5CEZD

Crystal structure of the bg505 sosip gp140 hiv-1 env trimer in complex with an early putative precursor of the pgt121 family at 3.0 angstrom
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
240
structure length
240
Chain Sequence
EGQLVQSGAELKKPGASVKISCKTSGYRFNFYHINWIRQTAGRGPEWMGWISPYSGDKNLAPAFQDRVIMTTDTEVPVTSFTSTGAAYMEIRNLKFDDTGTYFCAKGLLRDGSSTWLPYLWGQGTLLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
total genus 44
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezD01
3K2UL 3FT4A 1MJ7L 5DURB 2G60H 4X4ZA 1NEUA 3MA9L 5I75C 5JW4Q 4I77H 1EHNA 1NBVL 3OX8A 1QRKA 4XNQA 3RWHB 4R0LA 5EU7E 3PE9A 3F65A 4OCYL 1GOFA 5HDLA 3EDDA 4MQSB 5J6HB 3AROA 4JFEA 2HTLC 3E6HA 3PV7A 1DQJB 4XAKE 4WVRA 3TT1L 4UDTB 3RZCC 5F9JB 1TTUA 2JB6A 5TJWK 5IBUB 3QDJB 1E27B 4MNGA 4YWGL 3DRTB 3U46A 3DV6B 2R69L 3F5WB 2E7LA 5E5MA 1HZHL 5LGHL 3F7RA 3EIFA 1NCWL 1R24A 3QIWB 3HNSL 3QA3A 5D6CA 4HZAA 4MA3A 4LSPL 5D7JC 4FHBD 1QSEA 1RURL 3HZKB 4NO0B 5FIEA 3B8SA 4RFOL 4I0PB 3DX6B 4HIIA 3HR5A 2YZ1A 1ND0A 3C2AL 2NY3B 2VQTA 3O6MH 1AXSA 4UUJB 5ISZA 5I74B 3S37L 2ZUQB 4HWBA 3VJ6A 3K4AA 4P3DB 5D4QA 4HKXB 4WEUD 1IGYB 2Z9TA 5KAQG 2ADGA 2GFBA 3QXVA 3BKCL 1AGBA 4H20L 4XAKD 2YD4A 4F7CB 4QHLA 3IXTB 1OGAD 5D1XA 1MAML 4ALAL 3FOLA 4OGXH 3LMJL 2VISB 1X4ZA 5EZIL 2VXUH 4YEFA 1T6VN 1F4YH 1EFXB 2XZQH 3GSXB 5GS1C 2CD0A 4QRPB 1A7BA 1J5OL 2F54A 4P2RD 4KJWC 1VEMA 3MGTB 5FA3A 3ZZ1A 1BJMA 4AIOA 3GMRA 1G7IB 2H2PD 2YUXA 4U1IA 2VXTL 4LPTA 1CDCA 3ZDYF 3QDAA 1SYSA 1IGIH 1WT5C 5EBMB 3UC0H 5DC0A 5TQ0L 1IKFH 1FNSH 4JPVH 3DYMA 3L1OH 2NW2A 2R39A 2CDFA 5CEXA 3RBGA 1OSPL 4H5SA 4ZFOL 3C6SA 3WNLA 4HIHB 2IG2L 1N6VA 5HPOA 3U7WH 2VLJD 3CFKA 5LAXB 2QSVA 1Q9OB 3X14B 1WBYB 2FD6L 3NFSL 5IR1A 4LDLB 3G9VA 1JPSH 1JPST 3QDMD 3NCJL 4GRMB 5DVNA 4G3YH 4C56E 4C56A 1TNNA 1TVBB 4RBPH 3F7YA 1U2CA 4TVPH 4OV6F 5DGQA 2IAMA 3D2UD 4ZO9A 1XH3A 3VD3A 3VW3L 3ZHLA 1MI5B 3CFEA 3MRHA 4ZPVA 1I7TB 5E6IC 5ENWB 2PCPA 4P57B 3FHAA 4ETQA 2XPGB 1NC2B 1NAMH 5AD0A 1KEGL 1MIML 1D5IL 4GQ9H 2FATL 1FRGH 2OQJB 1WAAA 1J0KA 1KIPA 3QUML 4JQXA 5K9QG 3CIQA 3BI9X 5C07B 3KPRD 3MRFA 1RZIA 4YHLH 1ZHLB 3MLUL 3GSNH 4OLZH 2D03L 3VWJC 3VRJA 2R0LH 1G7PB 1ZGLA 1MEXL 2BSTB 1KJ2A 3OAUH 2P45B 2AGJH 3SE9L 3C5ZC 3T0VA 2PYFA 1MY5A 3WEXA 3WYRA 2BX5A 2FR4A 4BFBD 3EO9H 4RAUA 1D9KB 1MFCL 1F6FB 5E7FA 5BXFB 4X6BB 3F7YB 1JI2A 4P59H 2DQUL 2M26A 4CNIB 4TSCL 2XA8H 3DVIA 3CCHA 2X4PA 4O02H 4F57L 2JE8A 5IR1B 1U58A 3QUMB 3L7EA 4OLYL 5L2KA 4X4ME 3KPSD 3LS5H 5I1HL 5DZNA 1F2QA 1W2KT 3RL2A 3CFJA 3VXSA 1FYTD 3RWEB 1MCQA 3B2VH 1S7WA 5GISH 4XVTH 4DGIH 2OTPA 5IFHL 1YNKL 3BWAB 1I3RA 4WO4A 3PWVA 2NYYD 1UEYA 5KBNC 3D0LA 4ZFGH 4JQIL 1SYSB 5HPMB 2ADIB 4XP9L 3S9DB 4QT5B 4OZIA 3N9GH 1HHIA 4E5XA 1G7MB 1Z5LA 3MLPA 2WV3A 4XNYL 2XFXB 4JHWL 1MLCB 4JAMB 2YKLH 1F4HA 1TCRA 5TE4H 3BUYA 4NZDA 4QGYA 4R8WH 3TIEB 5TQ2L 4OM1H 5DWUH 3A67L 4HIXL 2X10A 3IJYB 4QXTB 1ACYH 3LEVH 3V5HA 3BJLA 4PRIA 3W9DA 1T4KA 2R29H 3SY0A 3LS5L 4JO4L 2OBGA 1CN4A 1FGNL 6CGTA 2FIRT 3SDDC 2QADB 4S1DD 2FJHB 3B2VL 4LMQI 4QHUA 3MV7D 2IFGA 4PTUA 3HI6H 1Z2KA 1Q9OA 1TDQA 1JTPA 4PJ9D 2HFFA 1KELL 5CP3H 2Q86B 1AGEB 5I1GL 1F4XL 1BQLL 2VIRA 4H88H 4RMVA 3FQNA 1QTYT 3VFPA 3GMOA 4IMKC 2X4QA 3FO2A 5BMFH 4U6YA 1DEDA 3HLAB 3WNNA 2VZOA 3AY4A 5D72H 1E0OB 2EKSA 1ZVYA 4YXKH 2PO6A 4ODWA 3FKUS 3MJ8A 3MOQA 4CVWA 1L7TH 4PJBE 2BC4B 4L3ED 4WTXA 3A67H 3MRIB 4HIXH 2VR5A 3MZGB 3TJHC 3I6KA 3VFSB 4CMHC 2GSGA 2WW8A 3CUPA 2A74A 3GSRB 1OTTD 5JUEL 2NX5A 5HDBE 5EULV 3TBTA 1C08B 3LZFH 3QUXC 4D3CH 4NHCL 2PW2B 2O5ZL 4F58L 4RGNC 1N3NA 5H37H 3KHQA 4HBCH 4HWNA 1ETZA 4LLWB 1V3KA 3CJJA 4ODWB 5HDOA 4EIGB 1XF2B 3QO1A 3WJJC 3NTCH 1G7LA 3T8XA 1P4IL 4KI1A 5I2IA 3QNZB 1NCTA 1U8QB 4LIQH 2UV3A 1XIWD 5FM4A 4PJ9B 5FCUH 3BP6B 4PPTA 3FT4B 4P4KA 4PB9H 3S5LB 1CFBA 5IB5A 1GH7A 3DX6A 1I1YB 3BHBA 4HAFA 3V5DA 2ZSWB 2JB5L 1AGEA 1IGFL 1Q94A 2YC1A 2DKUA 5GPRA 2WBKA 3VCLA 4TYUA 1AIFB 5E00B 2DQJH 3FQWB 2FJHA 5F7EH 1CLOH 2OP4L 2EEAA 4GXVL 4M8QA 3V6OC 4NRZA 4DVBA 3V9FA 2VXUL 4MNQE 4LSRH 1OB1A 4K3EH 5DMJB 2VQ1A 2CLZB 1EERB 3ARRA 2BNRA 3H9HA 3RWDA 3SCMA 1QKZL 4GW4B 1AP2B 1FGVH 3DXAB 3UO1H 2Q7YA 5HVFB 2NY1B 2DKSA 4TOYL 1HH6A 3KDMA 4ZPTB 5F7YC 2AXJA 2VXVH 1IGIL 1VEPA 5GS2H 4CMMA 3O2DH 4FFVD 3T77A 4L4TB 3NA9L 3L1OL 1D7FA 2FL5A 2ILLA 4MXWL 5HYFA 3RKDC 4LPCA 5HDQL 1RK1B 2NXYC 4LCIH 2BNQD 4YEEA 4OZIB 1UM4L 4KK8C 1WICA 2OR9L 3VWJB 1KIUA 3HCVB 4LSTL 1XIWB 4PLKC 2J8OA 5CJBA 4A6YL 3RUGB 4NKOB 1QR1A 1RIVL 1A7RL 1OARH 1DE4B 3IDMA 5JHDA 1L7IH 1ZMYA 3RWEA 2HVKB 4S2SB 5C0FB 3FFCE 2VLME 4KZEL 1T1WA 1ZA6B 2M8XA 3NOIA 1BLNA 3SDXF 4NWTL 4XB8A 1PGRB 5D2NB 3J7HA 4HS6A 2P7TA 2B4CC 1FGVL 4S10A 4DK3A 4H26A 3I6LE 4FXGB 1I1AA 4LLQA 2BRRL 2LU4A 1NEZB 2GTZB 3OR6B 1U91B 3MXWL 4XC1H 1KTKE 4YDKH 1HSAA 3WV0A 5DMGC 4K94C 3MNZB 4I48A 5C0ND 5T1LD 3RIFF 3PWNA 4GJTB 2M2DA 3CVIH 3WHXB 1T83A 4P0DA 2BSSB 4G6ML 4QTHA 1KN4H 1FH5L 1SY6L 4XBGA 4NBYB 4WWKB 5E2VH 2J1KA 2O61A 2UUDH 3MRJB 1KFAH 5DJCA 1ZEAL 4MSWA 1ODAA 1YQVL 3AXLB 4NQDB 5GGSY 3AAZB 5KSAC 1JIBA 2OSLB 1KIRB 3TPUA 5I30H 3X13B 5C0EA 1MQKL 1G7JB 3RVTD 4NQCB 2WLZA 3GK8L 4GKZA 