5CEZD

Crystal structure of the bg505 sosip gp140 hiv-1 env trimer in complex with an early putative precursor of the pgt121 family at 3.0 angstrom
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
240
structure length
240
Chain Sequence
b'EGQLVQSGAELKKPGASVKISCKTSGYRFNFYHINWIRQTAGRGPEWMGWISPYSGDKNLAPAFQDRVIMTTDTEVPVTSFTSTGAAYMEIRNLKFDDTGTYFCAKGLLRDGSSTWLPYLWGQGTLLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGLEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 44
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezD01
1GZQB 5DWUL 2DQJL 4G5ZL 4WJ5A 4HC1H 4PJ8A 2J8UF 4DN4H 3OAYH 1O7VA 3E3QC 4JN2B 4YX2H 2RCSL 1XH3B 3ILQC 3GSOB 3U6RB 3L3OA 4JFFE 4QWWD 1KCVL 1DBKH 3LIZH 4Q7DA 4X4ZA 5IB2B 1WV7T 3KS0J 3ZZ1A 5E95B 2R2HA 3FT3A 2YA0A 2DQTL 1AR1C 1VGEL 1PYWB 3CSBA 1CZ8L 1NDGB 1RZKL 3G9VA 4KDTC 4OBRA 1CICC 2UY6A 5D6CB 1YEEH 1EHLH 3WFCL 1KTKE 3I6KA 2ZCLH 4LCCC 3LS4H 3NVQA 1FNEA 1PG7L 5J12B 5HI5D 5DJAB 1TVBA 1W72B 2DLGA 4K8RL 2XKNA 4WY7H 4F7MA 2X44D 1QRKA 1NBVL 1RFDH 3AUVA 5E08H 2Y36L 4P9HC 4AENA 1GCFA 2GYSA 5IW6A 1MCLA 4RWYL 5EPMA 1YZZA 5J13C 3RJDA 3MRNA 5D6DC 3L3GA 1F6AA 1UJTA 1KJMA 5FECA 1U8OB 1BEYL 4M1GH 3QEQE 2F8XC 1V3MA 2F54D 4LF3B 1OP9A 3A6CL 4HFWB 3UTSE 4HBQA 2IANB 3EYSH 1AD9B 5JPNB 1OAKH 4JANB 5I1GL 5T3XE 2VQTA 3W0WB 3W81A 4W6WB 1NMBL 3DX6B 4OSUL 3DUUB 4NHCL 4OFDA 5BW7C 3K4ZA 2KBGA 3KLAA 4JVUA 1H5BB 5CJQH 1D5MB 3KLSA 1MCQA 5HHMB 2NXZB 2KQMA 2P47B 2NTFB 3RWIA 4HULB 2FBOJ 4GG6B 1CL7I 5CGMA 3OZ9L 1BPVA 4OGXH 3UTQA 4U6YA 2BVYA 4OF3A 3UO1H 5C0FB 3MNWB 3FQUB 1JK8B 1G7HA 5FO7A 3VXPA 5I18H 2DQIH 5D1QD 3BYTA 4WGVB 4JAMA 5IKCB 2PO6A 5FXCH 5C0RH 1IGYA 4RFNC 3NABL 4EBQL 3MXVL 5I75B 5J0BA 4X7EC 1T21B 3VXSD 1S9KC 5EZOL 1U8QB 1V3KA 4ELMA 1HHHA 1N4XH 1AJ7H 3C8DA 2G75B 5ESVA 5TF1L 3FHQA 2HLAB 3DO7B 4U1SB 3LN9A 1JN6A 1IGFH 1SY6A 4UQ3B 3CU1A 5BZWB 3C5JB 1QKZL 4M7JH 4R3SB 5HYJD 3KPOB 4IRSA 4Q2ZA 3MRIB 4QEGA 4G8EB 4U1HA 3PDOA 4YBLB 4YDJA 4MXWL 3EOTL 1U8IB 3QIBD 3JV4B 1TZGH 4UUJB 5AUMB 2AV1A 1JTOA 3SDXE 1GC1C 2F54B 3AGVA 3DSFL 4G7VH 5CJBA 2J8UB 5TGBA 1FFOA 4TN9A 3U2SB 7FABL 4NO5B 4XNZB 3GSNB 3PJSB 2A2QT 3DX8B 3HN3A 1PX3A 1HEZA 3O3EA 3T04D 1CLZH 4C59B 4BM7A 1NGZA 3ARRA 4RNRA 3PIQB 4W4OC 3C87A 1UJ3A 5K9OA 4K94C 5IP4A 3UTTE 3UJJH 4OLUH 1EEQA 3H7BA 4M7ZB 4KKLC 2Y5TB 5CZKA 4YXKL 3UC0H 5LQBL 2BCKA 1HCVA 3RIAF 4LPYA 1ETZA 1EMTH 1PD6A 5I76A 1EHXA 5M95B 3S3SA 3GMLA 3F7RA 1J11A 4JFYB 4GQ9H 3I85A 5D1QB 1IEAB 5D1XD 4Q9QL 3D9AL 3O9WD 1E4XI 2I60H 1LEGB 2GJJA 2OI9B 3VXSB 3K2UH 1FLRL 4X4ME 4QT5B 4ZMAT 5GS3A 4BFEA 1ZHNA 1KENL 4YR6A 2AK1H 3FFDB 3TFKC 2XV6B 2H3NA 4I77H 3DI2B 4YEEA 5ENWA 2A9NH 1CU4H 1J1OL 2OJEB 5ANMA 1DBBL 5HYJB 4Y5YB 5LGHL 1NCDH 4U0QB 2ED8A 1L0YA 1YDPB 3D0VB 1AXTH 3VGGA 3QIBB 5IM7B 1R0AL 4TVSa 1YEGL 4IRZL 1AKJA 1T03H 3WIHA 4WHTB 3KNBA 5FAAA 5HPOA 3ECBA 3OBAA 1RULH 2ESVE 4PJCF 4ODBD 2YRLA 4LOUD 5CKGA 4ZNEA 4YFLF 4J6RL 3AS0A 3C2SA 5L6YL 5HD8D 5LJYH 1MRFH 4NNXB 4PP2A 4GUPB 4UT9L 4XPFH 2PTTB 1Q9OA 1FZMB 3RWCB 5BRZE 3EYUL 2DQEL 3RIFK 4G6JH 5I1CL 1T20B 1LE9A 1JF1A 2YRZA 1JYWA 3CK0L 1B88A 2G5BA 3UJIH 3K2MC 4U2YA 1ZTXH 5FYLL 1W0YT 4QOKE 5GSVA 1HHGB 4PLJD 2BNQD 3MV9B 3HI1A 3BPLB 3FTGB 4YUEH 4F33B 3O6KH 2Y7QB 3H9SE 4TVPE 3WXVH 2MWCA 4I2XB 4XWOD 1RIUL 1Z9MA 4LVOC 4JRYE 4DGIL 1N64H 3U46A 1BQHG 4KV5F 3N1PC 4I18B 4JFFA 5D1XB 4M02A 3O9WB 1QD0A 4GO6B 3LEVL 4WFGE 4XNUL 1IL1A 2EH7H 4G7YH 4PLKD 6FABL 1T0MA 1A1NB 1LNUB 2K9UA 3FQRA 1HXYA 1G7PA 4ZPVA 1BREA 3ARFC 1SBSH 5DSCB 5HGBA 3VWJA 4S1SL 1IQDA 1ZA6B 3KAAA 4Y2OA 3L3IA 2V2TB 8FABB 4LHJB 4POZC 2JB6A 1YEKH 1IAII 2CDEB 3AAZB 1TCMA 3GKZA 1SEQH 1XZ0B 3GB7A 1IEBB 1EBAA 4YPGA 1N5YH 1FIGL 2RIKA 1TZIB 4RFEA 4EI5C 3QEQA 4FQIH 1N3NA 3PGCA 5I17A 4ACPA 4TUOB 3UTSA 3QIUD 3BP4A 3TJHD 3ARWA 1DQML 5D1ZD 1OPGL 3S3JA 4ONHA 4JFOA 4NUGH 1MIEH 3L5XH 1MLBA 1H0DB 3FL7A 4DOHE 1DQQA 1QFPA 1BM3L 3GEWB 5C07D 1YEDA 2CXGA 4NZTH 4LLWB 4H1LH 3VRLE 3TWCH 4MA3A 2WUCL 5C0NC 3QQ3B 3OKOA 2GK0A 4OT1H 4XMPL 5EULV 1DQLL 3PGDA 1OAZH 3HS0A 2XWBB 3WHE1 3VFNB 5HY9B 1EXUB 1FNHA 5IFAL 2AJVL 1PKOA 3U9UA 4OZ4B 1V7MH 2BHUA 4WV1C 2V2XA 3T09A 1A7OH 3U4EB 4N0RA 3TGXA 4R90L 5DD1H 2BNQB 5HVWA 4F3FA 3C5ZA 1FFRA 1F5WA 5FUCE 5H35B 3QRFM 3CFBA 2D03H 3O41B 3OB0H 4V2CB 3TNMA 4TUKH 4P5MB 4WW2A 1F2QA 4ODVL 2EEBA 1D9KC 2VC2H 4P2RD 4PJCB 2IPUK 3FN0H 1ZK9A 2CPCA 3ETBF 3MO1B 5DHVH 1GXEA 3SDAC 4ZUWB 1WC7B 3WEXB 4ETQB 5JHDE 5IMOA 1MHHB 1EO7A 2YD3A 4OI9A 4NDMA 5DRNB 4HHAB 3D2UD 3FN3A 4YGVA 5C0AE 5L8KB 1DUZA 3PG2A 1KJVB 1S7SA 3VFPA 5D5ME 3RVVD 5C7XH 4B50A 4WFFE 2HWZL 5DQJB 5JDSB 2IFFH 4WTZG 1MFBH 1EAJA 2NXZC 5EU3B 2XQBH 4NRXB 1NUFA 4JPIB 5J1AA 2J6EA 3SDXA 2R2BB 3RVWD 5HBBA 4LQ1A 3SJVE 2GIYA 2JTDA 3QIUB 4XH2A 2IAMC 3GJFH 5D1ZB 4I1NB 1P1ZB 1QFWL 5F7MC 4Z5RB 5FHAL 3UZQA 5IG7A 3QYCA 2D9QB 3WFEL 1JF6A 1WCQA 3PL6D 5HVHB 3EJYD 5C07B 5GRJL 5GRVK 3TBYB 2FEEI 3KYMA 4M6MH 5DMKA 1RIVH 5BJTA 4PJ7B 5E8NA 2E9BA 1E6OH 2NNAA 3TPKA 3UTTA 1LDPH 3GJEB 5JA9A 3KPQA 4Z8FH 2LAAA 2FO1A 4MSWA 2HKFH 5SV3A 1S9YA 5J9PB 4Z78B 3AC0A 4PRHD 4PJ9D 4Y4KD 4ZODA 1S9VA 4DGVH 3H9YA 1OT2A 5J6HA 2ICWA 2UUDH 2ITDB 