HHVL 3NBNA 2ZUUA 3CFEA 2RFXB 2BFVL 1OAQL 5ACZB 2DQCL 5DVOA 2OJZH 4HUWA 1N26A 5E94A 3QQ9C 3BESR 5CBEB 5BVPL 4NCC1 4B7LA 5JXEC 2VKXA 4R9HA 4QNPF 2JJTC 4KDWA 5D5MB 4ZUTA 2WINA 4ZAKA 4NGHL 2E3VA 3NH7L 5L9DH 4PRPA 5F7EH 4BSVB 5E8DL 3TNMA 2ZNWA 3FT4B 4C57C 1JF5A 3TV3H 3BZFA 3O6KH 1LO5B 4JFEB 4OCYL 2ICWA 4YHIA 5DD3L 1GZPA 3WS6C 2B39A 3QHFH 4PG2A 2ATPA 3IJHB 1OF2B 3OJDA 1B2WH 4G8EA 1G1YA 4PLOB 3IS1X 4FXKA 1A7NH 5DSCA 2NY1C 5L8LB 3NGBB 3MUHL 2QADB 1I1AC 1CD0A 4M7KL 5CIPA 4MDIB 2I24N 1MWAH 4J2XA 4P2RA 1V7MH 1AXSA 1ZHKA 4OV5B 4XHJD 4X5WB 3UBXA 4R6UA 4XMKH 15C8H 1BD2B 4JN1L 1JZ5A 4XC1H 2A6KA 2WWKT 1P2CB 4ENEC 4ETQB 2COQA 4P49A 4YBLB 3TCXA 2UY6A 4N0YH 3CFDB 1CZ8L 3F65A 2DN7A 5JLZB 1IEAB 4XNQB 4XAWL 4LF3B 3BZEB 3HCVB 3O3BB 5ANMB 4HHAB 25C8H 3KPRA 1U2CA 3ZZ1A 1MNUH 1I1AB 5FYJD 2APXA 3MROA 5CZXC 1C16A 5JO5B 4KJYB 3NN8A 4UAOB 3RDTB 3BFOA 4YHZL 3FOMB 3LKQA 4NWUH 3MZGB 4LVOB 5EUOA 4NN6C 5IV2A 3C2AL 2ZUXA 3G08A 3Q5OA 3RTQA 4V1DE 3BE1L 2F74A 4RDQG 2AGJH 1CE1L 3KLAB 3THML 2R8SL 1TVHB 1J1OH 4PRHE 3QXUA 5JLZA 3KYOB 2DQIH 1DLFH 3O41B 1UM5L 3B9KB 1MF2L 4OLUH 5FKPB 1AR1C 4KROC 1MCLA 1KIRA 4Y1AA 5J1AA 1PG7W 1NC4D 1P1ZA 3FN9A 4QNPE 3ZT7A 3KR3L 5ETUA 3S3JA 5L2JB 3OAZK 2OQJA 2GK2A 2O5XL 3TO4D 3VGDA 4OCNC 3ULUH 3C9NA 4OZIB 4K2UL 5KVDH 1KIQB 3L95A 3NZHH 4KHXL 5FOJA 2UZXB 2V7NB 5T3XD 4RGOL 2D0GA 2XWJB 3GO1H 5I1GH 5DD5H 1FFRA 5DK0A 2AABL 2GCYB 1S7SB 3GIVA 3C6LD 2VYRE 3MLPA 3ZKMC 1RZ8A 3D39A 4EN3D 1BQHG 2FX9H 32C2A 4M1DH 4OB5L 1IQWH 2HT4C 2MKLC 4PR5B 4P4KC 5CD3B 2FO4A 4JZOA 1MFAL 3SKJH 4J3XA 1BQHB 3TNMB 2ORBH 3BGAA 4ZUWB 2EDXA 3KPTA 5EC2A 5I8KH 4FABL 4X6EB 2EDQA 3SO3B 3FOLB 3ABZA 3OB0H 1YNKH 1K2DB 2CK0L 1FZMB 2F19L 4YX2H 4LVHB 2RAMA 4H8WC 1QEWB 4LEXL 3CGTA 5KW9H 1K8DB 4XVTL 4HBQA 5FO9B 1MRFL 4CDHA 1RUPH 3LKRB 3PIQB 2UVEA 4J3TA 5D6DC 4JFHE 4RQQA 4JDZB 1KIRB 4KTYA 4HWEH 3LEYH 3SJVB 1QSZA 2VLRB 5KBNC 1EHAA 2DQTL 3VWKA 4BFEA 4L3CB 4KJPC 4ONHB 3S96B 5JMOC 4H26B 4IMKC 4PFEA 4N0RA 2EDHA 4YK4B 4IM8A 1EIBA 1NLBH 4XCNB 4ZUWA 1XR8A 3ES6B 4WI4A 1PZ5B 3F12A 3DSFL 1ZGLB 2VXQH 4GW1A 4R26L 4X6DE 1ZV5A 4TTDC 3CFKA 1MUJA 1DTUA 1P9MC 4OCLC 4XMLL 5GGUA 3G6DL 3T4AA 1W0VB 1SVZA 4LRIA 4XXDA 4XB7A 2QR0A 1GGYA 4XBGA 1HSBA 2WUCH 4OD3L 5L88L 4PBVC 4KXZH 4ONGL 5IEKB 3KG5A 4R4BB 2NY5H 1BGXH 4BZYA 1U8MB 3W9EB 5JOPE 4XPBL 1AGFA 5JXAH 2C9AA 4M93C 2BFVH 1FAIL 3ARPA 4ZYKA 4YHYC 3O6MH 3ZSTA 4BH7A 1Z0MA 3L5IA 4IIQA 5BRZE 1L6ZA 3BN3B 2GFBA 1FFOB 1LWRA 3ISWA 1VFBA 4OGZA 1KULA 3QDJA 4DW2L 1Q9KB 4DFIA 1CBVH 4HAFA 1T6VN 3LPWA 5A40E 5EOCJ 4JFZL 4NQCB 5J3HC 1ZLVH 1RJLB 1FIGH 4IHOB 5ABDE 3HG1D 1IZKA 3GKWH 5JZ7D 2DYPB 1IAOA 4E41D 3DURB 3PXHA 4G5ZL 1A1NA 3V9FA 1DVFD 3BW9A 3PL6A 1JMZA 4LCUA 1KCUH 2P7TB 3FONB 3MMEB 4MSWB 4YX2L 4ZD3L 4ZOEA 5CEXA 1WSST 4YE4L 5GGSY 2VIRA 2NCMA 3CPLB 3QNZA 1BQHA 2Q3AA 4M43H 3F7PC 3LRSB 4JE4B 3J8F7 4TVPL 5E8PB 5IEHB 1IILE 3WN5B 1U8NA 2GY5A 4Z77A 4RBPH 2BSSB 3ZYOA 4R90H 1JGVL 4Y1AE 3VG0L 1D5XB 4E42A 4K94C 4JKPL 5GSRB 2IALA 4JJ5B 3SDXB 1P5UA 2W9DL 4Q0XH 2CIIA 3QI9D 4PPTA 5D7JA 1JYXA 2WBWB 5JW4N 2P5WB 3FJTA 3CVHB 4PGCB 3PGDA 5CHNB 4JHWH 4XNZB 5I18H 3SBWA 4XBEH 3E2HC 4M7LL 2H41A 4NKOA 3PNWB 5IMLA 2LABA 3UTQB 4EDXB 2VLRD 4K8RL 4S0SD 5F6HJ 5CMAB 3WJLA 4YGVA 2Z31D 1FVDA 1AGEB 4O00A 1PG7L 3QUMB 3ARBA 3WKNA 5BQ7B 2Z31A 5KTEH 2EDRA 1DQLL 3NIFE 4OLEA 3GM0A 2N7AA 1DLFL 4P3DA 3CU1A 1OCWH 1A7PH 3TLRA 1OB1A 5BOZG 3O0RH 3VH8G 5J6GA 4IRSB 1CE1H 2BC4B 3V4PH 3OXSB 3PGDB 1DCLA 5HYJA 1Y0LB 2VLMD 1FVCB 2XG4A 4LAQL 4LFHD 4QOKE 5EUOB 1JPTL 4B7IA 4L9DA 4F58L 3OAZH 5J11B 4XVJH 4W4OA 4M48L 3TA3A 1QR1B 1CXFA 2LVCA 4MAUH 3FMGL 4UUJB 5HJ3A 1IM9D 3QAZB 5FGCE 4BQCA 3G5XA 5E6ID 4FFVD 1P4LA 3HLAA 1IEAA 5GSVB 3ARYA 3WL9B 2W0KA 3VGEA 5J06A 1WK0A 1T1YA 1NBVH 4C56D 2BC4A 4XNMA 4CNIA 1A7BA 5FYJE 2CGRH 3LS4H 5IW1A 4CVXB 1E6OH 3BPLB 1MJ8H 5JOFA 2VKWA 4YC2C 3LKNB 5J13B 3UBXB 5H2BA 4KPHH 2VZ1A 4BUHA 3DNKA 4PJAA 3NTCL 1M1SA 4NNXA 3HI5L 4KC3B 3LQMA 1A6ZA 2VNCA 3G5ZA 4LBEB 3DUHA 3SO3C 4PJCF 2HKHL 3N9GL 3GI8H 4OZGA 5B38A 2F5AH 2X4OB 2XY2A 1KCLA 2CLZB 3QUXB 4HWBH 4M6NL 2IQAA 4G7YH 1FFPA 1J5OH 4PJEB 4D9RE 5EOTA 2OCFD 5MENA 5CWSA 3BP7B 4DGYH 1VFAA 3H2WA 2NY7H 2AAVA 2EE2A 3OSKA 3QHFL 4OD1L 3HG1A 4MMXC 4JREB 2ICES 1H3UA 1MCWW 3W5MA 4Q74A 2Y36H 4XTRC 4N90E 3QDJD 5EC1A 3I50L 1ZHLA 3VCLB 5F7EL 5SWZB 2X42A 3PGFH 3KPSE 3IETA 3CLFH 3HE7D 1JRHH 1KGCD 5BS0E 4I5BA 4PJ9A 5I15H 3O4LE 