5CEZD

Crystal structure of the bg505 sosip gp140 hiv-1 env trimer in complex with an early putative precursor of the pgt121 family at 3.0 angstrom
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
240
structure length
240
Chain Sequence
EGQLVQSGAELKKPGASVKISCKTSGYRFNFYHINWIRQTAGRGPEWMGWISPYSGDKNLAPAFQDRVIMTTDTEVPVTSFTSTGAAYMEIRNLKFDDTGTYFCAKGLLRDGSSTWLPYLWGQGTLLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 44
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezD01
3N06B 4BSWB 1EFXA 1SY6L 1U3ZA 4S1DC 3WHXB 1R3IH 4HH9B 3FQUA 1NKOA 3IETB 2Z35B 2NXZC 4UAOC 4QHMB 3LIZH 1K8IB 4LLYB 4GG6B 3RWIB 2K7PA 4JDTL 4XMPH 2IWGA 1B2WL 1CGVA 2OXHA 1NCBH 4UT7L 1MCWM 1RZKC 3LSOB 2BSED 2ID5A 4Z5RB 3Q5YA 4WI4A 4XPHH 4N0YL 4HLZH 4WO4C 4KRLB 5IROA 4AYFA 2VZ3A 2ZKHH 1T7XA 1QRNA 5ACMA 1KXTB 1WF5A 3RDTD 3U36B 1S7XB 5B39A 1SM3H 5GRJH 5AEAA 4L8DB 4NGHL 1INQB 3VGBA 5GGVY 1E6OL 4GRWF 5EU5B 3V0VA 2A6JB 1DN0B 3MTRA 2GJJA 3DV4A 5F1SA 5CIPB 3NFPB 1DE4B 5C0AB 3MRMA 1IQDA 2NY5H 5CHNB 3AS3A 1IEBA 5EBLA 4Y16A 5I8OL 4PTUA 1QR4A 3TJHD 4HIEB 4GAJH 1CICB 1ZEAL 1U91A 3BEVB 4PJDB 2JB6B 5C3TA 4A6YH 4JN1H 4M4PA 1U8MA 3RIAK 4G7YH 3VXSB 4G9FA 4M1GL 2OL3L 3V4VH 1B0WA 3BKYL 3L5XH 3LEYL 1GGCL 5DZOA 1T1YB 3ESUF 2QADC 1YYMH 3PIQA 4P46C 1ZLVK 5LJYH 3O2DH 1JCKA 1OB1B 3LKSA 1A1MB 3V4PH 4U1HB 5C6PB 3VMOA 1WVZA 1FNGB 2VLMD 1M4KA 3QUKB 4F7TA 5FYJL 3LMJL 5JHDA 3H2WA 1NGQL 2G2RA 5CJ5A 5JHLH 1LDPH 3C2AH 1AQKL 3EYUL 4UT9L 5L2KA 3N1MC 2HTKC 5IHUH 4KJPC 3ARFD 5ESQA 1RZGA 4YHYB 3ET9F 4JFED 2R29L 5HXMA 2ZZUT 4ODSL 5C7XH 1U8QA 1NANH 4CMHC 1OQOA 1S7RB 2F74B 2OP4H 5TDPA 3ZHDA 1CGYA 4TTGA 4Q9QH 1ZT7B 1I1CA 4MXWL 4I13B 2P46B 2E6JA 4MJID 2C4FU 5EN2A 1UFUA 5C0CE 3OWEA 4FQHB 4EN3C 4D0BB 3F7PC 1LHZA 4YK4C 1AP2A 2BHZA 3LN4A 4Y4HA 4H8WH 4DZ8A 4MNQA 3MUZ1 3W5MA 3FQTB 2XOTA 4K71B 4ERSL 1CQKA 3M45A 3P4NA 3UO1L 5DT1L 2DIBA 3HG1B 3VFGL 5MENA 1BREA 2X1PA 1QLFA 4ISVA 1UZ8A 3LV3A 2X70A 4BQBA 4ZPVB 2VLLA 4YDJB 4TSBL 3KPSB 2N4IA 1FNLA 3MGOB 2YWYA 4KK5D 3QCTH 3VD7A 1MWAH 1JPSL 4CNIB 5BRZD 1NJ9B 5I0DA 1J0IA 3STLB 3NA9L 2G9HB 4O2FA 2IAMA 3PABA 1MH5A 3KR3L 1P69B 3D18A 4FABH 4POYA 3MOQA 4YHOL 1MRFL 4HQQL 4NC0B 1J1XL 1MI5A 3T1FB 4BKLB 5EG6C 1H3TA 3QIBC 1C1EL 3RA7H 4AIXA 1DBBH 3LS4L 3MRKA 1E27A 3PWJB 1D9KD 1FFPB 3CU1A 1G7PA 2Q20A 2FWOB 4LRNH 4NP4L 1UB5A 4J7RA 1OSPH 1MFEH 1HKLL 4I77H 5GPRA 2HJLA 4WJ5A 5ALBL 5ITFB 3Q5OA 1AGBA 1BM3H 1UM5L 4FQ1L 1CDHA 4TSCL 1CD0A 3SDAA 2ZCKH 4YPJA 2YPKA 1NC2D 5IVXA 2HT4D 4JKPL 2BVQB 3MRHA 3GSNL 4XCNB 3SE3C 4K94H 4OGXL 3VWKC 4HIJB 4PJGB 3DWTA 1A6ZB 1D6VH 1HH9B 5EOCH 2CLZA 5IG7A 2VLJA 4ODXA 5D2LE 5LGHL 2BNUA 3HR5B 3ZE0E 5DYOA 5JNYA 3NBNA 4QXWA 5DJAB 3W11D 4LIQE 3FQRA 3OPZL 5BV7B 4JG1L 2GJ6A 5DHVH 3H9SB 2D7TH 1P4IH 1G7QB 2Y9RT 5IBTL 1OVZA 2DQEL 2P5WA 3OXSB 4PJBB 5JA9A 2A77L 4MJ2A 2GITA 4Y2DD 1IGJB 2PO6B 5CINL 5D7JD 1KEML 1I7ZB 3SE9L 4JLRB 1QSFA 3RUGF 4ZFZA 4OGAD 5E9DA 4L3ED 1Q72H 4U6YA 5T3XD 1EHAA 3QXDA 1FJ1A 2IQ9L 4IIQB 4AMKL 5F9JB 2Y06H 4WV1A 2AAVA 2NTFA 3BH8B 4JM2B 4U0RC 1BZ9A 1MCOL 3RVXD 1JV5A 1F8TL 3KYNB 4CBPA 2EDXA 4ONOA 2IALA 1JN6A 4NKMA 5HGBB 4R97B 3DX8A 3MUGB 3GDBA 5CMAA 5F7UA 3BD5A 5BS0A 4FQXD 4KI5C 2PR4L 1IC5H 1DL7H 5MENB 2K7QA 5KAQF 5HDQH 4HUMB 4LK4A 2EE6A 4DN4L 1EBPA 2I9LB 1CD8A 3R06B 4LEXH 3U7YL 5JDSA 3MLRH 4QWWD 2R2BA 3MBXL 4OLYL 4X80H 3DV6A 2IPTL 4DQOL 4QOKD 1NCWH 4QXUL 3QQ3A 4KV5E 5HHPA 3O2DA 3QXAA 3IXAB 1LEIB 3BQUD 2Y6SD 1OF2A 2FHCA 4R7NB 5I1KL 4ODWB 5DK3A 3QDJB 1R24A 3IDUA 5E0QA 5EOCJ 3V6ZB 2IBGA 3C60B 2A6KA 3HUJF 3W82A 1KJ2H 4KHTL 5C71A 2OMNA 2PW1A 4ODUA 1T7WA 1MY7A 4AJ0A 5J06A 3LKQB 5GIRA 2GFBA 1RUQL 3O0RH 3RU8L 3VGEA 1T1WA 3B9DA 3DUSB 4ONHA 3MBEA 4NQED 5IVZA 1JWUA 3T2NL 3IVKB 4YEEA 1EERB 1HHHB 4FFYH 3M1BB 3PNWA 4JFYB 1KPUA 5CJXA 1RIUH 4DKEH 4UU9A 3FN0H 1G0XA 5MEQA 3QEQA 3BP7A 1ZHBA 2PUQT 3L7EA 1CXFA 1N8ZA 2XFXB 3CPLB 2ERJB 2EXYD 4KJQD 1A3QA 1AO7D 3MNZA 2H2PD 3TBTB 3L7FB 4GW5A 4OZHA 2WM0A 1HQRA 5D6CB 1OW0A 1RUAH 2G75A 4TSAH 5BVJB 2DMBA 4OLZL 1QPXA 4FXKB 3MNVB 3VFSB 3MQIA 5IQ7H 25C8L 2IPKB 1MCKA 4P5TA 1MEXL 3TV3H 2G5BB 2GJ6B 1PZ5A 4XPGL 5E6IA 1FL5B 3X11B 3F12A 4P5KA 2EKJA 4ZXBB 4P23C 1R5WB 4LVHC 3QIWD 1V5JA 3EJYC 2XWBB 2ORBL 3KYKL 5GRYA 4P2CG 1FVEA 4N0UB 3AFLA 2CQVA 2CLVB 4HUVB 3B4NA 4JFXA 5DVLA 4XHJC 4HKBB 4K3HA 3B9KA 2EECA 4OCSL 1DQML 3D3VD 4GW4B 2ADJB 1OP3K 1N2RB 4J12A 4H88L 3VGAC 2X4TA 3IXTB 4Z9KB 1XIWB 1A14H 4KROD 1A9EB 4U1NA 5DRWA 2DYPA 4N8VA 1YNLH 2NY0C 4OZGF 4GKSB 4ZUWB 5HGGS 5JORA 3QAZB 1I3GL 5SV3A 3O4OC 2NY1D 5IB1B 4N0RA 2AK1H 5I8KH 1E0OB 4MLIA 2W59A 1VGKA 5IB3B 4R0LA 5D2NB 3TFKC 2HVJA 4A6YB 1E4JA 2RIKA 5DMGD 5HGHB 3M17A 1VADB 1ZHKB 4J6RH 3JVGA 5EWIL 1INDL 2CIIA 4OTXL 2R4RH 4J3OC 3HC0A 3V4UH 3VRJA 5JO5A 5DHVA 5GJSH 1P7KA 4KMTH 5KZCD 2DI9A 3PHQB 4RZCB 2HT3D 2EDLA 3AU1A 1E4WH 4MQTB 5EC2B 4ZTPL 5KANI 3H0TB 2IFFH 5FM5O 1Q38A 2JB5H 5F9OH 3G6JA 2X1WL 5C0JB 5M95B 4YXHL 2ATPB 4PRDB 4BH8A 4O02L 3F5WB 1FP5A 4Z7WE 4HS3B 4DKAA 1A7RL 1IC4L 3NZHH 3AREC 1CCZA 3MA9H 2AK4E 2E7MA 2VNCA 5EZLA 3E1F1 2VAJA 3GMRB 2W1NA 3PNWB 4X7TB 1S7TB 4D9LH 4ZS6D 1S9YA 3DX9A 