1D6VH 3P30H 1MCPH 2VE6B 3DX7A 4M62L 5TPWH 1CGVA 3S5LA 4JZNB 1QNZL 1HINL 5D7IE 3X12B 4LLYA 4HFWA 4R26L 5ABDE 4JZNA 1KG0A 1BX2A 4NQDE 5DD3L 1Y6MR 3BYTA 3A6CL 4QRUB 3U1SH 2BRRH 2GCYA 3LQZB 1SMOA 1YEDB 5JLZB 1A5FH 2MCPH 2APTA 2ZJSL 4BKLA 4DFIA 4G6KL 2XKUA 4MNQA 4P2RE 3DI3B 2OZ4A 1K8IB 2DD8L 3H9SD 4LMQE 3C5JB 1LK2B 3LSOA 3LKSA 3TYFA 1DQML 1NH6A 2BXYA 3KPRA 1FV1B 2CXKA 2A38A 3DBXB 3HI1B 3STZA 1YEEL 4PY8J 3LEXA 1KJVB 2MQCA 1OCWH 4JR9L 5GHWL 2EC8A 5KJRL 1V05A 1BOGB 1DL7L 3EJYD 3RL1A 3PJSB 3SE8H 1TFHA 2B0SL 3NFPB 3GSNB 3CK0L 4R97C 2RQ8A 1JN6A 4YHKH 3MMEB 5J06A 5B39A 1A21A 3W5MA 5DC4B 1NC2D 4JM4L 4X6CA 2IAMD 2YEZB 3D2UA 3FQNB 4R26H 1KCRL 5FV1L 3MFGB 4E41B 3O2WH 2AXGA 4OKDA 3QI9B 1XR9A 3RU8L 4AH2B 1UQSB 4DKFL 1LO3H 5F1OB 3ARFC 3LAFA 2NCMA 1X5KA 2ZG1A 4MA1C 4RGNE 3KPSA 1JHLL 2VDQL 1G1CA 2CQVA 1H8NA 2DQFB 4Z7VB 4G8GE 1Q0YL 4MVBD 5LBSL 4TSAH 5AZ2H 5F9OH 5ITBL 2O5YH 4OZIE 1D6EB 5F7NC 5EA0L 3DRQA 3QEQD 4WI9A 2BOBA 1Q0XH 1EO8L 3BVNA 5L0QC 1OOAA 1NPUA 4DUXA 5L7XL 4HH9B 4FXKA 1RULL 3RWGB 3KPSB 2XQBH 4ONHB 1DBAH 2OTUA 3UC0L 1JP5A 3X11B 3MOAH 1ND0B 2CDGB 1C7TA 2OL3L 1WWCA 4XZUA 2GI7A 1KLGA 1NC4B 5CEZH 5I73B 2MSPA 3PWLB 4WJ5B 4N0UE 4ZO6A 4UTAH 4K3DH 5I76B 3T0DA 1P7QA 1NLBL 2QTEA 3DV4B 4N5ED 4CMHB 4YXLL 2EXYD 5J0BA 3BQUA 2X7LB 2FD6H 3CD4A 4PJ7E 5IW6B 4BZ2L 2YD3A 4X7FC 3FQWA 4JY6A 2N56A 2DM3A 2MPAL 1MVUA 2ED7A 4LCWA 4RRPA 5AZ2L 2O5ZH 1YEGH 1WZ1L 5T3ZH 1UYWH 1ZANL 4IRSC 2VDLH 3MUY1 2J12B 5J11C 4UDTA 4AG4L 3TNNB 4KK9C 4KV5F 1JV5A 3DMMB 1G7QA 3KS0J 1UKQA 4FXLA 1KGCE 2CMRL 4KTDH 3TCXA 5DRNA 1BECA 1A0QL 2IGFH 4ZUWB 1FFOA 3I2CH 1RZKC 3IF1A 2X9YA 1TXKA 1DBAL 3ZT7A 4CVUA 2PR4H 3T8XB 5D5ME 5F96L 3MLUH 5CGMA 4OLWH 1LO0H 4Y2DC 2YRLA 4HJJL 1P9MA 1YN6A 2DTML 4QHMB 2DMBA 5D1QD 1GZPA 3EHBD 1K5NA 5JQHC 3ULUE 2WK2A 3MV8D 5IEHB 4WUKL 1YEHL 5F7UA 4HGWA 1FSKC 5CBAB 3OKKB 3SE9H 2XKNB 4NQDA 4JY6B 2GKIA 3MJ8B 1KSRA 4O9HH 2NR6D 3O0RH 1P7KB 4Z5RA 5GGSA 4PJIF 3LHPH 4N0UA 1UM6H 4DN4H 1INEH 4FN0A 5B8CC 1F6LL 3E0GA 3IETB 5IOPA 1EXUA 4ETQB 5IF0B 3CFEB 4GMSL 1KJ2H 2FSEB 1TZGH 3I50L 2FHFA 3BIKA 2GYSA 2NY4B 2DTMH 5IWLA 4LAJH 3JXAA 1EZVX 3W2DL 1FNEB 3ZKND 2G75B 4YPJA 5I1IH 3QJFA 5D2NA 1QG3A 5D71L 4LIQE 4OTXL 1YNKH 4IIQC 3QIUB 2EXWD 3TZVD 1WAAE 5IG7B 3CFKB 3UTQA 3P73B 1YN7A 3VRIB 3QEQA 4L3EE 5SV4A 3TN0B 4S11A 3VXOA 1AGDB 2K7QA 2MFNA 5B38B 1ZT4B 4QXUL 1UB6B 4BK5A 4RIRB 3A6BL 5I1KH 2ICWB 4P2YA 3FMGH 3U83A 3WSQH 4PJGF 3QIBB 2BSRB 5GGVY 1JTTA 1K4DA 1MJ8L 1UXSB 1D5BB 4UT7H 3TGXA 4FABH 2X4NA 4JPKL 5AG8A 4NZTL 4WI7A 3GSNA 5FUZH 2DKMA 1S7WB 1M7DA 2C4FU 1UFUA 2EDJA 3GSXA 4APQC 4P46B 4CRPA 4LASL 5JIHA 1E28B 3TA3D 3NBNA 3WE6B 3KPLB 1FGNH 3REVA 3QFJA 1HN1A 3P40A 2UVFA 2UZXB 1T6WA 5T1LA 3RWCB 1OB1B 1TZIA 5FYKE 2X4OA 1FYHB 2E8ZA 3HS0A 4KKNA 1FNEA 3OXSB 4AQOA 4CDGC 5DK2A 3DXAD 2HWZL 3HZVA 4F7TA 4KY1L 2AABH 5BXFA 1DN0A 5GGVH 1RK0A 1RUQL 5C0AB 1MCKA 2A6KA 2HMIC 3G5VA 1BQHA 1S7UA 25C8H 4PS4L 4APQB 4OGAD 1DUZA 1NBZB 2CGRL 5IVZA 2A6IA 5TDPB 5ICZA 5DQ9B 4LSPH 2ZJSH 3OR7B 4P5TC 4IRJA 3TBSB 3WLWC 4LCWE 7FABH 1JZ8A 4QRRA 2EH8H 2ATKA 1PSKL 2VQUA 3MSPA 3S36L 1DQMH 4BYHA 3MLVH 1RZIB 4GAJH 1NGQL 1XGTA 3ABZA 4X6FB 1NDGB 1HQRB 3ESUF 3O8XA 4NZRH 5LQBH 5E8PA 1MFEL 4ZUSA 2VLRA 1JNNH 4O00A 4PBVC 4MHHI 3WDIA 4G43A 5J1AA 2D9CA 4PRHB 1AHWC 1MI5E 4Y8AA 4NM8H 4HD9A 1P4IH 3EHBC 1JHKH 3QCTL 4X9FA 4UDUA 1MCRA 5HGDB 3VD4A 2V9QA 5GGVL 3BGAA 1IEAA 2EKSB 1UA6H 4XNQB 1U8NA 3ZSSA 3HLAA 3ZE1F 3JV6B 3Q3GB 2NY4C 3OZ9H 1UZ8B 2DTSA 4CU7A 3ZE2F 4KXZH 1X5XA 4M7KH 4HMCA 1J11A 1SM3H 1X5FA 3RTQB 3QULB 3O81A 4UT6H 3T0EC 1FNSL 2O5YL 4U3CA 4LSUH 5EA0H 1VENA 1JWUB 3UTSB 1KB5L 1HHKB 4XP4H 4LPUA 1RZ7L 4M93B 1EO8H 5E8EB 3Q6FA 2APVA 1A7QL 4G8EB 1UZ8A 4PRPA 1MHPL 2RHEA 3KYKH 3HCVA 3RHWK 3INUH 2AV1B 4PLJD 3WJLA 1HCFX 4L8SB 1M71B 1UCBL 5I15H 5JA9A 1IM9B 3MBED 4PR5A 1F6AA 1SVCP 2X1PA 5ECJE 5E2TH 5F9DC 1AR2A 2HTKD 1YZZA 1XGPA 4A6YH 3RWGA 1J0ZA 5DVKA 2NLJA 1KBGH 1RZJH 5H8DA 2AV1A 4EQ2A 4QOKD 5EZLB 3QEQE 4L3EA 5JOFB 5DGRA 4GOSA 5E8DL 5CILL 1S7TB 4M1DH 2BNRD 1FQ9C 4L9LC 4G9DB 1HNGA 3O3EA 2DYPB 3BYYA 4PJAB 3MA7A 1C5BL 1X7QB 1KTLA 3B2UD 5F7HA 2D03H 5I75B 2C26A 5H2BB 1KPUB 2AXGB 2PR4L 4RWYL 1GPOL 4R7DB 4EI5B 1YPZB 3HZKA 1SEBA 4P4KB 2Y6SD 4GRWB 3SCMC 3WIFB 3GDBA 1GGIH 1JN6B 4YGVA 4AMKH 5JOEA 3RL1B 1Z0NA 2E7HA 3TIDA 1D6VL 1P1ZA 1CU4H 3FQXB 5EU6A 3CFDA 3TO4A 1ZEAH 1H3VA 2ERJB 5F72S 3NN8B 1IQWH 2XA8L 3CDGA 3N1MC 4X9GA 5DO2D 5FM5O 4RNRB 4N1HB 3MV9D 1SJEB 2KKQA 4U1MB 1CQKA 4FQHA 4HMEA 3SJVE 1HQRA 2ZZUT 2MCPL 5C07A 1DVFA 3HB3C 4YBLC 2LTQC 5C0BB 2QKIA 4NP4H 5DD3H 3DSFH 4CN1A 2P8PB 4PJHF 3T65B 1OD9A 1G9EA 4LP4A 1S3KH 3OR7A 4HKBB 5FM8A 1IQDB 3BDYH 2E8YA 5IIEA 1D5MA 5E5RB 4CBPA 1RHFA 3BP7B 2DJUA 5FGBA 2GK2A 3HZMB 3H3PH 4XCYA 1UWEL 3OKMA 3CH8A 1KIRA 1NMCC 4WCYH 1DN0B 2VDRL 5E1AB 1OQOA 3O3DA 4X98B 1XCTB 4XVUC 3CLEL 1QFWM 4GKOA 5CEYA 2NY1C 2QSCL 4MSWB 2H8PA 2BVOB 2A6DA 3K7UA 5FK9B 2C3VB 4YDIL 2BVOA 1X5YA 3GMQA 1MJJA 3NIGE 1DANT 5FOBA 4QTHB 5C7XL 3VXQA 1FL3A 1JE6A 2X89D 3GKWH 2Y25A 3BXNB 4K9EC 4CN4A 2FSEA 4EZMA 5EBWB 1KOAA 4PJ7F 5T5FH 3FMGL 4LPYA 3RU8H 4P3CL 