3FB7A 3CSBA 3IRZA 1L7TH 1FZOA 2P24B 1NEUA 2Y6SC 1XCTB 2V17L 4Y2DC 1CDJA 1T83C 3DVGB 4K07A 1HH9A 5DF0A 2EECA 5JIIA 1QHOA 2J8UB 3A67H 1RK1B 2WBJB 4TNWF 3HMXH 3NFNB 3QG6B 1QSEB 4MXVF 5E9DA 4EEEA 1T66D 3AC0A 3DX8A 5JORB 5CJ8A 2HJKA 5FOBA 1EVUA 1R24B 4P2QB 4P3CL 1S7WB 1NC2D 2F54A 1A14H 2C3XA 4NT6B 1HXYB 2A83A 3TPKA 2NNAA 4OAWB 5HHOB 4ZSOE 5F7DB 2AK4E 1QQDB 2R2HA 3TJEL 3VXRE 2DQEL 3QB7C 2HJFA 4MX7A 4YXKH 5IIEB 1T1YB 3U79A 3UPRA 1AO7E 3IKCB 3UC0L 4HWBA 3SDDC 3TIDB 1NL0L 4MZ2A 4XMPH 5FYKU 3RVXD 4WFHD 3D9AL 3L3KB 5HYIA 1OT2A 4MA1C 5D8JL 4K3EH 3KXFA 4BK4A 2DL9A 3QXAB 5BW7A 1Q1JH 2YK1H 1WEJH 4MNGA 4UB0L 1TITA 1VGEH 3DVNB 5KAQF 5IR1A 3LEVH 1RJLA 3OKOA 2JIXB 3OKNA 4OLZL 3MRBA 2H8PB 6CGTA 3FO0H 1OWRM 2DIJA 4KK6C 5IF0A 9CGTA 2P7TA 3FONA 4MSWA 1L4IA 1PG7X 1RU9H 4FXGB 4HBCH 3KPPB 4YHOL 3E1F1 2AKRA 1GGBH 5ISZE 1G1CA 4NYLA 4U1SA 5FCUH 3QXDB 4JDTL 2DQGH 4HLJA 3CC5A 1PKQB 1RZFH 5IB3A 1IZJA 1SYVA 1F3JB 1I8MB 3H3KA 1XR9B 1YPZE 4LCWB 4RGNB 1J8HB 2HRPH 1FN4A 2AQ3A 4EQ3A 3LH2L 3NABH 5DHVA 5KSAC 3MLVH 5HY9A 1TLKA 1XCQB 1YEFL 5A2KH 4JKMA 4KJYA 4BFBD 4MXWL 1A7QH 1S9XA 1JE6A 2VOTA 5E24E 4PRPB 4WY7H 2ADIB 4JZJB 1XF3B 5FO8B 1G7JA 4EN3B 3P4LA 4RMQA 7FABH 2I07B 3RX8A 1F3JA 2GSIA 2Y06H 4NFDA 1KPVB 5EWIH 5C08E 3O9WD 2EKSA 4ETQA 4F37F 1U3HB 3H42L 2A2QT 3PP3K 4HKJA 1KFAL 5F8RC 1Q9KA 4PLNC 3ILQC 4G80B 1XH3A 4HUXB 4LGSB 3BE1H 5L2KD 4NM4L 2ARJQ 4KRLB 4XH2A 2DYPA 4PRHD 1G7LA 2EIEA 3MV9A 3BSZL 2BVPA 2QQNH 3C2AH 3QI9A 3MACH 1ZVSA 1JPFA 5CHNA 1HOCB 3FB8A 3LDBC 4QXUL 2QSQA 3JWOH 1HWGB 1ZA3B 1AGFB 1X4ZA 4LPTA 5B3JE 2WBJC 5EOQL 2YPKB 1H0DB 3BP5B 5KANG 3NCBB 5I74C 4PB9L 1H15A 4ZFOL 2YPVH 5HJ3B 3GMPA 1JV5B 2VZSA 1QZ1A 1WC7A 5I0DA 5D1XA 3D0LA 1MFAH 2QQKL 3WLWC 4O5LH 3U48A 2NZIA 1M7DA 2BSTB 4OCMC 1LP9F 1BIIA 1U3YA 1J9CT 5HDQH 2BNRE 3L3OB 1XGTB 4NRYB 3GGWB 2HKHH 3N9GH 2VABB 1FIEA 1Y0LA 5F6HI 2OYPA 2GI7A 4PB9H 1YNLL 3EOAB 2JJVA 3HI5H 3WFDH 4TSAH 3ZE0F 1LVEA 1EEZA 5GGRB 1HCVA 1KCRL 3JWOL 1FSKB 3HI1A 3MYJA 4K2UH 4N9GB 3ZDXE 1R3IL 5FO7A 3T1FB 4I18A 2NXYD 1X5AA 4QXGL 3VFWA 1FNSH 5KSBE 1MCEA 5DD1L 4DN4H 3BT2L 1NBZB 3RPKA 3X13B 1ERNA 2VQUA 4HEME 3I2CL 4UDTB 1TZHB 4MJIA 3VD5A 2Z8WC 4TUOA 5I1KH 3WJLC 3CMGA 2GT9B 1OP5K 4JHAH 3SN6N 4XX1G 1KJ3H 1UH2A 4CNIB 1BBJB 5D1QB 1HQRA 3SGKC 1U8MA 3BQUC 3W9EA 2G75A 2ID5A 5D7IF 4PGCA 3IFOA 3P4OB 5DVLA 3NH7H 2IG2H 4NGHH 3ZKXC 4IRJB 1KF9B 1CFNB 5DQJB 4HFWB 5IJKC 3EJZC 1I4FB 2YD1A 4TVSa 2OXHA 3QQNA 2WQRA 3PWUB 3JWDH 3U7WH 5B3NA 4MJ4A 4S1DD 5IK3B 3CMOL 3V8CA 1EXUB 2PTVA 5C86A 4KY1L 3IDYC 3QUML 1UJ3B 5CSZA 2R0ZL 3GSRA 5TF1H 1CGSH 2EDOA 5ECJE 1OM3H 4WO4B 2J4WL 3WXVH 1ORQB 4LPWA 4PJEF 4RISL 2GT9A 5E8NA 3WJJC 4AG4L 3QDME 3ZTNH 2HFGL 4LSQL 4PY8I 4R4FL 4EKXA 5LQBH 1SJHA 4OCSL 5CEXB 1IGYB 4NO3A 1EHXA 2XTJE 1YMHA 4CN6A 4F37K 4LLVB 5HXMA 2V5MA 3RHWF 3GKZA 3QEQE 1NQBA 2FECI 5DJ8B 3SCMD 5CP7B 1C7SA 3I9GH 4L29B 1ZA6B 3QPQC 4UMGA 3QXTA 5HYJE 4LIQE 1FE8L 1PZUB 3RWDB 3O3AA 2FATL 5CBAB 1Q0XH 3UJJL 7CGTA 3V6OE 2FIRT 4YQXH 4D9QD 4ZQKA 1BAFH 1XGYL 1RMFH 1A9EB 1D5MA 1M05B 4DAGL 1I9RH 2APWA 4M7KH 1JTOA 4WEUD 5CJOH 1C5BL 2EIDA 2HVJB 1E4XI 1SYSA 2HFEA 2MJWA 3GGWA 3MNZB 4RCAA 4XCCH 5E4EB 4NKDA 3BRGC 1A7NL 3FQUA 5AYUL 4R0LC 1FL6B 3GSQA 3WFZA 2EDYA 3GM8A 1JTTA 3VWJA 5D6CB 3OR7B 5JIHA 5JA9A 3IVKB 1G9ML 4X7SH 3TVMB 1LK2B 3QWQB 1YJDL 3ARXA 5D7LE 3O6KL 4WUUD 4YDKH 4YQXL 1DUYB 3S8WA 4PJHB 3ZDYF 4NUJA 1UKQA 4CMMA 1PAMA 1JHTA 5CP3A 4OTXH 5I1DA 4AL8H 3EZJB 1GAFH 3KJ6H 4AENB 2A9NH 3BKMH 3QULA 3C60D 1NH6A 1T20B 3KPNA 5C0BB 3KPPA 1EEQA 4NHCH 2B1HL 4OBSA 5CJ5A 1IT9L 2CMRH 1R3JB 3JV6A 2MQ3A 3IDMA 1DQQB 2IJ0C 4UI2A 3CSPA 4M7LT 2VZ3A 5FOBB 3ARWA 1J11A 2DQUL 4WJ5A 1BVKB 3GHBL 4YO0A 3WFCL 3JZ7A 3W11D 1Q38A 4OSUL 4K94L 5DD6B 5CLWA 2AJVL 4LLQB 4JY6B 5HDBF 4G8EB 5CGTA 3NAAH 4LLUA 5EH1A 2GJ6B 4KRMB 1I9EA 4M4PA 3H9HB 4IOFD 1GC1C 2B1HH 5C09E 3FO1B 5FYKH 5FEBA 3ARTA 2P5EB 4XP6H 1XCQA 4M9PA 5DRNB 4L8DB 3MOQA 2OR8A 3SQBA 2JCCB 4CVWA 1SBSH 1ZAGA 2P43B 5ICXB 3LB6C 3QFJB 2WAHA 5AG8A 5ADOL 5F7HA 1KTRL 1T5WB 4XC3H 2WSKA 3ROOA 1S7QA 3EZ8A 3F7RA 1N5AB 2OBGA 2HA1A 4EI5A 4DQOL 2GCYA 4LLQA 2AEPL 3LEYL 4LARH 3CFDA 4U1JB 3FFCE 5DQDH 2A9ML 3IFNL 3MRQB 3NCCB 3QQ3B 4L8BA 3V52H 3HZKB 3MV9B 1EFXA 2WZPD 2X89D 4JR9H 3DUUB 5IHLB 5D72H 4Y19E 4WUKH 4LDEB 4X6DA 1DLHA 3EYOB 4HC1L 5D5MF 1H3XA 5JPNB 3G9VA 4FNLL 4RAVB 2OX5A 5CKAA 2QSCL 4TQEL 3WS6A 1HXMA 3ZKQD 5CEZH 3W5NA 2GSGB 