5DK2A 4U1JB 3AMLA 5HI5C 1RURH 3SN6N 3P0GB 4OV5B 4LLDA 4HS8H 5F9AC 4L4VE 3GSVA 5FA3A 4XGZB 4X4MA 1OTUC 4P2RB 3CDYA 1IGTB 3U0TB 2DQGL 3MRCB 1P7KA 4LAQH 1IC4L 3SE4C 1INDH 5JR1H 1R3LA 3VFSB 2EDDA 3T0ED 1P4IL 5J06A 1F6FB 2GAZB 2GCYB 5DUPL 4MAYD 2A6JA 4ZXBA 3N85H 2EKJA 5CGTA 2VLLB 3D2UB 1KCLA 4XI5D 2FD6H 3FAWA 2GSGA 1D6EA 5E7BA 1ZT1A 4LSUH 5LAXB 1DEEB 3VH8G 2VN4A 3WO3B 1G7LA 5I1AB 3F58L 1EAPA 1XF4A 1OAXL 4ODTL 4LLUB 3V6FB 2O5YL 1LGVA 2JLLA 1XGQB 4MJID 2ESVA 3QUZD 5FHBH 5FYLD 1F58L 4I3SH 5E2WL 2XKUA 4Z76B 2VXVH 1J88A 3RFZC 3S6CA 3BKJL 3B2UD 5EBLB 1U58B 2NTSP 4RAUA 4NHUA 2VXSL 4XNQA 1NAKH 3WFHA 5CD3A 1XFPA 3PL6B 1OM3H 3FFCD 5D1QC 5BRZA 4BZ1H 1A6PA 5DQ9B 3OKDA 5KSBE 1WBZA 3VFMA 1QLFA 4G6AD 2X9XA 1KT2A 3B9VA 3K81A 1GZPA 3EYQD 5I1JH 3BFOA 1K4DA 4YDIH 4QOKA 3T4AB 5TDPB 3RZCA 4PRHB 4PJ9B 4Y4KB 5AD0A 1EVTC 5KVDL 5B4MD 3VG9B 2N56A 4LCYB 4ZOEA 3H9SA 3C08L 1QR1A 3WNNA 2Z93B 4KZDL 3PF2A 4JRYA 2X40A 5DD3H 4F37K 2FIRT 4XRCB 4YHOL 4BA8A 4NPYA 3X11A 3V95A 2HT4C 5D96C 1CFVL 3PWVB 4HEPG 2MHAB 3RI5K 3HAEA 2WIMA 2JJVA 4A2MA 4CN6A 1GIGL 4LHQB 2R23A 5E8PA 3OJVC 1DUYA 5JXED 4JFXB 2BDNL 2BSTA 4AEHH 3T0EB 3V4PH 1ULVA 1KLFA 2NY7H 2V5RA 3QUMB 3B3IB 3RWEA 4MCYA 1A4KB 4O51B 3TCLB 5E5RB 4MAYB 2BVPB 3BEVB 1AGDB 3OHXA 2PTVA 4X6EA 5TE7L 4IDLA 1IM3A 2BY2A 5F7FA 4PLNC 3FAXA 4KDWA 1QNZH 5BO1L 1C5CH 3LQAL 1VPOH 1ORQB 4LKCB 4P9HH 4MA1B 4YO0B 1A9EB 1F4WL 3LKSA 1L6XA 1J1XL 1YY9C 2LV4A 2RQ8A 4G8IB 1SEBA 4X6FA 5D2LF 1G9NC 4MJIB 3QUZB 5JPMB 3KDMB 1R5WB 2DRUA 3IFLL 1CDJA 4KGLA 2FWOB 3BQUA 4XVUD 3WD5L 5BQ7B 3HC0A 3L1OH 3BEWB 3GI9L 5EU7E 1AHWB 3LRSA 4OD1H 4MWFA 3FFCB 5JOFA 1GSMA 3W2DL 1DJSA 2HFGH 4KH2A 3MOAL 5FUOH 2VR4A 1T1XA 2CLVA 3RBSA 3ARVA 1YY8B 4X8JB 3CZFA 2YD2A 5DDHB 2DQHL 4KQ3H 4QTHB 1P6FA 5EWIH 3OX8A 3O3DA 4N9OB 1HH9A 2DQUH 1KJ2L 4MJ5A 2DQCL 1RZFH 4WI7A 2HJKB 3J7HA 4MA8L 5ALBH 4M6OL 3B5HA 2A73A 5EZJB 5HVFB 1YECH 3VXQB 3TEUA 3WFBH 2P48B 1DTUA 1IC1A 4S1RH 4HJJH 4WI6A 4JFPB 1T22A 4HQQL 2PW2B 1MPAL 2NY5C 5IOPB 2VXQL 4NKMA 5IEHA 3ORJA 3T1FB 4XP9H 1MVUB 3T8XA 3BPOC 1ZLUH 4TTDD 5DEZA 3SDCC 2NLJA 5JHDA 1S7XA 3MV7E 4ALAL 2DIJA 2HVKB 4Y5XA 2BC4A 1T5XB 1QVOA 3TBVA 3F7PC 1C8PA 3QXDB 4QRPE 1Y18A 2C26A 5GGUA 3WIIL 3DJ9A 4LOUC 2QSCL 5C0AA 5HDBF 3N1GC 5HD8C 1VEPA 4WEMB 5D5MA 4FA8A 3GSRB 1M1SA 4HX1B 5F3BA 5JZ7C 4KVCL 2CO7B 1WIPA 4XVSH 3GSXA 4QHLB 5L2KE 4P23C 3QZWB 4HC1A 3RGHA 5IB1B 3FMGL 4NJAL 3MJ7B 3SJVA 1T66D 3X12B 4HXBL 2C4XA 1PJ9A 1RZIA 5F7HA 3EOAA 5DT1H 2J5LB 5IVZB 5L8LB 5FEBA 4HK3J 4P3CL 1GC1H 1ZAGA 1FNSH 2GJ6E 4NWUH 4JY4A 3HZKB 4MQXD 1TZHB 5GHWL 5KTEL 5H94A 3UBXG 4S1QH 3S97C 1VFAB 1K6QL 3GMOB 2YC1A 4FFYL 1BQUA 2Z35B 1K9TA 5GS1C 2FX7L 2I9TA 1BVKB 1GGYA 2UVFA 4K94H 5FYJU 5MP6L 2XTJD 1UYWH 2QLVB 5BV7L 1U91A 5F71A 5J7CC 1C1EH 2LAGB 4M48H 3QHFL 2OLDA 4NO3A 3MLZL 4LSTL 4KQ4L 5IQ9A 4L4VA 1MJ8H 2WBKA 1FNLA 3AY4A 4LLVA 4MB3A 4R4BB 2K1MA 1HHJA 3ULUL 2BOCA 5D2LB 2XXCB 3FOLB 2X4RA 2KL6A 4RIRA 3V4VH 1UWGH 2Z92B 4HKJA 3P9MA 4KKAC 2Y07H 4G6ML 4JFQB 1X5YA 1AD0B 4DFIA 4OD3L 5GIRA 2D0GA 5DVKA 3TJHC 3NAAH 1SY6L 3OB0K 3OAZH 4MDIA 5IROA 4X83A 4G9DA 4LARL 1LO5A 1D5ZA 2M8XA 4Z7QE 5EIIA 5I1LB 2V5TA 2WP3O 2AEWA 1SYVA 4D94A 2JB5L 3I2CL 3O11A 4X6DF 3RDTA 4HUWB 4PJIE 1WQVT 1FVCB 4DKFL 5L7XH 1NCAL 1CXFA 5DRXA 3MRPA 3ROLA 1IARB 4KTYA 5I8EA 4BSJA 3ZKND 3QCUH 3DURB 2ZPKH 3IDGA 4LHUD 5HYSG 1H3PH 1YMMD 1BAFL 3QEGH 5HTSA 3U36B 1BBJA 5JHLH 1JHKL 3KLHC 4I4WA 4UOW1 5GJSH 3IU4H 4C55A 4NN5B 4YDVB 4Q74A 4NQUA 2IMMA 3LV3A 5GGTH 4N0FB 3P0YH 2H8PB 4U1NB 1RMFH 1TJIL 2FB4L 2JJSC 2Q3AA 4V1DE 5FO8B 1ZVSB 1JHTB 2HRPL 3TIEA 4JHWH 5FO9B 3C60A 4AY0A 1MFEH 5B38A 5KSBA 1QRND 2V9QA 2FBJH 3TT3H 3LH2H 3SDDC 4A6YB 4N0YH 5F96L 5EZIL 3B6SB 5LKNA 5IESH 2ERJC 2XTJB 3HMXH 5D8JL 3CSYA 3TVMA 1LO0H 1FGNL 2EDBA 1A7PL 4MJ2A 1A3RL 3RA7L 2V7NA 1U3ZA 4Z0XB 1K8IA 3G08B 3BMVA 4NC1C 1SMAA 3DRQB 5CLWA 3JVGC 5J8OA 3FKUS 2EH8H 4WUKL 3U7YL 1AR2A 1ZXQA 1G9MC 4MCZA 5KVEH 4HS6A 2UZIL 2UUDK 2R15A 5T1DH 2HP4A 4XTRD 4X7FC 4CADA 4XPTL 1TENA 5KSUA 1WK0A 3TPUB 5J89A 2BSED 1KIUA 4PGBB 4F7TA 1U8KA 4ZUUA 3H9HB 3MA7B 1F8TL 1I9IL 4KTDL 1NBZB 4LSRL 3T0VA 5DEFA 1JZ2A 4ZO6A 3QUXD 4WCYH 3MUY1 5DJYB 3D0LA 4HIJB 3NFNA 1IGJB 4MQSB 1KCSH 3M1BA 5I73B 4PV8A 5I0DA 4KHTH 4F8QA 1FAIH 4HDIB 4KHXL 4LHUB 2QADD 1WLHA 1YMMB 1RV6X 2DM3A 3VFRB 4X6BA 1QO3A 2C3HA 3NN8B 4GG8A 3VG9C 3IF1A 1BFOB 2O26U 4M1DL 5E94A 2B2XH 1AGCB 3HCVB 2BVTA 4YH6A 3BX7C 1RJYB 5EZLA 1JPGA 1KLGA 4PJ8D 4MX7A 1S8DB 2GTZB 2QL1A 2ICCA 2CRMA 1VFUA 5GRYA 1QRNB 4X6CF 4RBPH 2AXGA 2EYRB 5CGYC 1YEJH 5FYKU 2JKXA 2IQ9L 3MCG1 1A7QL 3EYVA 2C7UA 5SWQA 4JREC 3CFJA 4KMTL 4LSVL 2Z31C 5DTFA 1T7WA 2JELL 4X6DB 4UILL 3M17B 3P11L 4OCRL 4MAYC 1UKQA 3MQIA 4GKNB 4ZOAA 2VXTH 2N1KA 2OL3H 2XTLA 3IDJA 5TH2A 4XXCA 1AH1A 5D71L 4XI5C 4XP6L 3VW3L 5DS8B 1TVHB 3GK8H 4HUUA 1HHIB 4EUPG 4LCWE 3I3DA 4HCRH 3V52H 2CIIB 1DBAL 3OR7B 3TIDB 1E27B 4KMQA 3O6FC 5T3ZL 5EC1A 4XPBL 3MV7A 4MXQD 3LOWA 4GS7B 3RWDA 1I85A 5DJ0B 4QRPA 2B1AH 2ZOKA 4ELMF 4LCIH 5IV2A 3WJJC 1T04A 4H88L 4KVNL 4BZ2H 2F8OA 3D3VB 5D72L 4HUXA 1L7TH 1N7ML 2XPGA 1NAMA 5MEQA 2E7BA 2A6DA 1CYGA 3QUXB 