4ONGL 1ACZA 4LCUB 1EHLH 4XVUC 4KHXH 3D2UB 2CO7B 2V7HA 3ZO0A 2W9EH 3UTTB 2AV1B 3HI5L 5E99L 5ABDE 3CZFA 2BOBA 1JNLL 1H9VA 4LBEA 1NPUA 3VXNB 5LGKA 4H0HB 4PV9A 1ZOXA 2ITDA 3WUWB 4P2OC 1Z0NA 2M1KA 1XCTB 3IJHA 1K9TA 3AY4C 5IQ9B 2Q7NA 2FO4B 5C0BD 5FYKH 1MWAB 5HHOE 5I6XC 1YJDH 4KC3B 5IIEB 2X4QA 3U83A 3MJ9H 5HY9A 3ARFA 3IKCB 5CEYA 4TRPH 4IRJD 2FB4H 3MJ8A 5IF0B 1MFDH 3KPRB 4RMTA 4JFEA 4Z0BH 1DVFD 2EH7L 1FV1A 2XI9A 3TO4D 1KJ2A 1U8HA 3OB0K 5C70A 3QR2A 1RV6X 4YHPA 2QSCH 4D9QE 4V2BA 3QHZH 4MJIA 1YPZE 4HC1L 3EDFA 5HDBE 1BFSA 1UA6L 3SDXB 3CVIL 1DFBL 5C6TH 3HAEG 2EDFA 4BYHA 2VDLL 2AEPH 3BP5A 4HV8A 3LPGA 3QDGB 5TJWK 2L4OA 3BMVA 4JCLA 1QACA 5E4EB 4PRNA 5DRXA 4X6CE 1JGDB 1A3LL 1TVDA 4P3DA 4POZC 1I3VA 2J8UE 3NZ8A 5D93C 5GSRA 2VLME 1GHFH 4NRXA 1U3HC 3QDAA 3OL2A 2C5DC 2XG5A 1ES0A 3GSVB 1UKSA 4NNXA 5I9QC 1OAZH 4F7MA 1AD0A 5BRZA 2CIIB 3DIFB 4YE4L 4YHZH 3QHTC 3MLWL 4I0KA 2GQHA 1LEGA 3D9AH 5DFVC 5DA4A 2MCPL 4JFEE 2ZG2A 3QG6B 1ZLWK 3F7RA 1PKQE 5J4MA 3KPQA 1WBXB 1S78D 3D85D 5I71B 3RDTB 3MFFB 3O8XB 1T1ZA 3CFJB 4X6EB 1D9KA 1KJMB 4MJIE 4R8WH 1ZE3C 5EIIB 5INDA 4OCXL 2ATKA 3BIKB 4YR6B 2DQDL 4K23H 1HILA 4L1DA 5LKNA 4CMMB 1JWSB 3NCBB 4GLRI 4NZUH 2AV7A 1ORSB 4BSVB 3QHFH 1UXSA 4N5ED 5C0DB 5E5MB 4LP4A 1NC2A 1QSED 4YHIB 1FNHA 3P4MB 4MGXA 5DMKB 2R23A 1MFNA 4XH2B 2DD8L 5B3JE 1FIEA 1PG7L 4NO2B 5IOPA 5FHAL 3TBWB 4KKLD 3GKZA 1C16A 4EVNB 3A67H 5AYUL 1Q9OA 2WSKA 1J8HE 5J12B 1CD9B 1GC1C 2F58H 2OS7A 3OGOE 3V0WL 2P8LB 2WWKO 3VDCA 1CXHA 3UBXG 5IB4B 3KLSA 1CWVA 5ECJE 1F90L 1FNEA 3VXPA 4L4TE 4ZYKA 3DXAB 3T0ED 4L4VD 3OTTA 3HR6A 4Y2DA 5DJ0A 1A8JH 5D7JA 5K9OA 3ZKNC 1HSBB 3NMEA 4XCFH 1YEHH 3QDMD 5D5MB 5EA0H 2J88H 4R90L 3HNTL 2COQA 3MGTB 5EUOE 4M1CD 3SE8L 4L3EA 1WAAA 2R39A 5HHXL 1ORQA 4OFVA 1HXYB 4NOBA 3VXOA 3CAFA 4P59H 4K07A 1U8KA 2HN7B 5F70A 3EOAB 4S1RL 3CLFL 3FQXB 4YHPB 3N1GC 1FC1A 5J0BA 1NGPH 4Y5VB 3ULUF 1QBAA 5CZXC 1S7VA 1CDBA 4OBRA 1MJJB 4YIQB 3PWUA 2YN5A 5GGVH 2DJ4A 5EO0A 4WO4D 4GUPB 4LLUB 2I60H 3CJJA 5I19H 4JZOA 4FQXA 3SDDB 5ACLA 1XR9B 1QZ1A 3X3GL 3REVA 4UV4H 1IT9L 3C6SB 2VQ1B 2YPVL 1YN6B 3O2VH 5GSRB 4FXGB 5D1ZD 3V6OC 3WNPA 1J1PL 3ZZ1A 2X4SB 4XNUH 5MERA 4NT6B 3MRBB 1BVLB 2YD3A 1A1OB 4HJ0C 5F3BA 3RTQB 4QOKA 3TC9A 3FONA 5ICXA 2B7DT 3BQUA 3PP3K 3MR9B 5E4IA 1DEDA 1PYWB 2YWZA 5K59E 1F97A 3L5HA 1HYSC 3BZDA 3SHSA 3THML 1HH6A 1BJ8A 4JY5L 4F37F 3GK8L 3RFZC 1HHIA 3ILPB 1L4IA 3FCTA 3ARDD 5F9WB 5JIKA 4E5XA 4YDLB 2YPLD 1P9MC 4JFDE 4O5LL 5FKPA 1HQ4A 2F54B 1SVCP 5I1IH 2C7UA 5SWQB 4WU7A 4KZEL 1DR9A 3QEGH 5L88L 1RIHL 3T4AA 3KHOA 2QADD 4Q7DA 4NQEA 3TIEB 2XWTB 1BQLH 3AAZB 5HHNA 1JIBA 3FAXA 3NOIA 4OV5A 3X12B 3TVMC 5CD3A 2H8PB 1YUHB 2R23B 3MRNA 2WBJC 3BUTA 5E2TH 4HJGB 1QKZH 4X7DC 3SGKC 4LSPH 2AI0H 3UAJC 2OR7A 2QQQA 4OZ4A 1AO7A 3KXFD 1NBZA 4K8RD 2CKBL 2X42A 1FO0L 2FGWL 3O45B 2HTKD 4GMTH 5EUKA 1E6JH 4JPKH 4TQEH 3L95B 3MCLL 2ED9A 2LAGB 1UH3A 4JZJB 5EPMA 5I8CA 2ENYA 3L5JA 4CVWA 3BSZH 4R26L 4HUWA 1LK3L 1WC7A 4NKDB 5K93A 4PUBL 4KKAD 2BSSA 4K7FB 3QIWA 3DSFL 4LCYB 5HHME 4PGEA 3IAGC 2CRYA 1XGYH 4D8PA 4PBWD 5L8LB 4OGZA 4F8QA 3MFGB 5CBEB 4ZMAT 2B8OT 4PJEB 5FO9B 1OGAD 2O5XL 5I15L 3R8QA 4HXAH 2HVKA 3D3VA 3SGDH 2P7TB 2EDNA 3QH3B 1FIGH 3SKNA 3Q2CA 4RGOH 3NPSC 1TZIA 4ZAKB 4TVPH 4WCYH 4NM8H 5ISZD 2I5YH 1AO7E 3Q6GL 1S8DA 5HBBA 4NCC2 3E8UL 1VEPA 4LPUA 5I17B 3MREB 1CK0H 4JREC 2FECL 3NN8B 1OAQH 3C2SA 4EDXA 1DTUA 1RIVL 2AJVH 3VFPB 4M3KB 5AWNH 5LVEA 1MJUL 1MVUB 4RAHA 3VI4E 1H8NA 1O7VA 4XPFL 2FIKB 4WNQB 5DUMH 1H0DB 4F2MB 5CP3H 1Z3GH 4JHAH 3OJDA 3GMQA 4U1JB 3MRRB 1ZA6B 1FZMA 3V5DB 1YEDB 5MEPB 4OKVA 2HFFA 3PUCA 5IJVA 1ACYH 4DVBB 4S1QL 4NN6C 2NY2B 2Q7YA 3IJYB 4KH2A 4PP2A 1B6DA 4GG8A 1IAOB 1S7WA 3KPLB 4XP5L 3JWDL 2VABB 1RU9H 1LO0L 4HUUA 3J7HA 4L8SA 4PB0H 4ZFFB 1KXQE 1I9EA 1X6LA 5DJ6A 2R0LL 3MRDA 2UYLB 4OLEA 1T2QL 4KUZL 5J6GA 4U6HB 2ZCHL 4MJ6A 1A2YB 1HWHB 3VWKD 4F7PB 4FQJL 3G5XA 4Y1AE 4OZIE 4DN3H 4NUJA 4HG4J 5KVDL 4Q6IB 4U6XA 1SHMA 5ID0B 1RZKH 3K2MC 2DLFH 3LAFA 3VD5A 2R8SL 2VOTA 1AFVL 4YXLH 1I8MA 2BVTA 4P4KB 1YMMD 1T0NA 2XTJE 5D96B 3O4LE 5DMIH 3MMEB 4MXVE 4OT1L 5FA3B 1U2HA 5DJXA 2WBWB 4JPVH 3FMGL 2BHUA 4KK9D 1FSKC 2NXYB 2H9GB 1M71A 2IG2H 4OD1H 1TJIH 4DFHA 1K3ZA 2HRPH 4K3DL 4CVUA 3SCMB 2DKSA 2M2DA 4PJ5B 3U9PH 2DDQH 3NVQA 2OX5A 3ZE1E 3SBWC 1Y0LA 2BCKB 1H5BC 2WQ8A 3V7MA 1S7SB 4HEME 1QFWH 5BO1L 2FEEL 5F8QC 3QG7H 3PDDA 1HSAB 3OKNB 4KK8C 4G9DB 2RFXA 1DBAL 4QHKJ 3RUGB 3Q5TA 3GSWB 5C0BA 2DQCL 2ZUVA 1CBVH 1Q94B 3IDXL 1YY9D 1N6QH 3DUUA 1A4JA 3MRJB 5F1IA 3TO2A 5D7LB 5GRVK 4PLJC 1T5XB 4PJAF 2FJHA 3QPQD 1CLZH 4OJFH 5DDHB 4PJ7A 3BPOC 4D3CH 1UM6L 1YEEH 1DVFA 2VDOH 3TO4A 12E8L 2LAAA 5DJZA 2KH2B 2YOCA 1UB6B 1RZ8B 4F3FA 3FT4B 1PEWA 4ZNEE 1T0MB 5J56B 2Y4SA 1LO5B 2H3NA 3QISA 1S9XA 4JFPA 1WWWX 1N3NB 4G8FB 4UTAH 4M93B 3CK0L 2EYSB 5HGAB 2A1WL 4PJHE 4WU5B 1OD7A 4X8JB 2BY2A 4X5WB 5ICYA 3WIIL 1QPPA 2BSTB 3RGVC 4UDTB 1NFDF 3IDJB 4HJJH 4ZSOA 3ZDXE 5D7IF 2NY6B 3MACH 5DD0L 2CUMA 4NHCH 4GG6E 3I6LE 1MFCH 3ARVA 5B8CA 1MF2H 2UUDK 2DM3A 2YC1A 4U3XA 3S37X 4OKDA 2XACC 1A5FH 1Q8MA 4Q97A 3MLVL 3VCLA 3IU3B 3WFBL 2ICEA 3DSNA 5KZCB 4QRPD 3RWJA 3E6HA 2R4SH 5CLTA 