4OM0L 3T65A 2XWTB 4QOKE 3U7AA 4JY5L 4WFHD 2QLVB 2PN5A 1IC7H 5DR5H 5DQJA 3NCYS 2EC9T 1DVFB 4UTBL 1QFOA 3WFHA 4ODXA 5F9OL 1C5DA 2X6MA 5HHOD 4LBEA 1QRNE 4ZAKD 3SKMA 4U3HA 4MVBC 3IKKA 1TJGL 3QEQB 3BH8A 1C8PA 3PUCA 5EN2B 4APQD 2F74A 5D6DC 2I26N 1AGBB 1KJ3L 2HFEA 3LZFL 3MLWL 4Z77A 3FQTB 4GBXC 2Y7QB 4GKSB 5EUKA 4HCRL 3RKDD 2FB4H 4JG0H 2X70B 2PETA 4FFZH 4CMMB 1EK3A 3BN3B 1T20B 3MRGA 2VLLA 1NLBH 4GG6B 2ESVE 1RVFL 2ZCHH 1NC4D 2YA2A 3WXWL 2EXWC 2PYEB 3TZVC 4BZ2H 1Z9MA 1EJOH 1MCIA 2V5RA 2HP4A 3O3AB 5C9KA 4YFDB 2OL3A 4CVXA 5ERWB 2UWEF 4ZSOB 3VXSE 4N68A 4PGCB 5EOQL 4JKMA 4N9GB 2H6PB 5FKPB 5D2NC 1YNLH 3HZYB 5GS1B 4KKAD 2BVYA 4R6UA 2P1YA 3PGDB 3BFOA 4MAYB 3TH3T 5D8JH 2R2BA 3AB0B 5IEKA 3SDDA 2HLAB 2ICWJ 1MLBA 1T2QH 1MY7A 2N7AA 4FRWA 4S0TD 5TE7H 3VFVB 2ATPA 5GRWA 5HYJE 1I1YA 3V5DB 1R0AL 3CGTA 5DMIL 3ULSA 4QNPE 3ARBA 5ILTL 1A6WL 2F54D 4NQUA 5SWZD 3ZKXB 2GJ6D 2AK1L 2GEEA 3MGOB 2EIZB 1IT9H 4LARL 2XZZA 3PGFL 5HHQB 4GKSA 5EUKB 4M9OA 4RAVB 4KFZC 4Y89A 5EC2B 5GRJL 1A3LH 1I9IH 4RMRA 3ALWA 1IM3A 4LSUL 1XF4B 4JFXB 2YUZA 1FO0L 1PLGH 3MYJA 1NUFA 2NX5B 3MR9B 1OTTC 4RGMC 3T0WA 4GAGL 4K9EL 4ONGL 1IAOA 4B7IA 4LCWB 2GSIA 1G9ML 1R3HB 4L1HA 3CX2A 1JVKA 3FONA 1IC4H 5I15L 3G6DL 3FB5B 5DD1H 3GGWA 2HJKA 2H1PL 4OV5A 1PAMA 2G9HB 3RZCB 2VITA 1DANU 3MJ9L 5D71H 1RJCA 5EBMA 5DJ0A 1MHCA 5B21A 5BQ7A 5A2LH 1VADA 3JBG7 3NCEB 1IT9L 4XXDA 2RFXA 5FXCH 3MRNA 5EU4A 2CDGA 2EDNA 4LVNB 4JFFB 2CLVB 4MJIA 4QXUH 1IL1B 1U3ZA 1XAUA 1DN2A 3TYFB 3WJLC 2YA1A 1OAKH 5FK9A 4YHPA 1JUFB 3MBXL 1IC5L 5E8PB 4QHLB 4AEIL 1YEKH 1FG2A 2KL6A 4CW1B 2OMNA 4GS7C 2E7CA 2A6JA 5HYEA 2G5BA 3WO4C 4D0DA 4G9FA 3VDCA 1NL0L 1RUKL 4Q9QL 3SGKA 5I1KL 3K1KC 4JB9H 5JHDD 2RCSH 3FQUA 3K4DA 3V7AG 3EOAB 4ELKB 2UY6A 2I9TA 4RGOH 2CRMA 3UROR 3EFFB 3RY6C 3O3UN 4YAQB 4NZTH 1XR9B 1K2DA 1MAKA 3FB6A 1MJ7H 3Q2CA 5E4IA 3IXAB 3VH8A 2YEZA 3D2UB 4HK3N 4WHCA 4ZFZB 3RAJL 3QWRD 1S7SB 4U1NA 2F5AH 1UB5A 1I3RB 3IDNA 4XBPB 4U1MA 5BS0D 4HZLB 2BNRE 3UPRA 3PL6C 4ORGB 4GSDH 5I1DA 3UXFA 3G6JB 2JJTC 3HMXA 1A6ZB 2ITCA 2Z92B 3ULVH 1MFDL 1TZHA 3C6LC 3FTGA 3NGBB 2X1QA 5IKCA 2I07B 1HI6B 4LLAA 2IAMC 5C09A 4P2OA 4NIKB 2I5YH 1FHGA 4GKNB 5F89B 5A40E 1BBDL 5C09E 2Y4SA 3BJ91 4HIJB 1PY9A 2EH7L 2F8OA 1RURH 3MLVL 4UAOB 3VGEA 4GUPB 2HT3D 4ELMB 4YDVB 2UUDK 4L4TD 1PZ5A 1T7VA 4HDIB 8CGTA 4POZD 1E6JL 1JNNL 2XG5A 2C4XA 5F3HA 5JHDB 2Q6WA 5IG7A 4OZFH 1S7TA 5GRYA 2G5BB 4YDIH 2R69H 4OCRL 1T3FA 4PJIA 1U8IB 1ZVHA 4LF3A 1SJHA 2OSLA 3P4NB 5C7XH 1KENL 4P2QD 3AXLA 3PWUB 3QJFB 3EBAA 4EI6A 3BKCH 4H20H 5DFWH 2PXYD 3QIBD 2CK0H 2FL5B 4OD1L 2CO7B 5LVEA 2RGSA 4BH7B 5DO2C 1I7UB 1VKXA 5F9AC 4U49A 1JTOA 3ARTA 4JREC 1WC7B 5D5MB 2AJXH 3UBXA 2I5YL 4EUPB 3RVXC 1YYML 5J56B 2XZQL 3VDBA 3TO2A 4HIEB 3TPKA 4XP4L 3ME0A 5K59E 3OR6A 5C09D 3SGEH 2V17L 1WFTA 1UC6A 4FQIH 5KSAD 3BZ4B 3WS3A 1UACL 1I4FA 2A1WH 1UJ3A 1Z9SA 3TA3B 4I0PC 5KSAA 1XGRA 1WLHA 1XGUA 5FO7B 3QWOB 1E6JH 4JFDB 2XKNA 3BKML 3ELAT 5IMOB 1MFNA 3VWKD 3WIHL 3MV9B 4PJ7B 4I18A 1F4YL 5LJYH 3EYOA 4NPYA 1HEZB 4S2SA 3KPNA 3ZL4H 5E4EB 2FYYB 4KROD 4UNTA 4Y2DB 4XPBH 2HVJB 3QNXA 4KJYA 2IPUK 1U8QA 3B5TA 2DQTL 4NDMB 4AIXA 3Q3GA 4F7PA 1W0WB 4LLDB 5BVPL 3PQYE 2MQ3A 3VWJA 2PXYA 1A14H 3OJDA 1IEAB 3GMRB 3GI9L 3MTRA 3KPSE 4FFYH 3IB4A 1RIUH 3C5ZA 4KRNA 1KBGL 4L4TA 4FQJH 4XWGL 2R9HD 2YBRB 3H9SE 1EFXA 1AR1C 4WW2F 2HTKC 4WFGD 3OAYH 3W0WB 5EIQA 3WL9A 1HH6B 4H1LB 3QUYB 1DQTA 1QUNA 3HE6C 1IGJA 1AJ7L 2QQLH 3TNMB 1R3JB 3NCJH 5CCKH 1G1YA 3BX7C 1V5JA 5IBTL 4WRLA 3PWPD 4GXUM 3ZDYE 2QSQA 3MLZH 3UZQA 3GBLA 4MB3A 1TPXB 3VWKA 3RY5A 3FO0L 3Q6GH 1NGXA 3WUZA 4EOWH 5GRVL 1R3IH 3KXFA 2ICCA 5KG9A 3AS0A 2QBWA 1CU4L 5CJQH 3CH1B 2B4CL 1HNFA 4N0CC 5E00A 4KUZH 4U6HA 4IMKA 1OL0A 2FIKB 4DZBA 4AMKL 3DTXB 4QXGH 4OZ4B 1LMKA 4Y19D 5DD6A 2AJVL 3MRRB 1X6NA 5HI4D 1FN4A 2VR4A 4I5BA 4LHUB 1R24B 4CAGA 1EJ6A 3DV6A 4MMZC 3LIZH 1QZ1A 1J0HA 1T04B 5F1SA 3H42L 3MRMB 4I2XB 4PRBA 1OW0A 2VLRE 3OAUL 4ONGH 1TIUA 5F9JA 4XNMB 4PG2A 3E2HC 3GRWL 5C2BH 5KSBB 5JHLH 2X4SA 2OXHA 1IC4L 2GTWA 1DQJA 3LPWA 4GFTB 1FCGA 3PWPE 4TVSa 2EIDA 2XWBB 4LSSH 4P9HH 4LLMB 4EDWL 1S9XA 3MRIA 4LAQH 4N0CD 3U9PH 1XF5B 4U1JA 5CHNA 2AEWA 5BZWA 5EUOB 3V0VA 5I18L 4G9FD 1QO3B 1EZVY 4KUZL 2W59A 3L6FB 5SX5K 5SWZA 2CO6B 3MJ7A 3U7YL 2FO1A 1ZGLM 3RDTD 2ZUQC 5I1LB 5D7LD 1F42A 1EAPB 1BD2B 4X7SL 4X9BA 3D39B 1JZ3A 3LY6A 4G42A 4TPRH 2EZ0C 1OP5H 3V7MA 3BGFC 5D2LA 4OGAC 1PKQB 1LO4H 4X6CF 3AUVA 3G6AA 1BPVA 5BJTB 4NC1C 1YEIH 1ZS8B 3EO0B 1A6AB 5A3ID 3H3BC 1JNHA 1L9MA 1G9MC 2NNAA 3PNWA 1C5CH 4XRCA 1FV1A 1JL8A 4KRPB 1JRHH 3HG1B 3C60D 4EEEA 5KSAB 1B4JH 4FQCH 3RDTB 4JO4H 4LCCA 3LKPA 4UTBH 4NC1E 5E9DD 3STLA 3BESR 3HC3H 2DL9A 3LVEA 1TJGH 2KBGA 3O4LD 3VFWA 4OD3H 3BMVA 2DLEA 2X40A 3KPOB 3S3JA 1ZOXA 1TCRB 1RUQH 1I7UA 4OI7A 4N9OB 1KJ2B 4Q0XH 1LE5A 2P8PA 1HYSC 3LEVL 3ULUD 3GB7B 3NVQA 2WAHA 3WJJA 5HGHB 5SWZE 1HHHB 4YPGA 4OIIL 1ZVSB 5DRZB 5DD0L 4WTZA 5I16A 2Z31C 3KXFE 2FWOA 2P5EB 3GSOA 3EJJX 4KXZI 4W4NA 3MFFB 5C3LD 1J10A 3EUUA 4QYOA 3T3ME 2QQNL 4XC3H 3RUGE 4Q6IB 1SBBA 3MLWH 4ODUA 3SDAA 4I3RH 3UTPE 1ORQA 2IQ9H 3CDCA 4Q2ZA 3HPJB 5F6HI 3BKJL 1FFQA 2PCPB 4P57A 