5FDWB 4ELME 2E7CA 4P2QD 4GMTL 4LHUG 2CRZA 4MAYA 2ILLA 2BNUB 3KLAA 1MIML 2W9LA 1DANU 2F5BH 4LVHC 1KB9K 3RWCA 1IEHA 4TRPH 3VRLE 4HT1L 5HY9B 1FZJA 1TDQA 1CCZA 4LLDA 4OFYA 4CGTA 4QRQA 3ULVF 1KJVA 4RZCA 5DD5L 3S88L 4F57L 4LCYA 2BVQB 3CDGB 5D71L 1A5FH 3AY4C 3WS3B 2CKBL 4UV7H 4W70A 4XCYA 5FF6B 4LVNB 2WV3A 4GG6B 4LSTH 1PZ5A 1OY3B 4M03A 1DBML 1SYVB 3PV6A 1N6QH 1U8JA 4U0RB 1MHPL 1OTUC 3MRPA 3T09A 2C3VA 4MB5A 2IG2L 3CVHH 1FYTE 2IQAB 4PJIE 1URLA 3HPLB 5A1AA 5HYQB 3WIHA 4XBPA 1REIA 3NZ8B 1AQDB 5KVFH 4OFKA 2NQCA 4K7PX 1KT2B 2QADC 1F42A 2YA0A 5EO1A 3JSSA 1OAYL 3VXMB 1FNGA 2MPAL 4XCEA 4Q9CA 5CCKH 5FYJU 1MVUB 1BJMA 3BD4A 3HR5A 3IGAA 4D9LL 4F7MA 5GIRA 3GMRB 5F7UA 2WNGA 5DYOA 1OQOA 4X4YB 5HBBA 5D93B 3H7LA 1ADQL 3VD7A 4PTTB 5E1AB 3SGEI 4M6OL 3GSUA 4H5SA 3LZFL 5C0AA 4XC1L 5JW4R 3IFOB 3W39A 4W6WB 3NMEA 3O6FA 1NJ9A 1PKQA 2HLFC 3W2DH 5FCSH 4NC1E 5ESVA 4TUJA 4U31A 3AM8C 2I9LB 1T1XA 3KLDA 3VXNA 1ACYH 1NEZA 4H88L 1NLDL 4G5ZH 2IH1A 4FQQA 3H9YA 1I7ZB 1X7QB 4LLYA 3L9RB 3VXOB 1JWMA 2A38A 1MCDA 2A9MH 3BEVA 5J57B 1AIFA 4S1QH 1IAIH 1FG9C 4NCC2 5AAWA 4AT6A 4LHQB 2EE6A 3CVHA 2XICA 1OGAE 2XWTA 5I8CA 5C7XL 1E4KA 1M7IA 4JFFA 4PGDA 1QLEL 2WANA 4XCYB 5IVOA 2YPLD 3MJ9A 3QEHB 1KN2H 2BXYA 3X3FH 4U1MB 1KLUA 3TPUB 4W4NA 4UT9H 1JGUH 3O2DA 2R1WA 4HH8A 5I2IA 35C8L 1INEH 4WNQB 4XWOC 3H0TA 2CO7B 1II4E 5L88H 1EH9A 2DL2A 3P0VL 1JUFB 1W72A 1PVHA 3G6DH 2B7DT 4NQXB 1K3IA 5BVPH 4IRZL 1INEL 2QKIA 5LJYH 2YXFA 3FKUS 3OXSA 4OSUH 3MMEA 2EXWC 4JPKH 1V7NL 1HQRB 3IDGA 1LO4L 1LEKB 3WCYA 5I1EH 1G9MC 4GRWH 5DRWA 1LEIA 4PJ8A 2P8MA 4J3UA 5GHWH 3TH4T 3SKMA 5T3XE 3BI9X 5GS2D 3M17B 4PRPE 2ADFH 3V6ZB 5EIIB 5I30L 3VXNB 4LQFL 5E2VL 3T0DA 1S7XB 1R5WB 1DP0A 3SDXF 4ZTOH 3MCG1 4JY4B 4KJPD 1IAII 3TBSB 2ESVA 1VHPA 3TA3C 1BWMA 3CZFB 4XVTH 5KN5A 3G6AB 4G6ML 5D9SB 4WO4A 2EDDA 3D87B 3P4NA 4EI6B 3BWAA 1A6PA 2J12B 4JKKA 1YNKL 4P59H 1GXEA 1ZTXL 3HC4L 3HE6C 5A2LH 4YHML 3L5WB 4RFEA 3ZL4H 3EYQD 3P0GB 4TTDD 2DOCA 4YIQB 5C3TA 1FQ9C 3LMJL 4JREC 3ZDZE 4NN7C 1WEJL 4UB0H 4PJXF 4LCIH 1CTOA 1CLYL 1OTTD 3EDDA 4M00A 4R4NC 1JNNH 1R3HA 5DD0H 4M7JL 1JPGA 4YPGA 4HMEA 3BUTA 3MUJA 3D0LB 3MQIA 2UWEE 5CJQH 3DO7B 2EDNA 1BQUA 5DMKB 3AMLA 4OZFH 4ZS7H 4PJIA 1CICD 1S5HB 3KPOB 4EI6A 3HAEA 4I0PA 3PL6B 4LCUB 3CFCH 4KROD 2AK1L 2XZZA 4FHBD 4LIQL 4PLKC 5HSFA 2YA1A 1YUHB 4G8IB 4WHYH 5JW4M 1DLHB 3O2WL 3LKSA 1A9BA 5IROA 4JO4H 1CR9L 4Y19D 3B2UC 4JZNB 4PJAB 4Z0BH 3UTTE 1NBVL 3B9KD 5MERA 1K2DA 1VDGA 4I18B 4YWGH 4LOUC 5HHNA 5DR5L 2CIKB 1AHWA 2V5RA 1XFPA 2CLVA 3ZTNL 3CXDL 4HKJB 4U1GB 4EQ2A 3U2SA 5TGBB 4MA8H 3QAZC 5GZOD 4GS7B 5K9KA 3FO2A 3C5ZC 3VXUB 4NFBA 4OD2B 1E27A 3EO0A 2R0ZH 3H7BB 2BSTA 3MV7E 4NQXA 2XPGB 3KWWA 3IXAA 1FNHA 1K4DB 3PXJA 1BWWA 3U7WL 2EDEA 4H20H 5F3HB 4Z7WE 5CEZE 1MJJB 1KB5A 5TDOB 2PXYA 4GAFB 4JAMA 1Q0YL 3GMQB 4NWTL 4AEFA 1DL7L 3OXRA 4ISVA 1U8NB 3WE6A 3F12B 2APTA 1CICC 2V2XB 3O6LH 1U8LB 3B9AA 3BISA 4Y4HB 4NQVA 2FR4B 1G7PB 2X4UB 1ACZA 4JFYB 4YWGL 5EZOL 4JRWA 3HCVA 1WFOA 3QCVL 1AKJD 4HPOL 3WO3B 4BSWA 5DTFA 2ADGA 1MREH 3QCUL 4POZC 3BPCA 3DVIA 1VEOA 3OQ3B 1INQB 4UQ2B 3VXTB 4LGPB 2CR6A 2XN9B 1SBBA 3I02A 3O8XB 1KCRH 1XMWA 2DLFL 3I84A 2LE9A 4WV1C 4F2MB 5DMIH 1P4IL 3VU2A 3JV4A 2AK1H 4X6DF 3UTOA 3ARRA 4Z78A 1OHQA 5D2LB 3BD5A 3KYMA 2VLKA 1BF2A 4JPIA 1P7QD 3L6FA 3QCUH 5DSCB 4JJ5A 2LAGB 3MRKA 1XF1A 3RUGA 5FA3B 3L5HA 4P23D 3M8OH 5EBMA 4NKQB 4EUPB 4NQEE 1I1AA 3ARDC 4M43L 2YPVL 5EUKA 3LQAH 2DBJA 3S5LG 3MBXH 3DOSA 3GK8H 1ZTXH 5F70A 3FOMA 4FQPA 4WI8A 1YEEH 1P7QA 4OLWL 4RRPG 2XXCB 3B8SA 6FABH 5ADPH 1A4JA 4NCDA 5DD6A 5HHOA 4NRXB 3UBXI 5FM5M 1Y18A 4RAHA 4LLYB 2G5BB 4A6YB 4XP5H 2ADFL 3S35X 5M94B 1VEMA 3PWPA 4IRSC 5JR1H 2XQYK 3LN9A 5JZ7C 3SJVA 4N0UB 2BVYA 5TH2B 4LLAA 4C56A 2VDKH 1IC4L 4DN3L 3VFOB 3RWEB 2VH5L 4G9FD 1I7RA 2KQMA 1XF3A 3QDGD 3ECBB 1JI1A 2W60A 4OF0A 1XZ0B 3EUUA 2ATPB 3PV6B 2X09A 2ZUQB 3D5OF 3LAFA 5FGBA 5C0CA 3SQOL 2VXTL 3O6FC 2LU7A 3L5JA 2NY0B 1EO5A 1W8OA 4K8RC 4R8WH 1SM3L 1EEUA 1HSBB 4OTXL 1PJ9A 2DLGA 2W59A 2D7MA 3HUJA 3MLVL 3ESVF 4LNRA 1UKSA 1RSFA 4NNYA 1KUMA 5INCA 3SY0B 5EBMB 1ZSDB 4P5TC 1KYOK 2C7UA 2JB5L 4JY5L 4ZUTB 1K4DA 3RU8L 5EU4B 2CDGA 3I85A 1CT8B 2NY0D 1FVCA 3QEQA 1I3RA 1FL5B 2NTFA 2F53B 3D69B 4U1KA 1BFVH 1BFOB 3MRLB 1QNZL 4IBLT 2XKUA 2R2BB 5TDNB 3VFSA 3JTTB 4UINL 3E3QC 1T0NA 4QWWC 5F7DA 3EIFA 4OM0H 4APQD 4LEXH 2L7JA 2MOVA 3MOBL 3DETC 4PGBA 4MAYC 2AI0L 1ZS8A 1XH3B 4HUXA 3X12A 4MLIA 