4YNYA 2X7LB 4Q58C 3CVHL 2EDOA 5I1IL 5HVGB 4RGNE 3VA2C 5DHXB 4KK8C 5L2KA 2ATKA 2HFEB 2QHRL 4U3XA 5EN2B 1QP1A 3WS6C 3UPRA 4G6AC 1ES0B 3MRJB 3HI6H 3SKOA 5I16A 1RK0A 1QFUH 2QADB 1TDQA 2NY2C 5IHZB 5CMAA 1BFVL 5T3XL 3MTRA 2Q6WB 2GJ6A 2LABA 5F3HB 4D2NA 3E3QE 1NGWA 1Z0MA 3L3HB 3QZWG 5GGSB 1CFQB 3RY5A 1C08A 1KJ2B 1EGJL 3RHWF 4XC1H 3HRPA 1XF5B 3P4NA 5EO0A 3CCHA 4WJ5B 2WINA 3BZEA 1CF8L 2PO6D 4PJ8B 3HB3D 3GIVB 3VFWA 3QIWA 1CLYH 5L0QC 2E7LA 1TPXB 3DXAD 4DTGL 3L3OB 1ZHLB 5IW3A 4KKCD 1JCKA 3IDYB 1HSBB 2R2HB 2AEIT 5DD0H 4UIKH 3OB8A 2OXGA 3ALPA 4JZNA 5IVXE 2CSPA 3BESR 5JXEC 2OK0H 3I6KB 1TJHH 2MOVA 5EU5B 1UT9A 5E00A 5JQHC 5DJZA 2X70A 4O9HH 1TVBB 3UAJD 3MZGB 4TNVK 4IRSD 1X5AA 1NANH 5EC2A 1UH2A 4F7MB 2R9HC 2XFXA 1NJ9B 5JMRA 5IGXH 5IEKA 5HXMA 3DMMA 1OGTA 4AENB 1CLOH 1DQDH 5BVPH 5EPMB 2AI0H 4H1LA 3L3GB 1F6AB 3IXAA 5CS7A 1KJMB 4FABH 5FECB 1FORH 3V2AR 3T2NL 1SMOA 3P3YA 4YDKH 2DKMA 1R24A 2NY4D 3MV11 4IOFD 4X6CB 2AP2A 5JNYA 5C6WH 3QULA 3O6LH 1OAUH 4OUOA 4M8VA 1T2QH 4OF8A 5JLZB 4PJIA 3GSNH 3S98A 3KLAB 4N9GA 5L2JA 1ZLUK 1HYRC 5GJTH 5TE4L 4NZDA 5DEGA 3QAZB 5GZND 3JWOH 3UTQB 4U6YB 1KXTB 4V1DA 1A4JA 5DHVA 5SWSE 1YEFL 1TLKA 3CVIH 1G7HB 2ORBH 5FO7B 3E6FA 4GXUM 1OF2A 2B5IC 5IT2H 5GRZA 4JAMB 1OAQH 2PO6B 3QRGH 1DANU 1JFQH 3FB7A 5GGSY 1IGYB 5EUKA 2AJSH 2IWGA 4YXHH 3DXAB 1AIFA 4G42A 1UWEH 1C16A 2B7DT 2NXYD 3FN9A 4XCNA 4ELMB 4L3CA 1HHHB 4LNRA 5ESVB 4OLVL 4IDJL 1P4BH 2KZ1B 4E0RA 5B39G 3BO8A 4WUUD 4JQIH 2CUHA 3I9GL 3S34H 5FF6A 3UJTH 1RPQA 1Q94A 1KBGH 2AJYH 2EE6A 3GHEL 4JO3L 2WWMC 4FNLL 4AEIH 3ET9F 1HIMH 3MV8E 3GJFA 3SEPA 4IRSB 4Q2ZB 1ZVYA 3PGFH 1BVLA 4U1HB 3PDOB 3HPLB 2VZ3A 5I8OH 4BFGA 3H0TA 1JZ4A 3H3PL 2BXYA 4HGMA 4MB4A 4KU1A 5B3NA 1AKJD 4IOIB 3FRUA 3NIDF 3NPZB 4DAGH 2EDTA 3MLYL 1XF1A 2NY4B 5EUOE 5TGBB 1FFOB 3C6SB 4NP4H 3HFMH 3U7WL 1L4IA 4WVRA 5F7UA 1G6VK 4XWGH 1HEZB 4PRAA 1MCIA 1NGZB 5FDWA 4RNRB 5CCKH 4JFZL 4GRLC 3JTSA 3JV5A 5A40E 3LD8B 5K9OB 4WHCA 3T0WA 2G2RA 3OAZK 3IETA 1AC6A 5A3ID 2W0PA 3TZVA 1IBGH 5CJ5A 5DFWH 4WIQA 4EN3A 1JPSH 2BCKB 2YA2A 5IW1B 2VNCA 3ARGA 1ETZB 3EO1A 1NEUA 4U6TA 2R2CA 5DUBB 4LHUG 5I76B 4GBXA 3GMLB 1DLHA 5D7KE 1NCCL 2VDML 1A6WL 1UEYA 1U42A 3IU3A 3C09C 3PXHA 2NXYB 4XVJH 1F4HA 5HGDA 2H1PL 5IFHH 4TNWK 5GQBA 4ORGA 3MUHL 4RISH 4ZFGL 4N5EC 3CIQA 4RMQA 5BMFH 4BQCA 1CE1H 1ZHNB 4PG2C 4YR6B 3G5YA 4WUUB 4HXAL 3VWJD 1F97A 4X7CC 2ATPA 3WO4C 2H3NB 1MEXL 3PDDA 2Z8RA 3HZVA 4JR9H 1J0ZA 5ENWB 3REWA 3ZL4L 4GRMA 5ANMB 3CMGA 2H32H 4LCWA 2R0WL 4RRPG 1MCBA 4M43L 5J1SC 3SE9L 2CK2A 2VDPH 2B1HL 2XRAL 2RB8A 4U1LA 3ULSA 2NY5H 3ZKQD 1AKJB 4L9LC 3UTSD 1HZHH 3GKWH 4WW2F 1F13A 3KNBB 4ZS6C 4YQXH 1B4RA 1FZKA 5L9DH 3U7AA 3WHE0 5BXFA 4LVNB 4YFEA 3TO2A 4WENB 4GFTB 3MLTA 5E70A 5CEZL 1MCOL 3QP3A 1Q9OB 4Q0XL 2CLRB 3Q48A 1LE9B 3QDAA 4PFEA 1JF1B 4KJWC 1T0NA 5E1AA 1FSKC 3PWUB 4XT1C 2R29H 4RCAA 1KNOA 3T1WA 2Q8BL 3QWOA 1NBYA 4LLQA 3QG6A 5GSVB 3X14A 4WTXA 3SKJL 3P4LA 3C5ZD 1X5KA 4LCUA 3HI1B 2PKDA 4ZTOH 1B2WH 4KUZH 3SDXF 5KVGL 3A6BH 1CDYA 1LO3L 1KB9K 1P2CA 2Y72A 1H8NA 4FXGA 3GGWA 3QWRD 2WQRA 2V5YA 1MIML 2EIZA 3U46B 5GS0C 4KDTA 1WBYA 1D6VH 4H0HB 1IL1B 4LCCA 4NCC2 3RVXC 5B22A 1T0MB 3AREC 5K9JH 3V6OC 5IVXA 3FQRB 1J05A 1G7PB 1HXYB 4ZPVB 1UA6H 1Z3GL 4HKBA 5HGBB 3VWJB 1T4KA 2IC2A 3AMKA 1CFNA 3L3IB 4RBPK 3BN9D 1FL3B 3IAQA 5D6DA 3Q5YA 5KAQF 1UACL 3LN5A 3BE1L 2VDLH 4JJHA 1CTOA 4UTAL 1RZJC 4YPGB 4YHZL 1QBAA 1FO0H 1KPVB 2Y1VA 4RMUA 4UNUA 1YN6B 5D7SH 4RFEB 5BW7A 3EW3B 1IGCH 1N3NB 1I1AD 3MXWH 3PGCB 5I17B 3U79A 4NRZA 1R3HA 3UTSB 3BP4B 4OF5A 4PG9A 4GLRI 2W9DL 1IVLA 1KCRL 1T7YA 3CPLA 3SE8L 1PG7X 1UCBH 3LDBC 3SPVA 1XMWA 1PW3A 4ONHB 3WLWC 4JFOB 3WUZA 1MLBB 4J8RA 1E28A 3BDYH 3HMWH 3IT8D 4N0UE 1YEDB 4KPHL 4DVRH 4NNPL 2R4RH 3BPCA 4MA3B 3UTTD 1Q0XL 1MAMH 3OKOB 3JUZA 2GK0B 3WFZA 1VEOA 3PGDB 5C0EA 4HC1L 4OLXH 3QB7C 4M93C 1A2YA 4DN4L 1IGIL 2X4UA 3F7VA 3U9UB 4YHYB 4JGUA 1DBKL 2ADFH 3IJHA 5SWSA 3SCMC 3WUWA 4F3FB 1FP5A 2IALA 3C5ZB 4RMVA 1OWRM 3FONA 3LKRA 3CFBB 1EHLL 4GOSA 3TNMB 5EH1A 4BQ8A 2ZCLL 3LS4L 4WW2B 1VEMA 4J23A 2HYMA 2FATL 4LGSB 4MVBD 4JPVH 4UB0H 4WY7L 5I15H 1L0XA 5CP3H 4K3DL 4ZFZA 2EXYC 1RFDL 2ED7A 5E08L 2FIKA 3MODL 4FQCH 4NN6B 5IMOB 1U8NB 4O00A 4PR5A 3OWEA 5GRVL 1J0YA 2R0KH 2R56H 3DETC 4NDMB 3MRKA 12E8H 4M1GL 1S9XA 4ZXBD 3MV8A 1R5IB 1BD2E 3FRPA 2X4NA 1Z0NA 4FG6C 2X89A 2X4SA 1YJDC 1S7SB 4GG6E 1HHKA 4IOSD 2Q7YA 3CX5K 3RIFF 5CD5C 5DXWA 1G9MH 5J1AB 5CJQL 4GAJH 1VADA 3SDXB 1I1AB 1MJUH 2ESVD 4W4OA 5EUOA 5FIEA 3PV7A 3TJEH 5IG7B 3X17A 4NOBA 5I9QB 3CFEA 1YEIH 4HH9A 4UV4H 2AS5M 3GZKA 3V0VA 4PJHE 5BRZD 1FG2A 2W9EH 2XZCH 1GGIH 5DR5H 3UO1L 4OF0A 4P2OC 4TSBH 3VI3F 5DMKB 5BJTB 5E8NB 3UTTB 2NNAB 4XX1G 5I18L 1J9CT 3KPQB 4MSWB 3DGGB 2IBZY 5SX5K 4QOKD 4OIBA 4YLQT 4AK1A 1OP5H 5KANG 3RZCD 2ADJB 3ZKMC 1S9VB 1LO2H 1QBML 2ICWB 1JYNA 3H9SD 4TVPD 2ZUXA 1AJ7L 3UXFA 1UM4H 4JRYD 2AKRA 4P5KA 1L6ZA 3VCLA 2FX9L 3G5XA 2DB8A 4WFGD 1EEUA 1LK2A 1QSEE 3ROOA 2D2OA 1VCAA 3MOBH 3GSVB 3U4AA 5FA3B 4M7JL 2W1NA 1Q8MA 2J8UE 5AWNH 2P8LA 1Q9LA 2AJ3A 4YDLC 1OVZA 1S7UA 3V5HA 5IQ7H 1P7KB 1WWCA 4GT7A 1N5AB 2VH5L 2EDRA 4OUUA 1TZGL 3JBG7 4HWUA 2ZZUT 3CD4A 3GFUA 