4PG2C 3RHWF 4U1LA 2FX8L 1YMMD 2EEDA 2ICWI 4LOUC 3IDIB 3GBNH 2Z91B 4NJAH 2JIXB 1I1RA 1A9EB 1GJIA 3H9SA 4RZCA 4OLUL 5FYJD 5D5MF 4XNUL 1BIIB 4OCSH 2C7UA 2BOCA 2CPCA 2M1KA 4JO3L 5IESH 2X1XR 1T22A 3THMH 4IRZL 2BDNL 3ARDD 5E6IA 5B3JE 2KUTA 1I3GL 4PG9B 3X14A 1PEZA 4LCUA 4OCRH 4HV8A 2LFGA 1KTLB 5FDYA 4N90E 3WEXB 1DBMH 4F58H 1WQVT 3O3EB 2WANA 4MA8L 4OQTL 4OZGE 5CZXC 1DE4A 5IROC 1K4CA 4OLXH 1FVDA 1TETH 2FWOB 4HKZB 4KGJA 5HHNB 3RWIB 4Z76A 4ZS7L 4JPVL 2B1HL 3BKJH 5FUOH 3WUWB 5D2LE 4LSRL 1RZGA 4CADA 1FJ1A 5FAAA 1VGKA 4NBZB 4NJAL 3EFFA 4M6AA 3ARUA 4U0RC 5CWSA 3HFMH 4QRPA 4OF8A 4K9EH 4XNUH 3MODL 1G9MH 4HWBL 5F1NB 5E2TL 4MQXD 3ROOA 4EUPG 1GXEA 3UBXG 1JPTL 3BQUD 3MUHL 1JPSL 3VFOB 4J8RA 3QG7L 2VH5L 2BOBB 3QUZD 1EGJH 3KLAB 1JCKA 2R4SL 4V2BA 5JZ7C 3EJZD 4M8QB 3E8UH 3E6FB 2IEPA 4KK9D 3SOBH 1QKZH 3NFNB 4N0RA 2AQ3A 5EZJA 1MHEB 2PW1B 12E8L 5HDBF 3QUXB 1BFOA 1NGPL 4IOIA 3UTSD 4X99A 2UWEB 2K3TA 3G5ZA 3HE7A 4MWFB 2DM2A 1KLUB 3JTSB 4NO0A 4S1SL 1WF5A 3P4OB 4I0KA 3NIFE 1JGVH 1KC5L 4JY4B 5A2JH 2X89A 4Y4HD 1T0MA 1TJHL 3QA3B 1N64H 5D7JA 3VFUA 4YQXH 3QQ3B 4QXWA 4PJXA 1JYWA 1INDL 4PY7A 4P5MA 2P42B 3FFDB 1AFVH 4LCYA 5ESQB 5IT2L 2WP3T 4DGVH 3QDJA 2GSIB 1S9XB 3K46A 4P5KB 4H25B 3WFCL 2HJLA 1YMHB 1B0GB 2VDMH 3LRHA 3P9MA 2FECI 2VABB 3RVVD 3RJDA 5CCKL 3ARDC 4GRLB 3SGDH 4YBQC 1JZ6A 3O3BB 1L6ZA 4H8WC 1AH1A 4G6MH 2JIXD 5CEZE 4HUXB 3I75B 3WBDA 1A1NA 3GHEH 4WNQA 1S78D 4BFIA 3DI2B 2IPUG 3T08A 4ODTH 4ZNEA 4J8RB 1LGVA 4BK4A 3BMWA 1W72A 3KYMA 3QSKB 1BOYA 4ZFFB 2DF3A 1CIUA 3O45B 1UWXK 4RRPG 1BX2B 1YDPB 1I7ZA 5DC9B 5I30L 3TT1H 1GVIA 1JGVL 1KC5H 1Q72L 2BVEA 2Q76A 3IS0X 4LEOB 3BPNC 4JO1H 1CZ8L 3ARBB 3KR3H 3SKNB 3TN0C 2VE6A 2W92A 3DX7B 4NRXB 1NFIA 5DEZA 2BSED 2Q86A 5HI5D 2EE3A 2R2EA 3KYNA 3GSVB 5LGJB 4NCC2 3H3KA 3QIUC 4IOFC 1CDGA 1HZHH 3TO4D 3NPSB 4QHKJ 4I4WB 4PGEB 5EG6C 4D0BA 4YHIB 5DK2B 1R5WA 5GQBA 4MXQC 3DWTA 1EHXA 1MFDH 1HYSD 1H3GA 3F7VA 5KVGH 3U2SB 4XMLH 1JI1A 2XOTA 4BSVA 5HYJA 3GEWB 1NUDA 4MCZA 3WHXA 3FT2B 3H0TA 1Z9LA 5ADOH 3NH7H 1IGJB 2W65A 1E28A 3U4AA 1BBDH 3ULVC 1VEOA 5BW7C 1A6UL 1SYVA 5INCB 3GKWL 1KIQB 2YUWA 4JZJB 4GW5A 1J1OL 1MVFA 4X7TB 4R2GD 4RFNB 3CK0H 1IRAY 5DSCA 3RGVD 2YPKA 5F1IA 2YSSA 3TBVB 3PXJA 4J3XA 4IM8A 5KSBF 4KJYB 4DUWA 3BT2L 2VLRD 1U8KA 1P69B 4MD4A 4WEBL 5EB9A 3UPAA 5ITFB 2AV7A 1HXYB 3UTQB 4KAQL 2CK0L 3ARVA 1BFTA 4EN3A 3MV9A 3FB7A 3QJHA 1UACH 3BZFA 4OBRA 3LQAL 5B8CA 5TQ0H 2R4RH 5A43C 2YSSB 3E2HB 2AJXL 1AKJA 3O9WC 3CCHB 3SBWC 4KKLD 5HYIA 4NQVB 5D72L 4CNIA 1KCRH 2XN9E 5T1DL 2AKRB 4NM4L 1L9NA 1ULVA 2D7PA 1NBYA 4MJIE 4ZPTA 1IEHA 1ADQA 2WP3O 4RAUB 2J8UB 3C5SA 5F7DA 1DLFH 1BZ9B 4V2CB 5IVXF 5GIRB 4PJ8A 5I19L 4FFZL 3JV4A 4MCZB 5AAMA 1P4LB 3L95B 3PGCA 4J1UB 3VGGA 4PJCB 3QZWB 2BSTA 4NCDA 1T89C 1T66D 5I9QC 3OAYK 3LN4A 3OPZH 1CD9B 2GIYA 4HBQA 4XC3L 4OB5L 1KCVL 3FAWA 2OCFD 4O2FB 3JWOC 3KLHC 5HI4C 4KAQH 3SJVD 5HGAA 1TPXC 1SJHB 3P4NA 3MRQA 5EPMB 2AAVA 3R06A 3MOBH 4KRPC 1J7VR 5IW1B 1TNMA 5DMKA 3MNWA 4HS3B 3U36A 1MNUH 4PGJA 9CGTA 4L4JA 5HVHB 3S5LG 5A16A 3MRDB 2CRIA 2XQYG 3D39A 2ZNXA 5I1EL 5GGTA 4NGHH 4O2CA 5D1ZD 2YHGA 4N5EC 5GZOD 2X4RA 3QO1B 1VB9A 3L6FA 3QFJE 1QSVA 4ODHL 4OZHF 5I8EA 1SJXA 2NXYD 2AK1H 2HT2C 3MCLL 1FFOB 1ETZB 4LKCB 2FJFA 5GGRY 4PBWD 1H0DB 4LARH 1X4XA 3RVUC 2EDYA 1EHLH 5FO9A 4UOW1 3BEVB 4GRLA 4XMKH 1S8DA 5MERB 4EUPH 4OFDA 4NN5C 3E3QC 4OB5H 4M5YH 3S37X 4PRBB 2AJVH 4PJ8D 2QSTA 1PLGL 1B6DA 1YY9D 3NA9H 4PREA 2CKNA 3WLBA 2NW2B 1EMTL 1R5WB 3VWJD 4UB0L 1PX3A 5CLWA 2Z4QA 5ANMB 3GMOB 4K07A 5EU5A 2FH8A 1G7IA 3MODH 3ZHKA 3IXAA 2VIRB 3GMMB 4NRXA 5C2BL 3OGOE 4YAQA 5HYSA 4U7MA 4AK1A 4OUOA 4JRXE 1PYWB 1N59A 5EZJB 4IDJL 3L3IA 2F58L 1CK0L 4OSUH 3ZTJG 3QDJE 5DT1H 5C0IA 3VI4F 4O9HL 3TBYA 3VFGH 5T3XD 2Z31A 4PRIB 5KSBE 5D9SA 4KROB 2EDWA 5ADPH 4JHWH 4F33B 3HE6A 4IRSB 4HUXA 4V1DB 5FA4B 1TVHA 4X7DC 4XB7A 4I2XE 1GZQB 5GZND 3EW3B 3MBXH 4ZG1A 1XZ0B 1NGWB 2W0FA 4UUJA 4B0MM 5ISZB 2B20A 1MFBL 4QRRD 4ELMF 4U1SB 4HIIB 4ZD3L 4MJ2A 4Y5XA 4MS8D 1IGCL 3VG0L 3X3GL 5JR1L 2OI9B 1T21B 5BOZG 4U7KA 5ALBL 4X6CB 4XP5L 7CGTA 5KVMC 2Z4QB 1CLYH 1VFBA 3L5XH 1E4WH 5HGBA 3T09A 2HVJA 4X80H 4P4KC 1Y18A 1LP9F 5E8NA 3BP5A 3MLXH 4W70A 1CFTB 2W1NA 4DCQB 3UZVB 1QA9B 2OXGA 4IOIB 3WXVL 3VFGL 4OZFB 3ET9F 1Y0LB 1U3YA 2F53B 2X1OA 2EKJA 3KJ4B 4Z7NE 2FRGP 3SKOB 1SQ2N 3P0GB 3VRLE 3UDWC 1EFQA 5F97E 4JFQB 2OI9C 3QFJD 5J1SC 2I9LB 1A1OA 2DS4A 4OIIH 3V6ZB 3TA3A 1QD0A 2VWEE 1NCAH 4G6KH 3H9SB 4JFEE 2Y6SC 3T2QA 1JNJA 1I1FA 1N5YH 3ILQD 2WWMD 5D1ZC 3BW9B 3V8OA 2IQAA 5T1MB 1YC8A 1TJIL 1JF6A 4PGDA 4UV4L 5GGUA 5FUCE 2FECL 3P2TA 3TYGL 3MRDA 4ODUB 3SDAB 3RZWA 4OCXL 2VDNL 1RMFL 5DD5H 2X44D 3E3QE 1WCBB 2BVPB 4LLUB 1FZJA 2NY6B 1DL7H 3PDOA 4MXVF 1WISA 1GOGA 3QCUH 4O2FA 1XF3B 1HQ4B 3MRBB 4D8PB 2A9NH 1ED3A 5JDJA 4PJIB 4ZUVA 1N26A 2VDOH 2H6PA 4IJ3C 3C60C 1EEQA 1LK3L 3U4EB 4HG4K 4J6RL 3SE3A 3QRFM 5IB3A 4OKVA 1S7RA 3JV4B 1QPXA 25C8L 4PS4H 3WKMH 4O4YL 2IPTL 4APQA 5E2UL 1HK6A 4PG9A 1DBJH 3SDCC 4AEEA 5GS0H 2V2TB 4JO3H 3G5VB 5FO8A 5CIPH 4JANA 1BF8A 2LAGB 1YPZF 3TM6A 5C0RH 4LVNC 2E9BA 4HF5H 4KK8D 1UWXH 4C4KO 4K3EL 4NN5B 3JWDC 4JFFD 4Y1AE 4YUEL 