3LN4B 3VMOA 4EIZC 1T66C 1MHHA 4LSVH 3MLSL 1HWHB 5GGTL 4OM0L 3TYFB 4D8PA 5JDJA 1Q9WA 1PKOA 3MGTA 4GBXB 2NTFB 4QXWA 3SDCC 2NLJA 3O6FB 1S9WA 1D5BA 3QRGH 4ZODA 4K8RD 3OZ9H 4JFQB 4F33B 4UTAL 4MVBC 3VE0A 2OTUB 3MLZL 5D96C 2A1WH 4AG4H 1FZKA 2W65A 1RY7B 1TZIA 2VC2H 5HPMA 3RZCD 4KU1A 4PJ5B 4U7KA 3SDDD 1CS6A 2HJFB 4X9GA 3MREA 3RP1A 5CAYB 1MFDH 4LNRB 5KSBA 4KY1H 3GSOB 4K7FB 5E08L 4WW2C 3UTSD 1GOGA 3QUYD 2E6JA 2P5EA 4HF5L 1OAXL 4Y5VA 1ZGLM 5IFJA 3BD3A 4Z5RB 2IMMA 5F1NB 3CFIC 4OCRH 2XWTB 3B9EA 3OGOE 3EYOA 4JKWA 4OUUB 1KG0A 1RZJL 4QHNB 1WIPA 3T65A 4G9DA 4L8CB 5DUML 3U6RB 2I60L 3P0YH 4HXAL 5I1JH 4I18C 4RX4A 4HQQL 3JUZA 4PGBB 3BT2H 3PWPB 3QDGA 3NIDE 4X6BB 5I1LA 1ZT1A 4UNUA 1NMAL 2DI8A 2QKIB 1JRHL 3K74B 4LCYB 2IPTL 1MRFH 1I7UB 3SEPA 5ID1A 5KZCD 4X5XB 4QTHB 1YPZF 3MUZ1 5CEYA 5D7SH 2HH0H 2HT3C 4N0YL 5E8EA 2OP4H 1FPTH 5F96L 1OPGL 1XF4B 1UM6L 5JXED 1UM6H 2EIZA 1R3LB 4NN5B 1H5BC 1U8QA 1J5OL 5DC9B 1MSPA 1ZT1B 2JB6B 2FX9L 3P4NB 4M1DL 2Z35A 3RNKA 3S5LA 2HFEB 4X4MA 1MLCA 4O2CA 3UZEA 2DQDL 4XHQA 1RJCA 1CFVH 4XP1L 4KKLD 4B0MM 3EDEA 2AQ2A 2X44D 3DTXB 1JBJA 1XGPA 4QY8A 3QIWC 2E6QA 2W91A 3AAZA 2R29H 1YJDC 4QHLA 1S7RB 4ZNCD 1E6OL 2ED9A 3TN0B 4E5XA 3SKUD 3JUYA 3R4DA 4I3SL 1A8JH 1G7MB 2C1OB 4CMHB 4JRXA 4JFHD 5EZOH 2OTPA 5C9JB 4XT1C 3HC0B 4KROB 4DKEH 4HXAH 2Q8BL 2ZSVA 3CXHK 5T3XH 5LXGL 3S4SG 1S9XB 3BDBA 2DWDB 1XT5A 1SBSL 1TCMA 4NQED 1NGWB 3STLA 4KDTA 4PJCA 1IM9B 4HS3B 2W1NA 1DVFB 2AXFB 3IF1A 4OZFB 1C12A 1CD1B 4UU9B 5C8JB 1SHMA 1F2XK 3VXMA 1YEHH 1SJEA 1RV6X 1UB6B 3SGEH 3TN0C 3EDKA 4UAOC 1EO7A 5ILTH 4PJEA 5K9KB 5MENB 1FG2A 3WFCH 4KI5F 3MLWH 1UWEL 3NABL 1TJIH 1NFDB 1SJXA 2AJUL 2E9WA 2X70A 4N0UA 4AT6B 1NANI 1BBJA 5D1QA 25C8L 2G9HA 3EOYG 3KS0H 1F4XH 3DROB 3DX8B 2BX5A 5FIEA 4V1DB 3O3EB 3OGCA 4KRPB 1B4RA 3O8XA 4JDTH 1FCGA 2J6EA 3T0EB 2J3SA 5C3LD 1DDHB 4JQVC 4HKZB 1S9VA 4MA3A 2NZ9C 3UJIH 5CEZL 1K3ZA 4PJFE 3TFKC 2B0SL 3IAQA 1AO7A 3OPZL 1FZMA 3KPLB 2OTWB 4ZOAA 4UV4L 1BREA 5JQ6H 5KG9B 4LIQH 3PHQA 4UQ3A 1QEWA 3RJDA 1UJ3A 4NKMA 3L1OH 5SWZD 4O9HL 3CFJA 4RFOH 5HI4C 5I71B 2VDLH 2YWZA 4ZS7L 1L0XA 3DXAD 5ICYA 3DRTA 4BK5A 3FB5A 4GLRI 1L0QA 1Q1JL 1T22A 3CVIH 5DI8A 5DQDL 5ICXA 3DX7A 1A7RL 5ALBH 5L6YH 5DUPL 2IEPA 4M62L 2ERJB 1CLYH 5I8OL 5E9DE 3ES6A 1SJVA 3BJ91 3PP4L 1MHEA 3OV6A 3QUXD 2X4PB 2IGFH 3JWNC 4I2XB 1T3FB 1YMMA 1Q0XL 2XZCL 3KYMB 3BWUC 3OPZH 2BNRD 4WU7B 3P4MA 1SM3H 1S7VA 3UX9B 3QFDA 4TUOB 3K2UL 5IFHH 4IDJL 3W9DA 1KELL 2IF7A 2WBJA 5JW4Q 2EDKA 2R56L 1B4JH 1OSZB 2BHUA 4CADB 2H6PB 5T1MA 4HDIB 2P46B 3RIAK 2BNQE 1GC1H 4DN3H 1H5BB 4JM4H 4KVNL 4WUUB 4XXCC 3RKDC 1KEMH 2EYTA 1YMMB 4Z7VB 2DDQH 5AZ2H 2IFFH 2Q20A 1N3NA 3PUCA 3QIBD 2SEBA 1UB6A 1CFSA 5DMKA 4HK0A 4WI7A 1G9EA 1ZT7A 3ET9F 1PEWA 1T1ZA 5FECA 4JRYA 4LVNC 4FQ2L 4GQ9L 4JO1L 4OGYL 1J1XH 1Q9OB 35C8H 4U6HA 2OL3A 3E6FB 2OMBA 4HPYH 3GSXA 4Q9RL 4MMZC 2XFXA 4N8PA 1A1MB 1MCCA 5CGYD 5I17B 5HGGS 1DQJA 1JK8A 3C9NB 5CJXC 1MEXH 4G6AC 3BN9D 3WKMH 1UWXH 3V4UL 2HTLC 4H0IA 1ZWIB 2M1KA 3V79C 3FQRB 4KQ4H 2A6KB 1NGZB 3RY4A 3ZYZA 4M62H 1KNOA 2KZ1B 1WITA 4MNHB 2H3NB 4PJCE 5JHDD 3PIQA 4RIRA 5KJRH 4J8RB 5BV7C 1IC1A 3PJSA 3RVWD 3S36X 3T77A 3DVFA 4GT7A 2DS4A 1G7LB 2OI9B 3HRZA 4PD4J 4M5YH 3AB0C 1N5YH 3TEUA 2G9HB 3T8XB 2ZSWA 3S35H 4CVXA 3UROR 3RDTD 1NUDA 1KXVC 1P4IH 1PY9A 4HK3N 1TJGL 5IW6A 4HJGB 3QRFM 1SEQH 4H0HB 1MPAH 2Y07L 1L0YA 4PTUB 5D1XB 2MSPA 3D25B 4LDOB 5LKNA 2YD3A 1TZIB 1QA9A 1L7IH 4YLQT 4HV8B 4ZFFA 3MRKB 1LK3H 3LEXA 4Z76A 4V1DD 2XZQH 2A74B 4ZAKB 4NPYA 3PGCB 2FEEL 2MPAH 5E2TL 3I6LE 4P9HH 3QUMH 2DICA 1A3LH 4BSVA 5K9OB 2WW8A 4LASH 1Q0YH 4JO3H 1N64L 4U1SB 4XCNA 1KT2A 5JUEL 1FNEB 4M8QB 5DT1L 2PN5A 3JWDL 4AEHH 4NT6A 2YBRA 4J6RH 5IGXH 5IB3B 2LVEA 3TZVD 3IDNB 4LMQI 4Y16D 4HUWB 5HGBB 4URTB 4ZNEE 3TO4B 4WTWA 1AQKH 5TE4L 5T1DH 1Z5LB 5DUMH 2PTTB 12E8L 1D6EA 4C4KO 3RVVD 4F7PA 2PW1A 1UFUA 3RL1A 5D1ZD 1D5ZB 1T89C 2ZP0T 3HNSH 4F80A 5IB5A 5K9OA 2JF1A 1PYWB 5F7NC 3O2DH 5F3BA 2FIKB 1JGEB 1IM9A 3VFNB 1JNJA 5IB2B 5FO8A 1DBJL 1IE5A 3ZHLA 4ELMF 4NWUL 4LPCA 3VCLA 1GZQA 4QHKI 4HKXB 4U1MA 1H9VA 3UZVB 1MJ7L 1QFUH 1XGRA 2VLLA 3AREB 3MUGB 3D25A 3CFCL 5GGUB 2E6PA 3IXTB 4OCXL 4KTDH 4PRNA 1GRWA 2H2PC 3HZYB 4X99B 4W6YB 2MCPH 3QUZB 2NY6C 3SE3C 2ZSVB 4PJ8D 4P2OC 3MXWH 5J4MA 1Q9WB 5HD8C 3WNNA 3BQUA 3IS0X 3BP6B 1GPOL 1T1WA 1QSFE 3J7HA 4P2OB 3NFPB 1J05B 2E7MA 3QUMA 4TUKH 3S37L 1MWAL 5E6IC 5GGVY 5FYJH 1NUNB 5GXBB 2WMPA 5HGHA 