5CEXB

Crystal structure of fab 32h+109l, a putative precursor of the pgt121 family of potent hiv-1 antibodies
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
233
structure length
233
Chain Sequence
QVQLQESGPGLVKPSETLSLTCSVSGASISDHYWSWIRQSPGKGLEWIGYVYDSGDTNYNPSLKSRVNLSLDTSKNQVSLSLTAVTAADSAIYYCARTQHGRRIYGIVAFREWFTYFYMDVWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Antibody 9H+3L Fab light chain
total genus 48
structure length 233
sequence length 233
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cexB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cexB01
4G3YL 3WFHA 3UPRA 1MFCL 4JFDE 4F2MB 3MA7B 5B4MD 1MFCH 1UT9A 5D2NE 4HWZA 1EEZB 4XZUB 4AEIH 1QSVA 4LLUA 1E4XH 1CIDA 3RTQB 1IAOB 4HCRA 2WINB 1AP2B 5GHWL 2VLJA 3JV6B 1KB5A 1NMAL 2C7UA 1MUJB 1ZT7A 3EO9H 4YBLC 1HQ4A 2OJZH 3ULUC 2W9DH 5IFAL 3X12B 4DW2H 3IRZA 4R6UA 1VFAB 2GEEA 4LSTL 4NO5B 3TH3T 1JN6A 4UBDC 2VLMD 2IQAA 1I1AB 1BLNA 3NACH 1FL3A 1YEGH 3GHBH 2NLJA 4PJ8C 3ROLB 4TUJB 1EHAA 1B0GB 3ZKSD 1TNMA 3RVWD 1BZ7B 4POYA 5FYLE 1XCQA 5E2VH 1FORL 1KLUB 2RCSL 2GQHA 3MV8D 4JY6B 3MCKA 5T3XH 3X3FL 4P2OA 4OCYH 3NGBB 5FYKL 3VXSB 1WF5A 1HQ4B 4ZXBD 1TZHB 2PXYB 1ZK9A 2XZQL 5C0GB 1JGUL 1K6QH 1FSKB 3LS5L 1G7IB 1UEYA 5FCSH 2IMNA 1NAML 3EW3B 5JDSA 5GS0D 4YHNB 1OAZH 4H26B 1MCIA 1QACA 3OKMB 4HLZG 3I3BA 5I1DA 3FRPA 3MROA 5C86A 1H5BB 3IB4A 1SYSA 4FXKA 3E1F1 4TSAL 4OJFH 3OB0H 1E4WL 3TCLB 2YD9A 5ISZD 5DC9B 3ZT7A 3QIUA 1VERA 1TVBB 4XI5D 4F7TA 3OJVC 1PX4A 4F7MA 4Z7UA 4LLMA 1UJ3A 4JHWL 2HKHH 4K9EC 5IB3B 3H42L 1YNLL 1OAQL 4PP1C 3BEWB 4PPTA 1OTTD 4U0RC 1Q9OB 1CICA 1KF9B 2VWEE 1FFQA 4Z76B 2CLZA 4R90L 3VH8B 1T0MA 3ESUF 1GZQB 1J0JA 4L3AA 3Q1SH 4YHIA 1KCVH 4HW6A 4MCYB 5A16B 5HYJB 4YO0A 1U58B 4JM2C 4K3GA 2FR4B 2EICA 1KG0B 4I3GA 5E03A 5F88A 3FMGH 5B39B 2DQEH 3FMGL 3LPGA 4JFQA 1HZHL 5JIKA 8FABB 5BRZE 5J6GB 3T4AB 3Q6FB 4MJIB 1EGJA 4U6XA 4M7LL 5KSAD 4JFEB 1RZKC 1ZT4B 5IMKB 5BQ7A 1S7VB 1HSBA 1RZJH 3PNWA 1NGQH 2FIRT 3VG0L 4OV6F 2JCCA 4NCDA 1WT5C 3DMMC 3OKNB 2D3VA 1FN4A 2JTDA 5I74B 4L8BB 5JW4N 5HSFA 4I48B 4OGAD 2R1YB 4PJXF 3ARXA 4G8FB 3WJLA 4X7SH 4XX1G 1GPOH 4TULL 1Z6JT 2ILLA 4PJ8B 5HI4C 3V5HA 4PJ9B 5IMOB 1C7TA 3TJEL 25C8L 3MRDA 4GFTB 2DM2A 1I1AD 2HLAB 3N50A 1RK0B 2AEPL 2JJSA 1J0KA 1C12A 3HE7C 3K4ZA 5KSBA 3MGOA 5GRYA 1S7QA 2Y1VA 2ADGB 3PDGA 1TNNA 5CUSL 2BNRB 1H0DA 3L7EB 3QQ9C 1F8TH 1GGCH 1YUHB 4PRNA 3SKJL 1XMWA 4Q9BA 3Q3GB 1UM4L 4KDTA 4OI7A 2CKBL 1UZ6F 3SDAC 1CQKA 2FX9H 4RWHA 2FJGB 2H6PA 4YC2C 5ESAB 4MS8D 5JOFB 3WNOA 2B0SL 4A2MA 1MH5A 1IAII 2BNQA 3MJ6A 5F8QC 1CU4H 3I2CL 5CJOL 3PV6A 2GAZA 1AGEB 4GKZA 3HNVL 1YN7B 3MOAH 3GJFH 3S36L 1KFAH 2HWZL 1Y0LB 3U4AA 2EDFA 5D7SL 4GG6A 1TITA 1UXSB 1YMHB 3WNLA 2XT1B 4K3EH 5ERWA 4BFIB 4K7PY 3IGAB 4LDEB 5EZJB 3D9AL 4OZFG 3BRFA 1HN1A 4LP5A 1BFSA 5I76A 4IJ3C 2BY3A 4JO1L 1JHLL 5TQ0L 3DURB 4YHZH 3QIWA 3X3GL 4P2QA 4KMTL 4Q7DA 5C3TA 1UA6L 5C0BB 3REVB 2H2PD 4LL9A 5HPMB 3L3HA 2KL6A 1OP5H 4UINL 3WUWB 2GCYB 4Z7NE 1ZVSB 5D8JL 1HI6B 2HH0H 3GJFA 2L0DA 4YNYA 2YUWA 1IM9A 2CDEB 1YN6A 1BQHG 3UZEA 3H9SA 1TJIL 3L95B 3FFCD 1L6XA 3W11D 3VMNA 5ELIA 5JPMB 1JF5A 2B20A 2ZG2A 1PQZA 1T7WA 4X6CE 5AYUL 2ZSVA 3NZHH 5DZLA 4H1LB 5ISZE 3ROOA 3OKLA 1KPRA 4XCNB 3KG5A 2C26A 3MRMA 4OD1L 5JO5A 5L8JB 1G0DA 2QBWA 3WJLC 3KPSA 4XPGL 4U49A 1CR9L 3AAZA 3ALXA 4HH9A 1RHHA 3F58H 4PV9B 5I1EH 2VQUA 3GRWH 5FYJL 4DZ8A 2V7HA 5HHQA 4G6KL 4WUUD 3U30B 5D7KE 3SE4A 4XGZB 1OLZA 5JOPE 2XPGA 1TVHA 1KBGL 4KK5C 3WNPA 4Y16A 3UAJD 3PHQB 4G8GE 4X6BA 3U82B 1W72H 2CGRL 2OP4H 3FONA 4HK0B 3OSKA 4H0IA 1IQDA 2FO1A 2I60H 2IANB 4FQJH 4PV8A 4JEGB 4WO4B 4M6NH 2EO9A 1M6OB 3ZDXF 4YHOH 4JHAH 4EOWH 5C09E 3DV4A 5ESVB 3MRGB 4MQSB 4ZNEA 1WIUA 2WQ8A 4YK4C 3QH3B 5H2BB 3VGGA 4GRLB 3DGGA 2Q6WB 4P46C 4XMPH 4JO2L 2DLIA 5DHVH 1U8QB 4HPOH 5TDPA 2BNRD 4R96B 1D3CA 2HT4D 5FDWB 3V0AC 4E5XA 3TBYB 3GMMB 5ALBH 4ELMB 5F6HI 3GO1H 4JM4H 2I9LB 2MWCA 3PE9A 3K46A 2V2TA 2AKRB 4JZNA 3TPUB 4URTB 4AJ0A 2RAMA 2NY0D 1ZKAA 1PBYA 1K4DB 1LVEA 2Z4QB 1OTUC 1XZ0A 5LGHH 4X4XB 5HHPB 5BZWB 4O2FB 2P5EE 1HE7A 4ESKA 3NCEB 3RGHA 2W0PA 1UH3A 4WDIA 3OXRB 1S9WA 2A9NH 1AJ7H 2B1AH 2B1HL 3BKYL 4UTBH 2Y06L 3D3VB 2ADIB 3PWVB 1RZ7H 3PGCA 3RWIB 5DUML 5DRNB 5E9DE 3UTPE 4NHUB 2PW2A 4LASL 1MY7A 3MRKB 1DBBH 3V5KA 5L8LB 4RAUA 4CADA 4LSUL 2YPKB 5ADPH 3V5DA 5KSAC 1KXTB 1N7MH 1NUGA 1BVLB 1KELH 5IIEB 1N6VA 5D7JB 4H88L 3RUGF 1T4KB 4RFNB 1FVDA 2E7LA 4UOJA 3VWJC 3I6GB 5IW6A 4ODWA 3ZL4H 2G60H 3O8XC 1A3RL 1T22B 3QCVH 3V6ZB 2Y9RT 4GBXD 2Z92B 2FDBP 5FHBH 1ED3A 5ANME 1QQDA 2NTFB 1N2RB 3NZ8B 4RFEB 3B9EA 3BN9D 3ZTJH 2DL9A 2CLVA 3T08A 2DTML 2XKSA 3G6DL 1FNGA 3MV9B 1HCVA 3FZUC 2YPKA 3MA9L 2OL3B 4S1DC 3LKSB 1FNAA 3WSQL 2HT4C 4YHML 1UB6B 3AROA 2C1OA 4HKXB 5GIRB 1NQBA 4L4TA 3W9EA 3QHFL 3ZE2E 3MPCA 2Z93B 4MMZC 4E42B 2HMID 1FYHB 1NCBL 5GRJL 4KPHL 3RNKA 4PY8J 5MEPA 3HE6D 4OLWL 4P99A 1YEHL 3T3PE 5E2TH 5CD3A 4M9PA 5HVHB 3GMNB 3WIHL 1XZ0B 4KXZH 1R3JB 4HJJH 4Y89A 3MFFB 2FGWH 5JW3L 1DBJH 3KWWA 3LQMA 3V7AG 3O45B 5BRZA 4XHJD 1MREL 2Y4SA 2DJSA 2AJVL 1UXSA 1QYGL 3HNSH 2H3NB 1Q9WA 2DM3A 3DGCR 3KAAA 2X4PA 5CD3B 4AH2A 2IFFL 2NXYD 5FDWA 4F37K 