4FTVD 4R4BB 4MDJB 1FFNA 2BNQD 2EIBA 5FA4B 3TNNA 1UJ3B 1VENA 4EI6B 4L9LA 4YHNB 5CZVH 3DOSA 3EW3B 3V5KA 4FQ2H 2OQJB 2PYFA 3KWWB 3L3OB 2R0WH 4MA8H 4LSVL 2UZYB 2OTUB 3V9FA 4ORZC 1BIIA 1QSEA 3D39B 2DQFA 2FEEI 1CDCA 4R2GC 5C0AE 4LHUB 1D5BB 5IMMB 5I1JH 5BJTA 2H6PA 1QA9B 1QYGL 3S36X 3EJYD 4DWHA 3VJ6A 1E28A 1QLRA 1K4CA 3QUXC 4M61B 4CKVX 1UWEH 4U4BA 5E95B 4PJDE 5JLZB 5L6YL 3TN0B 3VXSE 3LIZL 4P3WA 3C87A 4PJCA 4R4FH 1TZGH 5CS7A 4FP8L 3GM8A 3T0EA 4L4VA 1X5KA 4XMPL 4RBPK 4N9GB 5IJKC 4YZFE 3ZTJG 1NCBL 1DDHA 3QDMA 4KQ3H 1NUNB 3WBDA 2ZUQC 4W4OC 3WJJA 3K8LA 3RIAF 3TBYB 5IHZB 4IRJB 3GB7A 3LCYA 4HW6A 3VXUA 3ARPA 4K3EL 1N5YH 4EOWL 3DMMC 1MUJA 4HGWB 3V2AR 2E27H 3TFKD 1U8JA 5I2IB 5DGRA 2P47B 3G5YB 2A74A 4HIHB 4R3SB 3BWAB 1GXEA 5EBWA 1EHXA 3OGCA 2DL9A 4X4ME 4WO4A 1CE1L 5JDJA 1D6EA 2N7BA 1NBYB 3B2UC 1T6WA 3PV7A 4PY8J 5IM7B 1II4E 2AEQL 1FPTL 3VGFA 5E03A 3OAZH 3FOLB 4IDLA 1KCRH 4L4VE 4FG6C 4G7YL 4NN7C 1QNZL 5JW3L 5D1ZA 3GM0A 3V4VL 3HG1E 3IFNH 3QB7C 1UEMA 5E2WH 1WT5C 1KIRA 3CSBA 1YYML 4M48H 3R8BB 3KPSE 3ZLQC 3O2DL 3BO8A 3ULVC 5ID1A 3MCG1 4G3YL 3V4PL 3VXUE 5B38A 2AS5M 4CW1B 3FQNA 3MLZL 5L0QB 2VR4A 1DLHA 3BAEH 3K3QA 3QEHB 4PTTB 3WNKA 3QI9B 3D85B 3ARDA 1K8DB 3K81A 2YPLA 1B90A 1MFAL 3C2AL 2XXCB 4XVUD 5F97E 2E9JA 2FNBA 4LMQE 4U1LB 4Z7NF 3G6DL 2HFGH 5B21A 3VXRD 5C3LD 1F4XH 2CUIA 1MIMH 1X5JA 5C7XL 2XQBL 4BH7A 3PWPD 3TNMB 1JPTH 3S5LG 5DJCA 4PBVC 3U6RA 1GPOH 4IS6B 5CEXA 3O6KL 1A7QL 5GQBA 1NFIB 4LARH 1MHHB 1ZVHA 2XYCA 1D5XB 3OX8B 1OP5K 2UZIH 3SY0A 2E7BA 3LS5H 5INCB 4I48A 2ARJB 2ZOLA 1A9BB 3KXFA 1TIUA 4H8WL 4AM0A 3UJIH 3V8CA 4U1SA 3P0VH 2VMFA 5I1HH 5CBAA 5GGQH 3TCLA 4BZ2H 1YYLH 4HCRH 5HTSA 4PJGE 5JOFA 5FM8A 4URTB 4P9MH 1A6WL 1RUML 3BGMA 1KC5H 1IGTA 2CIKA 2VLKD 5DEGA 5DF0A 2DB8A 1JGLL 3WYRA 5BZWB 3H9SE 3O3DB 1XGPB 3VFRA 4XMLH 2VLRD 3D0LB 1L0QA 2LFGA 3Q3GA 4F7CB 3U1SH 1T3FB 1OGAA 1MCPH 4YO0B 1UWGH 2C3VB 2V7NA 4X4YB 5C08D 1AGDB 1GGUA 2CJUH 3OKKB 5EH1A 4M6NH 4YHMH 3K2UH 1UG9A 1DBBL 4MQ7A 2MFNA 5DK0B 2FLBT 4PGZA 2NXZB 4UAOB 5GS3A 5F89A 2W9LA 2V2WA 4HS8L 2SEBB 2XKUA 1BJ1H 1I8IA 1MFEL 2ADIA 5EORH 4I77L 1LILA 4CUCA 2YEZA 5I18H 3TT3L 4PLNC 4IJ3C 1BM3L 1L6XA 4I9WD 1PLGL 1S9VA 3S34H 5C0EA 1CU4H 5JXAH 1HI6B 4JO2H 3E6FA 5SWZD 5E70A 5I66B 5IR1B 4LSTH 3FO1B 4KMQA 4C83A 4G8GD 5BQ7A 5D2LF 3GSOB 5MHSD 3L1OL 4TUJA 3UTSD 5KVEH 2BVPA 3QNXA 3MYJB 4HZLA 1P4BL 5EZIH 4I8DA 3S4SA 4UQ2B 3A6BH 1NANI 2D7TL 1P4IL 1HXMB 1DQJB 1KB5A 4G80B 2X89D 2OTWB 4XXCA 4I4WB 1Z9SA 1U2CA 3EDJA 2Z8WC 3O11A 3HE7B 3ARGC 1DLHB 2Y36H 4WTXA 5EU4A 2D0GA 1IBGH 4HS6B 3VWKA 2ZG1A 4XNZC 3QDJE 3VH8G 1IILE 4WTWA 3KNBA 5I1LB 1Q72L 3H7BB 3MLYL 1A1NA 3DJ9A 5TQ0H 4GRLC 1I9IL 4P46B 2QADB 2Y06L 1RZ7L 3FOMA 1JNHA 1YMMA 4NO0B 5HYSB 1KJ3L 4OD3H 4PLOB 1B4JH 5A1AA 1SMOA 2ZJSL 4NSKB 2KKQA 4M9OA 2EICA 4H25B 4UNTA 3D6GA 3GSXB 1HEZA 1JUFB 3O41A 4JHZA 1U41A 2FEDD 1W0WB 1T0PB 1ZT4A 5HPMB 2FX7H 1KELH 1IC5L 4HSQA 1DL7L 4U6VH 3CFBB 5D6DC 5E1HB 1TXKA 2X4RB 5HDQL 2VDNL 4V1DE 4HIXL 4NM4L 4CMHB 4QXTA 3CMGA 3LKRA 4NO5A 5EU7E 2P24A 1M7IA 4WI3A 1OAKL 4JO4H 1VEOA 3SDCC 3KGRA 4I0PC 2CLRA 1JGUL 3DNKA 3OAUL 1G7JA 4RGND 4EN3B 4BK5A 4YK4B 3CDGA 3BVNA 2BX5A 4KDVA 5M94B 3WN5C 3IDMA 3OJMB 3MRQB 5K9JL 5D71H 1FYTD 3RZCB 4N90D 3P4OB 3QUZD 3N1FC 4N0UE 4UIMB 2I27N 1KJ2L 1X5XA 3MX0A 2YBRB 2EZ0C 5HYJD 3WCYA 4Z8FH 1FLTX 5DR5H 3VMPA 3G04A 3QT2A 2P8PA 3U2SB 4W6WB 1I8KB 3W9DB 4WHYH 4EXPX 4QRUB 1AC6A 5ISZB 3IFPA 2DL2A 5J3HC 1KPVA 4FZ8L 3AMKA 5T33H 4FFYL 3IF1A 2OJZH 4JKMA 1RIUL 5GRXG 1NMAL 4DKEL 1YMHA 1T20A 5FO8B 3BKMH 2NCMA 4Z95H 2VB5A 4ZPTB 1PX4A 4JGUA 2ICWA 2Y07H 2WINA 5J7CC 3VA6A 3QIBB 1WGOA 1UM4L 4XAKD 1SEQH 1X6NA 2PTTB 3BXNB 5T3ZD 4TSAL 1RUAL 1CE6B 1A6AB 4O2EA 2PXYC 4MX7A 5I1CH 3PDGA 5IQ7L 2VE6B 1I1FA 1PY4A 1HDMB 3ELAT 5FKAA 3MRCA 4CVXA 3RWGB 2M8XA 1DQTA 4WGWB 3ECBA 4YDKH 4PR5A 4QRPA 4G8EB 3MV8B 4UV7H 4FFVC 4Y7MA 5BOPA 1GYAA 5FUOH 3DYOA 3ARBB 3HZKA 1JYXA 4WFHD 4FTVA 2R9HC 1YN7A 2IEPA 3MNWB 2BNQA 2VJXA 2J4WH 1Q9WB 2KUTA 2DWDA 3L5WB 4OLXL 2VXUH 4KTDL 4CADB 4F15C 1YECL 1YQVH 4GAYA 2V2XA 1FZKB 4XMKL 1T04A 1KJVA 2J7LA 4PRBA 3HRPA 3UDWA 4XX1E 1HHGA 4PRIB 1CFTA 4DKDC 3EGSA 4ETQA 2ZP0T 3ABZA 3QIUD 4MA3A 2ADGB 4LLMB 4X0KA 1N5AB 3SDYL 1I8LA 4JDVA 1P1ZB 1G6RH 4M5YL 1NEZA 5H2BA 2AQ1A 1YY8A 2GJZA 4KKCC 3BP4A 4UDUA 2Q8BH 4QY8A 2DQTH 1JK8B 3WDHA 4P2QB 4JDZA 3EO1B 1JGEA 3UTTE 1TVHB 4RIRB 5IEKB 2FSEB 1KBGH 3QZWB 3MCKA 1U92B 4U0RB 1AI1H 3OSKA 1C12A 3OAYH 4OQTA 2P24B 1UYWH 1CFSA 5D7KD 4Q0XH 1MJ8H 3V4UL 5EU6B 4BZYA 5CSZA 4D0DB 1WCBA 5T3XL 2AJ3A 5L7XH 4JE4B 3JBG7 4TNVK 1RAMA 4JFHD 1GC1H 1DZBA 1C5CH 1SBBA 3U0PB 1YNKL 2IFFL 5C0IB 3MJ7B 1JL8A 5JUEL 1W0VA 1LD9B 3NCEB 2JB5L 2FHBA 3KPRE 5F9OL 4JRXD 3X13B 2EKSB 3CXDL 3DURB 4H26B 4OAWA 1LP9A 3HFML 3IDIB 5D9SA 3T4YB 1Q1JH 2ZPKH 5DD3L 1LO2L 2IBZX 1AH1A 3NZHL 2HA1A 1EEZA 1HOCB 5HYEA 3H6JA 3UTZA 3SDXE 2GSGB 2AJUH 4D9LL 2EDYA 3LEXA 4ELMF 3VG9C 3PGDB 1FFOB 3T3ME 4EUPH 3HNVL 3QDGE 1HCVA 1URLA 5F1KC 1U8NB 2EXWD 3BDYL 4MCZA 4Z7VA 1CTOA 1PQZA 2HFEB 4XP1H 3W0WD 4OIAA 4GKNB 1ZA3A 1AE6L 2APBA 4NC2B 4NWTL 1QO3B 4KVCH 1KFAH 2R69L 4JFQA 3AC0A 2AEWA 