1FLTX 2A6JB 4MJ6A 4ZXBB 3QUMH 3U4BH 4YBHA 5GGTA 2BSRA 3SGEH 2GSGB 1GOGA 1D6EB 2VZOA 2KH2B 3LD8C 1A14H 1CLZL 4ERSL 1G7LB 1EAPB 1LDSA 1XF4B 4L5FH 3BVNB 2H9GA 3DX9A 2ESVB 1ADQH 3NH7H 3BQUD 4QRQA 2MKWA 3UJJL 3BAEH 4OLUL 1AGEA 3NIGF 4XNQB 4APQD 3WFHB 5CD3B 1R5VA 4U49A 1DBJH 5FYKL 3UC0L 3DVFA 3MROB 4PGJA 4HUKB 4QRTA 5BRZB 5D7IF 1EMTL 1DDHA 3OKDB 4V2BA 4ZDHB 1UADC 1UM5H 4JGJA 1WBZB 3SBWC 2AABH 4L29A 3SQOH 2NW3A 1QLFB 2NXYC 4C83A 4GQ9L 1MRCL 5D5MF 1LQSR 4WWID 4KKNA 1K4DB 4HLZG 2I60L 4BUGA 4QOKB 3OKLA 4GXVH 3RZCB 3D69A 4ORZC 5C0IA 5AD0B 5E6ZA 3GMQA 3VFVA 4FQHA 5ABDE 3H9SB 2E7MA 1QR1B 4QF1B 1VFOA 1R3IH 4JRYB 2AK1L 1IZJA 2HFTA 4L8BB 5EO1A 3ARFA 1HILA 3CNKA 4NPYB 3X11B 4PGZA 1CU4L 4NQSA 4DW2H 4LP4A 4PRNA 3HAEB 1NCDL 5DO2C 1F90H 2WM0A 5IMLB 4OGAD 4QGTA 4KWUA 3O81A 2I9LA 5JHDD 2UYLA 2APVA 3OPZL 5E8PB 4RAHA 2EDJA 1DUYB 4U1MA 2BSTB 1F3DJ 15C8H 2XA8H 4WU7B 5ADOL 3RWEB 4MCYB 5C0AD 4EI5A 1BGXL 4D9QE 4X6EB 1DANT 1TMCB 1U8MA 1RULL 4WFFD 9CGTA 1IM3B 1BZQK 4W6XB 4QHMA 5D7JD 1X3DA 1MRFL 2F58H 4XPFL 5HYFA 3BIBX 5IJKC 3QNYB 2E27L 3SJVD 1GRWA 5DQDH 5JIIA 3LKSB 4X6FB 1B90A 4G6JL 3TF7C 4OI7A 1TTUA 5EBWA 1F11A 2BHZA 4G80B 3QEUA 3CZJA 3BQUB 3HC0B 4X99B 1LHZA 2XWTA 5HI4C 4NM4L 4DOHB 2YD9A 4APQB 3ZKXC 1Y6NR 3LRSB 4N0UA 4JFDE 2B4CL 1I8LC 5JOFB 4WV1A 4YUEL 5LWYL 5MHSE 4S1DD 4MB5A 3JSSA 3C5SA 3EGSA 3WXVL 3IDXH 2GFBA 2NW2A 1T1XB 1N6VA 3ES6A 2CLVB 2OL3A 1Y0LA 4BK4A 1I1FA 1N64L 3CZFB 4UNVA 3VGFA 4HJ0C 4FMKA 4HCRA 2X10A 1JNHA 4PB9L 5CILL 2HN7A 3SGDH 3OX8B 1D9KA 3O3DB 1HH9B 3WL9A 4MJ5B 2IG2H 2X09A 2DD8H 3GO1H 4Z7UE 4WW1A 4ZS7H 1SBSL 2A73B 4L4VD 5TF0A 1CXIA 3SDAA 1W8OA 4OCLC 1RIHH 3QDHA 4HFWA 1AD9A 5JPNA 1T22B 3GRWA 3AM8C 5ESQB 1YC7A 4NKMB 5IEHB 1UWXH 3G9AB 3T8XB 1SEQL 1OTSD 2GKIA 1BQLH 3VDCA 1N5YL 2NLJB 5JHDB 1D5MA 1S7XB 4L4TE 1MCDA 2AJZA 2C3GA 1QVOB 5TPWH 4FQIL 3TBVB 5GGUB 2HMID 1Y18B 1BD2A 5F70A 1WZLA 4UOW0 5C0AB 4PTUA 1PSKH 3RDTD 5D5MB 4GG6A 1G7QA 3VXUE 3LVEA 4NUGL 2IAMA 1MIEL 2QTEA 2X1OA 3EYFA 2EXWD 3HRZA 4PY7A 5I1EH 1U41A 5D7JB 3GSXB 1JK8A 1HKLH 4NZTL 3OF6D 3SJVB 1EVUA 2X4PA 5IKCA 1RZIB 3EOAB 3L7EA 1VFBA 3OKYA 5E2JA 4BQ9A 3DRTA 1U8QA 4PJHA 1JI2A 3VA6A 3MLVH 2G75A 3C60D 5H94B 5DD1L 4F37F 3RBGA 5KS9F 2VABA 4GAYB 1CDIA 2YC1B 3QJHA 4IMKC 4M4PA 5F7NC 4MD0A 2R69H 4TUKL 1A1MA 5C1MB 3FT4A 1RZKC 2VDQL 2FCBA 2IBGA 3KPPA 5J11B 5J56B 1S3KH 1XCTA 1U91B 3FN0L 2VDNH 4OLWL 4NO3B 4K8RC 2M1KA 3JV4A 1FH5H 5F1OB 5AUMA 5IQ9B 4L4VB 1QSEA 1BOYA 4LLVB 3SE4A 2GK2A 1FN4B 2BOCB 1WIOA 2J8UA 1WICA 4H20H 2ZCHH 4WWKC 2RFXA 2E6JA 4KV5E 3GSNA 3P9MB 1YNLH 1U2CA 3R1GH 2QSTA 1P53A 3OGCA 1I1AC 4JKWA 3EBAA 5GIRB 1MFBL 4XVTH 5C07E 4MDIB 1S5HA 1OSPH 1TNNA 4G9DB 1LO5B 1D5ZB 1LILA 3CSGA 1PBYA 2A0LD 2F5BL 1TNMA 1X9QA 1SYVB 4KRNA 1QQDB 4JO1H 4JB9L 1NFDE 2Y5TA 3O11B 3RDTB 5GZOC 3GI8L 4K71C 5DRXB 3MJ8A 1A0QH 1DN0B 1H15A 3MRPB 4Z18A 3ROLB 1KN4H 5F9JA 4HPYH 4HZLA 4M6ML 3W39A 3T2QA 5M7QA 1RIVL 5D1QA 1BBJB 4TQEH 1BJ1J 1E6OL 1IEAA 2QEJA 4I4WB 3HA0A 1LDPL 3U0WL 1DQTA 2P46B 1WZKA 5I2IB 3NZHH 2FO4A 4R97B 4K7PH 1PZ5B 4LSPH 4XNXH 4XP5L 4P2RE 5EG6C 1P84J 3TIEB 3C60B 2APTA 2BRRL 5B38B 5KSBB 3BOVA 3KYAA 4HIIA 5ECJE 2DWEA 4FFVC 1RURL 4N8CH 43CAA 3DV4A 4HS8L 3DYMA 5LXGL 4F58H 4NC1E 4OCYL 3CSYB 3BISA 3D0VA 5EORH 4R0LC 2BY3A 2PYEE 3LAFA 2O5ZH 2EZ0D 2V7NB 5I71B 3O2VH 1INDL 5JR1L 1CXHA 4TSAH 1IAOA 2BX5A 3QQNA 2YOCA 4W70A 4CN4A 5GS0H 4MCZB 5CSZA 2VB5A 2FD6L 1T0PB 3MV7D 4QXTB 5JW4N 1BHGA 3ARDC 4LLMA 2HA1A 4K7PX 5KSUB 2W92A 4QRPD 5SX4I 4U0RB 5KS9B 4F7PA 4J4PD 1U8KB 3QI9C 1MI5D 4ZUUB 1I7RB 3GM0A 4Z0BL 5ERWA 5FHBL 5IB4A 3L5JA 4F7EA 4I3SL 1Q0YH 1ZT7A 3W5MA 2VXVL 3HUJF 4DGYH 1FCGA 1INQA 3RWJA 1NAKL 3NFNB 1OW0C 2H41A 1SVZA 3FTGA 1YNKL 3UPCA 4KK9C 1OM3L 1RZJH 4FN0A 3M1BB 3VFOB 4CVUA 4PV8B 3PHQA 3KPSE 2VSCA 4L3EE 4I18A 4X6BB 1QO3B 4GG8B 5JORA 4YDIL 5E94B 2YKLH 1Q9WB 3EDFA 4JFDA 2OJZH 1UVQB 5GRUH 5I74C 1JPGB 1KLGB 4P3WA 4MX7B 1WITA 3E2HB 4Z7QF 1TQCB 3QIWD 2NPLX 2CRYA 2AXGB 4GKZA 1G84A 4OTXH 2ARJQ 1OTTD 5C71A 5I19H 1FPTL 5DD3L 3WXWH 4PJIF 3EYVB 2C7UB 2H32A 3O3UN 3KS0H 5SWQB 5TJWK 3CFJB 5C08E 1T1YA 3AAZA 5DTFB 1XZ0A 3GIZL 3RPIA 4J3WA 3Q6FA 4NC2B 1YC8A 3NFSL 1VACA 3JV6A 4POUB 4Z7UA 1XF2B 3QQ9D 4R7DA 3RX8A 1U9KA 5HHQB 3DLQR 5TH2B 3SDCA 3B2VH 1M71A 4ZYKA 2NY7L 4HUUB 4HV8A 3QDME 5EC1B 3MLXH 3SO5A 3MV7B 1QNZL 4KTEH 1T89C 4L4TA 4LLWA 4NC0B 3KPRE 1OARL 1FBIH 3RWDB 3TT1H 3VGEA 4QRPB 2ZOKB 4P9HL 4OFPA 5IV2B 3AXLA 1BMGA 1T04B 1MI5B 3PQYE 2EC9T 1HYSC 5DMGD 4LK4A 2XPGB 4M5YH 5FGBC 3VXUA 1MCRA 1NAMB 3L1OL 1N2RA 4YNYB 3CXHK 1CBVL 1YJDH 4KJPD 4P59L 4OD1L 5T5NF 3UPRB 3SKOB 5I16B 2HFGL 5CMAB 3UZEA 4OF6A 3NPSC 3TA3D 1MHPH 2VL4A 4V1DD 1NGWB 5E4EC 5GS1A 1C08B 1B3JA 2BVOA 3P4NB 5EO0B 5EWIL 3CCHB 2VOTA 2WINB 3BZEB 3ZYZA 4JO4H 4PGCA 1EK3A 1WC7A 2EE2A 1QTYT 2DQUL 3VFWB 3QIWB 1Z9OA 1CG9A 1RZFL 5IHUL 4P4RB 5ALBL 3ZE0F 3MJ6A 1CL7H 3ZDXF 5DLML 3WFBL 3QFJE 2GITA 4F7CA 4OGAC 2OTUA 2QQKL 4MNGE 3V0WL 5HYIA 4OGZA 4JZNB 3K3QA 3L5WA 3LEXA 5FB8A 1FO0A 4XP9L 1AXSA 5EU3A 5DJZB 1RAMA 2X70B 2HAZA 2IEPA 5FGCE 1A3LH 5EC2B 2I27N 2XFXB 4WNQA 5D1ZA 4Z5RA 5D7JC 1OGTB 2IFGA 4ENED 