4JREB 3ORJA 4WJ5A 4DGIL 3B5HA 4U05A 4U1GC 5CUSH 3FRPG 3WDHA 4YDJB 2FWOA 4HG4K 1DUZA 5F7EL 5ICXB 3O6LL 5HYSB 1JHKH 1A1OB 4QXTB 1NGXB 5CSZB 5C09D 3V79C 2F19H 3MRNB 4P5TC 3QUYC 5D2LB 3V0WH 5JNYB 2R69H 2CXKA 1R0AL 2ED7A 3CK0H 4QRSB 4JFOB 3D1MC 4U31A 4YZFF 1W0VA 4KI5C 4KY1H 4NZJA 5IB5A 3T3ME 1QNZH 5LKNA 3O6FD 1A6VH 1Y6KR 1IQDB 3OAZK 1CGWA 1QOKA 1U8NB 4FQXD 1Q9LA 1RMFL 4LHUA 1X5GA 4QWWD 5EO0A 4PV9A 1OCWL 1ZV5A 1R3HA 4XPTH 1Q9KA 4D9LL 3NABH 3WIIL 4PGZA 1DN2A 3D39E 2YN5A 1D5ZA 2C3GA 1A1MA 1MCJA 2XZCL 3DXAD 3KPLA 1D5XB 1FZOB 5ANMB 3BH9A 3LN5B 5IIEA 3TBTB 1W0VB 3K8KA 4GQPH 4OLZH 5MI0C 5IV2A 4OFYA 3AB0C 1VADA 5DK0A 5D7IA 3LH2H 3HAEG 1FO0L 5FKPB 5GGTL 5GGVH 4OZHF 3Q6FA 5F7NC 2B4CC 3KXFE 43C9B 3ZYZA 2YPVH 1Y18A 3KXFB 4UUJA 4X7EC 4EDWL 1RUKH 4BKLA 1AHWB 1HIML 4GLRH 1R5VB 1KGCE 1KC5L 2VAAB 3RY5A 1ZHNB 4P4RB 3FQNB 4LAJH 4R90H 1I9RL 2XA3A 3KYNA 3BPNB 4LOUD 5AWNL 3MOBH 1AC6A 4MNGA 1G7MB 3M45A 2FO4B 2I26N 5AWNH 2UWEE 5L2KE 3DURA 1T1XB 4HLZH 3ARPA 5D7JD 5F7DB 5L9DL 1T0MB 4MA1B 1VGKA 1T89A 3SE9H 4PTTA 2MQCA 2W9EH 3O81A 4OAWA 4WTWA 4R3SB 5KVEH 3OGCB 4DEPB 3IJHA 3H9HB 1RUMH 5CEZH 2XQYG 1OAUH 4TQEH 5GSRB 4M48H 1YMHA 1F2XK 3T0EB 4N8PA 2X4OA 2FX8H 4PBVC 4MAUL 3N85L 5SX5K 3W5MA 3L3IA 3HC0B 1EO7A 3HZKA 2OBGA 2LU7A 5F3HA 2J5LC 4PJHF 3OKKB 4J6RL 5TF1L 4Y2DB 3BAEL 5C70A 3VXRD 3TYFB 5JZ7D 4XP1H 2EXYC 4PJDA 4ZFZA 1LNUB 2Z8RA 2YHGA 1OCWH 2EDJA 4F3FA 2A0LC 3MRFB 3QXWA 4W6XB 4OLYL 3VFPA 2DLTA 2CKBH 2EYRA 5IWLC 1QRKA 3UJIL 3U7WL 4W6WB 4O2CA 4C59B 4JO4L 4M7JL 1JWSA 4FG6C 4RFOL 4JLRB 5KJRL 2Q86A 3N1QC 5C09B 1VGEH 1VACA 4WU7A 4UIMA 1W8OA 4HXAL 1JNNL 1DQML 3HZYB 3OB0K 5GGVL 1WBYB 4Z7VB 2ZOLB 2H2SC 2V6HA 3DBXB 4Z7VE 2FIKB 5HPOA 1G6RA 1T0NA 1N0LA 4QHKI 4CW1A 4PLOB 1GRWA 3ILQC 3T65B 1X5AA 3SKNB 4P2RA 2NPLX 1NFIB 1OPGH 3U6RB 3OAYK 5DS8B 5L2KA 5DRXA 3TZVC 3WE6A 4M5YL 4NKMB 4TUOA 4XMKH 3HB3D 2QQQA 5MERA 2P8PA 2Z35A 4NQSB 5J8OA 2YEZA 5MI0B 2NY4B 4L3EB 1KB5B 3JBG7 1DUYA 5A3ID 5B39A 3ZDZF 1YN6B 4RWYH 2Q20A 3WLWD 3QEGH 1XR9A 1EX0A 1G1YA 1GGUA 3G08B 5HDLA 4NQVA 4YFLF 1KTKE 4YHIB 1I7ZA 5C0BD 3AU1A 3O6FB 4MAUH 4F7CB 3LEYH 5GRUH 2VXVL 3G5ZA 4MLIA 4R4BB 3C8DA 1NEZA 1HILB 2VQ1B 4Y8DC 3OG6B 3MRCB 1BMGA 2H41A 3CAFA 4OZGE 4PB0L 1KTLB 5D1XD 2X05A 2X44D 3ARQA 3MGTA 1QSED 2AKRA 4BUHA 3HB3C 4U6TA 3LHPL 4OM1L 4OKDA 1R5WA 3LEXA 4K23L 3LHPH 4OM1H 4A2LA 1TXKA 4LCIL 5IF0B 4QOKB 3B4NA 3HE6A 2ZG3A 3IDGB 4MD5B 1A14H 1UYWL 2EDBA 4AT6B 4YHNA 5JHDE 3BH8B 3WSQH 2XZAL 1MRCH 1FBIL 3SE8L 4R4NC 3MLYL 1MCNA 4MB4A 4KMQA 5L7XH 5DT1H 4F57H 2VNCA 5IK3A 2NY7L 1A7RL 5CILH 4ZUTA 1LD9B 4LHJB 3UTZB 4KK8C 5EDXA 3LKOA 2MSPA 2Z31B 3PHQA 1TIUA 3MX0A 5E5RB 3MV7D 3MLPA 1JTPA 3JWDH 2OM5A 4YBLB 3MRQA 4LSVL 3VFTB 3PWJA 4MXWH 4HDIB 2P24A 4F7PA 1WT5A 5C0AA 2D7MA 5JIHA 2NY6D 5I8KH 3KPRD 2NLJB 2VC2L 1NCNA 3PGDA 5C08E 4FZ8H 3UDWA 2Q3ZA 4G6JL 2AEQH 3ULUL 3O11A 1BF2A 5LXGH 4NUGH 4HFUH 1M71A 4NO5A 5I1LA 3MODH 1ZT7B 4BFEA 2BVOA 4HPYH 4BZYA 3SKOA 2VDNH 2HFEA 4MD4A 4ZUTB 3HHRB 2VDLH 2VDNL 1NEUA 1NLDL 4ZAKA 1TVDA 3F8UB 2P45B 2DBLL 2M26A 5HPMA 3WXVL 3TIEA 2KZ1B 3CUPA 3RTQA 4KMLB 5GISL 5IBLD 5F93C 3G9AB 4P2QB 4JQXC 3L5IA 4NQUA 4AT6A 4X0KB 4MVBD 2PCPB 1NUNB 3QEHA 4GRMB 4KPHH 1KCRH 5K9JL 4PJIE 4G8EB 3SDAA 2VDPL 4HUWA 2D7TH 4F9LA 5D1QC 1A0QL 4U7MA 1VFBB 2XFXA 3EYOB 4XP9L 5HD8C 1QBLH 3A6OA 4PREB 4PRID 3SJVD 2CUIA 5SV4A 2WP3O 4B53A 2R0KH 4NM8L 2APXA 4AEFA 4UI2A 3MUGB 5IKCB 1LO5A 4JFHE 3GSUB 1UKTA 1YC8A 1X5YA 4MQXD 5SX4I 5CS7A 1HILA 6FABH 5EZLA 5C0IA 2I27N 1LQSR 4PGEB 3OG4B 1QSFA 4NO2A 3EJZD 1V3LA 4XVJH 5HYJD 1WWAX 1JE6A 1BVZA 2XWBB 3WKML 2YD4A 5I8OL 3OJDA 4P3CH 1A4KB 5IP4A 4ZNEE 1WZLA 4FQXC 5T1MB 2MPAH 3E2HB 4EKXA 3QULA 4N1CA 4JRYB 3V52L 4HUVA 4XWGH 3O9WC 4OZFB 2XTLA 4XTRC 3ZHKA 1WAAA 3VI3E 2Z35B 1CN4A 2H1PL 3P73B 5TGBB 5HBBA 5T33L 1F3DJ 3PWPA 15C8L 4HHAA 4K8RH 5EA0L 4S1RL 2XQBH 3MRDB 3B3IA 15C8H 5FYKH 5HJ3B 3JV5A 3A67H 1FHGA 1U95B 5MENE 1GGIH 1DBKH 4I2XA 1JYWA 1H8SA 1ZLWH 4A6YL 4DK6A 5FF6B 4NPYB 1G7HA 3QHFH 5C0AE 4Z7OE 4XX1E 4L8BA 3D69A 3D0VB 4MLSA 1NMAH 3VDBA 1I1AA 4HXBH 1FG2A 1U95A 1HSBB 3PNWB 2XG4A 1JTOA 2DLFL 5BQ7B 5KVFH 1U8IB 5FYKU 3G5VA 2D0GA 5J6GA 2EYTA 4UDUB 1YMMB 1BX2B 4MWFB 5TE4L 1EDQA 4LDOB 3NFPB 4MZ2A 3ECBB 5I1GL 5CINH 2YPLD 4KK8D 1RUQL 3EJZC 4LPWA 2BSSA 2OK0L 1F3DH 3S96A 4LHUG 2ZSWB 4M61B 4PRBA 2YOCA 4IEFB 4A6YB 3ILPB 4S1SL 3O4OB 1NUFA 4PJDB 3ARDA 4F2MA 4PJEE 2FJHA 3S5LA 3STLA 1TCRA 4KRPC 4E41E 3GSWA 4YEEA 5ICZB 3MUY1 4CGTA 1UCBH 3FT2B 3T3PF 5J06A 4ZOAA 4UT6H 4LLAA 1AGDB 1IFHL 4YAQB 2PW1A 1GGCL 3ULVC 1I3VA 2XZQH 1P4LB 2APVA 1DEEA 5CIPA 2X6MA 4OB5H 3HAEA 4YWGL 4Y1AB 4Z7UB 4ZD3L 4XWOC 4NSKA 1A7BA 5FA3A 1Y6MR 4Y1AE 5LBSL 4RIRB 1BOGA 2B0SH 1TQCC 1CGXA 1QSZA 1SYSB 3ARGC 1NCTA 1X5IA 5DJ6A 3RGVD 4YUEL 4PB9H 2B5IB 2OSLA 1G7LB 4H26A 4JN1H 1AQKL 3IFPB 3G08A 1MCQA 5KVMC 1MCCA 4P59H 3VI3F 1FG9C 2ATKA 4IS6A 5HHVH 2OTPA 1CGYA 2J8UE 4JAMB 5HI4D 1Y18B 5EPMB 4RQQB 4FRWA 4MXQC 4NQSA 1EV2E 4YR6A 4JRYE 2PN5A 4XBPB 4QXWA 4TUOB 1TPXC 4DN3H 4FXGA 4RA0C 3IXAB 2UZIH 1UC6A 4J12A 5EC1B 2BCKA 3U6RA 1JGLL 4K8RD 2OTWA 1DBAL 4ODUA 2IBZY 5HDQL 4OZHE 3UTTB 3LAFA 