3GKWL 3QQ9D 2Q1EA 1KJMB 4UINH 1T21B 5MP6H 4G42A 1T03H 1J0HA 3DVGA 1CL7H 4IRJD 2EYRA 3QH3A 5MI0C 3N1QC 4F15C 1ED3B 2I25N 4OCYH 2AJYL 1I3GL 1DQDL 4ZTPH 3UC0H 5I1JL 3A0OA 2AJSH 4Y2OA 1BF8A 5EWIL 5E00A 1GZQB 3EFFA 3HC3H 1NKRA 3C6LB 1NGQL 2BSSA 1BGXL 3PHOB 1P7KA 5IVXF 4UIKL 3IGAB 2XKNB 1F97A 1FYHB 5SX4H 2N7BA 4G42B 5HGAB 1A9EA 4CRPA 4O2EA 1A14L 3NAAL 4N1CA 2XOTA 2HLFD 1D5ZA 1RVFH 2ZCKL 4XRCB 1UGNA 2AKRB 2MQCA 2AXGA 3HUJE 2OQJB 1A3QA 3CD4A 3JBG7 3MLZH 3LN5B 2YN5A 4G43B 5CMAA 1RZGB 4F9PC 4JRXE 5DK3A 3HE7C 3QRGL 2V17H 2CMRL 1CG9A 1OP9A 1BBDH 2YRLA 3C5JA 2F15A 4Y5XB 5K33A 3QIUD 5J6HB 1WAAE 4Z7UF 1Q8MA 4IRJC 5CZKA 4OFVA 5F7MC 1ZHBB 3D39E 1ND0A 4Y0GA 1FH5H 2CLRB 4L8SB 3ULVE 3QUZA 3R1GL 2EEBA 4PV8B 2BNQA 1UEMA 4FRWA 2N4IA 3L3GB 1VFOA 1JJUA 1FORH 5DI8B 1K6QH 1XIWB 4NO5B 5D1XC 5B38G 4X4ME 1UENA 3STZB 5IESH 5EC1B 1BZQK 4LVEA 1OVZA 5HHPB 3RWHA 3TA3B 2ZWLT 1A4KA 1XGQB 4X7DC 5ALBL 4TPRL 4DGYL 3DJ9A 4OM1L 2NY5C 3TZVB 1TZGH 3HFMH 3S37X 5B38B 3KPLA 1KEGH 2R69L 2YHGA 3R8QA 3U36A 2XYCA 1KGCE 2B2XL 1NL0H 4OCXH 3BP7A 1TZHA 4MJIB 1IKNC 1T21A 2PXYD 4O9HH 4F7CA 3UJJH 1OD7A 2KH2B 1C08B 1WCBA 5FHAL 2DLFH 2IADB 2Q87A 2NR6C 4UNVA 2ZUYA 4K9EH 1K8IA 5E03A 4J1UA 2C1PA 2ZCHH 2P8MB 1U2HA 1GSMA 4POYA 1UM4L 3O2DL 1DSFH 4IIQB 2IAMA 5T1LB 3QCVH 2GSIB 1ZWIA 3GBNH 3DX9B 2X4PA 4I48B 5IKCA 4NRXA 5EZJA 1U8LA 3DUSA 4K71B 2R0KH 5FUZH 4WHTA 2Q8AL 3BYTA 2LAAA 1G7PA 1U58A 3EYVA 3MV8E 4OZGF 1ORQA 1F4YH 1M7DB 5TPWL 3CVHL 4EN3C 4M5ZH 3ULVD 4LLDB 3NCEB 3KLHD 5IEKA 1YEHL 1AE6L 3CDFA 3MRJB 5EO0A 1R5VB 2Q7YA 3QNXA 3L5WA 2Z4QB 4PJXE 4H20L 4JFDA 1WFUA 1CFNA 5DQJA 5JHDB 5IBUB 1CICA 4RDQF 1TQBC 3MGOB 2F58H 4QRRE 3S88H 3GBML 3L3DA 4YUEL 2H45A 3EJJX 4J3SA 4OAWA 4WW1A 3C5JB 2CLVB 4Y5XA 3QNYA 3K4DA 4YFDB 3B8YA 3EDJA 2GTWA 3SDYL 5D2LA 3TO4A 3BRFA 3U2SB 3GK8L 4N5UA 3MRHA 5DEFB 5IM7A 3DARA 4NO2A 1F90L 4OIBA 4UDTA 2W0FB 1OWWA 4MD5B 1NDGA 3RVUD 3DURA 2FEDC 3E6HB 1FNSL 2X4RA 4Y4KC 5EA0H 3WFEH 1F3DH 1PEZA 3JVGA 4HWBL 3BIAX 1AHWC 3L5XL 3M07A 2B1AH 1BPVA 5LCVL 1FO0A 2FD6H 2NX5B 4HFUH 1KSRA 5I1HH 1TXKA 2F74B 4I0KA 3G5XB 4YPGB 1P6FA 2X9WA 3FL7A 3IJHA 2F8OA 3S6CA 4AEEA 5I74B 4PJ5A 5ITFB 5T1LD 4ZO7A 4HZLB 3VA2C 5C1MB 2R1XB 3F7YA 3O4OC 4LARL 1EHLL 1KPUB 2PW2B 4UILL 3UPRB 2FHCA 1JN6B 4POUB 4N0FA 2VL5B 1HI6B 1RK0B 1X5GA 3U30B 3V0WH 3OR6A 1F5WA 2V2TB 2EO1A 5D2NB 3TT3H 1YA5A 4GG8A 4QRPB 5EU6A 3IDIB 5L2KE 4QGTA 2NX5A 4YAQB 3SE3A 5IW6B 3HZMB 4MAUL 4HWNA 5DRZB 2CH8A 4HKZA 2F54B 5D7IE 5D7LD 1I85C 2VTFA 1QSFD 3QISA 4KK8C 2Z31B 1MWAB 1T04B 4LFHG 5E7BA 5FYKL 3HAEG 2ZJSL 3RQ3A 4F7CB 1HZHH 3Q3GA 4PJBF 5I6XB 2X05A 3GHBH 5IROC 3KYNB 5CEZD 1T7VA 1OAQH 1DQLH 3HE6D 4QRPA 5EU6B 4Y1AD 3VXPB 3HS0B 1N5AA 4JANA 1TIUA 4K3JL 4X6EA 2R56H 5A3ID 4KJQD 2V2XA 1X44A 4WNQA 3O9WA 4ODHL 2YUXA 2OR9L 3U82B 4HF5H 2A9NL 4HC1A 5H35A 5ITFA 4PJDA 5GISH 2C3HA 2VLJB 2VR5A 4AEIH 3VXUA 1T1ZB 4RAUB 5C09D 1FO0L 3BMWA 4UBDC 4GAYB 1AH1A 1WLHA 5HHMB 5B39G 3BQUD 1E0OB 3IXAB 1LE9B 1CI5A 3ROLB 4MDJB 1I7RB 1XR8B 4M7JH 1T2XA 4EOWL 1N7ML 2DMBA 3BZDA 1PSKL 1HK6A 1U8PB 1RUPL 1JNHB 2IPKB 1BQLH 1NLDH 3MLSH 3ZE0E 3ARFB 4U1NB 3M1BA 4OZHE 2WBKA 2FATH 1A2YB 4H1LH 4IS6A 1TJHH 3CSYB 1I7TB 1MH5A 4MDJA 3IDGB 1CT8A 3WS3A 3C87A 4Y88A 3ZO0A 1N6VA 3SCMC 1IQWL 1VCAA 3HE7B 5D8JH 1CDYA 1VKXA 1BECA 3LY6A 4M1GH 2XNAA 1R3HB 3WEXB 2YUZA 3BGMA 1TJIL 3SO5A 1N6UA 3OL2A 4PRDA 1OM3L 3V5DB 3VG9C 5FYKD 2CLRA 2J6EH 4CVZA 2VXSL 4D8PB 1B0RA 3I6GB 1AQDA 4OI9A 3ZYJA 5L2JA 2BNQD 5I9QB 4YDVA 2CDFA 2C1PB 5I73B 2HJKB 5IWLA 3BXNA 4XCFL 1MJUL 3GJFA 4P5TB 4KGLA 1I9JH 3F7VB 1AGEA 3QIUA 3D85D 3MYJB 5GRJL 2VDKL 5JXEA 1OGTB 4I3RH 1FFOA 1CDUA 5F7FA 3A67L 2C3VB 5IJKA 1NLBL 2NY3D 1W0WA 4G8FA 1YECH 4Z0XB 1NAKH 4WWKB 3CU7A 1O7VA 1FZOB 5L7XL 5CD5C 3HE6A 4X99A 3VD9A 1R0AH 3VDAA 1R3LA 3C5SB 1IGTA 4QXGH 3RL2B 3QUKB 1WZLA 3PDDA 5DT1H 4AEHL 3RWIA 4D9QE 4PGZA 2O5YL 5CD3A 5DJYA 2I26N 3K8LA 1KB5B 3UDWA 3PWPD 5D6CA 4UOJA 5FYJL 1JIBA 2MHAB 4X9IA 4FZEL 2Y36L 1WBXB 4FQHB 3RZCC 5IEHA 2XRAH 2NYYD 1FNGB 3WHXA 3MBXL 1A1OB 1CVRA 3F58L 4MAYB 2IBBA 1TETL 3MGAA 1B0GA 1MIMH 2R0LH 1C7TA 5TGBA 2ZKHH 1KJMA 3WN5C 3BEVB 3DPBA 1MPAL 2Y07H 1ND0B 1NCBH 1HHKA 1Z6JT 1V3LA 4IRSD 3RPIA 2H9GA 2Z8SA 3S36H 4UDUA 5FGCB 4LEOA 3MV9D 1KJ2B 3CLEH 5BS0A 5GJTL 5DJXA 2Q6WA 3N1MC 1EGJH 3AREC 4A6YL 2YKLL 5D72L 3VRLF 2PR4L 3NFPA 5CZVL 4F9PA 2IFGA 2ATKB 5KVDL 2MCG1 3IFNH 3RUGE 4L4TE 1IGJB 3TYGL 1T0NB 