2E9IA 4HKZA 1ROWA 1D5ZA 3F7QA 4XCEB 3U46A 3NABH 4NPYA 3TJEH 2V5YA 3V0AC 4YAQA 4FQLL 4X8XA 1YJDL 4K3JL 2W9DL 1XGUA 3BZ4B 2Q1EA 2FB4L 1KTLA 1T83C 4OUUB 3H9HA 3VXRA 2GAZA 5ESVB 1MHEA 1QR1A 3PWPA 2FATH 5DRNA 3X14A 2GYSA 1IC7L 1BFOB 3U4BH 2R0KH 4S2SA 3CSPA 5E00B 4KK8D 1CLCA 3GUTA 4QTHA 3QQ4A 4HLJA 4P23B 4XBPB 4LVHB 3UC0H 4L5FH 1A3RL 3NAAL 3GI8L 3MO1A 3RWEB 1NL0L 4W6YB 2PETA 3LY6A 3W39B 2W65A 5L8KB 3H42H 3KG5A 5FUCE 4FQQB 4H1LA 3VA2C 2Z9TA 2VLKA 1U58A 3RL2A 4C56B 1OAZL 1NLBH 3GJEB 4C54A 2VLRA 2IQAB 4F57H 2HLAA 3N85H 3FFDB 4LGRB 5E8EB 3KYAA 3MV7D 4GW1B 35C8H 1H8SA 1UVQA 1KULA 4RMRA 1X4YA 1KNOA 3R1GH 2NY0B 5FB8A 1W72H 5D5ME 5C08A 3QJHB 3WL9A 4LCCA 3ARSA 1JZ6A 3O4OB 5DQDL 5B4MD 1S7QA 3LKOA 5DEFB 5SV4A 1ZVSB 3WIFB 4R8WL 2QR0B 4MNGB 4EJ1C 3RGVD 1R3LA 3IDGA 5EIVA 4NCC1 1JHKH 3CFKB 3F6IA 1G7LA 5H8DA 2P5EB 3FFCD 4UT6H 4UNUA 1RK1B 4M43L 5IROC 2L7JA 5LGJB 1A7OL 3QDHA 4NZTH 3S36L 1SY6H 5KSUA 1AKJD 5SWZA 1DQLH 3MRFB 5DUPL 1JYVA 5IMKB 3DROA 1NFDB 5FECB 4G8GA 1G7MA 3TT1H 2CR3A 5F1OB 2VAAB 5D7IB 3UTSA 1JGVL 3HS0A 3A67L 4RSVA 4JZNA 1FZOB 4JDTH 4GXVL 2R1WB 4RFNC 1B2WH 4LPYA 1R3KB 3VD3A 4UT7H 4XGZB 2X09A 3IYLW 4PRHB 1CG9A 2E7HA 3WIHA 4RCAA 4RDQF 5E8NB 1CFQB 4JANA 2C3WA 4N0YH 3MRLB 3KS0H 3WO3B 1VFUA 4YGVB 5GZOC 1BX2B 2X89A 3AREB 4Y16C 5DK2B 3OKDA 4HWZA 5TPWL 1M7DB 1FYHB 4AIOA 2JK5B 1WTLA 1UACL 4I2XB 4R2GD 5J9PB 5EA0L 3S3PA 5IEHA 1F3JB 2J88L 5DJDB 3PQYD 4NGHH 4WTZG 4G8IA 1E6OH 4I9WE 2GI7A 3BHBA 2OI9C 5DURD 4P59L 1N4XH 2F54E 4IMKA 4JFFD 2FD6H 4GH7B 2Z91A 5SWZE 3S96B 2DN7A 1QRKA 1NGPL 4P2OB 4IHOB 5SWSB 3BZFA 1ZEAH 3N1PC 4U2YA 2CMRH 4E41B 1CXLA 4LLWA 4M1GH 2OL3H 5GGVL 3BWUC 1LVEA 4ZUVB 2I60L 4Y5YA 5I19L 4OFYD 3LEYH 1GGCH 4LFHG 3GMPA 1ZS8A 1U0QA 4EUPA 1AGCB 3O2VL 3ZYJA 1DN2A 2YUVA 3GHEL 2NX5D 4KI1A 3KLAB 5CJQL 3DX7B 5FYJH 3LMJH 4AEHH 4PRPD 3ZKQD 1HNGA 2B0SH 1IAKB 4Y4HC 1NUFA 3P9LA 3EYUH 4UT9H 2F53D 2KDGA 3CDFA 3HZVB 3TZVC 3WKNA 4J8RA 3B2UD 1FYTA 3QUZA 3L3DB 2R29H 5C08B 1G9ML 4M7ZC 4ODSH 4LEOA 4PJEE 5HYJA 4FG6D 1ZGLM 3MSPA 5D93B 4H20L 2V5TA 1U3HB 5I1IL 2FR4A 5J6HB 4BFBD 5HGDB 3QEGL 4D0CB 4G5ZL 4X5XA 5I9QB 4WGVB 2FBJL 4DOHB 3GBLA 4MSWB 1I7TA 3ULVD 1I7RB 1OCWH 2AKRA 5F7KC 4U1IA 2Y7QB 4P49A 4J3VA 2I07A 1I3UA 4O9HL 3VFVA 1MOEA 5E2TL 1XGQB 1C5DA 4LSPL 2AI0L 4BQ8A 4E9LA 4TSBH 5I73B 1G6RB 3LN9A 3LPFA 3OHXA 4XCCL 3VFTB 2VZUA 1IJ9A 1J05A 5EOQH 4GMTL 1NGXB 1JPSH 4CU8A 3F7VB 4TQEL 3DO7A 3C9NB 2Q8AL 1AD9B 3NA9H 3KR3H 4JVWA 1FYTE 3SDAC 3OKEA 2OSLA 5HYJE 3MLSL 5E94A 4Z7QF 1NCNA 4BQ6A 3F62A 3LRSA 1C1EH 2D4FA 1K85A 5F88A 4HULB 3SKMB 1CYGA 2Q76B 1JZ8A 5BXFB 1G9EA 3G9AB 4HXAL 1HKLH 5FYKE 4RRPA 1J9CT 3IJSA 3GBNH 4DW2H 2KQMA 1UC6A 3QXTA 3WHE1 4P2RD 1UM5H 4FQ1H 3NA4A 4B50A 2EH8H 1JTTA 4G7VH 4TSCH 3QIUA 4OM0L 4RQQB 5K9QI 2K3TA 5HPOA 4HK3N 4WCYL 4XCYA 4DCQA 2JF1A 3GSNH 2OLDA 2Z92A 4X9GA 1MLBB 4EQ3A 3G5ZB 4OGXH 3RWCB 1WBZA 2AJZB 3KPOA 2H41A 3BKCL 3FT2B 2CRMA 3ULUD 1J86A 3FO9A 3V79C 5AWNL 4R96B 5LGHH 1BBJB 5T1LB 1JF5A 3OPZH 5DUML 4WV1C 4HFWB 3TA3D 1LK2A 3U9UB 1TCRB 4U1KA 1EEUA 5IBTH 3VRLF 4JN2A 5H94A 4PJ5E 4I5BB 3DRQB 3ROOA 2A77H 3QEUB 3SKOA 4LVOC 5CINH 4LQ1A 4YFLI 3SE9H 4RAUA 4UILH 1KCSH 4XP6L 3F8UB 4PREB 3K80A 5AZEH 5TF1H 3IFLL 3RUGE 4ZUSA 1B0RB 1QHPA 5EDXA 5IB2A 2ESVD 1C08B 4Y8DC 2IQ9H 3D0VB 5JZ7C 4AMKH 5FGCB 1ZGLA 2FZ3B 3SGJA 2CDEB 4OZIF 1MCOH 4JRXA 4DN3L 5TDNB 2HT2C 3HUJA 4KJWD 1Y18A 1NBQA 3B6SA 3G6AA 3QO0A 1RZKL 5F1NA 2DLFL 1MY5A 4PP1C 1BZ7B 1RZIB 4PY7B 5I16A 4JY4A 2X7LA 3EFFB 4R4ND 2HG5A 5HHQA 1I3RB 2PR4H 1NGWA 2QSQA 4PJ8B 3RAJH 4K7PX 6FABL 1TJGL 1DQDL 3P11H 5I8EA 2VDPH 4OD1L 2IG2L 4X6DF 1TJIL 5DQ9B 1DBKL 4XC3L 3W0WA 3KYOA 2HRPL 4OLYH 3PXJA 3ZE1F 2XICA 2IPTH 3L6FB 2DDQL 4QXUH 3ALXA 3MBEC 3SGDI 3H7LA 2JCCB 3PWNB 5C09D 2EEAA 1IEAA 2HP4A 2WIIA 5GISL 5I1KH 4LNRA 3QG7L 1EK3A 1N59B 4Q74A 5AYQA 2X6MA 3TVMB 1S9WA 4XNMA 1LE9B 5FO7A 4QRRD 2H2SC 3QJFB 1MLCB 4LF3B 4MB5A 1N6QL 2WBJB 4WY7L 2UY7A 5EBMA 4QHKI 4QHLA 1RUQH 4UZGA 1SYSB 4NBZB 4OJFL 2F5AL 5FM5M 1W72B 3ARWA 3BIAX 3VFNB 3QA3B 4PYHA 4ENED 3ULVH 4KVNH 4XX1G 4M5ZH 5C9JA 1H5BA 1XH3B 3G5VB 2A9NL 1BOGB 1R5IB 3H3PH 1SEBA 3Q0HA 2UWEF 4OLWL 3RZWA 2HKFL 5IV2A 2GKIA 3SDCD 3M8OL 4XCYB 2IH1B 5IFHL 3CSYA 4ZUTA 3D39E 2NW2B 4K8RL 1KIQA 2X4PA 2B2XL 1XF4A 5C92A 2P42B 3KDMB 3IGAA 4U33A 4LLDB 3TYGH 2V2TA 1DJSA 3B9KC 1NC4B 5EO9A 4OLZH 3UPAA 4F80A 4OZGA 1G7IB 25C8H 1M7XA 1EAJA 2WQRA 4X4XA 3NPSB 4GG6F 2X9WA 5F72S 4HBCL 3CFDA 2IANB 4HHAB 3MACL 4B7IA 5TDOA 1V05A 5ANMA 1MFCL 5ESAB 3KYKH 3HE6B 3R0NA 5DVMA 3MV7A 3WUWG 3BRFA 5J3HD 1DANU 3VXQB 3RWHA 4KTEH 1A5FL 1KTKE 3O9WD 4O2CB 1VSCA 4JREB 1BBDH 1SBSL 4OCSH 1DQMH 2R4SL 4R0LC 5BOZG 2WUCL 3CSGA 1FVDA 4XNYH 4X6FB 3CCHB 2WMPA 5AUMA 3RGVA 3JVGC 2VKXA 4G6MH 5CZVL 2D31B 4AENB 3EOBB 4WW2A 1WFNA 3FFCA 2PXYD 2R0WL 4MA8L 4NN6B 5CUSH 1ZANH 2VXSL 1FNFA 1Q9KA 1T1XA 2R1XB 1N0XH 1I3GH 3D25B 1WIUA 1QFWI 2RCSL 4FNLL 4YQXH 4N0FA 3VE0A 5AD0B 4MWFB 3RJDA 1AKJA 3JV6A 4JCMA 2YUZA 1EIBA 3PWVA 1VGEH 1KTRL 1BZQK 2OL3B 4ELKB 1XGTB 5KJRL 3MOBL 3MV7E 4Q58C 2VIRB 1INDH 2IADA 5LXGH 4OTXH 4Y4KD 3QNYA 5C0FB 4J3XA 1NMBH 4R4FL 1TZGL 