5E2JA 1BZ7A 4OF3A 4OUOA 4D94A 3KPLB 4ZOEA 5CJ5A 5D9SB 1QVOB 2HRPL 3WN5C 1GIGL 5A40E 5KTEH 5L8KB 1EFXB 4DKEL 4RAVB 2H32B 2PKDA 3T77A 3VI4F 5C6PB 3FOMA 4X83A 3D25B 1OGAD 2DQTL 4PTUB 5EO0B 5HHOA 4PRPA 2Q86B 4OGZA 2IQ9L 3O3DB 1QKZL 5DEFA 4L1HA 1NL0L 1U2HA 3Q5YA 2GUOB 4XAWL 1IFHH 1TTGA 1HNFA 4GRWB 3WO4C 4LLUB 1A4KA 4PGBA 4XP1L 3NVQA 1CVRA 4WHDA 4AMKL 3MLYH 3QEGL 2DIAA 2J4WH 2DQCL 2RR3A 4L4JA 4YE4L 1P1ZA 4XVTL 1YY8B 1QSFB 1KJVA 2QSCH 4TSCH 2X4OB 2I07A 4JPWL 4P23A 1B6UA 1WZMA 3NBNA 3CFEB 2X1XR 3HC4L 4YGAB 3MLTB 4KJYA 4CMHB 5LGJB 3HCVB 5DMJB 4YXKH 5DD3L 4ELKB 3DRQB 4FZ8L 2GSIA 2WUCH 2HFGL 4HIXH 3RUGB 2A1WL 5DD3H 5HYIA 4M1GH 5HI3C 1RJZB 3WS3A 3VFWB 5DO2C 3BZFA 3BRGC 3O2WL 4J4PD 1T1XA 3JV4A 1S9YB 3BOVA 1FLTX 4JN2A 1PYWB 5H94A 5SV3A 4S11A 2ZP0T 3TESA 4U6YB 4WNQA 3QQ3B 4JRXE 1ZHBB 3GBNL 1BFTA 3FB5B 5EZOH 2B39A 4NDMB 2FCBA 3WFDH 4JRWA 3B9AA 1S8DB 3DOSA 4ZAKB 4S1QH 2FRGP 1C1EL 2M2DA 3TZVD 2HFEB 5DMKA 1EEQA 1KNOA 4HH8A 3TO4A 1GHFH 1SJEB 5I1LB 1WTLA 2JCCF 1OHQA 2V7NA 4QHNA 1P7KA 3DHJA 1H3UA 4JCMA 4LLWA 5D6DA 5FV1L 4OGXL 5TDNA 4CBPA 4ORGB 5DS8A 1P9MC 3OX8A 1T03H 1HEZB 4LHQB 4PD4J 3DV6B 1N6QH 3QDMA 4OZGF 3CSGA 5L0QC 1BWMA 1FFPB 3H3PH 4NQDE 3IDNB 3LKNB 1F6LL 5F9JB 4RGNC 3WUZA 1X3DA 3RWHA 1MAMH 4YFDB 1F11B 4FQQB 1WBYA 5AZEL 5A2FA 3HI6H 1YQVL 5KBNC 1ZMYA 4WU7B 1EO8L 1HXMA 3T0DA 3UTZA 4AEHL 4I18C 4KDVA 4RMSA 1U3JA 2CLRA 2X4RB 3DYMA 3GSXA 3IXTA 1MCWM 1ZGLM 2ATPB 5TE7H 3F7VB 1BIIA 4LPCA 1EVUA 4HUUB 1A1OA 4IOSD 2W65A 3R06A 1D6EB 3MRFA 5IFJB 5F96L 5D1ZD 4LBEA 4OZGB 1F6AB 4YDIL 2EYSA 3HPJA 2A83A 4N9GA 5C2BL 1QSFE 2LU3A 1KLGB 2FEDD 5HDBE 3QXUA 2AXFA 3PG2A 2VDRH 3BZ4A 1J0YA 3SDCA 2P5WA 4O2EA 1U6AH 5FUOH 1XFPA 3F5WB 1ZVYA 1EFXD 3K74B 3G6JB 3LKRB 3U7YL 3QCUL 4W6YB 5LWYL 1T3FA 2ARJQ 3RDTB 2X1OA 2EXWD 3TN0B 5LAXB 2F53A 2C3VA 2LFGA 4JZJA 3PDDA 1NCBH 1ZLWK 3RVUC 2JCCE 4KJWC 3M07A 4FHBD 3ARBC 3MUHL 4RX4D 3HMWL 3VXPA 2P7TA 1NFDF 3C09C 1JIBA 5MENA 5E4EC 2QR0A 5FV2A 5K9QI 2OTUB 4HPYL 1UVQA 4JM2F 4GKSB 1XR9B 1CG9A 1SQ2N 1ZA6A 2A83B 4N9GB 3P4MB 1ZHNA 3HZMA 1CD1B 5AAMA 2C3WA 3LKSA 1VHPA 1YC7A 1J5OH 1IC1A 4JDVA 4JM2A 4WY7L 5DMYA 4CDGC 2YWYA 2P8MB 3X3FH 3LIZH 3VWJA 4WFFD 1IGJA 5IJKC 1JF1A 2AXGB 1Y6NR 2BOCA 2E7BA 4LU5L 3MNZB 4ZSOE 4Z6AT 3WIFA 3NIDF 1RIVH 3BXNA 4ZUUA 3NH7H 1GC1L 4PLJD 1TJGL 3V95A 3V6ZA 4PJDE 2A6JA 4YDVA 5C9JB 5E2UH 1D7FA 1PZ5B 4M6OH 35C8H 3SGEI 4NQDB 2CRYA 3KPSB 2ED9A 3ET9F 2L4OA 3BPLB 3ZMRA 1J88A 4Z78A 1I1AC 2FYYB 5DEZA 3V5DB 2BOCB 2Q8AL 3Q5TA 1IC5L 4XNXL 4GG6F 1NAMA 4JPKL 3UJJH 5AYQA 3HRZB 3GNMH 3RZCD 2MNUA 1S9VA 1G7JB 4OKVA 1CDJA 4JDVB 1RURH 2GTWA 3WIIH 4NKQB 1RV6X 1LNUA 5JIPA 4FABH 4X8XA 1LE5B 4E0RB 4YNYB 1J1XL 3ZTNH 3ETBF 1FFOB 2DQIH 3W0WD 2DI7A 2R0WH 2FWOB 3FB5A 5I15H 1FZKB 1HH9B 4CVZA 3RTQC 1NANH 2QKIB 1FCCA 1S7XA 3NN8A 1PYWA 2DLEA 4LSTH 3R8QA 2FATL 3SKMA 3L3DB 2YD7A 2VIRA 3QUKA 3MCG1 4X4XA 5HHPA 5I75C 1UWGH 2HG5A 4PTTB 5EU6A 3O3BA 3RWFA 3KJ6H 4RGMB 1Z5LB 2AXHA 2HMIC 4HJGB 4TRPH 2EDHA 3QDMD 1G7PB 4E5XB 1OM3H 4BSVB 4QRTA 5GRJH 3FB6B 2BNQB 3S5LG 1P84J 3GMOB 3ESVF 4PP1D 2BRRL 3B43A 2AS5M 4ODHL 3RI5K 3ARBB 1F58L 3QI9C 4N8CH 4MHHI 3QDHA 4KI5E 3EYUL 1BQHB 4XI5C 5JW3H 3IVKB 3NIFE 4OLVL 5D7LB 1I8IA 4PRPE 2UUDK 3SE4C 5E6IC 1NCAH 1ORQB 5A2LH 1CDGA 2OJEA 3UJIH 1HHHB 1AXSB 3V6BR 3HRZA 4PJEF 4FQ1L 1JPFB 5TE4H 4V1DE 2UUDH 1AXIB 1FPTH 3DVGB 1C12B 4APQB 3O3DA 1RIHL 1TDQA 3FFDB 4CU6A 2WBJD 3GIZH 2V7HB 4ENEC 4PYHA 1D5IH 2Z92A 2VERN 5ACZA 4LLQB 4WV1A 4KZDH 4Y8AA 3OKDA 3DV6A 3DX9B 2A6JB 1QPPA 1ZGLP 5D9SA 2R1YA 1T5WA 5TDNB 2P48B 2E9WA 1JPST 2NYYC 3BXNB 3QJHA 3OB8A 1MHHA 4RGOL 3UDWC 1ZA3B 2IJ0C 3B9DA 3KPMB 4TUKH 2XKNB 4I18A 2XYCA 3FQUA 4KQ3L 4PJEB 3ZE0E 3BI9X 4TUKL 4ZUSA 5DD5L 1RPQA 5FO9B 3V5KB 4MNQE 1GGYA 4WW2B 3BEVB 3MBEA 4RDQG 4X7TA 4RMUA 2AP2A 4XPFH 3UBXI 1U2CA 4M7LT 3BSZL 1IGCL 5HYSA 4LEOA 1ZVSA 4KVCL 5C0FB 3VXTA 5SWSD 3PGCB 1IGTA 4WFFE 2OTUA 5EULV 3N85H 4Y4HA 2AW2A 1GL4B 5C7XL 2P7TB 4Y88A 4X4ME 5DJXB 1PG7L 2H3NA 4PR5B 3TIDA 2FZ3A 5EU6B 5TQ2L 3U4EB 2NZ9D 1UH2A 5LAXA 1J7VR 3WD5L 4MDJB 4RGND 5J4MA 2DWDB 3DVNB 3CZJA 4RISH 2DQUL 1AGBB 3R4DA 1P4LA 3JV0A 4RNRA 3ZYOA 1IGTB 5DTFB 4M7JH 1KIQB 3W2DH 5JZ7C 1JBJA 1MAKA 4BK5A 3EO0B 4BK4A 5T3XE 1ZS8A 5C0FA 5HHNA 3TC9A 1CT8A 5GS1A 1FPTL 4EDXA 3BP6A 3IKCA 4R8WH 2IADA 2BZDA 4HD9A 3UYRL 1U91A 4NM4H 4UQ3B 3S37H 3HUJA 3V6FA 3JWOL 3V6OE 1A3LL 5D70L 3BGAA 2QSTA 3KPRA 4Z95H 3KPMA 3QFJB 3VFMB 1FIGH 3C60A 4HCRH 4P3DA 1AKJA 1CFQB 4ZFGH 2HTKC 4B7LA 2WIIA 1M6OA 1PEWA 1PZUB 3FO2B 1XGUB 1OD9A 1A9EA 1JWMB 2EXWC 3P30L 5DD1H 2AK4E 5T3ZD 2NY2C 3EIFA 4MA8L 3HNTL 4WUUB 2XOTA 4YFEA 3MNWA 4QGTA 1HHJA 4CU8A 5IJVA 1CK0H 2F74B 5CJQL 3C5ZC 1MWAH 3FOMB 2DI8A 4KUZH 4QXUL 3CFKA 5DJCB 4F9PA 1DBMH 3WFBH 2J6EA 3RZCA 2N7BA 5IMMB 4KRLB 2XICA 3A6BL 1F3JB 1NFKA 2VC2H 2UY7A 2NY3B 3O9WA 1F4YH 3ROLA 5C07D 1WAAE 5HGBB 5FK9A 1MHPH 5F1KC 4I3SL 1E0OB 4QHUB 3UCRA 1YEKH 4KMTH 1JNLL 1KCUL 3FRUB 3RAJL 4LLWB 3S34H 2DOCA 2R4SH 3NFSH 3C9NA 1MUJA 3U7AA 2R8SL 4UZGA 5D7LD 4P4KB 3HPLA 4EI5B 3FB6A 4XVSL 4DN4H 4BSVA 1JGDB 1FORH 3H9SD 5CJXA 3V4PH 5C6TH 4XXCC 4NNYB 2OZ4A 3ULVH 1XIWC 4GO6B 