2ADGB 3A67H 4E41E 3IXAB 4HBCH 4ODUB 5C07A 4XVSL 1EJ6A 1KXVC 4XHJD 4YHIA 1H3XA 1A21A 1R24B 5FUZH 3IRZA 3LEYH 3WNMA 3GJEA 2YEZA 5JNYB 4BSWA 3QULB 1FC1A 1NFDA 1UZ8A 5A2FA 4PJIB 4Z78A 1NMAL 1GC1L 4N9GB 5L2JB 3P0VL 4OJFH 4DCQB 2VLKE 4JPKH 3MBXH 4NWUL 3UP1A 4WEBL 3ULVF 4U1JA 1FZOA 1AE6L 2JJSA 3OXRB 1HQ4A 4S1QL 3UMTA 3TZVD 5DEGB 2VYRE 5C0DA 4EN3D 2VDOH 5F7DA 4PGDA 5E5MB 3MJGX 4J2XA 3ARGD 3QXTA 2VAJA 4OBSA 4V1DB 4YE4L 2NY6C 4K94L 2X1PA 5CP3A 5GGQH 5GGVH 5DHVB 4RDQF 4P2RA 2HJLB 4BSVA 5IR1B 1N6UA 1IGTA 1BBDL 1UYWL 3SDDA 3VD9A 2KZWA 3E6FB 5INCA 2EE9A 1OF2B 1Y6MR 1C1EL 1DCLA 3VFSA 4M48L 2PXYC 1BX2B 3EHBD 3FB7B 3PWNB 4JDTH 5EUKB 3LKOA 3V8OA 3QPQD 3F6IA 4G42B 3CMOH 1C16B 1MJ8L 4LL9A 4N0CD 1OCWH 4XCNB 4YHLH 4L3CB 4ZUVA 1U6AH 4LNRB 5B8CC 1QSVA 3D2UA 1I75A 3JVGA 1AFVH 3IRPX 4E0RB 2OX5A 3V4VL 2P8PA 1UWGL 2OBGA 2PYEA 4G8GE 3LCYA 5FF6B 5LAXA 2A9ML 1Q94B 3OJ2C 4MNHA 3MLWH 1JRHI 4PJXF 5CJXC 3ULVD 1QBBA 1E4XH 4QRRE 3NAAL 4LLUA 2ITCA 4FXKA 3BZDA 5E6IC 1BVLB 5CINH 3PV6A 5K9QG 3H0TB 3WFDH 5BCAA 4MJ4A 3QCUL 2ZPKL 3B9EA 3KG5A 1H3PL 2UV3A 4AMKH 4LQFH 1T1WA 1LEIA 4R97C 5JHLL 5IVXF 3IU4L 1CVSC 3D6GA 1QSFE 3LKQB 1C7TA 4RGND 1QPXA 5GGTL 5FDWB 3P0YL 1IFHH 5HDBE 5HGAA 1RMFL 1D5XB 4LCYA 3JTSB 4P5TC 1ZLWH 2QQLH 4AL8L 5F6IC 3GMRB 3CC5A 4JHWL 5DJ8A 2G2RB 3IETB 1MFEL 3KPSA 5T33H 4ISVA 3TZVB 3KHOA 4L3EA 4JQXC 5F7WC 2Y23A 1S5IH 4EN3B 4HFUH 2H6PA 3ILQD 3LH2L 1ZLVH 4U1GB 1FL6A 1JJUA 3ARGB 3EO1B 2XA3A 2ZJSL 5ACZA 4PUBH 4B53A 3CAFA 4D0CB 3HMXL 1WTGT 4R2GC 1AR1D 1LO0L 1DLHB 4R7NA 5C92A 4TNVF 1BLNA 2Z31A 3RL1A 1CICD 5H2BB 3FQWA 3IU3B 3WSQL 4HJGB 3QUMA 1F4XH 5HGDB 1OLZA 4MAYA 5C08A 4ORGB 5ID0A 2DL2A 3X3GH 2NR6C 3G5YB 2ATPB 3T2PA 5T1DL 1FV1B 3INUH 1ZVHA 2A0LC 1ZV5A 3NA9L 4JGMA 3REWB 4YO0A 4GRMB 1YNTA 1A9EA 4K07A 1ADQA 6CGTA 1LEKA 4XCFH 2FECL 2XACC 4LEOB 1NDMB 3J8F7 2FWOA 2MTPA 3DV6A 3WJJA 2QJDA 3OAUH 2FJHA 3QDMA 2WK2A 3QUKA 4U1LB 1ACYH 1N6QL 2Q8AL 4ZUTA 3KPRA 4X80H 4OCWL 4RGOL 4YXLH 2EDKA 1U3HC 3K4AA 5CUSH 1FZKB 5JO5A 1L7IL 3T0XA 1ZLSH 4KHTL 3PQYA 1QRNE 1IAIH 5BXFB 5C0CD 1EA9C 3WS6A 1P9MC 3GBML 1JGDB 3TO4C 2IADB 1T1ZA 1BP3B 2XY2A 3PE9A 4TUJA 4U1KA 3MLTB 1TQCC 4Y19D 4RGNB 3V6BR 2B2XL 1MH5A 4R4FL 4X6DE 2H45A 4K9EH 4QXGH 1T0NB 4GAFB 1INEL 5E1AB 1J1PH 5CJOL 5EZJA 5JXAH 3JXAA 2YWZA 1KNOB 1GHFH 1HE7A 3QWOB 1NBYB 2FJGB 4LLQB 3QG6B 5SWSD 4IJ3C 1LD9A 4M00A 2H2PD 4WHYH 4LCUB 4U7MA 2EE3A 4JDZA 3CXHJ 1P2CB 3QNXA 2Y6SC 4FXGB 4JQVC 2EIZB 4RGMC 3V6OE 3VG0H 2HTLD 1WBYB 2W0KA 3LMJL 1CICB 4JHZA 5JXEA 2RCSH 1T5XA 4DN3H 2VXTL 3WKML 3QFJA 4MNGA 2HTKC 2DTMH 3GK8L 5IVXB 1J05B 2DQTH 3V52L 5C3LD 4FP8H 4HKBB 4CW1A 32C2A 4MD5A 1T4KB 3WFCH 1CFNB 4J4PC 3MV8D 1UQSA 1V05A 5IB1A 2DIBA 5FKPA 3Q2CA 1B0GA 2IBZX 2APFA 2GI7A 4L1HA 2B1AL 3LN5B 1FNGA 1I8MB 5C0BE 1MFCL 3LQAC 1YPZF 2AXJA 3O0RH 4KJQC 4BZ2L 1L7TL 4E41A 2ED9A 4NRZB 1R3HB 3HR5A 3MRBA 4PG9B 3GMOA 3BZ4A 2Z35A 3W9EA 2AQ3A 2FHCA 4H1LG 2IPKA 2YBRA 5C0CB 1OAYH 1NMBH 3O6MH 4J8RB 1OD7A 4OSUH 1E28B 4KKLD 4NHCH 4U6XA 2V5MA 2VLKA 4OI8A 4P2QE 4Y19B 3BPCB 4XC1L 2HG5A 1M4KA 3BKYL 1JIBA 3VMNA 3QPXL 1OTTC 4Z7NE 3SKNA 1HINH 1A2YB 5IMMA 5CIPA 1CLYL 1JNLL 3AROA 5B21A 4R4BA 1QBLH 3GMPB 1L9NA 3F7VB 1CN4A 1PEZA 3QT2A 5TDNA 4AZ8A 4RFNB 3IJHB 5SWSB 1HXMA 1ZEAL 3WUWB 2RAMA 1KGCE 2IALB 5DD0L 3QQ9C 5D7KD 5KSAC 3FONB 3BW9A 3DVIA 3LKRB 2R4SH 1TJHL 3TFKD 4QGYA 2CMRH 4O9HL 3ESUF 4CRPA 5C6TH 4X6CE 2ZG3A 1MNUL 4WGWB 5IBTL 3T0AA 1CGSL 5ALCH 3MRMA 1A8JH 5IGXL 1RUQH 4G8GA 3UEZA 2FIKB 3KYNA 1CLOL 1DQDL 4U7SA 5DA0B 4PR5B 3V4UH 2AEQH 4M9PA 3X3FL 2ID5A 2CGRH 3MRKB 4QRRA 1FORL 1S9XB 3MV8B 3BDBA 4FHBD 3IDIA 3CXDL 1AP2B 2X4NB 4BH7B 1RQ5A 1PY9A 4PV9A 1HHKB 1CGTA 3O6LL 2Q7YB 1OAUL 1T2QL 1WEJH 3KPLA 3GSNL 3EOTH 1MCJA 4LIQL 3FO1B 2Z8WC 1JF5A 5KVFH 2GY5A 2MPAH 1NKOA 4P57A 5EUOB 4GRLA 3TA3C 4G3YL 5GJTL 2DI7A 3BWAA 3DXAE 4J3OC 1B6UA 1KC5L 4M5ZL 3CFEB 1QSFA 7FABH 4HH9B 2VMFA 3V0VB 5A16A 5JW4Q 3JWOL 1FG2B 3TC9A 2NZ9C 4U33A 3CVIL 2ORBL 2PR4L 4LBEA 3D39E 5IT2L 1IGMH 1OAQL 4HIHA 1OHQA 2DM2A 3QRGL 1JFQL 1CQKA 4K7FA 2AJSL 4YXHL 5BV7C 4GKSA 1UWEL 1W2KT 3IFPA 5LQBH 1VKXA 1EO8H 3GSQA 4Y7MA 3E1F1 1YPZB 4TVPH 3MR9A 2AKRB 3HE7C 3BGFB 3DUSA 4JQIL 3ARFD 4PG2A 3ULUC 2DWDA 3G5XB 4JFHD 2R2EA 1KBGL 1LK2B 2AJYL 3ROOB 3D9AH 2AJXL 4KK5D 4AEIL 1HIML 3H9HA 2P8LB 4LSDA 1BZ7A 1Q9LB 2AJ3B 3HI5L 1F45A 1FLRH 4POZD 1S7UB 2LE9A 3V5HB 2W38A 4U1IA 3HAEH 5TQ2H 5C0GA 1F00I 5I8OL 1KENH 4NQTA 4OUUB 2YPKB 4FXLA 1O7SA 2Y9RT 2OR7A 4MJ6B 1LMKA 3GDBA 3KVQA 1J1OH 1QFWM 3MUGB 2MFNA 4L9LA 1DBBH 2DKSA 5CKAA 3BN3B 3FT2B 3QCVH 4KZEH 1ZHKB 1SJHA 5EU4A 4NP4L 1S9WA 2VZ1A 2V17L 3HFML 1JNNH 4YPJA 1JMZA 5C09E 4HW6A 1WISA 2MQ0A 5CCKL 1RJYA 3BGAA 5T1LA 1IKNC 3BJ91 1XGRA 2H9GB 3DX9B 1MAJA 1QRNA 5C0ND 1OY3B 3MFGB 4QRQB 3IFOA 1AGEB 1GL4B 3WHXA 3NFPA 4CDHA 3FJTA 1JZ8A 1R5VB 4O58L 3I84A 1TFHA 4QRSB 5EDXA 3WE6B 1EO5A 4OM0H 4ZSOB 4X6DA 1DDHB 4ZQKA 3TBSA 3QG7H 4L29B 2FGWL 2NW3B 3C6LC 4C83B 4OLYL 4UV7H 4Z77A 4LVOB 3FQXB 3ZHKA 2EDNA 3OKLB 3D69B 5C0IB 4XVJL 1D9KD 3GMQB 5IFHL 3VFVB 4FQHB 4RISL 3QXWA 2MNUA 5BMFL 1ZLWK 1CE1L 3ULVC 1NKRA 4DKAA 3AREA 2ENYA 3V6OA 1RIUH 3SDAD 