1KLUA 1KB5L 4W4NA 5A16A 3CFEB 1A6TB 5C8JA 4GKZA 4YHKH 2W0FA 1EEQA 4ZTPH 3SJVB 3PGCB 4QRQA 4NRZA 3HHRB 3PQYA 3TBSA 1EVUA 3D1MC 4G6KH 2OK0L 2BVOA 4KQ3L 4B53A 2XTLA 3C5JB 2NLJA 3HZYB 4JO3L 4KKCD 3FFCE 5HVHB 4ZOEA 3R4DA 1CF8L 1NGZB 5T1MB 2A6IA 2F8OA 3JV4A 3UTQA 1N5YL 3QNZB 4JFFA 1A7RH 3ISWA 1GOHA 1JNJA 1W0YT 2XT1B 1I1AD 1J87A 4KK6D 5LBSH 3PGFH 4QHNA 5D1XD 4NQDB 3ARFC 3HI5H 4TVPE 4E42B 4D2NA 4HG4K 4X4ZA 5JQ6L 1MCQA 1JNLH 4NQCD 1KCRL 2GCYA 3BPOB 3C5SA 3QUMH 2LTQC 3IDNA 2NX5A 1U93A 1RJZA 5E8PB 3CUPA 3TCXA 1KLGB 5E2WL 3S9DB 3HRZB 3PQYE 4NNPH 4M3JA 3FTGA 4XVSH 4Y8AA 3Q6FB 3SKJH 3BRGC 4PRPA 3QO1B 1D5IL 1ND0B 3EYVB 5IBUB 2BP3A 3HI6H 1ZMYA 1MCWW 1JPFB 2VDKH 4WWKD 5C07D 1K6QL 5D1QD 2UVEA 3BAEL 3ZDYE 4PJ9B 2W60B 2VITB 4QGYA 1FE8H 4NHUA 1CI5A 2GW5A 4KK5C 1FQ9C 4MQSB 4NQXB 4HC1H 2HFGL 4AEFA 2QHLA 2WW8A 1J0ZA 1F4XL 1DFBH 2XZQL 5B3NA 3ETBF 1JPTL 3DHJA 4G42B 4UINL 4ELMB 3RPIB 1CIUA 3BZEA 1IZKA 4CVZB 3MJGX 2V5MA 1A3LH 2NZ9C 2YSSB 2BK8A 1IEHA 3PDOB 4NO3A 2NX5E 1M6OB 3GSNB 1D9KC 3RWFB 1EAPA 3PJSA 5HYIA 1LE5A 1IGCL 3C08L 2F5BL 4XXDA 4U31A 3P0VL 4TVSa 1H3VA 3BI9X 1CT8B 1EHNA 3K4DA 4BFEA 2IADB 2R2EA 2V6HA 1MJ7L 3MLWH 1FL3A 5KSAD 5J57B 1ZXQA 4QNPF 4KDTA 4P9ML 2MCPH 1JPST 1JVKA 3BRDA 2HT4C 1NDMA 1F42A 1KC5L 2V9QA 1OGTB 2ZOKA 3PL6C 1P4LA 1CXEA 2H32H 1PVHA 5DHYA 4PJBF 5F7LB 3EO0B 1WEJL 3LN5B 5FGRA 2HAZA 4MDIA 2B1HL 2ICES 3QUXB 1CZ8L 3W11C 2DQDH 3RKDC 1FL6A 5CFHA 2CJUL 4F33A 4Z0XA 1RZFL 4M6NL 1U8IB 2CSPA 3MV9B 5L2JA 5KSBA 2GY5A 4P2RA 5JXEC 1FNSL 4Z7UA 1BF8A 3I02A 5GGSY 1XEDA 4HKXB 1VEMA 1EDQA 1P6AB 3VFWB 2GTWA 1ZLUH 5F93C 4GRMB 5D7JC 5EC1A 1AQDB 2VDRL 5EORL 2EYRB 2DI7A 5FHAH 1VKXB 5EZJB 2OR8A 3IRZA 3T09A 4PGJA 3ALPA 5HVGB 2OYPA 1CU4L 4LLQB 2DIAA 5ENWA 2ZUQB 1T89A 4JO2L 3V0WH 2XA8H 3VDBA 5IK3A 3TA3A 4M7LH 1WFUA 2YUWA 5C9KA 3CLEH 2Z93B 4LSTL 1F90H 4EI5D 3RVXC 3DMMB 1RHFA 2QQLH 4Q9CA 4OQTL 3OF6D 5IMOB 2VZ1A 3JXAA 3HNTH 5GS1A 2D7PA 3SE8H 5A43C 3I75A 5TE6L 1XF1A 4J1UA 2F53B 5HHXH 4F7EB 2VISA 4WW1B 4UUJA 2ESVA 4FQXC 3B9VA 43C9B 1K4DB 1KTDA 2BDNH 1RJYA 4U0QB 4X7SL 5CKGA 2QJDA 3QQ9D 4S1RH 5DA0B 1IBGL 3T65B 3GSQA 1I4FB 3GKWL 4NN7B 3LB6C 4QWWC 5ETUB 4KTYA 5DZLA 2I9TA 3ULUE 1FG2A 5DGQA 1EUUA 2NZIA 3QUYD 1GGYA 4LVNB 3BQUC 2XWJB 2Y6SC 2APWA 3WSQL 5IP4A 4OD3L 4NFDA 1B4JL 5DD6B 3V52H 3BE1H 1G1CA 3JTTB 4KUCF 3WMSA 1IT9H 3AMLA 2YPVH 5IVXF 4QO1A 2VWEE 5C0CD 4UOW1 1J1PH 3DTXA 4MJ4A 5GGRA 5GS2D 1BQSA 4Y88A 2DTSA 3T0WA 1OTSD 3P9MB 3MUJA 5ERWB 4WENB 5E2UH 1KELL 2PTUA 4U6VL 5C09A 2V5SA 5IFAH 3GJFH 32C2B 3QUMA 4M8QB 2VQUA 2A73B 5GJTH 1LO4L 3THMH 5JPNA 4JY5H 4P5MB 4LLVB 3P30L 3GK8H 1T4KA 4QRRA 4LCWB 4ZDHB 4UQ3B 3OZ9L 4RAVA 2H2PC 3RWDA 2PF6A 3MV8E 3FB7B 2JIXB 5DJ8A 1DLFL 1UWXH 5IUSA 4WFFE 4HUNB 3BD4A 4Z78A 3TYFA 3OR6B 3QIWC 3SDCA 2ZSVA 2XN9B 5IW6B 3B3IB 4J3WA 1EUTA 1RHHB 5KG9B 4JR9L 4LPCA 3L9RA 2BY0A 1T80A 3HAEH 2X4OA 2CKBH 2OJZL 4WUUB 1CDGA 1FO0H 2YRZA 2GK2A 1X3DA 2BVEA 3TZVD 3HI1A 4Z95L 2FDBP 2FH6A 5JTWA 3MCLH 2DI8A 2FYYB 4AG4H 4BZ1L 2AXFB 1W8NA 2A6DA 4V2CB 4NBYB 1H3WM 4R7DB 4P2QE 5DI8B 5H35A 2MKLC 1BMGA 4PUBH 1JF1A 3DSFH 4Y5XB 4JKLA 3WEXB 2EDOA 4HPOL 1XZ0A 4GFTB 2DJUA 3U30C 1AJ7L 3I6KB 3O9WA 2O5XH 1CGSH 4IJ3B 1XCQA 1IAIM 2NY1C 4YDKL 3PWLA 1FFQA 2VSCA 5EU6E 2XTJC 5BCAA 2WNGA 5FUOL 2AXGB 5DMGC 3INUH 3NH7L 2VXUL 1GOGA 4KI5E 3RJQB 1UQSA 3Q6GH 5HI3D 5A3ID 4LKXA 2PXYA 3OAZK 1CGWA 3EDEA 4LRIA 3RNQA 4WDIA 4FS0A 1RIVH 4L8SC 1LWRA 3KJ4C 3QPXL 1MJUH 2HT3C 3NCJH 4OFDA 5EOTB 3P73A 1ADQA 2E3VA 4MS8D 1G6RL 4GT7A 5DS8B 3ARGB 1P84K 3U4AA 2KBGA 3KPPA 5E08L 1KIPB 4AIZB 4XNZB 5CLWA 1K2DB 2DQTL 3EO9L 1PGRB 4Y4KA 1T22B 5DTFB 4I0CC 1GZQA 3WIHL 3D69A 4LP5A 4GRLB 2WWKT 3BUYB 4OZHF 1P2CB 3HMXA 1FVCA 2O26U 2EYTA 1NLDL 4XP5H 2BNRB 3C8KB 1LO0H 1VDGA 3IFOA 3UYRH 4ZS6C 2R0LH 1T2QH 4KUZH 1ZAGA 5HI4D 2CRIA 2ZCHH 1OAXL 5F7DA 2PCPA 4Z76B 3QULA 1NGYB 5JMRA 2A83B 4XZUB 3VFMA 5KVDH 4U7MA 3BIBX 3GIVA 3CVHH 2IH3A 2ED7A 2Q6WB 2R8SH 1AFVH 2WBKA 1I1AA 1KGCE 3PV6B 3OXRB 2EO9A 5KSVB 2AVGA 3T2PA 3FB8B 4BFIA 1Q1JL 4XRCB 4NJ9L 3L3HA 3IDYC 3QFJD 4WI5A 2I26N 1DEEA 3V5HA 4I0PB 4M7KH 4RISH 1RULH 5D1XA 1ZHNA 5F6IB 3ES6B 3SDXF 3HCVA 1VFOA 4L3CA 3WD5L 4K3DH 3U4EA 3WN5B 2AJXH 2NW3A 1DVFC 1G9MC 2MHAB 4NQCA 3TO4C 2P4AB 1JFQH 4JRYB 4H5SB 1F11A 3GMNB 4PIRF 4FHBD 1BQHB 3OKLA 1CVRA 5BO1H 1CDJA 4NQVB 1DBAH 1WBYA 3OBAA 4PJFA 2DQCH 2C1PA 1OAUH 5FK9B 1W2KT 2QHRL 3EYOB 4OF0A 4PJIB 4KVCL 1KFAL 3AROA 4P4RA 4GXUM 4MCYA 2X1QA 4C56E 4N8CH 2R2HA 1BLNA 3DBXB 1GSMA 4DFIA 4WWKA 5C07A 2YN3A 5LAXA 5D1QA 1UXWB 2IPUK 3DRTA 2EIDA 3NABL 1QEWA 3F58H 4PJAE 1UM6H 4ZUUA 3MODL 1VFAA 1WWAX 2WK2A 12E8H 2H32B 4ZODA 3O3EB 2LVEA 3L3JB 3IAPA 3ARTA 4YH6A 1IL1B 4PFEA 1F4AA 4Q9BA 2W0LA 1G7HA 5E7FA 2EO1A 5EO1B 5KTEL 4QEGA 3HC4L 4MNGE 4NDMB 2JE8A 4PB9L 3IU4L 1NAMA 2R0KL 4NQCE 4JAMA 4Y4FB 2P5EE 5GRUH 1S78C 3CK0H 1RQ5A 1IFHH 2A1WH 2GTZB 4X6DB 1VFMA 3UC0L 1RY7B 3R0MA 4L5FL 3X17A 2H2SD 3HAEA 1YEKL 5GSVA 4L9LC 4S11A 5T3ZL 3WXWH 5DD0H 1NFDE 2Y23A 4F15B 5FIEA 2YA1A 3QQNA 1MRDL 5D7IE 5KSAA 5C07E 3G08B 3SE4A 5HJ3B 4N5EC 3MRIA 5J13C 1ETZA 1B4RA 2EYTB 4M00A 4XBGA 1SQ2N 2FX8L 