3BKYH 3VXUD 4KKLC 4PJ7B 4WDIB 4CN1A 4Y4KD 5KS9F 1NBZA 2NY1D 5KN5A 4ZUVA 1MLBA 3SDCC 1XH3A 1SEQH 4K7FA 1GAFL 3LKQA 3T2QA 2VDKL 4PRAA 4P2OC 4TPRL 1CXEA 5EZJA 3SKMB 3E8UL 3VRJB 4G6KH 2IFGA 4F80A 5EH1A 4PJGA 1RJCA 1A2YB 1YDPA 4XPAL 4HWEH 3W81A 4L9LA 4YK4B 5TJWK 1YQVH 1U8QA 1GC1C 3MMEB 1LE5A 1EAPB 1QBLL 4M6NL 5IROA 3B9KB 4AEIL 4AEEA 1VESA 5GRXG 4I0CC 1O7SA 4OZ4A 2ZSWA 4PRBB 1G7JA 4KGLA 3THML 2CH8A 1EZVX 1NAMB 3SDYL 5AZEH 4JGUA 5CJ8A 3VD7A 2VH5H 3QEQA 4NO3B 4UTAH 5GGRA 5DMIL 2R39A 3U4BL 1DVFA 1YEEL 3VJ6A 3ULUE 4WV1C 5I2IA 4PRHB 5ICYB 4MGXA 32C2B 3NH7L 1RK0A 3EOTL 3RY6A 4AL8H 3O11B 3V7MA 5CMAA 3VRLE 3D25A 4HH9B 3ARDC 3IJYA 5GZOD 5E6ID 4ONFH 4ALAL 1B0GA 2UWEF 3B5TA 1IAIL 5CGYD 4ZUUB 2E8YA 1LO3L 1JNJA 3SCMD 4FFVD 4GRWE 1XF5B 1HEZA 1FAIH 4F7PB 1LEGB 1G7QB 1N8ZB 2B5IC 3BPOC 4LKCA 4OLUH 3AXLA 4DW2L 2VDRL 5K9JH 2GFBA 4AK1A 2NY3C 2OTWB 4Z7QE 4X4YA 4NT6A 2YXMA 1IEBB 4JRXA 1DBKL 5GGRY 3O4LA 4D0CA 1N4XL 4CL7A 2BDNH 5DMKB 4XXDA 2WINA 1E4XI 5F7YC 4RRPA 3RIAK 3WMSA 4HWZB 1F42A 1NDMA 4U7KA 3WXWH 1J8HD 5E5MA 5EO1A 2J88L 1G7LA 2IFFH 1MJ7L 2VLKA 2CK2A 3VXNB 3OKYA 5GPRA 1YZZA 3BT2H 3GKZA 2QTEA 3BGFB 4O58H 1CGVA 4XVJL 4ZQKA 3QFDB 5K9OA 5AZ2L 4YFLI 5ESQB 1WBZA 1NGPL 5DI8A 1KB5L 3SDCB 3P4LA 5CGTA 5ESQA 2VDOH 3I9GL 2GT9B 3GI8H 1YN7A 1WEJH 4QOKE 1KLGA 4F7MB 2VLRA 2BNUA 3KPTA 5E8DH 1A4JA 3DSFH 1DEDA 4N5EC 1B2WL 1KJ3L 1WICA 3UPCA 3EUUA 3KLAB 3TVMD 1T2QL 4IRSB 1VEMA 3WJJC 4YGVB 1MCSA 2D9CA 5LGKA 3GSNB 3HC3L 3E3QC 3EYSL 1OP9A 5D5MB 5MEOB 1GOGA 1CLYH 4NRXB 4EI5C 1KCSL 1TCRB 3QUZD 2BFVH 3Q6GH 1WUNT 1Z3GL 4LNVA 2AQ1A 1CBVL 1S5IH 3CX5K 3IXTB 3C6LC 3Q6GL 5D6CA 4ZD3H 3HMXA 4PGBB 4MA3A 2D9QB 2A74A 4M7LH 4P23D 3RWGB 4JGJA 4PS4L 3FQRB 5SWZE 3SKOB 3QEQE 3OHXB 2EEDA 4DGVH 1A22B 5CEXA 1ERNA 4OLUL 2VLLA 2EDWA 4P2OB 1PG7H 3PP3H 1J0ZA 1CDBA 43CAA 4PRHE 2Q87A 3VH8G 4LIQH 5JQHC 4Y5XC 3NPSC 3REWB 1T2XA 2F5AH 1N4XH 2X89A 1D5IL 2E7CA 3QUYB 5IVNA 2FBJL 2AK1L 3CFCL 3K2UH 1L7TL 4HQQL 5I8OH 1RUQH 4O9HL 3LRGA 1IGIL 1XR8B 1RSFA 3PWJB 3U9PL 3RWJB 4P2RE 5H35B 3KJ4B 1BLNB 4QHNB 1E6JH 2D7QA 2CKNA 32C2A 3P73A 4KJPC 5I19L 3RBSA 4G42B 2DKSA 5DD5H 2BC4B 5EFIB 1TLKA 2R29H 3TM6A 4QT5A 1SJXA 3F58L 3LB6D 3FCTA 1NH6A 3VXQB 2VLJB 4Y4HC 5CZXD 2F5BL 1A3LH 5D70H 4U1HA 5F88B 1IKFL 1K2DA 12E8H 5T1KD 5I74C 3AM8A 1EEZA 2DQCH 2DMKA 4FN0A 2EDTA 2CMRL 1NAKH 2P5EB 1CD9B 2N56A 1HOCA 3K2MC 2X40A 3WFCH 2FD6L 1K85A 3RWCB 4HUNB 3ELAT 3DIFB 2FD6H 5LJYH 5T3ZH 1CDYA 2NY5C 4OCNC 3JTTB 4RMQA 3U46B 2Y07H 5EUOA 1AQKH 4Q97A 3KNBB 3VXMD 2K7PA 3UBXG 2YUZA 3BE1L 2ADJA 4MAYA 1S5IL 2E6JA 4UT7L 4IOFC 2BJML 3BKCH 3TV3L 4NKDA 1MFEH 2WMPA 3IJSA 1N5YL 2JIXD 5IHZA 1F4YL 5A2JH 3MRCA 2G2RA 4HUWB 4YAQA 3HG1B 1WCBA 3QRFM 4HIIB 3SHSA 2NYYD 3ZE1E 5KJRH 3PP4L 5GGSB 2WAHA 1L0XA 3PQYE 4LK4A 4NRYA 3IDUA 4KJQD 2UZIL 4RGOH 2CIIA 1DBAH 3LVEA 5GRVL 1SYVA 4OI8A 2VKXA 1K2DB 4PJCF 1TTUA 1SY6L 2PTUA 3SQOH 4EBQL 4OV5B 3QZWB 4I0PA 4KHXH 2DIJA 1FIGL 5CHNB 1VEOA 5FA4A 4X4YB 1I7RA 4XBGB 1M1SA 1K8IA 2VWEC 2EYTB 3UTSD 3GMPA 3GGWB 1AO7D 4OZHB 3UTTE 1DQJA 5J13C 3BWAB 4PJCA 1GZPB 4XPHH 3O2DL 2UZYB 1I7TA 4XPHL 1SEQL 4FMFA 1I4FB 4HWBL 1MIEH 1SMAA 4H0HB 5C0AB 4HDIA 4S1DD 4KK9D 1J05A 4W4OA 1LP9E 2NX5B 4PJIF 4XPBL 4PLKD 5EU4B 5DA0B 3SCMC 4F8QA 4Q9CA 5F9DC 1IT9L 1C7SA 2AJYH 5CGYC 4IRSD 4MZ3A 1A21A 1Q72H 1YEJH 1OSZB 3ARFC 5KAQF 5CBEB 2NY5L 4RAHA 4I13B 1Q0XL 2A77L 5F7LB 1UEMA 3GKWL 4Z7NF 1T83A 5E9DA 2ICEA 5DJ2B 1NFDB 3V4VH 2VLRD 1TJIH 3VWJD 4L4VB 4MA3B 2DYPB 3BDXA 3HUJB 1L7IL 2FH6A 2HYMA 5E24E 1S9KC 3CXHJ 5I8EB 4LEXH 1OT2A 1T6WA 2WBKA 3JXAA 5DRZA 5A1AA 2CIIB 1R3LB 3V4PL 2DDQL 4NRXA 4OGAC 3MRLB 5EBLB 3OKKA 3NCYP 1DQDH 1MQKH 2BNRE 5FM5O 1RZIA 4G6ML 1YDPB 4JG0L 3RNQA 3UEZA 3PWUB 1ZXQA 1KIQA 3ZYJA 3BVNB 3MJ9H 3CSBA 4LVNC 5FYJH 1DDHA 1IMHC 3KXFD 5DJ0B 1BQLL 3GMRA 3TWCH 4ZNCD 3LRSB 5F3BA 3ARWA 3CDCA 1FDLH 1L4IA 3SDDA 3ZT5A 2ZUWA 4R4BA 4X8JB 3QFDA 1TQBC 1B9ZA 3DUUA 4FQLL 4PG2A 1KTLA 1FO0B 5DHXB 5ADOL 4CMMA 4QCIB 3S5LB 3V2AR 1NC4A 5JOEA 2ZCKH 4PJCE 4HMCA 3RL2A 4Z7VF 1CE6A 3V4UL 5MEPB 1I3UA 5E2TL 4JDTL 1QSEA 1UXWB 5IVXB 3TFKC 1OTSD 4NCC1 5JXEA 2IG2H 4EI5A 5F1OB 4NGHH 4F15B 2JIXB 4LLYA 3TIEB 1FVEA 1U9KA 5CCKL 3H0TA 1R5VA 2VAAA 4XB8A 3QIWD 3HG1D 4PLJC 5CCKH 2OL3L 5HDBF 5T1KB 3QYCA 3C5JB 1MPAL 2Z91A 3QO1B 4M00A 4Y4FC 1JMXA 4YX2L 3OKEA 3DETD 2P5ED 4WFHE 3RJQB 3N0PB 4ZUSB 5MP6L 3D39B 1RJYA 1SM3H 1U93B 2R56H 1MF2L 2J88H 2XKNA 1GGBL 5DZNA 3MV7A 2OI9C 2P8LA 2CJUH 3WN5A 1EO8H 2AABH 1EXUB 5I75B 1ZHKA 3AXLB 4G6FB 4LU5H 4UT9H 1BM3H 4YPGB 4NN5C 5IMMA 1JHKL 4Q0XL 4Q9RH 4YHPA 4R4FL 5J13B 3MREB 1UJTA 1AI1H 1Q8MA 4P5MB 1GAFH 4KKAD 4I0KA 3JUYA 4IRZL 4D3CL 3AS1A 2HA1A 5JLZA 3UBXA 1V7NH 3UTPD 1ORSA 1PVHA 2ESVA 4Y16C 3MRQB 2C4FU 1WK0A 1IL1A 1RHFA 2XZZA 4X5XA 1AO7A 4Z7VA 3TH2T 3KPSD 5T3XL 2EE3A 5ICYA 3OHXA 2ZJSH 1YPZE 3ZDZE 5C8JA 2WQRA 4PJBF 3D0LA 4CN6A 1BVLA 2ZJSL 2Y36L 2WV3A 1A7NH 3AY4A 4HF5H 4U1SB 1UYWH 2VOTA 1B0RA 5I8CB 4JPKH 2FSEA 4PJFB 4WGVB 4DVRL 1F6FB 4JDZB 4JQIL 4O2CB 2V5SA 1W8NA 4JHWH 5EU3B 2X4SB 4ZYKB 3RX7A 5A2IH 3L6FB 2QHRL 5LWYH 1S5HA 1NSNH 3QDGA 5DT1L 4F57L 4Z0XB 4IRSA 1DLHB 6FABL 4ZFZB 