3BIAX 3MRLA 1MFEH 5EBGA 4H0GA 1G7HA 4DOHB 3FTGB 4G6JL 1A1MA 2E7MA 2A1WL 1YJDH 1A6ZA 1WCQA 1M6OB 1IC1A 3ECBB 1S9YB 4MQ7A 3QCTH 2EECA 3WFEH 3C6SB 1JGDB 3BPLB 4HX1B 3SKMB 4XI5C 5C0JA 4JDVB 3UMTA 5DUPH 5INDB 1I9RH 1OM3L 1U3HB 1BREA 2VB5A 3FQRA 1R3KA 1L7IL 1K2DB 3MGTA 4W6WB 5D96B 3ZO0A 3NGBC 4WU7B 5I19H 5F71A 1MCJA 3FRUA 5B4MC 4PJ5B 5JW5A 3GSWA 4JKLA 3IDYC 3S3SA 2EE2A 4QRSA 4N8VG 4L8DB 2P5ED 1NCBL 4GW4A 1FNFA 3MO1A 4HUUB 2IFFH 3S36X 1FZOA 1TJHH 3BN9C 3VI3E 2W07A 3ARQA 2VXTH 1RZJL 4Y8DC 2AJZB 1QLRB 4LCWD 4RA0C 1VPOH 3DIFB 4P5TD 1MF2L 4M1DL 3N1PC 3CC5A 5L8KB 3ARYA 4ZTPH 4L4VD 3MRNB 5CD5C 5DHVB 1JYNA 2J4WH 1P7QD 1OTUD 3BH9A 1U92B 2CR6A 4X5LA 1HHJB 1JYXA 1FLRL 1KXQE 2ID5A 3EYUH 4WFFD 3RRQA 1CGUA 5DJ0B 3MCLH 3MLYH 1ONQB 3RZCA 5I1LA 2QADC 2VDML 5DVMA 2HJKB 5L6YL 2DIAA 5D1XC 2OJEB 1FFNB 4Y4FD 3S96B 1S78C 1NMBH 1MCCA 5ISZD 4M5YL 3ILPB 4HGWB 2IFFL 4JKWA 3CNKA 2DI7A 4WO4C 4Z7UA 4DN3L 3WL9B 3IFPB 1NAML 5J3HC 5IMMA 1K5NB 2A74B 2YN5A 3OGCB 2DM7A 3NZ8A 1U8OA 4KZDH 1U8MA 1XCQB 4OGYH 4QWWC 2KPNA 1U8LB 2MKWA 5I8EB 3CLFH 2YD9A 2G5RA 4R0LB 1MRFH 4MCYB 3VGAB 4OCMC 5LXGL 5JW4N 1A2YA 2HJFA 5I1IL 2EDBA 3GJFA 1T0MB 1N6QH 2IH1A 2JJWA 5C1MB 4JFZL 3UP1A 5EDXA 3NH7L 3SDYH 4YR6B 5L6YH 1JK8B 2WUCL 4NZUL 4JDTL 3RA7H 3RBSA 4TPRL 35C8L 4EJ1C 1X5AA 4IRJC 4DCQA 3VGHA 2XWJB 1JPFA 4U1KB 4X9HA 4LPWA 5LG1A 5GS1A 4F2MA 5C3TA 4N8VB 3QB7C 3QHZL 1HH9B 3BO8A 4M43L 2NX5E 1UJ3B 2H2SD 2APWA 3PGCB 2OTWA 1NMAL 3I9GH 4G80B 3BQUC 3V0AC 5I17B 4XZUB 4XX1E 1RIHL 1AO7A 4ZS6C 1B2WH 1B4JL 4EUPA 1QLEL 1MFAH 1V7MH 4UIKL 2BNUB 4FZEL 2F8VA 1EAJA 4XBEH 3C5ZB 3FRPG 5KVFH 3H9YA 4WFGE 1IAIL 2CLRA 5IFHH 1BGXL 3V8CA 4K3JH 4OD3L 1M71A 2C1PA 4KMTL 3U4BL 4FFWD 4DTGH 5HPMA 3AS1A 2X2YA 5F8QC 1ITCA 4G6AD 1S7XB 2V5YA 4CVZA 4PRPB 4Z7OE 3JWDL 5C9JA 1KUMA 1SVZA 3W0WD 4Z8FH 1G6RA 3GIZL 5LCVL 1FZKA 4OLVH 5D93C 4WUUE 3BPCB 5I66B 4NPYB 3GJEA 1JGLH 3P9LB 3FOMA 4YHOH 4IMLB 4J7RA 1JGUH 5GGTL 4Z7WB 1KF9B 3I3EA 1MCWW 1I9JL 2YPVH 5IFAH 1OAZH 3QQ4B 2R8SL 1DUYA 1CL7L 2PNDA 1DQLH 2NXZD 1PSKH 3S36H 1XGRB 1ZLUH 5B39B 1UZ6F 2P8LB 4GG6E 3BP4B 1MHHB 4QCIB 1U8HA 1QVOA 3G08B 4Y1AB 1Y6NR 4PREB 4J3OC 1NCWH 3NCYP 3ZDZF 5HHOE 4IRJD 3WNKA 3Q5YA 1ZSDB 3R8BB 1E6OL 4K2UH 4A6YB 3QR2A 2YR3A 4YK4C 5TGBB 5IVOA 5I1CL 1H3PL 2ZCHL 5IWLC 5MERA 3MZTA 3VH8G 1I85C 4HMDA 4ISVB 2CKBB 4XCCL 2YWYA 1HDMB 4HJJH 3WD5L 4HW6A 2AJUL 3GSQB 5DJAA 1YNLL 4YXKL 2IPTH 1QRNB 2ATKB 1JJUA 4G9FE 8FABA 3Q1SL 1CTOA 1OAZL 1LE5B 1FZMA 4XHJD 3K8MA 2MOVA 4H8WH 3B43A 3VFTA 2GQHA 2AW2A 5LGKA 1JRHI 2DQDL 3LMJH 3X3FH 5IK3B 5A2IH 2VN4A 4GXUN 1XH3B 3FAXA 3MRQB 1ZLWK 2AEPL 4HUVA 1UM6L 1TVBA 2OMBA 3MV7E 1OD7A 4BFGA 5L88H 3MRJA 5DJCB 2CIIB 2HH0H 5DVOA 5CBEB 3OTTA 4Y16D 1DP0A 4NNPH 2K9UA 4JPWL 1IL1A 4IEFB 4Y5VC 1MCEA 5TGBA 4XPFL 4XCCH 3VXUE 2CKBH 2DLFH 2EDKA 4LU5H 3GI8L 3O8XD 2HA1A 4HZLA 5JTWA 3AMLA 2CDFB 4Y4KA 4KK5D 3TZVA 5CEXB 4NQEA 2EDLA 4QHNB 3IJHA 1AO7D 2VLKD 3V4VL 1A6TB 4NQVA 1PQZA 5M94B 4ODSH 3FB5A 1IE5A 4O5LH 3U79A 3CXHK 4HS6B 4RDQG 3VMOA 4R4BA 4XP6L 3HUJA 5EC1A 1LE9B 1NCBH 4IHOA 3EDEA 3S97C 4U1SA 3S3PA 4A2LA 1DQDH 1V8HA 5H35A 1OAYL 2NQCA 2XZCH 4HFUH 3UJIH 5L88L 3MYJB 1VFMA 5SWSE 1KEGH 3MRKA 4K7FB 5FECB 4POUB 4HXBH 2BCKA 4D0DB 5FHAH 3UTZA 5DYOB 4PJ5D 1CGWA 4X4XA 1GGIL 1G7HB 1IGYA 3CMGA 5FYLL 2F19L 3Q0HA 1GAFL 3N0PB 2WIMA 4JZJA 1TITA 5DS8A 4MJ6A 1CT8B 3GSNL 1QFUL 4OLZL 3RP1A 1F4AA 4JPIA 3K80A 5JQ6L 2C4FT 4P2OD 4K71B 3ARFA 5E7BA 4JANB 4MNGE 3S88H 1QACA 1DCLA 4P2QE 5I17A 4JRXB 4Z76B 1MHCB 3K0WA 2FZ3B 4U7SA 5C8JA 4BUGA 1NMBL 1CZ8H 2G9HA 2AS5M 1GHFH 1HXMA 4PGCA 5C0BD 4YDJA 3O6KL 3VXRE 2D3VA 4UV4H 1CFSA 3IFNH 1KN2L 3IAPA 3DHJA 4NOBA 1CGYA 3DYPA 4MLIA 5EO1A 1T2JA 4JHBA 2C7UB 2VTFA 1UXWA 4GAJL 1YEJH 2P24A 3RNQB 3RWHA 3GMNB 4X4XB 4JQIH 5DD5L 2EIZA 2WUCH 5BRZE 4F7PB 2WMPA 1NFDB 4DVRH 3L3OA 4RFOH 4OF7A 3CMOL 1CE6B 4F9LC 3GHBL 3TBTB 4RMUA 1CS6A 3U36B 4Q6YA 5HI3D 1MLBB 5E2WL 2AI0H 1B3JA 3T4AA 1BFVL 5JXAL 5E24E 1T7WA 3R06B 3S37H 1MAMH 4X0KB 2P5EA 3GSOB 1FIGL 3AREA 1UJ3C 4R8WL 6FABH 1H3TA 2QL1A 5SX4H 3CVHH 4YPGB 4YDJB 3HZYA 1ZT7B 4GQPH 1DBJL 4KKLC 5FYLE 2GK0B 3ARGC 3O6FD 4IBLT 1QLEH 3QFDB 4A2MA 5LKNA 2FGZA 3B6SB 3RPKA 5BCAA 2R4RL 5ICZB 2PYEA 5B3JF 1ZTXH 3SO5A 3PHOB 3C8KB 3S7GA 3ARDA 1EEZA 1YEEH 4JM2B 4NFCA 2UYLA 3LKOB 4TQEL 3QQ9C 4PP2A 4PTUB 3LEYH 4H88L 4O2EB 4JN2B 4ZUUA 3HZVB 5BRZA 4FXKB 2V17H 1LD9B 3JWDH 3UAJD 1Z9OA 3DGGB 2AEQL 5KW9H 1P84J 5HYSG 5LWYH 3WFEL 3KLAA 3OSKA 1KCSL 4PRHE 2HRLA 5D9SB 1DEEB 2C1OB 5HVHC 4L9LA 4JZOB 4PGBB 5C0CA 3GO1H 2BP3A 4P5TB 5L2KE 4OZIF 3AGVA 3TBWB 2VERN 1RZ8B 2Q6WB 4Y19E 4P9HC 1KCVH 5FYJU 1WIPA 1H3XA 2KZ1B 4KMLB 3GSWB 3QHFL 1G6VK 5K9QI 1FSKB 4RMSA 5C0GA 1WGOA 3MOBL 4CKVX 4UINL 3WIIL 1OGTB 3TBVA 3MREB 5LBSH 3CX5K 5HD8D 2VSDA 3BD4A 1EUUA 4JKKA 3DUUA 2W60B 4KKBD 5EOQH 1OGAA 4NUJB 5JDSB 3FT3B 3D85A 3D0LB 3C8HA 1U36A 3ARGD 2XTJD 3IYLW 1I3VA 1T1YA 4J4PD 1NSNH 5TE6H 3C87A 3U30C 4ZMAT 1X5LA 5D1QC 4XNZC 3B2UC 1T0PB 4MQTB 3TLRA 4PJCF 5E2JA 1MEXH 2IH3B 3NCBB 2E7BA 1T22B 1FPTL 1MCDA 5ICYA 3V4PH 1TVDA 4ONOA 2BOCB 3IDNB 3LV3B 4XBPA 1KJMA 4LHUA 1QSFA 5CINL 