4O51B 3RL1B 2PYEB 3RPKA 4PGBA 3DGGA 4I2XE 4OCMC 5IMLA 1BVZA 1FZJB 3K8KA 1A7NH 3P0YL 2BC4B 2FJGA 3T0EC 2YHGA 2H26B 1B9ZA 5F3HB 4TN9A 2UWEB 3NIDF 1FH5H 1JHKL 4HIIA 2LU3A 5KS9B 3U0TB 1QYGH 1L7TH 1OQXA 4JY6A 4M1CC 3C5ZA 5DSCA 3WJJC 1QSVA 5SWSE 4NZTL 2Z4QB 4HKJA 4KU1A 1F58H 1OM3H 5L6YH 5DVNA 4E41E 2AK4D 4MJ5B 2ICCA 1BFTA 1DQLL 5ITBL 3GRWA 4EI5A 3TT1L 5DJ2A 2CK0L 4FP8H 5EFIB 4X9IA 3W2DL 2MCG1 3OF6A 5DUBA 2NNAB 1U8PA 3V6FB 3GMOA 1YEIL 4TTDC 5FYLD 3MRPA 2E7LC 2DF3A 3WNMA 3UBXA 4XP4H 4UIKL 5IFJB 1U8OB 4IMLA 2FX9H 3GJFB 3OKOB 4LKCA 4Q2ZA 2BOCB 4PJXB 3TH2T 4K3EH 3IRPX 3Q48A 4EOWH 5D1ZC 2CDFA 3BOVA 3CC5A 3VWJD 4XI5D 2HJFB 4N0CD 3S7GA 2CO6B 2C1OB 4I1NB 1A0QL 5HHOD 3ZE2F 3MLUL 1F6AB 3TIDB 3SO3C 2X44D 4I3SH 4RFOL 4OFIA 2DLTA 1N4XL 3QUYA 5JPMA 3WNLA 4HK0B 3CVHA 3L3GA 3TBVB 2FD6L 4I3RL 1CE1H 2VZTA 1BGXL 3BPNB 1SJEB 3HPJA 3RVTD 3O3AA 2AEQH 1FPTH 3EYFB 2HJKA 5FDWB 4D9QD 3B5HA 3ARDC 5BV7C 2CMRL 5I1DB 1QNZH 5JW3H 4NKIL 4MD4A 1RK0B 5C0CA 4NQSB 3RX5A 5GGUB 2MPAL 1TMCB 4NIKB 1JZ2A 1ZSDB 2CKBB 3WKMH 1FO0B 3D48R 3CU7A 2PO6C 1KT2A 4L29B 3UTPD 3O3BB 4RFEB 1WSST 1TNMA 4G3YH 1AXSA 1Z5LA 1NSNH 3OR7A 1HNFA 4FOMA 2NY3D 3HZMA 4U1MB 3MLZH 1AY1L 1B0GA 4QCIB 1T21A 4AEHL 1QBMH 1DUZA 1GGIH 1IGIL 2B0SL 4QKXB 3QFDA 1MFAH 4K8RC 5CZKA 3OMZA 1T5WB 3BYTA 3F6LA 3G6DH 5DJYB 3QWOB 4PJEF 4IOFD 1LNUA 4Z7NE 3WS3A 2HWZL 2VL5A 4OSUH 4GBXD 2BMKA 4R97C 2XQBH 4Q9RH 1P7QA 1XF2A 4QRTB 3FT3A 2BRQA 2GUOA 4KGLA 5BZDA 4L8BA 4KKAC 3O6KH 3NCCB 4POUB 1A7QH 1G0DA 1SYVB 4LOUD 3SGEI 4IOIB 2FJFB 1XAUA 1IM9B 3KYMB 4MZ2A 5I1AB 1NDGA 1MCBA 3BEWB 3X3FH 1A4KA 3L5IA 2ED8A 1OCWL 43CAB 3BPCA 3T8XB 4PRAB 4ZFOA 3NFNA 4ONFL 1BD2B 3TZVA 3TM6A 2VKWA 3STZA 1EFXB 5DWUL 5FUZL 3OAYK 1JPGA 3VDAA 5D72L 3GEWB 3FQUB 1A6WH 1IKNC 3RY6A 1RUMH 3H3KA 4NJAL 1J18A 3JTSA 3TEUA 2R1YA 5EOQL 4S0SD 3CH8A 1JGLH 1JHTA 5D2LA 1J8HD 3S98A 4JM4L 3RIFF 3BW9A 1OLZA 5I1GH 1QRNB 1KPRA 1X7QA 1AGFA 4L4TD 2NZ9D 1J8KA 4DGIL 4M62L 4YPGA 4EEEA 5B39B 1HYRC 4TUKL 4HDIA 5DXWA 1WFTA 4PV8A 1KG0A 5FGCE 1PX3A 3BH9A 4G6AD 3MROA 4HS8H 4ZFGL 1ONQA 3GMMA 4RFNB 1AXTL 1LEKA 1LGVA 3V0VB 4AEEA 3GBNL 4DW2L 2IC2A 2ZUWA 3TT3H 3DV4B 3LDBC 3V6OE 1IGML 1PLGH 2OXGA 5DO2C 2EH8L 3MRMB 1IQDB 4G7VL 1Q9LA 4OQ1A 3U82B 1U42A 4XXCC 1IEBB 1A47A 1CD1A 4APQA 5EBLB 4Y16B 4PTUB 4Y19A 3H8NA 3MZGB 5DRZA 1S7UA 5EU7C 3PL6D 1U91B 1QSZA 4JEGB 1U8MB 5MI0C 4G9FB 3L1OH 2PW2A 4ZO7A 1DBJL 4ESKA 4YC2C 2XKNA 4LCIH 1P4BH 5KW9L 3RKDD 3WJLA 3PIQB 1KT2B 2OI9B 3OB0H 4FMFA 3LKSB 5JXED 3WNOA 4L8CA 3WO4C 4AQOA 2XIDA 1F3RB 2NPLX 4KRPD 5AZ2L 2JCCE 3KPNA 3AVEA 1K5NA 4F7TB 1QTYT 5JHDB 5CJOL 4UILL 4KK9C 1CFVL 1KCSL 2G2RB 5AZEL 3EOYG 5TF1L 5L2KB 2CGRL 5L8JB 3MLYH 3FB5A 5ESQB 2R0ZH 1I9IH 3BN3B 1RZGB 1S5IL 4G43A 3AXLA 3UJTH 1RZ7H 1U8QB 1CFNA 3RBGA 4OI7A 4Y19E 5TDPB 1KJ3H 1YEJH 2KZWA 1NCTA 3P40A 4JFDD 5CEZD 4DZBA 2ZJSH 3CD4A 5EN2B 2DLEA 3QFJA 3PHSA 1YY9C 4J4PD 1CN4A 3ROLA 1AP2B 2H1PL 5KOMC 3LN4B 3MLTA 3QPQC 4Y4HB 3WFHA 1G84A 2CDGA 3DPBA 4DZ8B 4MNQB 2J8OA 3G9VA 4O4YL 2VDML 3P4NB 5CAYB 3VRIA 4WFGD 1QLFB 4ISVB 3C6LA 1UZ8B 3LV3B 1PSKH 2X70B 3C09C 3RAJL 2VDNH 4KAQH 4HIXH 4NM4H 4M7ZB 2NTSP 3P11L 2VLLB 2VDPL 1KEGL 4A2MA 3S35X 3LB6D 1OAKH 3CGTA 1NQBA 1JGUH 3OAUH 1OL0A 4YGAB 4LPWA 1EO5A 3WUZA 3HNSL 4O2FB 1ZWIA 2IAMB 1QQDA 1MH5B 1EJ6A 1OHQA 2IANE 3PABB 3D18B 3QZWG 4OZFA 1DUYA 5K9JH 1X4ZA 4B0MM 1MI5B 4LDLB 4IRSD 4LSRL 1WIPA 4ALAH 3ARXA 3EIFA 3MRKB 1E27B 1RFDL 1DQQA 5HHMD 1G7PB 4P9HL 4E0RA 3QFJE 5I76A 1NKRA 4XAWL 2FRGP 1UB5B 3UEZA 2W38A 3UXFA 3BP6A 2KZ1B 4P57A 2HJLB 3ULVL 4KVNL 3O6FD 4WJ5B 4FZ8H 1AGBB 4HK3J 4M5ZL 3ZSTA 1NMAH 5H37H 3RNKA 3SDAB 4YFDB 4JO1H 2HMID 5IVXB 2YPKB 3H3PL 3RVVC 3K4ZA 5ACZA 3MRHB 4N5UA 4XNQA 4XVTH 1EGJH 4NRYA 1UM4H 3RVWD 3EAKA 5IBLD 1RJLA 4XWGL 3TYGL 1J88A 2CLZB 5IG7B 3VFOA 2VLJB 3GGWA 2X4NA 4ODXB 3UDWC 2BNUB 2A0LD 4TNWK 5DYOB 5JNYB 2D03L 3FQRB 5EU3A 2PTVA 1EH9A 1T2XA 4WI7A 4TUOA 1AGEA 4JGMA 3I2CL 3JUZA 3QWRD 2P5WB 2VDQL 1I8LC 2AJYL 3WE6A 3EHBD 2VXTL 4HUKB 2GITB 1QSFB 4UNVA 4ZFZB 5MEOA 4KTEL 4OLXH 4KTDH 5E9DB 3GBMH 3SJVE 1YECH 4EXKA 3VXTA 1BBDL 4U6YB 4O00A 5FYJE 4XMKH 3QXDB 1FJ1B 2VL4A 3WFEH 1DCLA 2LU4A 1AR1C 4G6FD 3MA7A 1R6VA 5SX4H 1UKTA 4L9DA 4PGCA 1U95A 4WV1B 4U7SA 4XNYL 2NTFB 3E3QE 2P8MA 1VB9A 1BZ9B 1JV5B 2DQHL 4G6ML 2JJVA 5ICZA 5K33A 3SDYH 3D5OF 2D2OA 2IALB 5T1KD 1JN6B 4Y1AD 2OJEA 4M5YH 3KAAA 2JELL 4NKMB 4LVOB 5CUSL 1ZANL 4MVBD 2PKDA 3DX8B 4NZDA 1AIFA 3ULUL 4YFLF 1N0XL 4Z7WA 4BK4A 5ADOH 2IPUG 3LQZA 4YQXL 5KN5A 5CMAB 1A7BA 2AK4A 5BMFH 4AH2A 5SX5H 2X4UA 3VXMD 2FH8A 4JFZL 3WLBA 5BS0B 4LSQH 4NQDE 2XTJD 3O4LD 3EYSL 3T0DA 1VGEL 3F7YA 4TOYL 1IGFH 3HLAA 5GGSA 5AG9A 4MAYD 4HT1L 4OCYH 5CWSA 4JFOA 5C0GA 3UPRA 3OKMA 5LXGL 4B7LA 5JDSB 2R2BB 1I7UA 1GCFA 3DV6B 4AEIL 3QQ3B 1NMBL 5HHPB 3QXAB 1TVBA 1WITA 1WWCA 2IBZY 3P77A 5T3XH 4AQ1B 1QFHA 4CJ0A 4OCLC 1OF2B 2VQTA 4KJYA 2GK0A 4YHKL 1R24B 3LZFL 1YNKH 2ARJQ 3KPMA 3VWJA 5JUEH 2NR6D 2A6KB 2B4CH 4G6KL 5TE7H 5J1AA 5HHOA 1OWWA 2VR9A 2PW1B 4ODUB 3GSUA 5FOJA 3CXDH 1OTUC 3HFMH 5GIRB 1LO3H 2GFBB 2ADFL 5DD3H 1T1WB 1LO2H 5EULV 3CNKA 3VU2A 4ONHB 3MBEB 5IVZB 1JWUB 