1BOYA 3CLFL 1NGZA 3KR3H 2X4NA 2VLRB 3SO3C 1QP1A 3SJVB 3CVHB 4C83A 4L9LB 4NFBA 1NGYB 3GJEA 1K5NB 5ALCH 5DJZB 3QCVL 3S3SA 1XGRA 3OZ9H 1KIPA 1ZWIB 4K3DL 4PR5A 2AI0H 1QEWA 4RRPG 3MOBL 5FIEA 3OAYH 1MVUA 4JPVL 1G7MA 4Y4HB 2H9GA 2IAMB 4MD0B 4BQ8A 1MFBH 3BD3A 2JK5A 1Z9LA 3BQUD 5F7DA 1S7UB 5K9QG 3SEPA 1KB9J 4H20H 2PETA 3W0WB 3KXFA 1F97A 5FUOL 5ETUA 1QRNA 1S3KL 4KI5F 4L9DA 4PJHE 3DLQR 1DQTA 1V7MH 3BEVA 3KJ4C 4L5FH 2FGWL 1DUYB 3SOBL 1FAIL 3CJJA 3NFNA 4Z0BH 4G9FD 1NMCB 1IAKB 3RU8H 1KIUA 43C9A 5JHDA 4BH7A 4KV5F 1SY6A 4TRPL 5HVHC 4JE4B 1NCAL 3U9UB 3WFCL 2XKUA 4OCYL 3S35X 2J8UF 3KPOB 2D4DA 1RZKH 3BESR 5B3JF 1FGVL 5D7IB 4AIXA 5JXED 1A1MB 2R4RL 4F8TA 3DMMA 2IAND 1N3NA 4WFGD 1A0QH 3SDAD 2F5AL 3TBTA 1YY9C 2ICWA 2PYFB 1QA9A 4FZEL 4C56E 3EZJB 4CW1B 1X4XA 3VXMA 1J1PL 2F54B 2GKIA 3EDFA 5D7JC 2UVEA 3I6GA 3D18A 1B4RA 4I5BA 2F54A 3FQXA 4XP5H 1T66D 1EBPA 4UIMB 5KVDL 3BD5A 1YMMD 3GSNL 3O8XB 3PP4H 5SX5H 3OL2A 3VWKA 1IKNA 4DGIH 2YK1H 5HYEA 4J4PC 4JFOA 2R0WL 4JLRA 1BIHA 3T1FB 4Y0GA 4G8GD 1FIEA 1MCEA 5CFHA 4NKIL 2ERJB 2YPLA 3P0YL 4LSRH 2DLGA 4QHMA 2FATH 4U0RB 1KCSH 3VFPB 4KHTH 2V9RA 1FE8L 4XPTL 3RL1B 1U91B 3BMWA 1CD1A 5INCB 4GKNA 4Q6YA 3QG6A 4ZO8A 1MAJA 4R97B 2IADB 1UWEL 3C2AH 4CJ0A 1KN2H 4MA7H 1I7UA 3P9MB 2LV4A 1A6VL 4LNRB 5IESH 1A2YA 5DQDH 4L4TD 4KQ3H 4W81A 5B38B 2XN9E 4OSUL 4AH2B 3VCLA 1AH1A 4NJ9H 2HT3D 3KDMB 5DUPH 4LRNL 1MFEL 4PGCA 3MRJB 2Q8BL 5KANG 3NCJH 1H3TA 1OTSC 1AD9A 4M48L 1FZJB 4X6FB 4UNVA 1Z0NA 4WWKB 8CGTA 2IH3B 4LPXA 4Y2DC 5I1CH 2WZPD 1JHTA 4O2EB 3AU1B 1A5FH 2AV1B 4GMTH 4E42A 4GAJL 3BZEB 1T04A 1U8HA 3MV9E 3TYGH 3MR9B 3O4OC 1TJHH 2O61A 4CMHC 3D87B 3TA3A 2MQ0A 5FECB 3H3KA 1JPSL 5HYSG 2A6IA 2VN7A 2AK1H 3K2UL 4LGPB 4J3OC 1QBBA 4ZPVA 4NOBA 1AHWA 3VXME 1FYTB 5AUMB 3C9NB 3SQOL 4LCYA 4EBQH 3A6CH 3W9EB 1JI2A 3PJSA 2W65B 3R06B 3T1WA 4P5TA 1XIWB 3BQUB 4DKEH 5ITFB 4Z18A 1GOHA 4YHKL 2NXYC 2MHAA 1YECL 4LCWD 3C6LA 3OAUL 3S4SB 1T7VA 2PYEE 3FQUB 1QLEL 2VYRE 5F1IA 4WO4A 1AQDA 2OMBA 4NQEB 1EBAA 1QLEH 5FDYA 1P7QD 2VZVA 3T65A 3BWUC 4XHJC 1H3GA 4QRPA 3C8KB 5E1AB 5IEHA 2IPKB 5IROC 1RI8A 5C2UB 1OAXL 2FIKA 4PUBL 3WKNA 4ODWB 2E9BA 4UOW0 3KHQA 1U3HB 3IDNA 2JF1A 1RUAH 4MQ7B 2MKWA 4QRRB 1YNKH 2FECI 3CVIH 1U3HA 4BSJA 4I2XE 3QSKB 2ZCLH 3GI9L 3I84A 1MCRA 2CR3A 5HVGB 5TQ0H 1A6TA 2C3HA 5IBTH 2IPKA 7FABH 3TJHC 2WIIB 4FQJL 2ICCA 2OR9H 2BOBA 1CICD 1FLRH 4ZFOA 3WN5B 3HC4H 4ERSL 2OJEB 1JNHA 1SHMA 5DYOB 4QGYA 4IOIB 2QADC 3QQ4B 5ITFA 2BRQA 5BO1H 3I85A 5I1KL 5IB2B 3SPVB 1WZKA 2XV6B 1A8JH 1S7SA 4DFHA 2GIYA 3WD5H 5GZOC 4NQEE 3GSRB 5HHNB 2ARJB 3QXTA 3AM8C 1QRND 3CMOL 4OF0A 1AHWC 5ALBL 3VG9B 4ORZC 1XF2A 4MD0A 4GBXC 2H9GB 1WJ3A 1KYOJ 4F9LC 5C07B 4O2FA 3GM8A 4G9DA 3X14A 1Q9WB 3ZKNC 1GZQA 3KPQB 1MWAA 1VB9A 3SGJA 2SEBA 3GBNH 1K4DA 1IEHA 3IU3B 4Y5YB 3RWFB 3AB0B 1LO4H 4KUCF 3MJ9A 4NZDA 3L3GA 5BZWA 3F6LA 1K5NA 3UTQB 1O7VA 3NAAL 5CEZD 1DTUA 3HZVA 4PJ5A 1IT9H 1JK8B 5JPNA 2V2TB 4C55A 1TFHA 2QSVA 5J1TC 1T1WB 1OP5K 1B3JA 5CWSB 4BUGA 5JOFA 4GKNB 1RZIB 1ZTXL 3VXTB 1OB1B 5C0CD 2GJ6A 2DQHH 2HJFA 3QFJE 4KTYA 4ONHA 4QY8A 3ZL4L 4GW5B 4M3JA 1DANU 4X99A 5D1ZC 1H0DB 2QSQA 4BQ9A 1HKFA 5GGVY 4P57B 1GGBH 2DQUH 2FX7L 3MJ7B 5IMLB 3O8XA 3GJFK 2V5MA 4W4OC 5BJTB 4Y16B 2D7OA 1AC0A 2Y72A 3VXSA 1P9MA 3T1FA 1J12A 1J18A 4H0GA 4WI3A 3TZVA 1U0QA 1XIWD 1BD2A 5IR1A 1CS6A 4LLQA 5CGMA 4GRLC 1MFAL 1T22A 3D18B 2BX5A 1XF1A 5KS9E 4WWKD 4OFIA 4YBQC 3TT1H 4M6ML 4YHPB 4QTIH 2EZ0C 2GSGA 5HGDB 4G6MH 1IKNC 1MFBL 3LQZA 5FFLA 4NP4H 2EECA 3VFNB 2W0KA 3RY4A 3OR7A 3O0RH 1U6AL 4XNUH 4CNIA 1RULH 1E4KA 5GGUA 4DCQA 2VLKD 4Z8FH 1T1YB 3LPWA 1RZFH 1FBIH 3FFCE 5CSZA 3SE8H 5HYFA 4F58L 1A6ZB 1V7ML 3K4AA 4PRHD 5FA4B 3PJSB 2JLLA 3ALPA 5D5MF 4MNHA 1DCLA 3H8NA 3C6SB 2Z31C 3S9DB 4BM7A 1ZHBA 3ARBD 3MRRA 1EPFA 4QLRA 3I6KA 1JWUB 2DI9A 3C5ZD 1P4IL 5F97E 4KK5D 4LKXB 3TO4D 1EHNA 2DB8A 2P5WD 3D85D 5IBLC 3VGAB 1WQVT 3IETA 4P23C 2JK5B 3WLBB 2HJLB 3FTGA 4X6DA 5I18L 2C4XA 3QIWB 2QLVB 4GAYB 4PGCB 2G2RB 3MLTA 1Y0LA 4NM8H 1WITA 4QNPF 2RGSA 2JJWA 3BGFC 4YHLH 3UJTL 1I9IH 5DJZA 2QKIA 4IRJD 4GG6B 5CBAB 3BW9B 1KELL 5BOPA 1I7UB 3FT2A 4OQTA 5K9KB 5I1DB 3EFDL 4PY7B 1S7RA 2HFTA 3E6HA 3TO2B 1BD2E 1KEGH 3LPFA 4Z0XA 3MA9H 4MCZA 4M61A 2FJGA 4OBRA 4QRPD 3BDYL 4FQCL 5JTWA 1U92A 3JWDC 3MLVH 3MRPB 4GUPA 3PIQB 3L6FA 3QCTH 3P77B 1S7WA 2ICES 3JTSB 5FKAB 3RVTC 5KVGH 4XP4L 1JGVH 4AIOA 3QCTL 1UWEH 3C2AL 4RDQF 5C8JB 1QFUH 4ENED 5I6XC 2PXYD 2ERJC 3UTOA 1FV1B 3G5VB 1OL0A 3VWKB 4XHQA 5HVFB 2E5EA 5J12C 4PIRF 5JW4R 4JM2D 2AV7A 1FZMA 1YEHH 2ZKHL 4ZAKD 4P9HL 1OWRM 2HKHL 1T4KA 2YUXA 1CLCA 5J1AA 5FF6A 5FYLH 2ICWB 2HN7A 2PYFA 4DAGH 5KS9A 1FNSL 1J11A 3NTCL 2APWA 2F15A 4APQC 3MLUL 3QIBD 4OD3L 5DJYA 4N0UB 4ODVL 1KEMH 3IAQA 5HHMB 2COQA 4X6DE 2R23B 3TBSB 3QO1A 1BECA 2ENSA 2I5YH 4D2NA 4DOHE 5GS0L 8FABA 1HIMH 5HY9B 2BXYA 5T1KA 3PWVA 3RWIA 2VE6B 5C0RL 1QSEB 1UXWA 1MI5B 4YO0B 1HXYB 2H1PH 5T33H 3KJ6L 3WUWA 3O3AA 1WEJL 1FVEB 3OXRA 1DFBL 1MFDL 3VXPB 4Y16D 3VH8A 4JFEE 1KJ2H 1EIBA 2UVFA 4IBLT 2OR7A 5HYJA 4JZJB 4NJAL 1NGQL 4XAWH 2AJ3B 4LMQI 1P7QA 4YXHL 5IVZB 2J6EL 3DRTA 4JZOB 4OCMC 5D93C 4NKDB 1IGYA 2I25N 5IB3A 1DEEB 4EUPB 