2OZ4L 5EO1B 4GW5A 3ARFB 1HILB 4DGIH 3KXFE 2H2SC 1X4ZA 3O3BA 4JR9L 2DLFL 1H3VA 4IHOA 4NQSB 1IZKA 4PRNB 6FABH 1FFQA 1A7BA 2FECI 4QTIH 3VGHA 4UBDC 1NCNA 2I9LB 2UYLB 1CS6A 4U1MB 4U3CA 1XR8A 4S1SH 2HH0L 1BD2D 2NY5L 4EUPH 3ARQA 5I30L 3GKWL 3MRJA 1J8KA 4EI5B 4YQXL 1FVDB 2A77H 1CGWA 3S36H 5C0BA 1U8MB 2H26A 4QYOA 3UDWC 5HHOD 1NBQA 2IAMD 3GUTA 1P7HL 2VDRL 4CVXA 4ONFL 3L3HA 4QHMB 5GGSA 1CFQA 1X6NA 2AQ2A 2BK8A 1ZOXA 1XF5A 1UKTA 1S7QA 1XF3A 1X5ZA 4LFHG 3GIVA 4X0KA 3ZDZE 3EJJX 3H8NA 1U93B 4LSSH 5EBWB 1F11B 1C5DA 4FZ8H 1JL8A 1DQMH 3LKNB 3QEUB 1SJEA 5SWZE 4N90E 1ZHLA 2R29L 1IE5A 2XWTB 3Q5TA 3NIDE 3PHSA 4U6VH 1HSBA 2C9AA 4LVHC 1J0JA 4N0UB 4KK6C 4P2QA 4ZTOL 3QA3A 3DWTA 4WV1B 1B2WL 1JWMA 1K8DA 3A6BL 3C5SB 3EGSB 1PKQE 3SCMA 5DK0B 1YN7B 2GFBB 5EU5A 1AGFA 2NW2B 4PRID 1QLRB 3ES6B 3WNPA 2OL3B 1Y0LB 2VSDA 2J88H 1I1FB 5IFAH 2AJVH 3G6JF 4JG1L 1D6VL 4I48A 1JNHB 3ZHDA 1NSNH 2HN7B 4PJGF 1NJ9A 3S36X 1D9KB 4JPWL 3WL9B 1OTUD 4CDGC 1AO7E 4IBLT 4WW1B 1FE8H 1UA6L 4MQTB 1H3TA 1QSED 3SDAB 1FHGA 2GUOB 4ZTPH 3Q6GH 5CBEA 4G43A 1VERA 1X44A 4X6CA 4RMTA 1YEHH 5DMIH 5JLZA 2VIRB 4XMLH 5E5UB 1FO0L 3MNZA 1L9MA 5D7SL 2AJZB 1XGPA 2FLBT 4JY5H 3DVNA 3MXWL 5DF0A 1BD2B 2DBLL 2CLZA 3LKPB 5JIKA 3IJSA 4PTUB 5ACLA 4YWGL 1X5HA 5HHPA 1UCBL 1G7QB 5HHOB 2IAMB 3G6AA 3MLRH 3EYFB 3V5DA 3HRZB 4PY7B 2AQ1A 3BDYL 3HMWL 3GHBH 1P4LB 2FZ3A 1EHNA 2R4RL 2X4PB 4MLIA 3WV0A 5I1DA 1MAML 2P45B 3STBA 2WNGA 4P2OA 1N59A 3L7EB 3DXAA 1VFBB 4OLXL 3TNNA 4PYHA 3HKFA 2H2PC 4B41A 3DRTB 4PJHB 1UG9A 1BECA 3KR3L 2ADFL 4JZOA 3P4OA 4DZ8B 5CZXC 4AG4L 2HTLC 2VABB 3O45A 5HJ3A 1WCBA 3QJHB 3D39A 1KCUH 2EDLA 4PRIB 1XIWC 4EIGB 4DKEH 4MD0B 1A1MB 2DAVA 3FT4B 4XP1H 1UB6B 3KPPB 2HT4D 4UB0L 2WLYA 5KN5A 3HPLA 1UC6A 5I15L 4XCYA 5EOCJ 3WBDA 1XCTB 1CGYA 4WTWA 1JYVA 4DUXA 1A5FH 5BOZG 4FQCL 4DVBB 3ARZA 1QSEB 3K80A 4IOIA 4Y16C 2OMNA 2R56L 3QSKB 4CJ0A 12E8L 4CGTA 2RJMA 3C6SA 1S7VA 4EQ2A 1G0DA 2RFXB 3B43A 4EVNA 3QH3B 2OP4L 3VMPA 3MFFA 3MRFB 3OGCB 2L4OA 2YPLE 3UTOA 1P5UA 1IC4H 4LVEA 1JUFA 4P48A 1G9ML 1S5HB 5JQ6H 5IHBA 4GAJL 4WRLA 3RRQA 4D9QD 1MJUL 5DUPH 1QA9A 3CDGA 1YY9D 4QXWA 4QLRA 3ZTNL 2N7AA 3TJEL 2W65A 3G6JB 1YUHA 4Z7UF 5IW1A 2ZCKH 2X2YA 1XGYH 4NBZB 5C09A 3RY6C 3MJ8B 4DUWA 4OCSH 4UV4L 1H15B 5DUBA 5F9JB 4TYUA 2W9EL 2XZCL 2Y4SA 1GGIL 4HZLB 5DR5L 3W39B 1OAXH 4ODTH 3PNWA 3FB5A 2A74A 2O5YH 1E4JA 4DQOH 1G0XA 3ALXA 3LB6C 4AQOA 2VQUA 3SBWA 3MRQA 5D93C 4Z7OF 2FO4B 2X05A 4JFDD 5IB3A 2Y5EA 1LO2L 3BGFC 5MHSD 5FCSH 4WUUA 4D0DA 4HIIB 2DWEB 1UM4L 5IBLD 2CKBH 1QLEH 3OGOE 3I50H 3DV4B 43CAB 3BUYA 4KRPC 1OQOA 3MOBL 2OXHA 3KGRA 1EPFA 3MGTA 1T5WA 2XICA 5D96B 3O2DA 4IS6A 5IQ7L 2MKLC 2NY0C 3K74B 1K5NA 3SDCD 3KXFA 1IAOB 4FRWA 1CXLA 2VO5A 5DC0A 3QXVA 3QUML 3VH8A 5CSZB 2GY7B 3O8XC 3U4BL 1DBMH 5EO9A 1MUJB 1XCQA 3FZUC 1YMHA 4L4TD 4LLMB 1Z6JT 4D3CH 1C12A 3HZMB 4M62L 5JZ7D 4HAFA 3VXNA 4L4JA 1M05A 3IGAA 2CLRA 3OKNB 5ADPH 5F9OH 4N8VG 4F7PB 2BNRE 2QKIB 1CFSA 4P23D 3PWUA 4PS4L 5IJKA 5ERWB 3VXUD 5IB4B 5FM5M 4F7EB 1ZT7B 2Z0BA 5TE7H 3BAEL 1JYXA 1INQB 3RWJB 1LK3H 1NAMH 4QNPE 1FCCA 5IB5B 4C4KT 4FQ2H 5BO1H 1DBJL 2VZUA 1CVRA 4E5XA 3LPWA 4Z6AT 2V2WB 3PHQB 1UKSA 4Y0GA 4HG4K 3RTQC 4YBQC 4KDVA 2KKQA 3EDKA 3RX5A 1I8LA 1UM5L 1J1XH 5SWZA 3SQOL 4XMKH 4I3RL 4K23L 5JORB 4H26B 3WDIA 5MI0C 1JGVH 2JIXA 1OB1B 1H3UA 4JFDB 3GI9H 4GXVL 3MUJA 4AH2A 1JWUB 2CIKA 1I1CA 3C9NB 2AK4E 4PY8I 5FGRA 4UZGA 4KUCF 1PKQA 3W2DH 1KTLA 4GKZB 4CMHC 4KK5C 1R3IL 1NFDF 2VR9A 5J1TC 1FL3A 3VI3E 3DI3B 3F65A 1U3YA 2H32B 3THMH 3PDGA 4Z7VF 1T1YB 2DM4A 4I13B 4QHUA 1WGOA 3RPIB 4FTVD 3Q6FB 4AIZB 3AM8A 1NH6A 1AO7A 1VACB 3JV6B 4PY8J 4Z7UB 1KPVA 4KKAD 4R7DB 1QFOA 1YN6A 3N1MC 4U6HA 1KIPA 1T6WA 1REIA 3BPOB 4M6OH 1AI1H 4HKXA 3SKUD 3QEHA 3SDCB 2EDQA 4Y4FC 2Q3ZA 15C8L 2XA8L 1M71B 4ZYKB 4NUJA 3WN5C 4WI4A 2P8MA 4HV8B 2WBJC 4KRMB 4L4TB 3HG1D 3NCYS 2F58L 1A7NH 4ALAH 4KUCD 1FC2D 2XG4A 5FOBA 3AXLB 5DQDL 5D70L 3MREB 4P23B 3WIIH 4ZFOB 4I3GA 1T3FB 3VXUB 3KLHD 3O3AA 1N2RB 3IS1X 2K7QA 2J8HA 3JV0A 4FFZH 5IMKA 2EO1A 5LCVH 1T83C 5F1IA 1E0OB 3Q3GA 3S9DB 1L0QA 3QWRA 4HXBH 3BJLA 1JMXA 4ODHH 43C9A 3OJDB 2VLME 4Q6IC 4OCXH 1RVFH 3MSPA 5FM4A 4IMKA 3ARBC 5GS1B 4Y2DD 4WI9A 3NTCH 3SDDD 2BVOB 3NIGE 1EH9A 2G9HA 4PGCB 1DP0A 2IG2L 1CG9B 4ZS7L 1U8NA 4M6AA 3BIKA 3P9LA 5D7IE 2CRZA 1LVEA 1ODAA 5F9WC 1R5IA 1RIHL 4BKLA 2GITB 4F7CB 2OTUB 3QCTL 4JDVB 1J87A 2XNAA 3L5WB 3DTXA 3LEXB 2PYED 5FB8B 1FO0B 4FTVB 5BV7H 5ICZA 4GRWH 3HZYA 4WWKA 1AXSB 1BQLL 3MLZH 3PWPE 4G6FD 1UM6H 2GJZA 3FQTA 3WNLA 1I1AA 5TPWL 2DL9A 4WNQB 5DGRA 1IC5H 1PSKL 1F2XK 1M6OA 3UBXI 2C5DC 4YZFE 4BELD 3U30C 4G6MH 1HNFA 1WBXA 3ARTA 3B9KC 4OD3H 1LE5A 3ZTJH 3HG1B 4YHIB 1KUMA 2W0FB 5BS0D 3UYRL 2YEZB 4BSWB 3AVEA 4HMCA 3DGGA 2SEBB 1UZ8B 1NFDB 1B6DA 1UCTA 4AEEA 3W5NA 4JKMA 3UBXA 2CR3A 4PJEF 2BNUA 3VMOA 2ADJA 4Q9RH 4W81A 3FOMA 4DKFH 1NCAH 4MA7H 1KELH 3MLVL 3PWJB 4Y4HC 5GPRA 1FZOB 3KPSD 1HQ4B 5C9KA 4L3ED 2X9WA 2HKHL 3PP4H 1F4YH 1NGYA 5C0DB 3O4OC 2BMKA 1PLGH 1PEWA 5F7DB 4PGDB 5CGYD 5IWLC 4LRIC 2EDXA 4ONOA 1WFTA 1HCFX 1EJOL 2Q20A 3P77B 4BSVB 4Y2DB 4A6YL 4X5XB 3SDDB 1NMCB 1EFXA 5INCB 1RUKL 4JN1L 2Z31D 4JRXE 4KXZI 