3MJ6A 3EYQD 4FQXD 4U1NB 3VXPA 3RWFA 4MJ5B 3CX5J 5DD6B 3WKNA 4UU9A 2EDTA 3HZMA 5D70L 1AGFB 5CJQL 2YPLD 1M7IA 4ZNCD 2CJUH 3ARED 4QEGA 4YFLF 4D9QD 3LS4L 3EDFA 5IOPB 4RGMB 1H15A 2BMKA 1ZLSH 4G9FB 1G7PA 4OGYL 4FQPA 5C9JB 2YRPA 2OJZH 2LABA 2P5WB 4CVZB 4DN3H 2F53D 4L3EB 3MRBA 4X8XA 5DJAB 3AAZA 3GNMH 2BZDA 2Y5TB 4XCEB 3DMMD 5I8KL 4LQFL 5M7QA 2JELH 1QLFA 4PBXA 3PDDA 1X5ZA 1MCOH 2IWGA 3P0YH 2E5EA 3ZTNH 4J1UA 2NY0B 3OQ3B 3FRPA 3QXDB 1AY1H 4JN1H 4ACPA 5JHLL 1YMHA 3T0ED 3DUHA 1HYRC 5T1MA 1YEHH 4KRPD 4D9LH 1MIEH 5ESQA 4P9HL 4UILL 3PV6B 4NWTH 4N1EA 3VXTA 3MC0A 2P8LA 4KDTC 4H26B 1CG9A 3T2PA 1NMAH 4EQ3A 4PYHA 5JR1H 2P7TB 4ZOAA 5I1AA 4G7VL 2H32B 3N85H 2CR3A 4NQSA 1MCHA 3LPFA 3RX8A 1T7YA 3SGDI 3K8KA 1LO2H 3VXUD 2IALB 1MFAL 1V7ML 2BHUA 4P3CH 3NFNA 1A3QA 4XBEL 3LN5B 4PUBH 4FNLL 4G9DA 5I0ZA 4XAWL 2F19H 3L3OB 5HHMD 3WXVH 1MCOL 3AC0A 4TUJA 3U7YH 3S4SG 3JTTA 1BQLH 2F5AL 3OF6A 3L5JA 4GG8B 4M7ZB 4I8DA 1U8LA 1ZXQA 5DZLA 1IBGH 4GO6B 1Q9LA 2RAMA 1U8OB 3HNVL 1BGXH 4FQLL 1EFXD 3ESVF 2XWBA 3OAZH 4KK5C 5C6PB 4XMPH 3C5ZD 4YC2B 1N5YL 2VDKL 5HYQA 2NY5H 4GW1B 2AK4B 1A7OH 4Z7QF 2ED9A 2OS7A 1YYLH 3HE6B 3OKLA 4IRSA 5CP3A 5HHNA 3RWIA 5CIPB 3H8NA 4YHMH 4OCWL 1EV2E 4UNVA 3CZJA 3F8UB 1XGQB 1HH9A 3BO8B 4Y16C 4OCXH 3O41B 1U3HD 3WS6A 2EYRA 3VI4E 3BEWB 4G6FB 4NHCH 1T0NA 5IFAL 2DQFA 1U6AL 2VLKA 3BKYH 1CL7H 1FVCB 1C1EH 4NRYA 1SJVA 2G60L 1DUZB 3HR5B 1VA9A 3EGSA 3ULUH 2EE6A 3RX5A 4UOW0 2Q8AH 1AE6L 3SKNA 4ESKA 1YECL 2GJZB 4PJXE 2JCCA 5F6IC 4FQLH 3O6FC 3UYOD 3O4OC 2Z31D 4I3GA 1EGJA 5H94A 3FB8B 4MCYA 1A9EA 5KTEH 1DBBH 1XF2A 1IEBB 2B5IC 5D8JL 2HFEB 3GHBH 5HHMB 1TZIB 3DHMA 3RY6A 2PF6A 4PJHA 4Z7UF 2VOTA 2QQNH 1A7OL 4Z78B 1N3NB 4IRZH 2BCKB 3PHQB 4N1CA 5EN2A 4MB5A 3UEZA 5GS0D 3FN9A 4PJFF 2D0FA 3IDJB 4EVNB 5CZVH 2X4UB 3P0VH 1IKNC 1B0GA 3D18A 2DJ4A 2XNAB 1UB5B 2YPLB 4G8GB 2FEEI 4TSAL 2WQ8A 4ZFZA 5JMOC 2FBJL 43C9A 3M1BB 2HH0L 5CSBA 1SMAA 2CUMA 2EO1A 3O2DL 3UYPA 1UB6A 2O26U 5DEFB 3EOAA 4QO1A 2V2WA 3EFDH 5L7XH 4X5WA 1UM4H 5FYKD 4QTIH 5IW1A 4PTTA 4QGTA 3C9NB 1FCCA 3L9RB 4NQED 2WQRA 2BNQB 4OI9A 4CW1A 4PJ7A 1KCSH 5F6HJ 2XRAL 5EO0A 4MXWH 4QHUB 4JFDA 4TNVF 4Z0BH 1B0WA 1PBYA 1MWAL 2OR9H 4LEXL 3IAQA 5IQ7H 4LVHB 1T83C 1J87A 2NNAB 4XVUD 3LQAC 4OGZA 4HUKB 2BSSA 3PG2A 1QFWH 2H9GA 4Y16A 1F3RB 1J8HA 1PG7H 5GGRB 2D7TH 3T1FB 4OFIA 1FVEB 3AS3A 3TVMB 2RJMA 2MPAH 3VG9B 1VPOL 4Y88A 4YK4B 2AK4D 4W68A 3KNBA 3LD8B 3VXRD 2DN7A 5HTSA 4ZTPL 3SJVA 4BFEA 1FJ1B 4R9HA 5FYKH 3EO1A 2XZCL 3GGWB 5JZ7D 4E41D 2P8MA 3B9KC 4DEPB 5AG9A 1FLRH 4D2NA 5FYLH 1UJTA 2XZAL 5DJDB 1I8MB 4G8GA 1JWSB 2C9AA 4Y4HA 3T2OA 4CUCA 5HHVH 1FZJB 1Z0MA 5FYJE 3JSSA 2X4UA 4HX1A 1G9NL 2B8OT 5EUOE 1KFAL 1MWAB 5C0FA 1G6RL 1YN7B 3VRIA 4M6NH 1KPVA 4L29A 1KN4L 4QHMA 4OQ1A 3QT2A 1HOCA 3CFDB 3TO4B 4JM2D 2YD6A 1B0RB 3CPLA 3GMLB 1XIWA 4M9PA 3TIDB 1R3LB 4X8JB 2X4PB 3NIFF 2E6QA 3IU3A 3IFOB 4ENEC 4GKNA 3DNKA 4YH6A 5CILH 3QUXD 3H42H 3MPCA 3MRRA 4EXPX 2PTTB 3KDMB 5DJZB 4Y5VB 1MRFL 4YHZH 4ZS6D 3KPQA 3ZT6A 4X6DF 4F15B 2AERT 3GRWH 5IF0A 1IMHC 1CFSB 2YMXL 2B2XL 2BNQE 1ORQB 3EOTH 5FEBA 3K4ZA 3T0EB 4LRIA 4P23A 1YEFH 1A9BB 3ROLA 4BSVB 1KYOJ 4LSSL 3HE7C 5D7LB 3IDXH 4WO4D 2XG4A 3BQUB 1ROWA 4N9GA 1YEJL 3BAEL 1T1ZB 4NSKB 4H1LG 1ED3B 1BEYH 1VFBB 4KJQD 2R0WL 4C56D 3C09C 4ZDHA 1JFQH 4P3WA 4E0RB 1BJ8A 3WN5A 5JW3H 1RI8A 4PD4J 4JO1L 4Z7NF 1NUNB 2N7BA 4X6DE 2YPLE 3MRGB 5ADOL 2VUOA 5DJ2B 2CIKA 1QSZA 4NOFA 4PJ9A 1YUHA 4NO0D 4W4OA 3OKNA 1WSST 3LKQB 4HC1L 2XICA 5F6IB 5CD5D 4MXQD 5EORH 3TT3H 2ZUSA 4AQ1B 1FORH 2XTJC 4LLVA 3GRWA 3DX8B 4U6XB 3V6ZA 1LNUB 1Q0YH 4ZAKA 1FIGH 1DZBA 2PUQT 1WEJH 4WTWA 3DSFL 4UT7L 1OVZA 1UKSA 4X6DB 4PRDB 3PNWB 1LO3L 3BT2H 1WBYA 1MOEA 2ZPKH 5ID1A 5CSZA 1UENA 1BIHA 1RZJC 1IFHH 4ODXB 1DDHB 5IMOA 5BJTA 3QI9A 4HK3J 3QXAA 3OG4B 4NO3A 1RZFL 5IW6A 3L7FB 2XQBL 1AC6A 3DX9A 4L4VB 4U6YB 3K2MC 3GJFB 2NYYC 2VN7A 1A2YB 2HJFB 3RPIB 4RMWA 4YO0B 3U48A 2HWZH 1NC4A 2R1YA 4UTAL 1U2HA 4IIQA 1S9WA 3GFUA 3QNYB 1CDYA 2IBBA 5TDOB 1A64A 1M05A 4K7PH 1KPRB 3W5NA 4HHAA 2VISA 1F58L 4V1DE 4EI6B 5E9DA 4OT1H 5D1XB 2W0KA 4EIZC 1RJYA 1JBJA 3W9DB 1I75A 2MHAA 4DAGL 3X17A 3IGAA 1IC7L 2ADGB 1KELH 3AM8A 1NFKA 1OPGL 3UZEA 3NIDE 3MGOA 3SKJL 3Q48A 1JGEA 4DZ8A 5DJ6A 1DVFD 1F11A 4P99A 5C07D 1FZMB 5DMKB 4R7NB 3DTXA 2A77L 3SDDB 2XYCA 4N0YH 2CMRH 2ADIA 2Q8BL 1FPTH 1FDLH 2DQGL 1BQHG 2WUBL 3RWFB 3SDAD 3L3DA 4KDTA 2NZ9C 4NNYB 4ZXBB 3QUZA 3LV3A 4P2RA 2VJXA 3OXRA 1KB9J 3FCTB 1RZKL 2Y06H 3HS0B 5C09B 4DGYH 1P2CB 1VGEH 1BOGA 4J2XA 1J12A 2AEPH 3GBMH 5EBLB 3CFJB 4AT6A 1FZOB 5L2JA 3P0VL 4HV8B 4G3YL 1IZJA 2UY7A 3D9AL 4NCC1 5ALCL 1U0QA 4WFED 3REVB 4AYFA 2WWKT 3QUYA 4DN4L 1S8DB 3PL6A 1FNAA 3JVGA 2FBJH 4ETYA 5ACZA 3UTTE 2QEJA 2FX9L 3G6JE 2GJJA 4XVJL 4YGVB 4ODHH 3V5KB 4M1CC 2QQKL 3QPQC 3O0RL 3TFKC 2R0KL 1MJUH 4HK0A 3QCVL 4OZFG 3DUUB 4PGZA 4UB0H 1D9KA 2P43B 3QDHA 3MUGA 4PJGA 3P3YA 4U6VH 1MAJA 4Q2ZB 1I8LA 5T3ZD 4L29B 3W2DH 4LLYB 4NC2B 1AY1L 4JN1L 5AUMB 3TN0A 5CFHA 1IJ9A 1TZGL 5JW4R 3NZHH 4IS6A 3MROA 5L9DH 3O6FA 3RUGF 1CICD 3QIUA 1YY8A 3DETD 4I18B 3VGBA 2ZSVA 1OAYH 3FN0L 3HNTH 3N1QC 1XGYH 5CJXC 5E95B 3VFRA 4FQXB 4NKIH 