3TJEH 4JFDA 1ACYL 3I3EA 2P5WB 4HXBL 3GJEB 1WBZB 1EHLH 5EUOB 1JGVL 3ARFB 1JFQL 4KKBC 3SJVA 1GXEA 1K9TA 1OF2A 2FLRT 4HIJA 1FGNL 4Z77A 3BIAX 3DGGB 4PD4K 1U8LA 1INDL 2VLKB 1CLZH 1IRAY 1SBBA 3MZGB 3LV3A 4HZAA 1PDKA 1S5HB 3S4SG 1A6UL 1I1CA 5I16B 1WAAF 4P49A 4O4YH 4Y2DD 2CRIA 1NFDA 3QQNA 2QQKH 2YPVL 5AG9A 3VXRB 4FS0A 4OFPA 4AY0A 5JDJA 3O8XD 4FFYL 1UFUA 4KV5E 3I9GH 5C0EA 1U8KB 3O3UN 5DJAB 3O4LB 4D0CB 3S6CA 4NZTL 1PX3A 4HIEA 3WBDA 3PHOA 3FQWA 1P6FA 1AO7B 4QNPE 3IFLH 5J6HA 4PGDB 3PGFH 3D0VA 1LO2L 4F9PC 2E7HA 1A6WL 1FFPA 4LVHC 1XCQB 4M7ZC 3BP4B 1HKLH 4OD1H 3TBVB 5J12B 1Z3GH 1CBVH 4G8FA 3QUYA 3V9FA 4LQFL 2IWGA 5EOTB 4KZEL 2AJUL 4R7NA 3DHMA 1W0YT 4MJ4A 5T5FH 1QKZH 2P8LB 3X12A 5BMFL 1G9NC 3OGOE 3FKUS 1NPUA 1AIFB 5CLWA 3P11H 2YRPA 4HUVB 3FQRA 3T8XA 4Z7WF 5D5ME 4UINH 1IM9B 3X13A 3L3KA 1JYNA 4ETQA 1KENL 1QFPA 4P5KB 3JV6A 4FFWC 4XBEL 3AS2A 5TE6H 1H3WM 1QR1B 4FP8L 3WHXB 2ESVE 3AFLA 4HAFA 3GSOB 4M5ZL 5CZXC 4FFWD 1OGAE 4J1UB 1AO7E 1BZQK 3RL2B 4OT1L 3B9KA 1BBDL 5EOCL 3WDJA 5I66A 4DFIA 3ZHLA 1TETL 4LCCB 2VZOA 4OLXL 3B83A 5HHXH 3MUGA 1E6OH 1FYTD 1R5WB 3LEXB 3WFZA 2X9YA 3RX8A 5FYJD 3S97C 3HMXH 4WW2C 5B3NA 2HJKB 4MA1C 2E6PA 4HS8H 4K7FB 4ZUWB 3HFMH 2VABB 5E8OA 1P7QB 4YPJA 2P5EA 2VKWA 1XAUA 3N1GC 4POZC 3SCMB 4FXKB 4KKNA 3DIFA 5F9OL 2VQTA 5KG9B 3O6FA 1QR1A 4U1MA 5T3ZL 3QWQB 1U8OB 3WEXB 4K55A 5HDOA 3RVUD 4ZSOB 1MRCL 3U7YH 1A6WH 2C1PA 4I3RH 3S96B 1YNKL 2AVGA 4LCUA 4PJXA 2EIBA 3EOBA 4YE4H 4GQ9H 5E70A 4XPBH 1IGCH 5BRZD 4DKFL 1A7RH 1BQUA 5CILL 3U7WH 3MV8A 1LILA 5BOZG 4U3XA 4WW2F 4KVNH 3S3JA 4IOFD 4OFYD 4PYGA 5HI5C 4PJ8A 2RBLA 3CH1B 1IM3A 2NY5H 3F65A 4L29B 5F6IB 2P24B 2VO5A 1C08A 2WP3T 1G6RB 1YJDC 5IM7A 3ARED 1SY6H 5DDHA 3VDCA 4ODUB 2RFXB 5GISH 5BXFB 5AYUH 4PY8I 4NC1C 3FO1A 1W72A 3ULVL 1QFWL 1KACB 5GRVK 4KROB 1LD9A 3QHZH 2VLLB 4P4KD 1QFWH 5DLML 4D9QE 1NDGB 4Z7WA 3KPPB 1E4KC 4RZCA 2DTMH 5TE7L 2VRAA 4TPRH 4HF5L 4NOFA 1I8MB 1MCDA 4GMSH 3MRPA 2XZAH 2V17H 4WFEE 4O02H 3V6FB 4OZ4B 2OI9B 4MNQA 1Z9MA 2F54E 1EHXA 3CFBA 5DVKA 3QIBA 2F9BT 5ID1B 2VXUH 2A73B 3MACL 4X98B 3VE0B 1MCPH 5E00B 2JJUA 5ADOH 4QHLA 1MRFL 4KAQH 4KQ4H 2CRZA 2I60L 4Y2OA 5F9OH 2J8UB 3BUYB 3CZFA 2UWEB 3S37X 3CDFA 5IKCA 4XCYA 5GSRA 1KJMB 4WHTB 2ZUQB 5FHBL 5F72S 3EO9L 2L7UA 1L9NA 1X4ZA 3CCHA 4GAYA 3FB7B 1D9KA 3TCLA 4DUWA 3L5WA 1XCTA 5BW7A 1JZ3A 3DX6A 1PLGH 3STLB 1OW0A 4XMLH 1G9EA 2DQJL 3LS4L 4QRQB 1TTFA 5DHYB 5DR5L 3S35L 3WDIA 2EDDA 2YD2A 3I6KB 1DR9A 4L4TE 1LDSA 3BMVA 1ODAA 2E6QA 5KSAA 1UM6L 4GAFB 2XIDA 3FN9A 3IDMA 1X5HA 1YJDL 1LEKB 4X5WA 4JPVH 4P48A 4XVSH 2JJVA 4FQLH 3QA3A 5EZIH 5L2KB 4QRRE 5EWIH 4JB9H 4JRXB 1G7QA 1VADB 2BY1A 4DWHA 3SQBA 4PJ9C 3DMMD 4HS3A 3SKNA 3BO8A 3QPXL 1FRGL 1VPOL 4G8GA 1F58H 1LP9B 2NX5E 3GSVA 1K3IA 4N8CL 3QB7C 2H8PA 1MRDH 4JKKA 4L8SA 5M95B 5FYLL 4XCCH 1MCWW 4WV1B 4BFBD 1FZMB 4QOKD 2P43B 5IWLA 5AG8A 5IFAH 3MNWB 3ZSTA 5IJVB 5JMRA 1OAZL 3HE7A 4HKZB 5IQ9A 3ZO0A 1FV1A 4WCYL 5FCUH 1A6AB 2GW5A 1MCPL 4ZAKC 2BXZA 2APFA 4U1NA 3CDGA 3GB7B 5FUCC 4AM0B 1OAQH 2P4AB 3STBA 3CU7A 1AI1L 1ZGLA 5AZ2H 2NY3D 4GS7C 3WFHB 1GJIA 3T04D 4PY7A 5F7KC 2MPAL 3RBGA 4G8IB 1A47A 1NCDL 2AQ2A 1R3IH 4BFGA 2AAVA 3HZKB 3EO0A 4V2BA 2VABA 3HE6B 5J11B 4ZUWA 2DF3A 4WJ5B 3GSUA 2BNUB 1I1RA 5EIIA 1UADC 4LSRL 4C56B 2D7TL 1OVZA 1UJ3C 3BX7C 3VFUB 3IJHB 4H1LH 1ZE3C 4RGMC 3SGKC 4ODTH 3MYJA 3VG9C 1VCAA 2F58L 1KGCD 1R5IB 3MGTB 2EZ0D 2R0ZL 1DQLH 5E8EB 1NBVH 2D2OA 3IF1B 5E6IA 2V2WA 1P4BL 1XH3B 3H7BB 2FH8A 4MSWA 3FT3B 4Y4KB 3QUZB 4DN3L 4LF3B 5EWIL 1I3RA 3HLAB 2VDML 4M8QB 2ZUVA 3RNKB 1H9VA 5DXWA 2OQJB 4MJ6B 4GG8A 1KTDB 1SVZA 1I7ZB 4D8PA 4AENA 1SJHA 2H45A 2O5XL 4UUJB 3WIHH 4WHCA 4L4TB 4OGYL 1A6ZA 1M05B 4MB5A 1FNSH 3MBEB 1BQSA 3QNYA 4P4KA 3QAZC 1M7IA 1N5AA 3BISA 2YS4A 1RFDH 5DRXB 4RFOH 1II4E 1IC4L 4H20L 5KSBE 2FYYA 3K4DA 5IHBA 3RIAF 4ODHH 2AJXL 5C0RH 1HWGB 5C0DA 4R26H 2W0FB 5IW6B 1NAKL 4P46A 1P53A 1NC2B 4WUKL 5E7FA 1HHJB 2YSSB 3ARYA 4KH2A 1MCOH 5TF1H 4ZS7L 5CSGA 3HNTH 3O3EA 3T0AA 2A0LD 2R2EB 1JWSB 1IJ9A 2YXFA 5ENWB 4OB5L 4PJAB 4XCEB 3ULVF 3NIGF 5IW3A 4X9BA 5KSBF 1A7QH 1N0XL 4K94H 5I16A 2EYRB 3VW3L 1ZVHA 2HP4A 5JW5A 5E08L 1DUZB 5ICXA 3SDDC 3MRBB 5J56B 3V0VB 2EO1A 1YQ2A 2W92A 3KYMA 3LQAC 5KSVA 3LN4B 1M4KA 2VXQL 3VA2C 4OCXL 4QRRD 1A5FL 1MEXL 2F53E 5F3HB 1ZS8B 1S9WB 1QSFD 2B8OT 4PP2B 2XY2A 2IBZX 2VXVH 5F1NB 1INEL 2BP3A 2RB8A 4UQ2A 3L3GB 5EBWB 1UB5A 1C5CH 2NY2D 1RK1A 1JUFB 2FX9L 3RVXC 3KPQA 3BRDA 5KTEL 4ZO6A 3W39A 3DRTB 2DQFB 5IVZA 3VCLB 2XXMB 2XTJB 3G5ZB 5KN5B 1J0IA 1QHPA 4D0BA 2H26A 4M7KH 3FQTA 3TIDB 4JKMA 1XF2B 3OAUH 4X9HA 5KZCD 1ND0B 3O2DH 2WWMC 1V3KA 5I19H 4LSQL 1PJ9A 3ZDYF 4YUEH 2ICWI 4G5ZH 5C7XH 3L5JA 5DUMH 3VXSD 3LN4A 1I9EA 4KKAC 4MQXC 4ZXBB 1RIUH 3TBWB 5DYOA 5HHVL 3V7AE 4LVOC 3EHBC 1RZGA 4P2QE 2VSCA 2ATPA 4Q6IB 2QQNL 5DD0H 5GGUB 3U36A 5ENWA 3W82A 1I8KA 2CMRH 3MBEC 5B21A 1VENA 3DARA 2OP4L 2V9TA 1ZA3A 1QR4A 3DX9A 3CFIC 2A6DB 4H5SB 3O9WB 3X11B 3ZDYE 4JPWH 3BAEH 4HKJA 1HWHB 1D5XA 3F7RA 2XN9B 4U6VL 4BYHA 5GXBB 1Z0MA 2XPGB 3RZCB 4EI6B 3P4NB 4YDVB 3JUZA 3INUH 3CGTA 4NWTH 2ZNWA 3TFKD 3JWOH 4JJHA 3DXAE 4G7YH 1N5YH 4XVUC 5C09A 1PY4A 4U6HA 2N4IA 5EOCH 