1CLOL 5DEZA 3W9EA 1AHWA 2BERA 4M6OL 5FUCC 5J12C 3REWA 1KPUB 4R9HA 2YD5A 4UU9B 3L3KA 2EIZA 5LBSL 4F58H 5MEQB 3QEQB 3BP7B 3HNVH 1YPZA 3HPLA 4MD5A 3PGFL 1BIHA 4ELME 3AB0B 4WI6A 1ZHBB 1A7PL 3BDYH 3VI3E 3L7EB 1N8ZB 2XG4A 3FZUC 5FYLE 3MNZB 1ITCA 4GW5B 4OZHB 3FO2A 1HQRB 1AE6H 4NWTH 1R5VA 1FN4A 2G75B 3J8F7 4LASH 2R69H 4X6CA 3B83A 3QUML 4P5TB 3VGGA 1F2QA 2J8UA 3CXHK 5E6IB 1PZ5B 3ZT6A 4NNPL 1J0KA 4PJCF 2JKXA 4XVSL 1XF3A 3F12B 4P5KB 4FQLH 3SKJL 4NKOA 4ZO9A 3RRQA 2QTEA 4K3JH 2W9DH 5JW4M 5TQ2H 3HI6L 3I6LD 1FVEB 1L7IH 4ZQKA 1HHJA 2VDKL 2DWEA 3ZDYF 1P7HL 4JFXB 4U05A 4GBXA 3B9KB 2UZXB 1PKQA 3T0VA 1J5OL 5E1AA 1FE8L 1IC7H 2NY4B 3QRFM 4PGDA 2X4TB 4JPIA 5FV1L 2AXJA 3S3JA 3L3IA 3MV9E 3SDDC 1PW3A 1IM3A 1U8LA 4OF8A 4U1NB 2VERN 4CRPA 1WZ1L 4BUGA 5DRWB 1TFHA 3LRHA 1A3RH 2DYPB 2ITCA 3NAAH 4N8VB 3GI8H 4N1HB 5GS0D 5JORB 3UTPE 3S5LA 5K9KA 2X1XR 4LCCC 1NL0H 4I18A 1OSZA 4FZEH 4GSDL 8FABA 3NCYS 4WHYG 3UZVB 3PHOA 1EGJA 3T0AA 1VGKB 3SPVA 4B41A 4R0LB 2HVJB 5F21B 5C0AD 3S37H 1ZT1A 1VFBA 3M17B 1GZPA 4KMLB 2DQIH 1CICD 1JWMA 1J8HA 5JW5A 5F9WC 3VXSD 5JO5B 3HC0B 3VRJB 1I1YA 5DHVB 1ZHLA 1X5YA 2GT9A 1QVOA 2EDRA 1AR2A 1P7KB 1HHKA 4L4TA 5DQDH 4ORGA 3AU1B 4Y89A 3IAQA 5IB5A 1ULVA 1NAKL 1TZHA 3G6JB 5EUOA 2IMNA 5HHVL 3IS0X 4BH8B 15C8H 1D5MA 4M43H 3N0PB 1A7OH 3S36H 2HH0L 4QF1A 1IQWH 3CH1A 4HEPG 5EZLB 4Z77A 4L3AA 1ADQL 1YNTA 3PL6A 5DUPH 3EOTH 1S9YB 3DX9B 2DBLH 5FF6A 4X6BA 2J6EA 1JGVH 1HK6A 2V7HB 3JWOL 4GXVH 4MNHA 4NNYA 5D8JL 5J89A 5C2UB 3RI5F 4WFEE 2XA8L 3FB6A 3KJ6L 2MNUA 3CZFB 2BOBB 4IMKC 1GGTA 4M7LL 1EO7A 4LBEB 3CLEL 3HMXL 1WZMA 4PV9B 5JXEA 2QQLL 2ITDB 5TPWH 1O0VA 3IJHB 2G60H 1BF2A 1UACH 3HG1D 4RNRA 2XPGA 3CX2A 2Y5TA 2FEDC 3LKNA 3KPSD 2X4QB 4Y5YC 3DVGA 5CEYB 2OTPA 3ARFB 5HY9B 5IKCA 4LSDA 2BDNL 3MJ8B 3VXUD 4CDHA 2MQCA 4JFEB 2APFA 4LVEA 4PYGA 3KLHD 1FV1B 1KJ2B 4WHTA 1R3JA 1U8HB 3I3BA 2EE3A 4L1HA 3VH8A 2LTQB 3GIZH 4JFDA 1R3HA 4MJIB 2XY1A 1TTFA 4RGNC 4J4PA 3T77A 4K3GA 4TTDD 3LRGA 2MSPA 5HYQA 3BP5B 1MHCA 4HV8B 2XN9E 3QUZC 4MD0A 3V52L 2RGSA 4PRNB 5DRXB 3BE1L 2NY2C 1MELA 3BFOA 1RPQA 4P3DB 2LE9A 3D87B 4WUUE 3NZ8B 1ED3A 4NRXB 3GHEH 4X99A 4YDVA 2P43B 2WWMC 1F4YL 5CJQH 1ES0B 1RVFL 5TGBA 4NNXB 5E2UL 2OZ4A 4F7MB 1XF5A 3V95A 1AD0B 5BRZB 4JHBA 4LFHD 5IFAL 1IAIL 3U7AA 3DX6A 1LEGB 3BGFB 5GJTL 2ZCLL 5D7SH 4ODTH 4Q6IC 4C4KO 1QHOA 1G9MH 4IRSA 3KPQB 1R0AH 3SQOL 4DJMA 1QFOA 5IW1A 4X9BA 5CEZE 1T1ZB 4H0GA 1KN4L 4OCRL 4RGMC 1D9KB 4H20H 3H9SD 5INDB 2E6QA 2ATKB 4CN4A 1VACA 3OV6A 4G5ZH 1M05A 2FBJH 1HILB 4WVRA 2PO6D 4LPXA 3O6FA 3UZQA 4KKBD 2C26A 1NAML 2FL5A 1VERA 1SJHA 2AV7B 4BA8A 4WFGE 1UXSB 2QEJA 1FCGA 1PEZA 1NC2B 2O5YL 4O9HH 1IE5A 5FGBA 2J3SA 3P2TA 4X98A 3NPZB 1IGYA 1XGRA 2ZUXA 1TPXB 5IOPB 4XCCH 4JM2D 3VFUA 2YD8A 1C16B 4WHCA 3I85A 1Q9OB 1QLEL 2YK1H 3DETC 2Q8AH 4AG4L 5FDYA 3QIUC 3NIGF 5LCVL 1FNEB 3VXPB 3QWRA 4ZYKB 4MMXC 1XR8A 1EMTL 1TCMA 1L0YA 3MLSH 4Y2DB 5DJ0B 5D7JB 5K9OB 2BNRE 4Z7QE 1TTGA 2QKIA 1CGSL 4L3EB 4J3UA 2Y1VA 1ORQB 1PJ9A 4EQ2A 1F3DH 3FQWA 5FM4A 3VXOB 2Z31A 4HGKC 1U8KB 3INUL 4YEFA 4OF5A 4KI5F 3TPUA 4P2YA 1FDLL 4HWEL 4OM0H 3V7AE 5KVGL 3QDJD 4HAGA 4QHUA 5T1KA 3I3EA 4Y1AA 3C60D 1S7VB 4OZIA 4ZO8A 5JR1L 3BKCH 4BM7A 2Q86A 3PWUB 3CFCL 2GSIA 4XPTH 5EO0B 2ZG3A 3NCJL 3VXMA 2NY6C 3LKPA 4DEPB 3DVNA 4FQXB 4JZOB 2CR6A 3ESVF 3O4LA 2APTA 3SGJC 3REVB 3U7WL 1FAIL 4HMCA 1W8OA 4MAYA 3VRLE 2N1KA 1Q0YH 2AABL 4JRYE 4KUCD 1V7ML 5MERB 3MRGA 4KY1H 1CXKA 5F3BB 2OR9H 4QOKB 5JQHC 4YUEL 4XP6H 4QT5A 3FONB 3IFLH 5ICXB 3MLPA 3SN6N 5DO2D 3BQUB 3GMLA 3UYRL 4LL9A 2F9BT 4HX1A 4PJIE 4V1DD 3ZTNH 1YDPA 2XNAA 4ZOAA 4MAUL 3I9GL 1HH6B 2EXWC 1HHIB 4WEUD 3FCTB 1OPGH 4E5XB 4GJTB 5FKPB 1HQ4B 4K7PY 2LU7A 4O58L 1PAMA 3HC3L 2C7UB 4WU7B 4ZXBD 1H15A 3A6OA 3T4AB 5CP7A 3CVHL 4NQEB 3VXME 2Q3AA 3FRUA 4XHQA 4MA1C 3HB3D 5HHNB 2V17L 4QYOA 4OV5B 3TN0C 5CD3B 1PFCA 1N6VA 2QSTA 4M7KL 1F3DJ 1I9RH 1RULL 3MRNB 4RISL 6FABH 1TJGH 1DQDH 3U79A 4OZ4B 5T5FL 1AO7B 2BSRA 1CVSC 1DBKH 1NBZB 4XC3H 4ZNEA 2O61A 1XIWD 1EXUA 2JJTA 4X6DE 2AJXL 5EUKB 3S35L 5C2BH 3V6BR 1JFQL 3I6GA 4OZFG 5EPMB 5I8CB 4OLVH 4PJHA 5GISH 3EBAA 4IM8A 4BSWA 4HUWB 1WC7B 3WHXA 5CD5D 4OGYL 1OAUL 2BSSB 3QIWB 5CKAA 4HH9A 5BV7H 3IETA 2Z35A 1CDUA 1F00I 4QHMA 4PGEB 1K8IA 4LLYA 4WY7H 4GG6A 4D8PB 4N8CL 2FECI 1NCAL 1IZJA 3RWIA 2F5AH 2AEIT 1KF9B 1V3MA 3F58L 5FXCH 1CS6A 2PYEE 3LSOA 2HVKB 5MP6H 3D3VB 4Z5RA 1QBLL 4DUWA 1DP0A 3SKNB 3WNNA 2A9NH 3OKYA 3QYCA 4JHWL 3PE9A 1BECA 4KRMB 2DBJA 3HTLX 4KROB 1TZIB 4OLWH 2HKFH 3M8OH 3U36A 2VC2L 1S7XA 1S8DB 5IFHH 2UWEE 4K2UH 1G9NC 3UBXI 4K8RH 4L8DA 1INQA 1LP9F 1MCHA 4ZFOL 2B2XH 4ZTOL 1NUDA 4PD4J 4EDXB 1GAFL 5GRUL 3UCRA 2NY1B 5EU5A 5B4MC 1OARH 1DN0A 1IFHL 1KXVC 2A6JA 3DI3B 2HLFD 5CIPA 3NFPA 5GGTA 1DE4A 4F9LA 5C0AA 2DIJA 5CHNA 3OJDB 3ZYIA 3DUHA 3GMQB 4Y2OA 1VPOL 1FZMB 2N7AA 4HBCH 4OKVB 2HFFB 5IJVB 3WXWL 3OG4B 1WWBX 1M1SA 4WW2C 1KCKA 4HIEA 1CICA 4Z7VF 3BEVA 4PJDA 2JB6A 3PG2A 1N6UA 2Q7YB 3VXSA 4LIQL 2Y5EA 4PP2B 3D2UD 5IVOA 4M1DL 3UTTD 4GG8B 1S7WB 5D70L 1SBSH 1VA9A 4HUUB 4L8SB 4OF3A 5IT2L 1T1YA 3KJ4B 3RVVD 1A6VH 5DJ6B 3MRDB 2WUCH 3B9EA 4OB5H 7FABH 5J6GB 1OB1A 1SMAA 3BKJH 4MJ6B 