2R23A 1KIPB 2CSPA 2CDEB 5IFJA 4Z7QE 2VAJA 5FHAL 5BO1L 1X44A 4YE4H 3MRCA 4DGVL 2Y07L 3KPOA 4NT6A 5FOJA 4JFFA 3AM8C 3QRGL 3PWNB 4ZPVB 5GS0C 1AO7B 4AEFA 3LQMA 2ORBL 2WNGA 4TSCH 5B38G 3W82A 1U91A 4J4PC 3UBXB 4LDOB 1NGZB 2ARJB 2YRZA 4OKVB 4FZ8H 4LSTH 4C58B 4NZJA 3OV6A 5GS3A 2FO4B 3OJ2C 4TUKL 4TTGA 1OARL 1DFBH 2ZKHL 3VU2A 4PUBL 2ZWLT 1ORSA 2RR3A 4X80L 3TEUA 4MNQD 3REWB 2LU7A 1I9EA 1IAOB 1U8IA 3VCLB 4LSDA 5F3HB 5KZCD 4TNWK 4YR6A 2ZSWA 1JZ5A 3CAFA 2ED8A 3O6FB 5C07E 4HIHA 4WEMB 1J88A 3VFNA 4XP9H 3EYFA 5ITFA 5CP7B 4QRRE 3O8XC 5AUMA 3W39B 3IDMB 2R0ZH 2L4OA 3KPTA 4KJQC 3AU1A 1YN6B 5ALBH 4DK6A 2B7DT 3MUGB 3BPOC 4YE4L 1MRCL 4DEPC 3PABB 2BXZA 4Y4KC 1CQYA 3KYMB 4ZFFA 3RGVC 5JORA 4NKDB 4EDXB 4R2GC 4BFIB 3MRPA 2AABL 3OKDB 3QO0A 4OJFL 3ZE0E 4UDUB 3D18B 4R2GB 3MA9H 3JV0A 2NZIA 1G0DA 2J88L 1FH5H 2Q87A 3VG9C 4JB9L 4JDZA 1IGTA 1S3KL 1TZHB 1NGQH 1AP2A 4J3TA 5JIKA 2MWCA 3UTTD 3O8XB 4Z78A 2CH8A 4DVRL 3RDTC 4F7CA 5BV7H 5HYJB 4PRPD 1IEBA 3ZE1E 4P5MB 3BSZH 4WV1B 3T3PE 5IB1A 1WTLA 3FCTA 4YNYB 1MCPL 4OIBA 4PIRF 5FKAB 4YHIA 1CXIA 3RGHA 2X4QB 4I5BB 1HSBA 5DTFB 4JHAH 2NY7H 4XH2B 4R97B 2Y9RT 5DQ9A 2V7HB 1NGYA 5JXEA 1BBJB 1U95A 2MJWA 4Q9RL 5CJOL 5CUSH 4H1LH 5HY9B 4R7NA 4OUUA 3RNKB 1U95B 1K3IA 5GSRA 2HFFB 4U6HB 2VLLB 3HNSH 1RK0B 5E2UH 1QSEB 1AKJD 2LQRA 4WI5A 1BHGA 4R3SB 4M7KL 2V5TA 3JUZA 3LDBC 4ALAH 3OXSA 3QISA 2ICES 1NFDE 4DJMA 2VDOL 3SY0B 4PJFB 3U9UB 1ZHBA 5CZVL 3DO7A 3MO1B 1NCNA 5C0IB 2CRZA 3ROOB 3FHQA 1IGTB 1JZ2A 1YMMB 2ZUVA 3U0PA 4YBQD 5D1ZB 3I6GA 3BH8B 1AQKL 4MDIB 2YD1A 1PYWA 3GSUA 2WWKO 4Z6AT 3OAZK 1MLCA 1U3JA 4JAMA 1QOKA 5K9KA 3FZUC 2WWMC 1ZV5A 2PO6B 5E1HB 5IB4A 2FH6A 4WTZG 4CJ1A 5J57B 3F58H 3U7WL 1IAMA 4RIRA 2NY1D 1IAKA 4F80A 3BWAA 3QNXB 1BVLA 5J6GB 1N0XH 3MX0A 3M17B 1JNLH 4KVNH 4QOKB 2VZ1A 2OP4H 1F58H 4GXVH 4M7LH 4XTRC 3WNPA 4M7LT 4X83A 1CD8A 4EBQH 1LDPH 4P2OC 3R0NA 3MR9A 1KT2B 1PG7L 3AMKA 3NABH 3VFMB 2QHRL 4TOYH 5DMYA 5L8JB 1N6UA 1A7PL 4GRLD 4HUVB 1U8PB 3D6GA 4PRHD 3V52H 5IP4A 1AD0A 5HHVL 5IQ9A 3OKMB 2MCG1 1KB5B 2EC9U 2HT4D 3RVWD 2HKFL 3W9EB 5J1TC 2OL3H 4U1LB 4N0YL 2HFGH 3KYOB 3LKQA 5D5MA 3D25B 3V4UL 5CMAA 2ADJA 5MEPB 4K3DL 5CJ8A 3ULVE 5SWSB 4AL8H 1A7RH 2VWEC 1F3DJ 2HRPL 2NX5D 1S9VB 4LPVA 3WN5B 1WJ3A 4MNHB 4V1DD 5IV2A 1H5BB 1QBLL 4L5FH 3GSQA 5DJXB 5GGQL 5D6DA 4OF5A 1OF2A 1HHHA 1P5VA 3GI9H 1A3LL 1I9IL 4JJHA 4RNRA 4XXCC 5MEND 5TDNB 5JOPE 4OZGB 4M61A 1I8IA 4MAUL 3ETBF 1KNOB 1KCUH 2XPGA 4KTDL 3CSYB 1M7IB 3EOTL 5CKGA 3PXHA 4Z0XA 3TV3H 5L2KB 1FL5B 3HPLB 1HSAB 5J3HD 4M00A 4O58L 1EUTA 3MXWH 5F9WC 3VXNB 1QHPA 4U3XA 1MHHA 5F7WC 1QSFB 2D4FA 2HFGL 4U0QB 4WUUD 5DD1L 5GSVB 4Z18A 3D87B 4RZCB 1MIEL 4YIQB 1DUYB 4YDLC 1YY9C 2Z91A 4AL8L 4EOWL 2CXGA 5E2VL 5I71B 3ULVD 2YZ8A 2F53A 4KHXL 2QADD 1B0RA 3CPLB 3TH2T 3CSYA 4KI5F 1CICC 2HLFD 2VMFA 5DURD 1WZKA 1WIOA 1ZE3C 2ESVA 4NNXB 2AV7B 1PKQA 3ZKSD 4MD4B 3MFFA 2R56H 3IU4L 3CFCH 1PZUB 2IJ0C 2QSCH 1HWHB 1OSZB 5J9PA 2DJSA 1WV7T 3PWLA 1FO0A 1VACB 1H5BA 5SWZB 1N6QL 4MNHA 4I3SL 3V0VB 4NFBA 5B39G 3MREA 3U1SL 1F11B 3AY4C 5D1QA 5T3ZE 1CLCA 1IARB 5ID0A 1RUKH 4Q9QH 1NGWA 5B3NA 2X4SB 1ZAGA 4JQVC 1F6AB 1DFBL 2ZKHH 1XT5A 3HNVH 1FVEA 2ZCLH 1FNHA 2J8UF 1X9QA 1F90H 1WBZA 3VXQB 2Z8WC 3RKPA 4P49A 4NUGL 4M48L 1CTNA 5E9DB 4X4MA 1KACB 4LGPB 3U4BH 5CEYB 1ZT1B 1N59B 3RVVC 4RQQB 1R5IA 4BSWA 3KYNB 3L9RA 4HCRH 5SX5H 2EIEA 2Z35A 4XXDB 5FGCB 4K7PL 2Q1EA 1NGYB 4I3SH 1RMFH 2V2WB 3B6SA 1MJ8H 4WW2B 4HPOH 4NYLA 4X5XA 1IAKB 1BD2E 2AXFA 3OKEB 4PB0H 5ACLA 1MELA 2YS4A 2AVGA 4MDJA 2D7OA 5GGSB 5IJKA 3C2AH 3PWJB 1T5WB 3EOBB 5I0DA 1CD1A 2H26A 5C08B 5JOPD 5HHPA 3WO3B 4FQHB 3HC3L 2DMCA 1MCLA 2VC2H 3WKML 3BEVA 1Q0XL 4PRDA 4Z7UB 3NTCL 5HHXH 3CDGB 1YJDC 5HGGS 1I9JH 3FOLB 3SDCD 1DR9A 3WS6C 2VLRB 4P48A 1K8IA 5J6HA 4H25A 5EU6B 4JZJC 3T4YA 4JFYB 5E99L 3PP3H 1ZWIA 1T04A 1CD1B 5C08A 4LCYB 4TTDC 3OJDB 3OX8B 3I84A 4AJ0A 4HXAH 1IGFH 1W0WA 4LLDA 2XY1A 2YD8A 1DVFC 1QR4A 2DRUA 1AXSB 5DQDH 1G7QB 3Q1SH 1UVQB 1A3RL 3EYSH 3BH9B 3FFCD 4OUUB 5TH2A 3RNKA 1OWWA 2VZTA 1BQHB 1RZKH 1LDSA 2NY2B 2Y06L 4WHYG 4MAYA 2JJSC 1ZK9A 3TPUB 4X9IA 5DJYA 2O5XH 1XF1A 3JV5A 4R96A 4PRNB 4U4BA 1OSPH 1A4JB 3HMWH 4XPHL 2QQKH 1QLRA 4IOSD 1T0NB 1ZANH 2JB5H 3WDJA 3UO1L 1MJUL 2BY0A 3D3VD 3O41A 5EU3A 1NCDH 2NY3D 2V9RA 1P7QB 3DRTA 2OL3B 3O4LE 2FZ3A 5C8JB 3MJGX 2MNUA 5M95B 2FX9H 4J3VA 2HKHL 3HR6A 3VXUB 2V9TA 2WIIA 3VXMB 3QEGL 5MEQA 3MYZA 3OHXB 1WBXB 1I3GH 1JHTA 4XPFH 3MJ9H 3WNMA 3LH2H 4E42A 2O93L 4LU5L 3ZE0F 1R6VA 3TJEH 4FOMA 5SWQA 1VGKB 1DJSA 2R1XB 5GRVK 1RU9L 1RFDH 3H7LA 4XPBL 4NC0B 3BVNB 5I1EH 32C2B 4QRPD 5IVXA 3VFRB 5INDA 2C3WA 4I9WD 3PWVB 4NDMA 1BLNB 4NNPL 5AYQA 1JZ4A 1T3FB 3MLRH 4ZO8A 1NFDF 3FN0H 2Y07H 3HNTL 5E8EA 3R8QA 3QUMH 3VXMD 4NKIL 1B6UA 5KSVB 3NMEA 1S7QA 4MS8C 3P4LA 3FFCA 3I85A 4XPTH 1BF2A 3WFHB 3MLSL 4HIJA 2LV4A 4ODVL 4QF1B 3V52L 3HHRB 1Q9KB 2HKHH 4TUKH 3MRLB 4RBPK 3C2SA 2P8MB 4YIQA 3V4VH 4EI5D 1WFOA 3QEGH 3V7AE 2ZOKB 2XWTA 2NR6C 5IBTH 5MEOB 4PJBF 3V5KA 4Y5YA 4I0PD 4XP6H 4MYWB 1AXTL 1B4RA 4DWHA 2Y5EA 2Q7NA 5CGYC 3TVMA 2VO5A 1HCVA 3DO3A 3RQ3A 3O2VL 1CGTA 2ZNWA 2Z8RA 5KS9B 2XIDA 1WC7A 2ADFH 3QXDA 1PFCA 