4RBPH 1TETH 1CGSH 4XMLL 1MLCA 3CMOH 3OKLB 3OX8B 3FO2A 1T1ZA 3MRIA 4WU5A 1ZANH 3VWJB 5CSBA 1DE4B 4KUCD 4NFDA 5MHSE 3B5GA 2EH7L 1N5AB 1D5BB 4F3FB 4IM8A 3MBED 4L1DA 3WIHA 2BSTB 2NXZC 2YMXH 1PY9A 4JQVA 4ZPVB 1B6DA 1JZ5A 2GJZB 2W1NA 4YDLC 2YMXL 3LDBB 1ZA6B 1PFCA 5JORA 3CC5B 3CFJB 3VFVB 1KXQE 2DD8H 4DJMA 2J3SA 1N59B 3L3IB 4KQ4L 1JZ7A 4JDTH 3NOIA 3QQ3A 3RIFK 4HV8A 1FRGH 1FL5A 2ICWJ 3GK8L 4WWKA 1JNLH 1KCUH 1NGWB 4QEGA 4EQ2A 2VL5B 1LDPL 1ZLUK 2ADFH 4D9QD 1G6RL 3ALWA 1OARH 4S2SB 5K93A 3UC0H 3HI1A 3U0PB 2IPUK 4LAQH 1RZJC 3IDYC 3IGAA 2GSIB 5EU5A 1T7ZA 3EYVB 3WLBA 3F7YB 1IVLA 1NKOA 3RGVC 3X14B 3WHE0 4HS6B 4YX2H 3K0WA 1QO3B 4N1EA 1WIPA 3BGMA 4L3CA 3GO1L 4JM4L 5DMGD 2NY0C 4KVNL 5D93B 3RHWK 3ULUH 2GAZB 1A02N 3LIZL 3T0XA 3S35H 4NUJB 1FZKA 1HH9A 4P4RA 4UT9L 2GTWB 2XTJD 4APQD 1JP5A 3LEVH 1TJGH 2C1OB 3CLEH 1PKQE 4QHMB 4WW2A 5ID0A 3BN9C 2FSEB 5T1DH 3RGVA 5DQJA 3WS6C 3O3EB 3GB7A 1ZT1A 5I17B 5ANMA 3O6KH 2YSSA 4X6BB 3QO0B 3NZ8A 5HGGS 1PZ5A 3HKFA 1D5ZB 3VGHA 4GOSA 1TZGL 4J8RB 4V1DD 1I1YA 4GXUN 2DWEB 5IB4A 1ED3B 3QUMH 2DWEA 5FB8A 4OF5A 3N9GL 5GJTH 4EI6A 4FABL 1JF1B 2AXGA 1MAML 4QRPB 3SO5A 1Q94A 3C8HA 3X11A 3MJ7A 5I17A 3QNXA 1YY9D 5EUOF 4ODXA 1AXSA 4TVSa 3D48R 1CD0A 4U2YA 1IGJB 4DVBA 2QHLA 4FXGB 1JV5A 1NC4D 1T83C 2PO6B 3OKEB 1ITBB 4V2CB 3ILQD 2GI7A 4NN6C 1X5JA 2MCG1 4JM2B 2I5YL 3DROB 5I8KL 3PWPE 4WEBL 2EE9A 4NNPL 2QV2A 3H0TB 1X5FA 5E4EB 5KW9L 2H2SD 4HKBB 2OQJA 4OD3H 1KG0A 4NQTA 4R9HA 3Q1SL 4JKPH 2PR4H 5H94B 5C2BH 5BV7H 2ZZUT 3O9WD 3BZFB 2X09A 5CEYA 2CLZB 4NIKB 3T0EC 1Z5LA 2JB6B 2K3TA 3R1GH 5DJDB 2BRRH 5D96B 4KJYB 3LRSA 5F3BB 4KTDH 3RDTA 1NGYA 3TEUA 2E3VA 2M1KA 4XCFH 1ACYH 4IIQA 5J57B 5CLTA 1NJ9B 2EXYD 1ROWA 25C8H 1RZKL 1A7OH 3MLSH 4K71C 4P46D 1ES0A 3HUJE 3PABA 4PP2A 1J8HE 2A9ML 2WNGA 5CP7A 4Y5VB 1KJVB 2WBWB 3SPVA 3TN0C 1JMZA 2ZCHL 3RX5A 4HUUA 2BVPB 3OKOB 4DOHB 3VW3H 3QQ4A 2BSTA 2VXTL 5FGCE 3WUWG 3WV0A 2GTZA 5FO8A 4P59L 1QSEE 4O4YL 1VA9A 1AE6L 4E41A 3DETC 4ZFFA 3WS6A 2ADGA 4JZJC 3GSXB 3MBXL 2BOBB 4RZCB 4XAKE 3MCLL 1TZHA 5JOPD 3T0ED 2OZ4H 2IANA 1VDGA 1QQDB 1IGFL 3RWHB 1IL1B 4QKXB 4LIQL 5DK2A 1MNUH 1QBML 5GSVB 5L2JA 3EYSH 1TZIB 3IFLL 3GIZL 1AD0A 1CFTB 2EIZA 2MCPH 2YA1A 5E8PA 3S36H 1F11A 4Q58C 3D69B 2VDOL 3DNKA 1EJOH 4POUB 4YPGA 4PJ7E 4NPYA 2X1PA 4OCRL 4G8GB 1FN4B 4L29A 3GRWA 3UMTA 2IQAB 5I30L 1KCVL 3S4SA 4M5YH 3WL9B 1SJEA 2CDGA 1KJ2L 4XC1L 1JI1A 3RVVD 1RU9L 4MJIA 3L3JA 4B7IA 4K7PL 4MNGE 4QYOA 3T4AA 3OR6B 1RZGB 1PQZB 2ZOKA 5TGBA 1W2KT 4JFQB 1YPZA 1TENA 1FYTA 1AP2A 4JRYA 3CDYA 3QULB 4PJXB 4LCUB 4WNQB 3SOBH 4JR9L 3D3VA 1MIML 3FJTA 3S88L 1U58A 3UZVB 4N90D 1NC4B 3RJDA 1S7UA 4K2UL 1J8HA 3FT4B 5A43C 3JWNC 1KEML 3ZKQD 5I0ZA 3U2SA 3DUUB 1FGVH 1ETZA 4RIRA 2DQDH 4JFFE 2C3VB 1HQRB 4OCWH 3BEWA 1H3PH 4LARL 1RJZA 3WS3B 2HJKA 1DDHB 4IMLA 1AFVL 3P9LA 5CIPB 3PV7A 4UQ2B 1AFVH 2UWEA 4M5ZH 2HFGH 3PWUA 1C5DA 1F3RB 4PJ5E 1OSPH 3OPZL 1FNEA 1MJJA 1QFWM 2WM0A 3CFEA 4HEPG 4I4WA 1YECH 3K1KC 4KK9C 2VAJA 4MJ2A 3OTTA 4OTXH 2EYSB 3HPJB 4ZS7H 5GRWA 1F6AA 2Q6WA 2EDRA 3SY0A 4YXHH 3MRBA 4J1UA 1A7PH 4K3JH 3QDGB 5I1AB 1D6EA 4G8IA 3N06B 4WI7A 4KZDL 4R26L 3T2PA 5D1ZA 4HZLB 2YC1B 3NFPA 4JFPA 4NQED 3VFSA 4Y4FA 3G9VA 5HYQB 1QRNE 1B0RB 3IDXL 1URLA 2JJTA 3VFRA 4QHKJ 2BNRA 4F33B 2AJUH 3I2CH 4U1KA 4EJ1C 3FONB 4HK0A 1QZ1A 5DD1L 4EN3B 5ITBH 5DEFB 4ZG1A 1UKQA 1M71B 1A6AA 1A9BB 4LSVH 3WLWC 2D31A 2IALB 3RWJA 4R7NB 1EFXA 3BE1H 2NZIA 4NQCA 3HR6A 4NRZB 4LCWA 3MLRL 4J3VA 2Q7YB 4P2YA 1WBXA 3QDMB 2R8SH 4I0PC 4R2GC 5L6YH 1FL3B 4JO1H 5CEZE 4JO4H 1BWWA 3QDME 4D0DB 5L6YL 3CH1A 3OF6D 5TE6L 3ROOB 5C92A 2LAAA 3P9WB 5I1CL 3QHTC 1WC7B 4FA8A 1UQSB 1WWCA 1ZLUH 3QXAA 4HIEB 5C0CE 2BCKB 4EXPX 2Z31A 4JFFA 5IW1B 4MAYD 4U1IB 2ATKB 4IS6B 5JHLL 4QF1B 1KSRA 1GVIA 3QP3A 4XVUD 3UO1H 1QRNB 5MEQB 1T21B 3HR5A 3S37L 4NC0B 3L3HB 4AENB 4LQFH 1PGRB 1PG7X 4EVNA 4PG9B 4Q9QL 5KG9A 1WV7T 1GHFL 5IGXH 1I3RB 2KPNA 2LVEA 3HFML 1X9QA 3JV4B 3OWEA 1MELA 1UM5L 1RZ8A 3MO1A 4QOKA 4LRIA 2HTLD 5F71A 2NXYB 1LK3L 2ADJB 4XC3L 3IS1X 2X4UA 3VGBA 4H88H 4PJ9D 5DUBA 1DQQB 3GMRB 2DQHL 1FC1A 4BH8B 4HCRL 4WHTA 3BYTA 1CFVL 4G80B 4TOYL 1IGYB 5EC2A 5L7XL 4P23B 2R0LL 3QIUB 1LO0H 7FABL 5KSUA 2VISB 3G5XB 2A77H 1FFNA 1EGJH 4X0KA 2LTQB 2XN9D 2DQJH 3LS4H 3RAJH 4YC2B 3H3BC 4EVNB 3QIBB 5ID1A 1KPVB 2GK2A 2FJHB 3QJFB 4ELMF 1FC2D 3EJJX 5SWSB 5IBUB 5I8CA 4WEBH 5T1DL 4YHMH 2Q76A 1IBGH 3RVXD 3VD5A 3FAXA 4H1LG 5J1SC 1VFOA 1AIFA 3C08L 2WBJA 4ACPA 5IEKA 4NT6B 3TBSA 1FG2B 2GJ6D 2R23A 2QADB 1WZ1L 2A6KB 2G75A 1DLFH 2APBA 3KYKL 2HKFH 1VKXA 2I9TB 4TSBH 1U8IA 4JY6A 3CVHL 1A1NA 5KANI 1VFMA 2EKSB 3KS0J 3N1FC 4ZPTB 1LEGA 4L8CA 3AY4C 1YYMH 1NKRA 5EN2A 1F4HA 4N5ED 5JHLH 3HRPA 3T0VA 3N9GH 5GJTL 1E4XL 5IHUH 4NRZA 3O2VL 5C6TL 2C4FT 5FO7B 1VKXB 4JJ5B 4JRYD 2WUBH 4XP6H 1I7TB 2AV7B 4ZPTA 3CXDL 1VACB 3GGWA 3M17A 1N7ML 4WIQA 3VFRB 4JQIH 5IK3B 1CD8A 3DSNA 5IEKB 5SWSA 3GNML 4QWWC 3ARZA 2ZUXA 1PEZA 5T1MA 2JIXA 4LLYB 1A3RH 5MP6H 3WXWL 1TCMA 2B7DT 5DHYA 3SDXB 1MJUH 5EZLB 3SY0B 1U8LB 1U8OA 3QJFA 4U1MB 1UCBL 2DIBA 2EC9U 3VGFA 3KPSE 4Z76A 1E28B 5C0IB 1KJ3H 2VISA 3BW9A 3VGEA 1EEYB 3HG1A 1TQCB 2FL5B 4BSWB 4D3CH 3CMGA 