3UTPE 3HG1E 2B20A 4OCWL 1JHTB 1A6VL 3DO7A 2OZ4A 5CSZB 2IALB 5DJAA 3H42H 4QEGA 1CDGA 4F7TB 2D03H 5F1KC 2QQLH 2GY7B 3MRJA 2A73B 4M3KB 3ULSB 1DEEA 4Q9RH 4D0CB 4WY7L 1IC5L 1F02I 4O51A 3UMTA 4G8GB 4ZXBC 4NJ9L 1I8MA 3B6SB 4Z9KB 5GGVH 4ELKA 5DRXA 3T0ED 4OT1H 2CIKA 1ZHBA 4H25A 4JY6A 2DLEA 4DCQB 4Z0XA 4LSRH 1X5KA 3VWJD 4MLSA 4X7EC 4F57H 1OCWL 4JVUA 4GW5B 1IAOB 3V5HA 1Z0NA 3OAYK 4MD5A 5DMGC 4KMLB 3SE9L 5F7LB 3MCLH 5DTFB 4MHHG 2H32H 4OV5A 4PP2B 2F5BL 1F58H 1OGAA 1IL1A 2DBLL 4MNQA 3SDCD 2ZUTA 1NFDF 1KG0B 3RWJB 1RIUL 4NJAL 1NMCB 4JGUA 4FTVB 3MV7A 5J8OA 2VDRH 4U7SA 3NCMA 4FMFA 1NFKA 4HIIB 3UO1H 3JVGC 4K7PL 4P2QE 3CDYA 5IOPB 4RWYL 2YSSA 4NNYB 2CXGA 4G9FB 3STBA 2EXYC 4WW2A 4QRQB 3B3IB 3MROB 4L8DA 1LD9B 5EU5A 1W2KT 2BVOB 5KJRL 1A47A 5DJYB 1A3RH 2ED7A 3MPCA 2XA3A 3SKOA 4WGVB 3VFPA 5C0JA 5DZNA 2DIAA 3U0TB 3GIZH 1NCWH 4LSPH 5C09B 3WFHA 3K1KC 1K6QL 3O45A 3C09B 5LWYL 3G5ZB 5JHLL 3RZCB 3CZJA 1IGCL 5HHXL 5J6HA 2PO6B 4L4VA 3VA6A 3QO0A 5SWSB 3ZKMD 2NW3B 4G6MH 1FGNH 4RIRB 4HZAA 1EERB 1JFQL 5FUCE 1S5IL 4JO1H 4Y1AB 2ARJB 4ZTOL 2AV7A 1G6VK 3CX5J 3PF2A 4EBQH 4ODWA 1RUML 4HJJL 3RGVA 1MLCB 4O2CB 3TBTA 4XRCA 3HNTL 4WO4D 5C6TH 4NUGH 5KS9B 1J8KA 3SE8L 2P48B 2R15A 4MQSB 5JHDA 5LQBL 4LSQH 3D69A 3VWKC 3SE9H 1X5IA 1JK8B 4LCCB 4YDJA 4GRLB 1DBBL 3RTQB 1DBBH 1HSAB 3MLWL 4PJAF 5C2UB 1FP5A 4ZO6A 3TIEB 4KKNA 2XQBL 4J3OC 4JPVH 4JPWH 4ERSL 2ESVE 4N0CC 2EXYD 1I8KB 1MAKA 2HT3D 5DJ2A 4P2CG 5H35B 3G5YA 1LMKA 3IRPX 4RMSA 3WLWD 2IMNA 5IIEA 5ICZA 2DRUA 2XPGA 3KWWB 4HIHB 5J6GB 4I13B 2FB4L 1ZLSH 2EDBA 2F53D 4MA7H 3QDJE 4GUPB 1QVOB 4OZ4A 3L3JA 5KS9A 4ZUVB 3VD3A 3P4OA 4BZ2L 4D0BB 2G2RA 1KJ3L 4HGKC 5A16A 5BJTA 2E9IA 1HIML 1RFDH 5CZXD 3TGXA 1R24A 4P2QA 3V0WL 1E28B 1HEZA 2A6JB 4WU5B 4BQBA 4P46B 4UILH 1PX3A 1RZKL 4QCIB 3A6CL 3KPSB 3V6BR 3MRHB 4S1QL 4U3XA 3WNOA 3P4MB 3TYGH 3VRJB 3OKOB 4QRRB 4CL7A 4C54A 2HMIC 3MJ9H 3GI8L 1FFNB 4UT6H 5D7JB 1B0RB 1BM3L 4K23L 4FQCL 2XQYG 4LLWA 1QPPA 3ZE2E 4ZMAT 4MZ3A 3SDDB 4YJZL 4FABH 2K9UA 1I3RB 3EO9L 4G7VL 3OR7A 2B0SH 4W68A 3V0VB 5KVEH 1ZHLB 1O5DT 2CUMA 3WUWG 2V9QA 1NSNL 1W72H 2ICWB 4YHIB 4NJAH 1RIUH 1NCAL 3GNMH 1EJOL 5EU6D 3AREA 4S1RH 3IJYA 1JGLH 4ZDHA 2MCPL 5J9PB 1CDBA 1QHPA 3T04D 3GJFK 1ZT7B 5EBLA 1EUUA 4GKZB 1VFAB 5ALCH 1PLGL 3RL2A 3BPOC 5CGYC 4M02A 1JF1A 4PIRF 4WTZA 3WXVL 1SYSB 1A7OH 3O4OB 2AABH 2BOBB 3QEQD 3CSYA 1M6OA 2FJFA 1FRGH 1CFBA 3VFRB 2AEQL 2HT2D 1FC1A 3DXAA 1X3DA 1NAML 4JM2A 5J89A 2HT4D 3G6JE 3JV4B 1AP2B 3KPRD 4NNXB 1J05A 4P4KD 4G9DB 4KKCC 4L8CA 4GAJL 1FVEB 3V6ZA 3MV8D 1KB9J 4PJ7E 2MFNA 5ESVB 3CCHB 4O2FA 4M5ZL 2GTWB 5I0ZA 1IQDB 1DN2A 4Y4HA 4U1JA 43CAB 2D3VA 2VDOL 2BVTA 1OT1A 3O11A 4WU7A 4TSCL 4TSCH 4OLUL 5MEQA 1U8QB 1F4AA 2BCKA 3BIKA 3MRIA 3QI9C 5BVJB 5KZCB 3MOAH 3ZHDA 1XGTA 3L3OA 3GBNL 4N0FB 2HWZH 3P2TA 3CDGA 5KOMC 1V05A 1DBMH 4P4RA 4MD0B 4KK5D 1V3KA 5DHYA 1YEFH 3DYPA 1DVFA 2AXFA 2CXKA 2CKBH 1YN6B 4OZFA 1BLNA 1N8ZA 4ODTL 5EULV 3T4YB 1KXQE 1HSAA 3TH2T 5LGJB 5JW5B 2NY4B 3QUXC 1EMTL 3KYKH 1KC5H 4FQIL 3RI5K 1YQVH 2AVGA 3GMPB 3QG7L 1MCOL 4KWUA 5EU6E 4L4VE 4N8CL 4YFEA 2SEBB 4XNQA 1T5XA 2Q76B 3BKYL 3QZWA 4DKAA 4Z7NF 4JKPH 3X13A 3WDIA 4HHAA 4XAWH 2R69H 5H94A 3S36L 5C9JA 3O3UN 3MLTB 4L9LB 3BWAB 4NN5C 4YXHH 4XBPB 4S1RL 1KCKA 2ZG1A 4QRTA 1JPFB 4BFIA 4V1DA 1EUTA 1ZANH 4K71C 3S3PA 3L7EB 4NOFA 4PJDF 1F8TL 3TO2A 1EV2E 3S9DB 5BJTB 1SY6A 1BX2A 3VFSB 4Y2DB 1CK0L 3SCMA 3OB0K 2AK4D 5EOQH 2PYEE 2PO6D 5C0FB 3T2NL 4FXKB 4JFZH 1PSKH 5C71A 1KB5H 4GRLC 1S5HA 2EE9A 1RAMA 3SDXA 1BEYH 4JFPB 1ZSDA 3GSUB 1ODAA 1BBDL 4FMKA 1T7ZA 4PRBB 2FO4B 3D9AH 4KH2A 3D2UD 4MQ7A 4HJ0C 1YEJH 2QBWA 1D5BB 1U36A 3RY6A 4XC3L 1XF2B 2KBGA 4EZMA 1HKFA 1XZ0A 4QHUB 1ETZB 4PJ9D 5GISL 3DUSB 4G8FB 5DA0B 4L4VD 1S7XA 3H9SE 3SQOH 2XN9D 4FQ2H 1KJ2H 1MRCL 4HIXH 4PJXA 3KXFE 3FO2B 4OCRL 3SE4C 4ZXBB 5HD8D 2C1OA 5B21A 4LLMB 1YN7A 2WUBL 4P23C 3RVWC 3RKPA 3OTTA 5IFAL 3MRRB 3IDJA 1F45A 2C4FT 4JPWL 4ERSH 4MJID 1QLFB 4EXPX 3LIZH 3A6BH 1VGKB 1KTDA 2CDFB 3BP6A 2YMXL 3EYFA 1FNEA 4M8QA 5FK9B 3SGJA 1EAPA 3LCYA 2V2WA 1KPVA 2WIMA 2YRZA 4G6FB 4WW1B 4U4BA 2XKNA 3G9AB 1ITBB 1TNNA 4PBWD 4K3DL 1P4LB 5F88A 3IXTA 4HXBH 5CINL 1NMCC 3EJYD 4PGJA 2X10A 1ACYL 4LSVL 3X17A 4XPGH 4QO1A 2CK0H 4X4XB 5HHXH 3BP4B 4TUKL 5DJZA 1LO2H 1T22B 4G6KH 1M7IB 4TSBH 4XZUB 1YEIL 4HH9B 4KFZC 1ES0A 4LSPL 4QTHA 4PJ9C 1V8HA 5SWSD 3D3VE 3VJ6B 3VXUE 2OR7A 5HPOA 1S9WB 1V5JA 4G3YH 5IVXE 5I76A 5DO2D 5TE7H 