4P46C 2CUIA 1N5AA 2ERJB 2VDNL 3I6LE 5FV1L 3WJLC 3LKOB 4R0LA 1FH5L 3EFDH 4UINH 2DMCA 1EERB 3H7LA 5C08D 4ZUVB 2LVCA 5MENE 3BRDA 4H20L 4ZO7A 5EZIH 3UTPE 3EOYG 5D8JH 2P8PB 1YNLL 2PYEB 1IAKA 3R1GL 1A7PH 3GSWA 3O6FD 1ROWA 1JV5A 1A3RH 4MNHB 3HE6C 4G6FB 4XVTL 1J8HD 4PP1C 1GGTA 3ARDA 3BVNA 2ITCB 4FXKB 3ULVH 5ISZE 3ZE1E 4P49A 3U7YH 3PV6B 3N1FC 5H37H 3QI9A 3QDMD 1VSCA 4JO1L 4Q9CA 3BYYA 4HF5L 2IPTH 2ICEA 5HYSA 3MRDA 3KPRD 3MROA 4D9RE 5ILTL 1NLDH 5F7LB 4XPTH 5HI3C 1KN4L 4HPYL 1NLBH 4ZDHA 1RJCA 3D85A 2BNRA 4LP5A 4KK8D 3PQYD 4XB8A 1DQJB 5BS0B 1AY1H 1T1WB 1LEIB 4R4NC 4TQEL 4CVWA 5C6PB 2ZUYA 1F8TH 1LP9F 4K3EH 4KTDH 4ELKA 2NY2D 1FDLL 4RMWA 4FFWC 5D9SA 4WI8A 4CJ1A 4IIQC 4K7PL 5HGAB 4LSPL 4XNXL 3CC5B 4QF1A 5DJ8B 3W11C 1GAFL 3KPSB 4ISVB 5FDYA 4HT1H 4L8BA 4L3EB 1CD1A 4TULH 3I75A 4N8CL 2H6PB 4JEGB 5D2NC 1FL6B 2X4QB 5MERA 4F58L 5ACZB 5IMLA 4XP4L 1KF9B 2AK4A 4AEFA 4UDTA 3GNMH 4JREB 4XZUA 2R39A 4R7NB 4J1UA 5EORL 1BLNB 2Z31B 3RL1B 4I8DA 4HLZH 4FMFA 1DL7H 1E4KC 1FVEA 2O5ZL 5F88A 4HG4J 4ZD3L 4O4YL 5E8DH 2VLJE 5INDA 4TSAL 3FQWB 3FQNA 5L88H 4WU7A 3QFJD 5KS9E 3T0BA 2IQ9H 4OFIA 3MJ9L 3OXSA 4N68A 5C08B 5M94B 5ID0B 3MRLA 2R9HD 4KMTH 5GS0L 4JY6B 5DYOA 4LSVH 3CH1A 2JELH 3HNVH 1SM3L 4MQ7A 4UU9A 1E4WH 4FOMA 1QUNA 3O6FB 3QNYA 4OCRH 1YNTB 3IAPA 4QY8A 5C0JA 1J8HB 5A1AA 1T89A 1LEKB 2ICES 2DQDL 4G80A 1MCKA 4PJFE 4UAOC 1MJJB 3DV6B 4X99A 1EZVY 1CR9H 2FJHB 1Q0YL 3QDMB 1N0XH 4E41D 3ISWA 3QUKB 4APQA 3LSOA 3S5LA 1RUPH 3LPGA 4ZUTB 5FGBA 4PGEA 3KPRB 2R8SH 1U8LB 3IKCB 5JO5B 3S96A 1RZJL 4JM2C 3GSUA 4A2LA 1Q38A 2NY1C 3PQYB 1PDKA 1Z5LA 1RU9H 4KRLB 4HAGA 1HSAA 1T1ZB 4TUJB 4U1KB 2NY2B 2VLKD 1HKFA 2YZ8A 4L8DA 4PD4J 1K85A 1DVFC 2YKLL 3ZDYE 3RKDD 1MH5B 3IDMB 2YHGA 3PXJA 5IBLC 2P5WE 4KI5C 4GLRH 2OR9H 1WVZA 3HC4L 3CLFH 4HUNB 3VRIA 3I02B 5CFHA 1I8KA 2XG5A 1EEYA 1BFVH 5DVNA 5L0QB 3VD4A 3KJ4C 1LD9B 3HNTH 2OMBA 3B9AA 5ESQA 2Z91A 1IQWH 4JDZB 1ZT4A 1I3GH 1M7DB 4XPHH 4LGRB 1KULA 3QNXB 1U2HA 3T08A 5EB9A 4XC3L 2HJFA 2KDGA 4EI6A 1GOFA 2QBWA 4IEFB 4EUPA 5D7IA 2D4FA 3DGCR 4DTGH 4AIXA 2WWMD 3BD3A 3QFJB 5IBUB 1MI5E 3B2VL 4MNGB 4UMGA 4Z95H 1TCRA 2XZZA 3UZVB 4G8GD 1P7QA 4CW1B 32C2B 1A6VL 3R06A 4FQXD 4FZEL 4MD5B 3PWPA 5D7JA 3MLXL 4QRRD 4F15C 3HC3H 2NMSA 4KTEL 3FCTA 1UQSB 2ZUTA 4JO2L 1FBIL 5FKPB 5FGCB 1B0GB 3SDYH 1GGCH 3MACH 1FNGB 1N8ZA 2B20A 5T1KD 1ZSDA 1CXEA 1V7NL 3O4LE 1NEZB 3OV6A 4E41B 2WWKT 5HDQH 1BF8A 4FQ1L 3HR5B 4GRLD 2W0LA 3MRBB 1TITA 2D7PA 2HT2C 4GAYA 3BZ4B 2F5AL 4AT6A 2ZUQC 3W9EB 4Y89A 2IPKB 2YBRB 1QSFD 5EIVA 1J7VR 2B4CC 1MHPL 5E2UL 4U6XB 3D5OF 2VLKB 3E8UH 4Y88A 4EDWL 2HG5B 3HUJE 2O5XH 3VE0A 4OAWA 2EYSA 3EJZC 1RZ7L 3SKNB 4JO4L 5IMMB 5CIPB 2B5IB 1FN4A 1I1YA 2JCCE 4K3JL 4WO4C 5TDNB 2PXYA 1ZA3B 3FHAA 5FV2A 1W0VA 1HXMB 4PLOB 3S88L 4JVPA 5C3TA 3ZKSD 1MWAH 1TQBC 1YEFH 2APWA 5B8CA 3BW9B 4JRXA 4N5ED 3UX9B 4X98A 5CWSB 4YHML 4O2CA 2ADIA 3F12A 3D87B 3UYOD 1I9RL 3VFUA 1MFAH 3O2WH 2ZG2A 3I6GA 4JHAH 4RFOH 1V8HA 5CJXA 4EKXA 2E9JA 1A3LL 3NZ8A 5AZ2H 3TM6A 5MENA 4MS8C 1QQDA 4JKKA 2VWEC 1QFWI 4GMSH 4JCMA 2VE6A 3MRMB 4IDJH 5E6IA 4G8GB 1EUTA 3KYNB 4WHDA 3F5WA 1UFUA 4FQXB 1DN0A 3A67L 2J7LA 4M8QA 4JCLA 1KACB 4OB5L 4UT6L 2RBLA 4QRRB 3GHEH 3U1SH 2NYYD 5ISZA 3OF6A 3IDIB 4ZS6D 3F7QA 1JE6A 5FUZL 1AC0A 3LEYL 2WV3A 2CRIA 4PV9B 1CD0A 5T1KB 4JG0H 5I2IA 5F6HI 3QDGD 2F74B 4HMEA 1RZ8A 1RZGA 2EDYA 1PZ5A 3KPLB 1CT8A 3H42H 4OJFL 4PIRF 3CSPA 5T1LD 5C86A 3P40A 2P4AB 4MAUH 3MBXL 1ZHBA 4P57B 3REVA 1OOAA 4GRLB 1B0RA 5LG1A 3SKMB 3L3JA 3BWAB 4KJWD 4QXUH 3L9RA 4Y2DC 1QSFB 4DJMA 2VDOL 1WZ1H 3N0PB 4PPTA 1NMCC 5F6HJ 4JQXA 4YHNA 5A16B 1K3IA 1S7WB 4JM4L 5FGSA 4K3GA 4GRWE 3ZO0A 1IT9H 3VD5A 3BH8A 4LBEB 2BVUA 4MDJA 4XBPA 4NJ9H 2PUQT 4OFVA 4OZIE 4HIHB 1WIUA 4K7FB 3BSZL 4JDTL 3DIFA 1CGVA 5GS0D 5B39A 4GKSB 1ZGLM 2OTWB 3CMOL 3MLUH 3WKNA 3ULUE 3IFPB 3NA4A 4OZGF 3DO3A 1OCWL 4YHLL 1VKXB 3GSQB 3TV3H 1QSZA 5I8KH 4OLZH 4NNYA 1U6AL 3RVXD 3C09B 3BPNC 3ARED 3MR9B 1S7RB 4QXTA 3VWKC 4YK4C 2MQ3A 3DUSB 4AJ0A 3BKCH 2DWDB 2VDMH 4M7LH 2R2EB 2VLJA 1MELA 5KS9A 3WO4B 4NYLA 1E4XL 1I7RA 3RNKA 3GMNA 3RUGE 1BZ7B 3K8MA 4ZNCD 2H1PH 2E6PA 3ZE0E 2DQFA 4U1IB 1D5IH 3T65A 5C0GB 3QDJE 4Z7NF 3ZDXE 1NGXA 2XOTA 3WFDL 1CQYA 1F3DH 1MEXH 3VFOA 2YD8A 2PW1A 4KFZC 5GS2H 3QO0A 5C0BD 2P7TA 3WIHL 4L9LB 3BP7A 2YPVL 4AMKL 1SJHB 4GAGL 4LQFL 4PJFA 2R0WH 5TFSH 5EU4B 4LDOB 1S9WB 5AZEH 1MCPL 2MQCA 3WLWD 4LDEB 1I1RA 3QDGB 1Q9WA 4X8XA 3T4YA 1UVQA 2B1HH 2DIAA 3TO4A 1IFHL 5T1LB 1XEDA 1XGRB 2QQLL 1A6UH 1QOKA 1MQKH 2CKBA 4I0PC 3NGBB 5HGGS 3IFOB 5T33L 1JTPA 3WHXB 1FSKB 2XYCA 3NFPB 4F8TA 1S5IL 4P2QD 1MREH 1V3LA 2J4WH 4NN7C 4RAVA 5CEZH 5JW3H 4ZQKB 4Q0XH 2P5WA 4PUBL 2VAAA 3SCMD 1XF2A 5HSFA 2EIEA 3TBSB 5J6GA 4H8WL 5F1SA 4Z77B 4X7DC 5HHQA 3CFCH 3ULVE 4D9LL 4JQVA 4N8PA 5DJ2A 5LGJA 2R1YB 3LS5H 1KGCD 4G6KL 5AYQA 2RHEA 4GBXC 3U0PA 3X3GL 5HGHB 1A9BA 3AREB 1IC7L 2EXYD 4W68A 2VZSA 2DDQH 1ZWIB 4GW5B 5JMOC 3VXTA 3INUL 3O3BB 1NUNB 3DETD 2CJUH 4IHOB 4J4PA 1MI5A 4LMQE 1ZANH 3GRWH 2JJTC 4AM0A 4XCFL 4UIMA 3R8QA 4HWBH 3UTZA 4FG6D 5DHYA 2DLHA 4XXDA 3SOBH 4OGYH 1XR9A 3ZYJA 3OAUL 1ACYL 3DYPA 5D7LE 1XR8B 2CDFA 5CD5D 4X80L 1JGLL 