2BSRB 1RD6A 1EA9C 2P1YA 4PJIA 4M6MH 5JIIA 3EYFB 5E2UL 4OUUA 2D7PA 4NQCD 2XZCH 4JFHD 4Q2ZB 1PKQB 1VFBA 4HWEL 2RQ8A 1E28A 3MROB 4QTHA 3M1BA 3FN0H 1WZ1H 1HOCB 1INQB 4EEEA 2VR5A 1SBSH 4MNQB 5I8EA 5DC0A 4DVRH 1JRHH 4KRPB 1MI5A 2J8HA 2DYPA 2Z8WC 1RZFL 3F7PC 4U1HB 5EO9A 3NCJL 5HI3D 4K9EL 5E9DB 1RURL 3NPZB 1AR2A 3HE6C 5J11C 5E94A 4G9FE 2P8PB 3ZKMC 4ODVH 3PUCA 2GFBB 3QDAA 4K2UH 5DMIH 4HUXA 3TYGL 2AJSL 4OLWH 5CP3H 1N8ZA 3HMWH 4HT1H 3QXAB 1UQSA 5I1GH 2MFNA 2MCPL 5C3LD 1IC7H 1MHCA 1JJUA 3P0GB 1XGQA 2AK4B 2Q7YA 1C08B 2X2YA 3R1GL 1OAKH 5CMAB 4PRPD 3BPCB 1CXLA 2F5BH 3EOAA 1BJ8A 2EIZB 3NCCB 1AD0B 4JO3H 3EJYC 4MMXC 4PJCB 5IR1B 4F15C 1CF8L 5DMGC 3B3IB 2D0HA 3BIKB 4TTGA 4XAKD 5D2LF 2VMFA 1A9BA 2A6KA 2V2XB 3TCXA 1KOAA 1YEIH 1X5LA 3L5HA 3RFZC 3MJGX 4Y4FB 1YEFL 3U48A 2BNQE 4Y4KC 4G43B 3P2TA 1K4CA 4X7SL 1KCKA 2Y07L 2EDOA 4RMVA 3BH8A 2KBGA 3E6FA 4OLVH 1AXTL 4MCZB 5FO8B 1F4WL 2XWJA 2GJJA 3PL6D 4MDIB 1INQA 5F7FA 4X5LA 5CZVL 2ID5A 4WUKH 3PF2A 2GJ6B 4JQXA 4J4PA 1FGNH 1KT2A 1QFUL 1JHLH 1H15A 4JY4A 3MCLH 1INDH 1FNEB 1MJJB 3DX7A 1DL7H 4M8VA 4K8RC 4ZFOL 4HIJB 3B2VH 5IHZB 5SX4H 1AGBA 5JPNB 1SBSL 3U0TA 1H3PL 3KYOB 1C8PA 2B4CL 3CIQA 5MHSD 2HT2D 3IDIA 4HWBA 5E08H 4JFDB 5JHDD 4EUPA 1EMTL 1ETZB 4JKLA 1NBZB 1JZ8A 3BJLA 1KJ2B 1VGKB 3HUJF 1MVFA 4CKVX 5GS3A 4LSSH 3KYAA 1LWRA 3ARVA 4Y19E 3IU4H 1JGDA 1IC4H 4TVPH 3BHBA 4HFWA 4KKLD 2V5YA 3QISA 3WFDL 1CLOL 4XPFL 4R97C 1HXYA 5JA9A 5MEQA 3R0NA 2HTKD 3O4LD 2VL4A 2HRPH 4YHKH 1OQOA 2BC4A 2LVCA 2ESVD 3FO9B 4M03A 3NCFB 5IW1A 4M43L 1JV5B 2PO6A 4WTXA 4BJLA 5DQ9B 2YEZB 1NANI 3MV8E 1FNGB 3OR6A 1KIRA 1C16A 1MHHB 5BS0A 1Q94B 4NJAH 5DJYB 1XR8A 3O41A 1MIEL 4U1LA 1T0NB 1CZ8L 1RQ5A 4MQTB 1CXKA 1V3MA 2O26U 5HGHA 4X7CC 1KYOK 3TBVA 4JCLA 3IJYB 3B2UC 4OD2B 3WFBL 4R0LC 3F7QA 3QDJA 2WWMD 3TZVB 4J8RA 2QSCL 4IMKC 1U8PA 4APQA 3VFGL 4XVTH 3VWKD 2D4FA 5TH2A 4ZXBC 2AK4D 4LVHB 5IB5B 5DJAA 4DK3A 3EYQD 2DKMA 2Q76B 1MY5A 2YKLL 4RAUB 4CADB 2YD3A 2W9LA 2AGJL 4KI1A 3QXVA 1T80A 3QXDA 5BV7C 5MEOA 2JE8A 4O5LL 1CT8B 3G5XA 3S98A 3W0WE 2DYPD 2VXSH 3TYFA 1JGEB 2EC8A 4DGYH 1NL0H 2YR3A 1J87A 3MR9A 4FQXB 4HK3J 2DWDA 3HZVB 4PJ5B 3UX9B 1LK3H 2EDXA 5BCAA 3DX8A 2Y06H 1H5BC 5D7LE 1Q0YH 4X80L 5K9OB 1DSFH 3C09B 3IU3A 1QBAA 3D9AH 4NYLB 1OW0C 4JZOA 1HQRA 5D7IE 5GGSY 5E6ZA 5SWQB 5EIQA 1S7XB 5DD0L 4UU9B 2PO6C 1NUDA 3IDYB 4LSUH 1PG7W 5T1LA 3S34L 3T0BA 3LMJH 2XI9A 1UA6H 5ILTL 3W9DB 1MCBA 3GSQB 4NQVB 4X6CB 1KXVC 3BPNC 4KK6D 2VE6A 1LE9A 5DURD 5FUZH 1JCKA 3HPLB 4V1DA 1UB6A 4LAQL 5INCA 2Y5TB 1Z2KA 4XNYL 2PNDA 3MRGA 3QFJD 2F54D 3JSSA 3QUXA 3J8F7 5INDB 4P5TD 1IEBA 4KKCD 3C08H 5MERB 2NXZB 2CLVB 5KAQG 1I85A 2A9NL 1R24B 5JW4M 2CJUL 4YDLB 2MMXA 3OR7B 1N2RA 4FNLL 3GKWH 2NTFA 3BYYA 3L5XH 5DWUL 1XGYL 5EZOL 2BK8A 2Y36H 2IH1A 2VDQL 4L8SC 1E6OL 4LLVB 4OZIA 1TZGH 4WFGE 5FHAH 3QQ9D 4JVWA 4PJGE 4XC3H 5DHVA 1LEIB 1BP3B 3L7FB 3TWCL 5KVGL 4C56D 2PYEB 3CFKB 3O6MH 4N0CC 1IAIH 1R3HB 2VXUL 5DC4B 1I1YB 4ODBD 3CNKA 5IB4B 3TLRA 1ZT1B 4TTDC 3WIFB 1N3NB 2P47B 1X44A 5K59E 2R0LH 2FHFA 3L3OB 1YMME 1XGUA 2WWKT 1CIUA 4WENB 3QO0A 3RGVB 1SJVA 4E41D 1AKJB 4UV4H 1VFUA 1ZLSH 2NY0B 4ZS6D 3RPKA 3MRKA 4FXLA 1S7WB 3P77A 5FKAA 3PIQA 1ZLSL 4QXTA 4RBPK 2CO7B 1OOAA 5IVXF 2LU4A 2X89D 4JHAL 4EOWL 4I3RL 3MRNA 2VH5L 5E2WL 3L95A 1EUUA 2LQRA 2VUOA 2JB5H 1NCCH 1BGXL 4QTIL 2OR8A 4JO2H 1HI6A 4UDTA 3I75A 5CKGA 5CP7B 2QR0B 4N68A 3W0WA 3NPSB 3HC0A 1DQDL 4HX1A 2NZ9C 2NX5D 4J2XA 1IM9D 4YH6A 4N0YH 4J3WA 4G6AD 2H26B 3DVNA 3BGMB 5D2LE 2VLKE 3LSOA 4ALAH 1P2CA 4AL8L 4OCSH 1PAMA 5I76B 4NYLA 3EYVA 1G1CA 4NBYB 2X7LA 5B8CB 3GMNA 1KIPB 1ZWIA 3L3DA 4OQ1A 2Y5EA 4ZTOH 4JZNB 3NMEA 2LE9A 1D5MA 2O5ZH 4JHBA 4RMWA 3FT4A 2DD8L 2DQGL 4G9DB 5DJXA 2HKFL 2I9LA 2AABL 2Z93A 1ZLVH 2D03L 5HGAA 4LP4A 1FFOA 5IQ7H 2P44B 2NY4D 4WI6A 1NC2D 4HKBA 1QFOA 1A7NL 5H2BA 2ARJA 2VLJE 2BVEA 4PJBB 2E8ZA 4D9RD 2KQMA 4JVPA 4GBXB 1KB9K 5IG7B 5EIVA 5FHAL 1QYGH 4HKXA 4QRPE 1F90H 1DZBA 1U3HD 2MJWA 4XCFL 3NABL 1MREH 1P4IH 1YNTA 4IOIA 1F90L 4NN7B 3TJHD 4PJFA 2W38A 4PJ7F 2EIEA 1CDIA 1F00I 1CI5A 4PV8B 3PXJA 5GZND 5FK9B 3GSNH 5ADPL 1O5DT 4XNXH 4PJ5D 5CZKA 5SWZA 3BH9B 3LN5A 5DEGA 1E4WH 2EE6A 3GHBL 5I9QB 4RFEA 1F3JA 4BQCA 3P0VL 1MNUL 1WCQA 5GGTH 3L7FA 4UNTA 1BD2D 3K8MA 5DA4A 2PF6A 4TTDD 1G9MC 5C0DB 3G5YB 3ZE0F 5C9KA 5H37H 4HKJB 3MC0A 4JO3L 1Q9LB 5HGHB 2DJ4A 2Q1EA 3MBXH 4O9HH 1FVDB 3P4NA 1OLLA 4KRMB 3MNZA 4UTAL 5CJBA 1X5ZA 4HWNA 1F02I 3C8KA 1UZ6E 5E1AA 1OP3K 1H8NA 4HLJA 2ZSVB 5E8DL 2YD8A 3BZDA 5SWZB 4UT6L 4BZ1L 4HULB 5BV7L 4MJID 1JGUH 4NQEA 5IESL 3KPRB 5T3ZE 4M1CD 5TF0A 4X99B 4PBWD 5D2LA 3NIGE 5GS0H 4UQ3A 2HAZA 4OFVA 1S3KH 3AREB 3IVKA 1XIWA 1M05A 2Z91B 4B50A 3SBWA 1YJDH 3SDDD 4J7RA 3TBWA 3NTCH 2Q8AH 4NUJA 1NBVL 1MIMH 4OI9A 1JYVA 4S1RH 3REVA 3EKCA 4PB9L 4RNRB 2FLBT 3S8WA 4FFZL 4KK6C 2RHEA 4MDJA 3H42H 2FEEL 5D8JH 4AQOA 4CMMB 5J3HC 1NMCC 5TDOA 4OGYH 2AJZA 1RK1B 4XT1C 3VGAC 7CGTA 5E9DD 5ALCL 3PDOA 4U1GB 1FAKT 4XBEH 5BVPH 3TNNA 1P5VA 3QG7L 2DQFA 3U9PH 3MRJA 3W39B 3OMZA 5LGJA 3DX8B 4DZBB 2IBGA 2DJUA 1BHGA 2AJVH 4YDKH 1X7QA 2AEPH 4HK3N 4LSSL 3B9KC 1CCZA 1RFDL 1NGWA 4AQ1B 5C1MB 1XF4A 1UJ3B 4F37F 3NCBB 4LDLB