3RBGA 3X11B 5E4IA 4BQ9A 2OZ4L 3D6GA 3S34L 4OZGB 2HFTA 3H9SD 2CLZA 3LQZB 4IHOA 3BKYH 1X9QA 5I1HL 1QFPA 3LHPL 3DYOA 4RWYH 3GMLA 4NC0B 4RWHA 4PRIE 4D3CH 5CIPB 5IHZA 1N0LA 1O0VA 5KSUA 5I1GL 4QXTA 4YXKL 1KJ2A 4GKSA 1T0MA 1UACL 3E2HB 2NY0C 4XPTL 2JCCF 5IW1B 4X5WA 4MS8D 1MJ8L 4YGAB 3K2MC 2DI7A 5GS1B 4GW4A 2APVA 5DRWB 1LEIB 1LNUA 3MV9E 2BZDA 4O51B 3QIBB 1P7QB 1A21A 1F58L 3HNSL 3WE6B 1AC6A 3TZVA 4GFTB 4EI5B 4KXZI 1P84J 3QWOB 3SDCB 3V6OA 3WNMA 2R2EA 1QA9B 4MAYD 4Q2ZA 1EBPA 5DJAB 1K4CB 3VXSB 1FZJB 4OBRA 4JFOB 1T89A 3PWJA 1HHJA 4XVJL 2YUVA 5AAMA 2YD7A 2JCCA 2W0LA 3S98A 4FFYL 3MA7A 2HTKD 4YFLI 1F4WL 2W0PA 4B41A 1WWAX 1UG9A 4KTEH 3EHBD 2O5ZL 3MLRH 3RWJA 5LVEA 5MERB 4PJ5E 4R2GC 2R9HC 2IPUK 5HDBE 3RA7H 3LQAC 5EIIA 2GYSA 2Q8AH 4KDTC 5KSAD 1RURH 1LK3L 3ZE1F 5BMFH 3P40A 5DR5H 1UWGH 4KVCH 2D0HA 3FT3B 5DMJB 1AGBA 3VMPA 1XCTA 1PY4A 4GKNA 3UBXG 1F4HA 3GNML 1EX0A 3DWTA 1SEQL 5FGSA 5ISZA 4JHWL 2CUHA 3HB3D 2NY2B 3MFFB 2OMNA 5CZVH 3QA3B 3FN3A 4CW1B 2HLAB 1WF5A 4Y16A 2LQRA 2GW5A 1XGQA 4HUUA 4OZHA 2FD6L 3IETB 2DQDH 3O8XC 5E99H 5FGRA 4HG4J 5J0BA 2YPLB 4E42B 5IJVA 4KK9C 5F88B 3X14A 3D39B 1FGVL 4IJ3C 1HH6B 5E2WL 5IG7A 1UZ8B 3UJTL 4S0TD 4YBHA 3ZKSD 2ZNXA 3F58H 2ZG3A 4LSSH 4JRYD 3UZQA 4TSBL 3VXSD 4G6KL 4BZ1L 3JTSB 5EU7E 3VFOA 3TV3L 2CJUL 5EFIA 4DWHA 4WI9A 1HILA 1KBGL 1B6DA 1BVKA 1FH5L 5CP7A 5FA4A 3N85H 3KLSA 3AS2A 3TBYA 3ZKNC 1SY6L 4KZEH 3TIDA 2E9BA 2OSLA 4KTEL 4J3VA 4B5EA 1U8OA 4LAQH 2JJSC 4OQTH 1CF8H 1OAKL 1WISA 4Z8FH 3U1SL 5KSVA 1FG2B 4AENA 3V4PL 1J88A 4KJWC 1NAKL 3EW3B 2VQTA 1IFHH 5JPMB 1T20A 5E1HB 3RGVD 4OIIL 1U8KB 4F7EB 2VDNL 2EH7L 5BV7L 4H5SB 5CJBA 5EORH 3IDYB 4MCZB 5C0AB 4P3WA 4JM4L 4KVNH 5FXCH 2DQUH 4P5MA 3CXDH 3LDBB 4FFWC 4ZNEA 4NM8H 1SQ2N 1VADA 2FJHA 3VFMA 4NZTL 4HWZB 5IW3A 5AG9A 3IVKA 4FQHA 4RX4D 3HE7A 5EZIL 1WTLA 3HNTH 2I5YH 4HKBB 4M6ML 4XCEB 1S7UB 1GGUA 2CPCA 4TNVF 1OD9A 1YYML 5C0FA 5GPRA 1FC2D 4RA0C 3O2VL 3L6FB 1GGCL 3MRMA 3FO1A 3O11B 4UNTA 2PXYC 3HZVB 4PJ7F 2BCKB 5DS8A 1A2YA 5T33H 5J1SC 1ZVSB 2X1WL 1OAZL 4WFFE 3BEWA 1C5DB 4DOHB 2DM3A 3IDXH 4PJBB 4HUVB 2A77H 1I1YA 2V9TA 1UCBH 2HJLA 4P5TA 4NRZB 1KPRA 2G60L 4G3YL 3UCRA 2X7LB 5DEZA 5MENE 3O45B 2IANE 3LSOA 1DR9A 1U8HA 3LMJH 1IAIM 1ULVA 4WFGE 1RU9L 4NUJB 2G5BA 1NAMA 2J5LC 4HLZH 4YHLH 3MRMB 5HVFB 5ESQB 1FJ1A 4JFYA 2OL3L 1ZEAL 2NXZD 4GAYA 4RMTA 2F54D 2J8UE 4XPGL 4LPVA 4WEMB 2WIIB 2GKIA 1J12A 2ORBL 4R4BA 2VDRL 5D1QD 3VI3E 2VL5A 4XNYL 5I1IH 1X5FA 4XZUA 4EUPG 3MZTA 4GS7C 5BV7B 3EOBB 4YPJA 5D7KE 3VFMB 4I0PD 2E8YA 1N7MH 3FT4A 1YMMD 4EOWH 3TNNA 2ZOLB 4FQXA 2K1MA 1I8IA 2AEIT 2HLAA 3BPOB 3TBWA 3I3DA 2BDNH 4TN9A 2QQQA 5DFVC 1KLGA 1MUJB 1QQDA 1NAMB 3KYAA 4FP8H 1G7MA 1FJ1B 1QSFA 3PE9A 4P4KA 4EI5D 1G9NL 4J3WA 4LSUH 3SBWC 5TF1L 4JPKL 4MNGE 4QRRA 3QDAA 3WYRA 4ONGH 2NX5D 2W92A 1GGTA 3Q3GB 3QXWA 1KCSL 3MXVL 4FZ8H 4E0RA 2BNRB 3TC9A 4ONHA 1KTDB 4ZPVB 2VLJD 5EZIH 4K55A 5MEPB 4CU6A 4KZDH 1EEZB 2NXZC 5C0CD 2AJSL 1B3JA 1UQSA 3DYMA 4ZFGL 4OQ1A 5DVNA 4I4WB 2C4FU 1P4BL 4FFZL 5KSBB 1RI8A 2Q7NA 1JUFA 3OJ2C 3KPMA 4Z8FL 1P53A 4KUZH 3UYOD 4PR5A 4PG9A 4YHNB 1R3IH 2HYMA 3IKCA 5J12C 1N64H 2BNQB 4JO3L 5IWLC 5D70H 3SGDH 4R96A 3TF7C 5HI3D 1ZOXA 4YHPB 1FRGL 3P30L 2GAZB 4Q6IA 1QFOA 2GTZB 1YMME 1J1PH 2A6IA 4PRHA 1YY8B 5ALCL 2EYSB 1MIEH 2VDML 2YZ1A 3TCLA 1UQSB 4ODUA 4I48A 3VGAC 4TNVK 1U91A 1LP9A 2NY7L 4OKVA 1EHLH 4P48A 4LHUD 43CAA 4U1LA 4IOFC 4GMTH 2H32A 1D9KC 3TBSA 3BKCH 4O4YH 1NDGB 4YXHL 1CU4H 1QRNB 2VWEC 1NCCL 4XPAL 5MEOA 4L3CA 4OUOA 5SV4A 2YN3A 1Z9MA 3EO9H 5E99L 3QBTB 2XTJC 1QOKA 4JCLA 1EDQA 3VI3F 1V7ML 5FGBC 1AGCB 4NNPL 3U0TA 3ZT5A 2XKSA 4KV5F 3VJ6A 1U95B 4GKOA 2VE6A 3WD5L 1DUYA 4PBXA 3WLBA 1MREL 1TQBB 2XTLA 3KDMA 4Y5XC 1J86A 1DQML 5IVNA 5HPMB 4Y7MA 1W72B 1T6WA 3TH3T 4UT7L 4MQTB 2YSSB 5TQ2L 4R7DB 1YECL 3Q5YA 4X4YA 2FCBA 3DI3B 1D7FA 4F3FB 3EFDH 4C55A 4ZS6C 4R3SA 5GRJH 3HPJA 2DQIL 2FLRT 5ISZB 1IAKB 2P47B 1J1XL 3EO1A 2OM5A 5C07A 5T1KA 2DIBA 2R0WL 3QCTL 3T0XA 4YO0B 2MTPA 1J8HE 3AXLA 1T0PB 3AVEA 5CBEA 4FQQB 2NW3A 1KTLB 5E2TH 4LSUL 1G9NH 5DK2B 4MQXC 4PRAA 4XP9H 5E5UB 1PQZB 3K0WA 2J8UA 5EN2B 2WP3T 3KXFD 4Z7WF 1XIWC 5DJCB 2X1PA 1H3TA 4IDJH 1EJOH 3OWEA 1F11B 1ZMYA 5KVMC 2O61A 2DQJH 2A6IB 2RGSA 4PRHB 3OXRB 4KMQA 3TZVC 2ZCLL 3UP1A 2PCPA 5KANI 1P7KB 3ZT6A 1OF2A 4HS8L 4WI3A 2O93L 1NC2B 3ULVH 3LKPA 1ZLUK 3RWCB 4YDKL 5CILH 3BVNB 4HG4K 3RVVC 4GJTB 3C09C 1ZK9A 4UT6L 3C5SA 1U3ZA 2J2ZA 1WFTA 2CKBB 