2X4TA 3NCJH 4YXLL 5JW5A 1HI6A 1OLLA 1ZLSL 4IRJC 5C0BB 1UACH 1NGQH 2AAVA 2GSIB 2H26B 2HVJA 3BE1H 4PJXE 2CK0L 4QYOB 3V6ZA 1IAIL 3GUTB 4CVXB 3O4LA 3I3BA 3LDBB 2A1WH 1KIQA 3CLEH 4NKDA 4XAWH 3JTTA 1S7QB 1XF3B 4NSKA 4R9HA 4DWHA 1YYLL 4OCNC 3RWHA 4K7PY 4OQ1A 4X0KB 4P2OD 4K9EL 1C5DB 2XZQH 4QXGL 4XBEL 4P4RA 1NCWL 1J1PL 1SJEB 3E0GA 2W9DH 5CSBA 5JXAL 1U92A 3VJ6B 1DZBA 1VFMA 1GHFL 4M93B 4XPAH 4FQQB 1MF2L 4P2QB 2UWEE 1BQHB 3QA3B 3ZKMD 5C2BH 3HUJA 1JWMB 1K8DB 4NNPH 3D39D 5FYJH 1Q0XH 3SCMB 1AGFB 5KSAA 4M61A 2BJMH 3MZTA 3I3EA 4ETYA 3VG0L 4OM1H 2YUWA 2JCCA 4ONGH 1IGIH 4UTBH 4YIQA 5HHXH 3JWDC 4I48B 4DN3L 1CDUA 2AW2A 4BJLA 2DTML 2YMXL 3BDXA 1G9EA 4NKQB 1BJMA 1TXKA 5T3ZE 2ADGA 4FP8L 1ZKAA 1MLCA 3G6DH 4ODUA 5LBSL 2HFFA 4X9IA 1HQRA 3NCFB 5CBEB 4G43B 4LSQH 4GSDH 1EFQA 2FATH 5DVLA 5SX5H 2EDHA 3KYKH 5FCUH 2YS4A 5C0CE 4C58B 4K3DH 3O0RL 3BD4A 3TN0C 2IH1B 4DCQA 4P0DA 2VL5A 5DJ6B 3MODH 1TETH 3MNZB 4Y19E 1X6LA 1XGPB 3DVNB 1I7TA 3VD3A 3OXRA 2CLZB 2J6EL 2VISA 3TYGH 2F19L 3IJSB 4HS3B 3SO3C 3KPNA 5HHPB 3RNQA 5E5MA 4KAQL 5C09D 1JPFA 3QUYC 3TA3A 1OAYL 3G6AB 5E99H 3RKDC 2BSSA 3O6ML 4HK3N 3V5DB 4WI5A 5IR1A 2HJLA 2FZ3B 2QHLA 1CE6A 1CFTA 5I1DB 1BJ1H 3PWNA 1BX2A 4P2OB 1N59B 5MEPA 1AQDA 3ESVF 4O2FA 1HINL 3TNNB 4ZAKD 4F9PC 1QBLL 3AB0B 5HHNA 2XQYG 4JZOB 3OR6B 3P4OB 5F72S 1G7MA 2VZVA 3X13A 4HWEH 2FEEL 3O45B 5HJ3B 1WCBB 2LQRA 3D39B 1NGPH 4OZIA 5F89A 2R4SL 1KJ3H 2ENSA 3HE7A 5I66A 1WT5C 1FGVL 2CMRL 2MCPH 4JLRA 1G7JA 2A6IA 1JPTH 4OZFH 5JIHA 1J5OH 5KN5B 5C6TL 1QBMH 4S2SA 4XCYB 4QHNA 4FQXC 3SY0B 5ALCL 5DO2D 1OQXA 3ZDZF 4ODWA 2IGFL 4YDLB 1RUQL 4RWHA 3KXFD 2AVGA 5F97E 3STLA 2FX9H 3V4UL 2AEQL 2CDGB 3DROA 2CGRL 1C5BL 3P4MA 3RUGA 3VDAA 3GBNH 1S7VB 2UZYB 5IF0A 4JKPH 4EVNB 5E0QA 3MFFB 2F8VA 5K9KA 5E8OA 3QDJA 1CDBA 1CDCA 3WIFA 3LKQA 4IMLA 2DKUA 1JUFB 1ED3A 1WEJL 2LTQC 2ZSWA 1D5XA 2VH5H 2AV7A 5KVFL 3GMRA 2MPAL 5KANI 1QA9B 3CDGB 1JNJA 1IKNA 5B3JE 3TH3T 2W65B 3L3DA 4ZG1A 4TPRH 2I24N 1YUHB 1ND0A 5C09B 1OP3H 1G9NH 5HI4D 1HWGB 2AERT 1YPZE 4HEME 4D0CA 4ERSH 4MD4B 5SX4H 1NL0L 3IJYA 1NCTA 3V7MA 3PNWB 3S37H 1BZ9B 3FB5B 2F53E 2A74B 4N90D 3EIFA 5H2BA 4MLSA 5SWZD 4D8PA 1IGML 5IVNA 3M8OL 3MRQB 4HJGA 4Y5VC 2ZOLA 3C6LA 2JIXD 4ZAKB 5IB3B 2VERN 3ILPA 5FYKH 1KTDA 4HJ0D 1EO8L 4NCC1 3MV9D 3K8KA 2DBJA 2X1QA 4D0DB 3C2AH 4TVPL 2YD7A 5ETUA 1FV1A 2YD4A 3BUYB 5EOQH 2VXUL 4P4KC 4XPGL 1MRCH 5JUEH 2E6QA 5KG9A 2D7OA 3MGTB 4GMTL 4LEOA 1NDMA 1T5WB 2DJUA 4LMQI 2G60H 1X4XA 1AO7D 4IS6B 3ARXA 2Q86A 5TQ2L 3QXAA 2C4FT 35C8H 2NYYC 3C8KA 1K5NB 3KXFB 2D7TL 4CVZB 1FL5B 1R3KA 3S37X 4EZMA 4L8SC 4LPCA 3VH8B 2O61A 1WAAF 5EO9B 2YR3A 1RK1A 1XCQB 1JGDA 1BQSA 2IADA 3QCVL 4HGKC 2FH6A 4KZEL 4YAQA 1YMHB 1JNNL 3UDWA 1C12B 3OPZH 2YXMA 5CLTA 5D7LA 3VXNB 4ESKA 3NGBC 1M05B 4ZSOE 3IGAB 2ZSVA 2Q1EA 5LVEA 2APBA 1CFSB 3N50A 1M7IA 5ADOH 3KPMA 3WNKA 1QHOA 4PJXA 1BGXH 1GPOH 1I9EA 2X1WL 4XNYL 4RX4D 4K55A 3EYOA 1OL0A 2FJGA 2DOCA 5I8CA 1J0IA 1FYHB 2A38A 4E5XB 5TDOA 5KW9L 3ZKXB 4OM0L 4JKLA 2PCPA 2E27H 1JGUL 3RGVC 2B0SH 5GGVY 1KFAH 5I1HL 2GHWB 1CICA 3QG7L 4NO2A 5SWZB 4JFEE 4UV7L 4JFHE 1MJ7H 1XGUA 1B4JH 3GBLA 4B0MM 5DFVD 4H0GA 1DSFL 4NM4H 2JIXB 4UI2A 3CDFA 4AH2B 5F93C 2UWEA 4E42A 4NKIL 5E8EA 2CIKB 2XZAH 2YUZA 3QBTB 2B4CH 5EU6E 5LWYH 1PKQB 1KTLB 4K8RD 2WIIA 1P5VA 3IVKA 3TYFA 1A7RH 2UVEA 1FRGH 4QHUB 4XCEA 1I8MA 4PB9H 5CILH 4QTIL 3NCYP 4WWKD 1MFDH 3IFNH 1AO7B 2BZDA 4FQLH 4U6HB 1KIPB 2J3SA 4TRPH 5GRXG 4PJ7F 3K1DA 4NO0D 4HKXB 3MRRA 3QEHB 1P69B 5FA4B 3NIFF 4NUJB 3RWGA 2A77L 1HK6A 3S36L 2P8MB 5C0CA 2YPLD 5GZOD 5CEZE 3CVHA 2V9RA 1S78D 3QO1A 4Y19A 5J3HC 5FOBB 1VGKA 4PJ5D 4LSSL 4FZ8L 4YX2L 3GMPA 5KSVB 3O3AB 4BFIB 4OCMC 3V79C 3MBEC 3LIZL 4U6VL 3VFTA 3IB4A 3OKMB 1EGJA 4ZO8A 4LASH 2NQCA 5IMKB 4GW1B 1NC2A 3LHPH 1CK0H 5F1IB 3Q3GB 1YEEL 1LWRA 2X6MA 43C9B 1U8PA 4FFVD 2VITA 1RY7B 2J88L 2B39A 3K0WA 5DD5H 1S7TB 1XIWA 2PETA 3DHMA 4Q9BA 1IMHC 5KZCD 4CBPA 4NRYA 5AG9A 1EFXD 1KB5H 1NSNL 5ELIA 1KG0A 2QQQA 2G9HB 5GSRA 1BWMA 5J12C 5CP7A 1FE8L 4UT7H 2JK5B 2YRPA 4X9HA 4NZRH 2APXA 3BIKB 3P9LB 4U7KA 3KHQA 1YQVH 4R26H 3Q5OA 4QNPF 4EDXA 1GGUA 4BKLB 5E56A 4ZTPL 3Q6GL 4MMZC 1AP2A 3EYSL 2YN3A 4BH7A 1OAKL 4Y16A 2VDQH 2XNAB 1YEHL 3DTXB 3MCLH 5ICZB 5HHOE 3HZYB 5DMIL 4WWKB 3ELAT 2AXHA 2C1OA 4OLWH 3TH4T 3FO1A 4XMLL 2GJZB 3FQTB 3ARDD 1PZUB 4NO0B 5E2VH 5GGRA 1OSZA 3RU8H 4FQPA 4JY5L 2XN9E 3VFGH 3OAYK 2VDKH 2IQAB 1KLUA 3QI9D 4L9DA 2LFGA 1M6OB 2VKWA 2YPLB 2MCG1 1I9JH 1H5BC 1GGBH 2W60A 1WBXB 5IVOA 5TQ0H 1Q72H 4OGXL 3MLRL 2EEAA 4K71B 4X4YA 1LE5B 1JRHH 5A2KH 3D85D 2BNRD 3GHBL 5FYJE 3RY6A 3BKMH 3VXME 3A0OA 4KK9D 3STZA 2DQIL 5T1MA 4KJYA 2F5BH 4PJ5B 5C0RL 4PRIE 3AB0C 4W6YB 4JB9H 1EBPA 5IUSA 1I3VA 3UBXB 1RHHB 2BNUB 4MNQE 3FO2A 3P30H 3FOMB 3BP5A 3GI8H 3T0DA 1N4XL 1MWAA 5IHLB 3DARA 3H9ZA 1I8IA 1YPZA 1RD6A 2LU7A 2ICWI 2F53A 2EC9U 1IGFL 1NGYB 3R0MA 5I75C 1KCUL 2BMKB 5IK3A 3V7AE 4QWWC 3U0WH 4H25A 3MPCA 4DKEL 3HLAA 4X9FA 1GH7A 1EZVX 4M7KH 1ORSA 4XP1L 5DC9B 4KY1H 4M6NH 5DURD 2AK4D 5KZCB 4XP5H 4K2UH 1W8NA 4WI3A 1EFXB 2BRRH 2ICWJ 2COQA 4OIIH 1A5FL 4R0LB 2YPKA 1VDGA 3RX7A 2C1PA 4BH8A 2P42B 1BJ8A 5LXGH 4D0BA 4YHPB 3MUGA