1A1MA 1GOFA 4U1HA 4OV6F 3ZDZE 3V8OA 1FNGA 3G5XB 3QUKA 4MHHI 4NUJB 3T3PF 4U6XB 4ETYA 2VXSH 1A7NL 4ZOBA 4MLSA 3BPLB 4JB9L 2RCSH 1MHPH 4FNLH 1I8MB 1NCUA 4ODBD 1FH5L 2VZSA 1T0NB 1GRWA 3KPRD 2DLIA 1E4KC 2IJ0C 1L7TL 4FFWC 4LAJH 1S7RA 2F74A 5DJXB 3LQAC 4GAFB 4YXKH 3GJFK 1ZT7A 5E56A 5KJRH 3MOBH 1M71B 1F58L 1OM3L 2FO1A 4X4MA 2MOVA 4FQHA 4D0BA 1ZTXL 1AR1D 2E8YA 5I30L 3IT8D 1KB5H 4LAQH 3QXUA 4ZD3H 1Y0LB 2YD4A 3ME0A 1T7YA 2D9CA 3FQTA 3QDGD 3HG1A 2RFXB 2J12B 1PG7X 1UWXK 2X10A 5C0BB 3B2VL 4MYWB 4ZPVA 4XP4L 1JBJA 2OK0H 3IDYB 4YDJA 4PLKD 2FX9L 3KPSA 4JO3H 3DUUB 1A4JB 5F1IB 3MGOA 3TO2B 2IGFL 1CF8H 1F4HA 2FJHB 4PJ7B 2DTMH 4IRZL 5FOBA 4CNIA 1JMXA 1NJ9A 1BHGA 1DVFB 4XWOC 3STLA 3TO4B 5FEBA 2G9HA 4WTZA 5DJZB 3S88L 1CGTA 2ENSA 3T1FA 4BKLA 1J11A 4I3SL 4F3FB 1EZVY 4ODVL 1I1RA 3QRGL 2E7LA 2DM4A 3O8XD 3PWJA 1FFPA 2H3NB 3F65A 2FWOA 1S9XB 5L9DH 5JQ6H 4JFPB 2D0HA 5DFTA 4LPVA 1JYWA 4M6AA 5ITFA 1BD2E 3E2HC 3NCMA 3W5NA 1CDIA 1EJOH 5ICYB 4P9HC 3WKML 2DAVA 4ZSOB 3NGBB 3HE7C 1OTUD 2HKHL 2BVQA 4XCNA 1RUPL 5E6YA 5B8CB 1D5IH 2YC1B 4HIJA 1NSNL 4PJGA 1A6ZA 4EKXA 1HH9A 2EDTA 1K6QH 4IDJL 1O5DT 3HR5A 3VCLB 5DJAA 2ICEB 4HZAA 1QBML 3RWJB 1GGIL 3E6HB 3CX5K 3SOBH 2E5EA 4YHLH 3H9SA 1FFNB 1G7QA 1QRNE 1X5GA 1RD6A 3FZUD 3TNNB 1UEYA 3DXAD 3OXSA 4PJBA 4L9LB 1L9NA 3NTCL 1IGJA 3V5KB 2PO6A 4OSUL 5E2VL 1I7ZA 2XZQH 4JLRA 2PYFB 4KDTC 4Q9RL 1J12A 1VCAA 4UINH 2FIRT 5I74C 1WCQA 1BIIB 1QSEB 5J13B 2DQFB 4BSJA 2NY7L 4X7CC 4IIQA 3KVQA 3WXVL 5F9JA 3X3FL 5BJTB 2H6PB 5CCKH 1IGCH 3C08H 3BH8A 3QCUL 2F5BH 4JM2A 3VJ6B 1E28B 1QLRB 5J1SC 1K4CB 3KYNA 4ODHL 5KANG 2DMKA 1MJ7H 4G9FE 5HGBA 3TH4T 1QOKA 4HXBH 3MUGA 4C57C 4PJCB 4QNPE 4RDQG 1J1OH 2FGZA 3T0EB 4JQXA 4L4VB 4HF5L 1CGXA 3RZCC 3SDDD 3VG0L 4JKWA 1DDHB 3QDMB 1WEJH 3ULUC 5ADPL 4PJBE 2B1HH 2I9LA 3R06A 2ZSWA 1C8PA 1INEL 1IARB 4OM1L 1T89C 1CZ8H 5I1GL 5JHDE 3GB7B 3TA3C 1RZFH 3VXUB 3RTQD 2JJSC 4XNXL 1L0XA 5L2KE 1CL7H 5FOBB 1FNSH 3IXAA 3WFZA 1MUJB 1IKNA 1P84J 1LEIA 1U8JB 2VWEC 4R7NA 3ARRA 4ODWA 3QDJA 3V6ZA 2EEDA 4Z6AT 2VDRH 2A74B 3C60A 5GS1C 4MA7L 5EBWB 3OGCB 3LH2H 2RQ8A 2F54D 4WO4B 1D6EB 3LKQA 3KLDA 1MPAH 2Z8RA 2E6PA 3DUSA 4MQXC 4MNQE 3IVKA 2BFVL 5D1ZB 1HHHA 1OWRM 4RWYL 3M1BA 1A02N 4JFYA 1MAJA 2NYYC 4KJWC 5MENE 4OQTH 4JG0L 4LCIL 4JVPA 1KIRB 2C4XA 3GI9L 5FYLL 3ARBC 3HA0A 3MYZA 3SO3B 2ICWJ 3BO8B 2XFXA 3CPLA 4R4NC 5ID1B 5TE6H 2JCCF 3DHMA 3TBTA 5LQBH 5B38B 3BT2L 3L7FA 4V1DA 2YUXA 5D6CA 3FQNB 5BVJA 4X7SH 5B22A 4FXKA 2E8ZA 3MNVA 3VFSA 2WLZA 2IPKA 3ARDB 5E6ZA 2G5BA 3GKWH 2YPLB 1HIML 1NH6A 4J3TA 1MI5E 4YBQD 1FL5A 4FA8A 3X11A 3UMTA 4ZXBA 2JTDA 2O5ZH 1R5WA 2R0ZL 1MCJA 2XWBA 3UJTL 3ZKXC 5LG1A 4FRWA 3WSQH 4BH7B 4N0UA 4XT1C 2BXZA 1YEJL 5DJCB 2CLVA 3U6RB 5CEXB 4HUVA 2V5RA 2I25N 5F6HI 4HKBA 4AL8H 3SY0B 4GW4A 4I48B 2ADJA 5IVNA 1N2RA 2ZOLB 3U0WL 3KXFB 5IVXE 1OTTD 3IXTA 1IAMA 1CQYA 3DGCR 1XIWA 4AM0B 1UH4A 1A9EA 4ZAKD 4U1SB 5CBAB 4ENEC 3TCLB 1BJ1J 3TWCL 1PSKL 2B5IC 3ULSA 5GZND 4KAQL 2Z8SA 5JOFB 4GKSA 4ZUWA 3TESA 2VLJE 1MNUH 4JPWL 4LQFH 3BGMB 4DKFH 1LO4H 4MXQD 1IGTB 2CIKB 5IB1A 5DEGB 3P30H 2GJ6E 1GGBL 3VFRB 5A2FA 5IB3A 3OZ9H 5D2NA 4A6YA 3Q3GB 2P5WE 3STBA 5HGHA 2J8HA 1OGAB 2DLGA 1VADA 1ZHKA 5DMJB 2ZSWB 5GHWH 1DLFH 1QSFE 5IW3A 2V7NB 1C7SA 2WANA 2NY2D 1XMWA 1SJXA 5E9DE 1UT9A 4ALAL 4MQ7B 4TNWF 3AM8A 3MOAL 1OOAA 2B1AH 4X9HA 1C5BL 5F89B 2WWMD 3V7AG 4BQ9A 2V2WB 4RZCA 3PHQA 1I8IB 5EC2A 2ADIB 3H0TA 4KRNA 2YEZB 4JR9H 2G5RA 2GIYA 1T7VA 3O9WC 4GMSH 5FYKD 3H9YA 1S9VB 4FMKA 5C0EB 4JO1L 5C0JA 4OFKA 4RA0C 2ATPA 4PRDA 3E6FB 3F5WA 4C58B 4BZ1H 5I0ZA 4LDOB 4XVTL 1EGJL 1WUNT 4HS3A 2EDEA 1KN2H 4C83B 4H1LH 1Y6NR 3ILQD 5BQ7B 1F45A 5BS0E 4FFZL 4P4KD 4TUJB 3GMRA 4AZ8A 2BVPB 2A9ML 3QNXB 3MUY1 1S7TA 4X7TA 5D2NE 4HZLB 2FLRT 1X5IA 4LRIC 3S4SB 4HPOH 4LCUA 4ZOCA 1BQHG 5F7MC 3D2UA 1AJ7H 3LDBB 3SQBA 3UTTA 2NXYD 3MGAA 3RY5A 1KB5B 2AV1A 5DLML 1FNAA 4V1DB 3SCMD 5C0RL 4PJ5D 1HINH 3O11B 3VXNA 5EU4B 3VWKB 3WUWA 2WP3T 2AQ2A 2WUBL 3JWOC 3NH7H 1S9KC 5MI0B 3KNBB 3GBML 1XCTA 1YQ2A 4Y4KC 4C55A 4GXUN 4NQUA 5IQ9A 3H9ZA 4QTIL 1A1NB 4YC2B 2FO4A 3WFEL 3MC0A 4NUGH 1MWAA 2XZCL 2GHWB 3DETD 4GRWH 1SVZA 2AGJH 5J11C 5IIEA 2YD7A 1JNHB 1YMMB 3FOMB 5D7LD 3QPXH 3IKCA 1ZV5A 5IF0A 3KPRA 3WO4B 4U6TA 5A2IH 5AAWA 4ZS7H 5TE4H 2J6EL 3O2WH 1HEZB 3O41B 5E08H 5ADOL 3EO9H 3N1QC 5BMFL 3QEQE 1BWMA 3ARZA 4P48A 4LSQL 4NBXB 3WIHH 2X2YA 1ZT4B 3SDXA 1I1AC 2QQKL 3ULSB 1IGFL 5TFSH 1NLDH 4OZHE 3QDGA 4KK6C 4OCYL 4QXTB 3LKRB 4NO5B 1JGDA 1M7IB 5D1XC 2CLRB 3FO0H 2ILLA 1G7JB 4JQIH 1MREL 1OAXH 3CDGB 3BVNB 2IBBA 3QBTB 3GSVA 2ZUSA 3IDMB 2NY6D 5EBGA 3DIFA 4U3HA 2B4CL 4NC1C 5TE7L 3C09B 5GGRY 3QG6A 2EIEA 4P3CL 3G04B 5CEZL 5ILTL 2P8PB 3CFIC 1LO3L 1WBXA 1EO8H 4NJ9H 3RDTA 3MFFA 4NZJA 1ZK9A 3O8XA 3CFJA 4X6EA 5CGYC 5F44A 3IFPB 2WV3A 1KJMA 5EIIA 3QXWA 4WWKC 1KPVB 3WFDL 4WW2F 5BW7A 4K7PH 5D1QC 3WD5H 3IF1B 3BIKA 4YR6A 4U1GC 1YMHB 4OF6A 1T20B 4CMMA 1JWSA 3VI3F 4F58L 2ICWB 2CD0A 2WINB 1JTOA 1ORSA 4BSVA 5C0DA 2KQNA 1X4XA 5E5MA 5EZOL 1BAFL 2NMSA 3D39D 4YHIA 3P4MA 3BMWA 5DMKA 2D7MA 2OZ4L 4XH2A 2QHRH 4LASL 4O2EB 4LHUD 4MX7B 1T66C 4NO2A 3TBWA 1I1FB 5SX4I 5HD8C 5FKAB 3MRCB