4OFYD 4O58L 4OJFL 2BHZA 2BMKA 1UADC 1W0YT 2NY2C 1WWBX 3FQTB 4S11A 4XNZC 5D4QA 2QEJA 1AD0B 3CAFA 1F11A 3QUZC 1YY9C 5FKAA 1G6RL 3C08L 4GMSH 1HXYA 1ZA6A 3JWOC 5TFSH 1YEIH 1HIMH 2L0DA 3AXLB 4YC2B 2ITDA 1MWAA 1T04A 4FG6D 4A6YA 4GBXC 4RGND 1WZ1L 1XIWD 4DGVH 2DQEH 3MRBB 3ARGB 4HXBL 3NVQA 1AGDB 3UYRL 1CGVA 3QIWA 3X3GH 2DQJL 2CKBA 3UTSB 3QDGE 5BRZB 3WIIL 3IAPA 3HPJB 1QR4A 1IBGH 5FYLH 2XFXB 3QEQB 2M8XA 3OR6B 4JFDB 4K94H 4JPVL 1UZ6E 2BRRH 1JHKL 2XN9E 4UU9A 5HI5D 1E4XH 1NGYA 4UUJA 2R4RL 4JFQA 3F7QA 2VLLB 2ZCKH 1QD0A 1I1FB 1FZKB 2ED8A 3F8UB 4HGWA 2Q86B 3WLBB 2R2HB 1AD9B 4PUBH 1CF8L 4YNYA 2MKWA 3KHOA 5GGTA 1CXHA 3G6AA 5D9SA 1QBMH 3RL1B 1YY9D 5BRZA 4LHJB 1NUGA 1SY6H 4GKSB 5GQBA 4X8XA 4C56B 1CXEA 5E56A 1IL1B 3QXDA 2QQLL 4JHZA 5JW3H 4L1DA 5DLMH 1GHFL 1TVBA 5I1KL 4MXQC 4AY0A 4Q9QH 5E6IB 4QRRD 3PWVB 4HS6B 4XWGL 3FB6B 3REVB 2CD0A 1NCWL 5B4MD 2J8OA 3PP3H 4PY7B 5FB8B 3N0PB 2ICCA 4NKIH 1A3RL 4DCQA 4PJIB 4G7YL 1JVKA 4P2RD 3U0WL 3GMMA 3P9LA 1FHGA 3OB8A 2P5WA 2VSDA 1BAFL 4U3HA 1F6AB 4YK4C 5HI5C 1T5WA 1WUNT 3VWJB 2MHAA 1T2QH 3MODL 5K9JL 4Z6AT 1CU4L 1P7HL 4ZO9A 4TULH 3BZ4A 2VUYA 3QIUC 1FL3A 1J8HA 4H1LG 3TO4C 2KZWA 4QF1B 1MVUA 4GRWB 3BO8A 5F7WC 3TA3D 1NCUA 5C07E 3MYZA 4QOKB 4KVCL 1UWGL 3RTQD 2XRAL 1D5MB 4X6CA 5I1LB 1UWEH 2V6HA 4ODWB 4P57A 5INDB 2KQNA 3NZ8A 5I1CL 4L5FH 4BFIB 1X5HA 5HDOA 1INDL 3GUTB 3MLRL 4Q9BA 2J8UF 3FAWA 1QBAA 2KKQA 3QPXL 4OLYH 43C9A 3C8DA 3IJSA 4PGEB 2R0WH 3QCTH 3KR3H 1AE6H 1IC5H 3T2PA 3MJ7A 1G6RB 1MAML 4KMTH 4QYOB 1HQ4B 4WWKC 4GRMA 4WV1B 2HMID 1JCKA 3MOAL 2DJ4A 5IBTH 4GG6F 3P0YL 3Q48A 4RAUA 1UC6A 4CU8A 2UV3A 4Y19B 3BPNB 3QJFA 2BJML 2NR6D 5TQ2H 3RDTA 2DWDA 3PDGA 4CUCA 5TE6L 4YIQA 2A0LD 4NQSA 5I66A 2WM0A 1CD9B 3VXPA 5IVXA 2RQ8A 2C5DC 5MHSE 4R7NB 2EO9A 1H5BA 5EBWB 1B6UA 3F5WB 2DMCA 1NBYA 4Q0XL 4LQ1A 5FAAA 1YNLH 5GZOC 1CLZL 4JY4A 4HUMB 5GJTH 1N0XL 5GS0L 5F1IB 2I9TA 1G0XA 3KLHC 4N5ED 1CFQB 1BOGB 3BW9B 3LKOB 4XWOD 4JDZA 3BAEH 4KKAC 4JB9H 4BKLA 5TH2A 2YC1A 3V7MA 5DGRA 1Z2KA 1ZHKB 5BS0B 2PYFA 4KKCD 1NGXA 4Y4HD 2VLKE 3PL6C 4WWKD 2IC2A 4GG8B 4GXUN 2YBRB 2R2BA 4AM0B 3BRDA 2GITB 3BX7C 1NFIB 3BHBA 3MOBH 2R4SH 3CUPB 4LPYA 3ZKXB 4MNQD 3P30H 5IVZA 4PJDB 3KAAA 3PHSA 4ZFOB 3G5VA 3MJ8B 3BVNA 4G9FA 4BM7A 2QR0B 4NN7B 2QQNL 2A0LC 2X6MA 3BSZH 2GHWB 1NBQA 1WGOA 4K3EL 3VXUD 4FN0A 4NQUA 3SJVD 1F6AA 3B83A 2ZUSA 3WKML 4RFEB 2LTQB 3PDOB 1OTSC 2FJHB 4PJGF 4P5KA 3QWRA 2HG5B 1KIQA 3L95B 3V4VH 3MNVB 3K7UA 4PJEE 1RVFL 5TF0A 1AO7B 4HGMA 3V5KA 4PREA 4ODHH 2WUCL 3L9RA 2FZ3A 4Z7WA 5CLTA 1Z5LA 1RUQH 2X40A 3E8UL 4ORGB 3P0VH 4RQQB 1VERA 3V5HB 2H8PA 5JOPD 2A6DA 2GJZB 2J6EL 4W4OC 1P1ZB 4FQ1H 4R26H 4KRPD 4YDVB 4P9ML 3HC3L 1QFWH 5ESAB 2JELL 5D1ZB 2XWBB 2VDQL 5FUCC 1JI2A 5L0QC 3RDTC 2BRRL 4Q97A 4YBQD 4U1GC 3WO4C 3O4LB 5FF6A 2AJYH 4D0CA 2BY1A 1IFHL 4PP1C 3FOLA 5HHPA 4QHUA 3OZ9L 1AI1L 3R06A 2D7QA 5HTSA 1JF6A 1S7TA 5BOPA 2IBGA 1CWVA 4F7MB 2Z31C 4ZFOA 4KHTL 4X83A 4JRYB 3GMNB 2LTQC 1YEEL 1OTSD 2EYRB 2R4SL 3DI2B 2YD8A 5D2NC 1DUZB 1FLRL 2YRPA 3BDYH 5HHMD 4OZIF 5I71C 3PP4H 3PWPE 5F3BB 1ORSB 1NC4A 2NY4C 3GSNL 2NXZB 1NGPL 4WVRA 1S9VB 3MA9L 3BAEL 4OGXH 4PY7A 4MA1B 1GIGL 2QLVB 3RUGF 5CJOL 3IDXL 1WIOA 4D9RD 3D85B 4NO2B 3MRRA 4N8CH 2XTJB 2AP2A 3L7FA 1N4XL 1IKFL 4NFCA 2Z35B 4YBQC 3RNKB 3FRUB 3S5LB 4BFGA 4UV4H 5CCKL 5D1ZC 4GUPA 3NZHL 4ZFZA 2C3GA 1JZ8A 1MAJA 1M7XA 5AZEH 2X9XA 3VFVA 1JPST 3SKOB 1WFNA 3VFPB 5C0JB 4JZJA 1MCWM 1Q94B 3HMWL 3IF1B 1RHFA 4POZD 1A4KB 4MCYA 3TVMA 4ISVB 2HWZL 1QR1A 1F90H 2L7UA 4HUUB 4OZHB 5C0RH 2K3TA 4NP4H 2DMKA 4X6CE 3UAJC 3GSNA 2XZAH 1U42A 1I8KA 3DETD 1WCQA 2HN7A 3O6LL 5JDSA 1WQVT 5F89B 2Y25A 3CIQA 1HYSD 4L8SA 1I1CA 4PB0H 2CUIA 3QIWB 4WRLA 3VFUB 2O5ZH 5C0BD 3RJQB 2ICWJ 2FYYB 1GYAA 1OAKH 5E0QA 1OGAB 1IGFL 5I8CB 1BHGA 2L4OA 3TWCL 5EU3A 2X1QA 4LASL 2VAAB 3GDBA 1KPRB 4L5FL 5IHUL 1BJ8A 1U9KA 2P5WE 1KBGH 1JNHA 5JNYB 3C8HA 2XZQL 1VFBB 3Q0HA 5GZND 1FNLA 3JV5A 4U0RC 3EDFA 5ENWB 4JQXC 1LDSA 2PO6C 4L3EB 4OF3A 5E8NB 1CZ8H 4KDVA 2JB6A 5EU5B 2X89A 4XPHL 5DJZB 4C59B 1BIHA 5I8EB 3CX2A 1F6LL 4FQLH 2EC8A 3HAEH 1J0KA 2R2CA 1IKFH 4HIJB 3QHZL 1TVDA 5GJSL 5GJSH 1LO5A 4H0GA 3VXQB 5LGHL 2GJ6E 5TQ0L 3Q2CA 2IQ9H 3OAUH 2BNUA 3IDUA 3KDMB 1RZKC 1U58B 3HFML 5I75B 2UZIL 2VZTA 4ODSL 4L3EA 1RZJC 1JNNL 5DD0L 5TE7L 3O3BA 5ANMA 3BIKB 3MRIB 3MRGA 4PJHF 4F7PB 5EN2A 3WIHL 3GSNH 3EHBC 3WHE1 3O6FD 5KSUB 5E6YA 3MRCA 4N1HB 1CVSC 2GK0B 5DA4A 2K7QA 1INQA 5MI0B