1Q9WA 5HHOA 3IT8D 1FFRA 1MCFA 4S1SH 4BH7A 3U2SA 4S1QH 2HT4C 1ZGLB 2XXCB 1QLFB 1I8LC 4PJ5E 3C5JA 3T2NH 4Y2DD 3OXRB 4M62H 2R23B 4Z7WE 1OAQL 2NXZC 3BISA 2A83A 1CDJA 1GYAA 5CBAA 1DLHA 5KVEL 5F3BB 2R2EB 2Y72A 4LPXA 4QRUA 4FQ2H 4WY7L 2FGWH 1HILA 4X6EA 3BHBB 1RJZB 4Y0GA 3NAAH 2WM0A 2R0WH 3L5IA 4JG1H 4WUUB 3WSQL 3ES6A 5DJ6B 3LB6D 2I9TB 3VFTB 1YNTA 5AD0B 4WUUA 5D7IF 1I7TA 5ENWA 3L3GB 1S7VA 4FQQA 2EH7H 2EDRA 4EDWH 1QNZH 4TULL 3QZWG 4ZUWA 1HDMA 1NBQA 4M43H 2YXFA 4PRAA 3I75A 4TVPE 1OCWL 2HT2D 3QEUB 4JHAL 1CVSC 4S1RH 1EO5A 3QXWA 5TQ2H 3VI3F 4WI3A 3O2DA 5KJRH 1CXLA 5GJSL 5TDOA 5EWIL 3SGKC 3J8F7 5MENA 1E4JA 1BWWA 4RX4D 4C55A 3I6KB 1ZS8A 5F7KC 5DDHA 4M93C 1P1ZB 5J7CC 4QOKA 5DFTA 2VNCA 3M17A 4PJEE 1WAAF 3O2WL 4Q9RH 2ZUWA 3QQ3A 2ICEA 4KU1A 3BP4A 5SWSD 2XTJE 2X4NB 3CVHL 4ZXBA 3MBEA 1RUPL 4KMTH 4DTGL 2DQCH 4FQ1H 1PEWA 1F4XH 3V0WH 4L4VE 1FLTX 2AJSH 2BSRA 1KTDB 4PJIE 1T21A 4WV1C 4Y2OA 4Z8FL 1T66C 4N8CH 4LVEA 7FABL 4Z7WA 1BM3H 4Y5YC 3H7BA 3L3HB 3HRZB 2ZCLL 3P77B 4LSQL 2E9IA 2VDRH 4G8FB 4NBXB 1CF8L 1H5BC 1A6UH 1KGCD 1XF4A 1RZ8A 4WENB 3MRMA 3ZYJA 4MJ4A 1JHLH 5FF6B 3KPMA 1GGBH 2GW5A 1N2RA 4KQ3H 2FEEL 4JM2F 1ZTXL 1JNLL 4KVNL 4ZTOH 5DK0B 3F58L 2HLFC 4XGZA 4OM0H 5HVWA 3VW3H 1RUPH 1Q9LB 2PO6D 2W9DH 2FNBA 3QHFH 2F53E 2Q7YB 1RAMA 4M3JA 4RGNB 5DUMH 4L8SA 2EYSB 2JK5B 2V7HA 5FCUL 3OB0H 5HXMA 5KW9L 1D5IH 2OR8A 5FHBH 3UJJH 1RUML 3OL2A 4UT6L 4F37K 3MOAL 4WO4B 5T3ZL 2GK0A 1YA5A 2DWDB 3O11A 2ICEB 3NA4A 4JRYD 3ZKNC 4OV5B 1A6VH 3B9VA 4OCSL 5D7LE 1UEMA 3NABL 2WUBH 3QXAB 4BZYA 1R3JA 1IVLA 3T0EE 5A3IC 1R5VA 1QFPA 2OYPA 3MCG1 4XHJC 2BDNH 5CSZB 5E4EC 1SY6A 2DBLH 3MBEC 1FYTE 1M4KA 3INUL 3VD7A 4XHQA 5FO9B 2X9XA 3I3DA 1BAFH 1DBML 1TQBC 5GS2D 2IH1B 1CG9B 2YK1L 3VDAA 4WDIA 3VE0A 3IU3B 3ZLQC 5JORB 1LP9A 2PXYB 5HHQA 4PLNC 1U8MB 2W9DL 1MCNA 3RVXD 4JPWH 4I18C 1KNOA 2YA0A 3DMMA 3ES6B 4K23H 4QXGL 4UBDC 1UWGL 4OLWL 4K7PX 3MNWB 4HS3A 3TV3L 1W8NA 1RY7B 3CVHA 1NUGA 3ZYOA 3CUPB 3ZE2E 1IGMH 4JRYE 3OF6D 3X13A 3PGDA 4BQ6A 1JWSA 4MAUH 4HWBH 2Y1VA 3IDYB 4BQ8A 4F7MA 1TENA 4DW2H 2A73B 1FFNA 4NQCE 3B9KD 3LIZL 5HGHA 5KS9F 1T1ZA 3QG7H 2I27N 4NSKA 4JO2H 2DBLL 4GMSH 2KQNA 5FGCE 1NEZG 4CVXB 4NYLB 1S9KC 3WS3B 1H8SA 3SO3B 2Y23A 2EYSA 2JK5A 4JREB 1NBZA 3VFWB 4HIEA 3ZTNL 5C2UB 3W9EA 3LHPL 3MNZA 5ESVB 4KWUA 1KB5A 4XNYH 3LOWA 3BXNA 5IHBA 3BRGC 5E6YA 4UAOC 4RQQA 5H37G 4MJ5A 4HC1A 2R56L 4MX7A 5DS8B 2X09A 3B5HA 4N0FA 1ZHKB 4C83A 1KB9K 1IQWL 1CICB 3I9GL 5EOTB 4AZ8A 2VLJA 4X8JA 4X7SH 1KT2A 1PW3A 2JELL 4HAGA 3MUJA 5B8CB 3P11H 4RISL 4OCNC 1B2WL 1INDH 5EH1A 1D6EA 4XCYB 3BWUC 3QFJB 1T80A 1LO4L 5LAXA 3ZYZA 3BD3A 3HAEH 1U93B 5JIIA 4G8IA 4YJZL 4FQCL 5HYJD 4DW2L 2IBZY 1AR1D 3MV8E 1LO2L 4N90D 4GUPA 5JXED 4U1HB 5BVJA 4FABL 3AREC 4LBEB 1QR1B 4AH2A 2XFXA 4FNLH 1D5BA 3MLTA 1HHIB 4E5XB 5EIIB 2VR9A 32C2A 2DI9A 2E27H 4UV7L 4HK0B 3GHEL 1WZMA 4KUCD 3EO1B 3MLTB 5J12B 1CE1L 1OGTA 2UZIH 3MUZ1 4G7VH 4OZHA 2BERA 2L7JA 3VXOB 3IDJA 5JIPA 1NKRA 2Q20A 4PJCE 1JGUL 4F9PA 5JW4M 1FL6A 3IFNL 3P4MB 3BRFA 3DYOA 5GJTH 3T2NL 4ZUTA 3V6OA 4AEIH 3DMMC 1ZHBB 5KANI 1Q1JL 3DO7B 5I1DB 3FQXA 2NY5L 1OAQH 4AT6B 4PJHB 2VAAA 3BGMB 1MJJB 5HHME 3LKSB 1NDMA 3L3KB 2AJ3B 2C3VA 1CICA 4P3DA 3QEHA 1NL0H 2ZUYA 1CLYL 3SDXA 2Q3AA 3HTLX 4MNQB 4L3AA 2GJZA 5LGJA 4R7DA 4EI5A 3MLXL 3VH8B 3C9NA 4B50A 4NQEE 1C7SA 4QKXB 2WBJB 4I77L 1EBPA 1CR9H 2FIKA 4DZBB 5J89A 5IBLC 4DKDC 1YNTB 1KCLA 4JQXC 4ELKA 5KAQF 3KVQA 4MA3B 3FQUB 2L7UA 4PB9L 4RFNC 1C12B 3THML 5JXAH 4KKCD 3QIBC 3PQYA 5E5MB 1U3HC 3HC4L 2A6JB 2K1MA 2ZG3A 1JF5A 1ZHLA 1XGQA 3ZMRA 4BH8B 4HJ0D 4WNQB 2DLGA 3TNMA 3AREB 4LLWA 5IESL 1U6AH 1K85A 2BFVL 1LQSR 2AK4E 4NN6C 3UAJC 1Y6KR 5IGXH 4DKEL 5ITBH 3QI9D 3BIBX 4H1LA 2FLRT 4YFLI 2YBRA 2GHWB 3QNYA 4HXAL 1AE6H 3NN8A 5JPMA 5EU4B 4PYGA 2VDNH 2O5XL 4PRIE 5GRUL 3GUTA 3WMSA 1I1FB 3SDDD 4KI5D 3BN9D 3PQYD 5HD8C 5AAWA 1UGNA 5H94B 5E6ZA 4Y5YB 3KHOA 2LU3A 1I3UA 5F70A 3QG6B 1JF1A 5BS0E 1Q9KA 2F9BT 1J0IA 4QNPF 4X99B 1PJ9A 3IKCA 1QSED 3CFBA 5IJKC 2BJML 2EDQA 1JMXA 1MPAH 1QBBA 4M6MH 5ANME 4BJLA 1S7QB 2AJYH 2H32A 4NWUH 2QQQA 2X7LA 2P49B 4JFXA 1WUNT 4K94L 1R0AH 1OAXL 1WZ1H 5EZIH 2R4SH 4HWZB 4HQQL 4MZ2A 4AG4H 2Y36H 3S98A 2L0DA 4GMTL 4YZFF 4XX1G 3OKLB 2JJUA 1EH9A 2NLJB 4BZ1L 4GAYB 4HT1H 3SE3C 1YMME 3U0TA 1NANH 1N64L 3T77B 5K9OA 5JPMB 4LRNH 5AZEH 5DJ2A 5CWSB 5DK0A 3SDCA 5K9OB 5EOCH 1CT8A 3T04D 1LO0L 3ULSB 2XRAH 4PJFE 4PJGE 2EEBA 4K71C 1G7MA 1Z5LB 1A6VL 4KJPC 1QBMH 1FO0B 1VACA 4ZDHB 1RSFA 2IG2H 2Z31B 4TUJB 3PP3K 2DL2A 4M6OH 2P5WE 4OIAA 5GZOC 5EZOH 1CLZL 1QSEE 3Q6FB 3NFSH 4R4NC 1AXTH 1MREH 5I6XC 3O3AA 5H35B 5BZDB 3VA6A 3CFBB 4LRIC 4DUVA 2ADFL 4WWKC 4KPHH 2A6KB 5FYLD 1AI1H 1UVQA 4Q74A 3CXHJ 5ANMA 3UX9B 3N1FC 3KR3L 1KJMB 5I2IB 4MLSA 3IVKA 4RSVA 2AEIT 4WV1A 2FDBP 2Y7QA 5I8KH 1OTSC 2I07A 3IDIA 4S1QL 4FQ2L 4WY7H 2F74B 3Q5OA 2AP2A 1FNGA 5DVLA 3OJVC 3SPVA 4HG4J 2N4IA 4Q6IA 5L0QB 2IANA 1JPGA 3MLZL 2CIIA 4PRAB 2JJVA 1D5XA 5DJXA 5I16B 4NUJA 5AEAA 3BAEH 4FFWC 4EDXA 3S96A 3EJYC 5FV2A 2P5WA 2ICWA 2X4RB 4TNWF 2OJEA 1ES0A 4QRRB 1XFPA 4S1RL 1V7NL 3QIWD 3IU4H 4HS8H 3EO9L 1BZ7A 2VL5A 2AXFB 3OKEA 3AU1B 3GJFH 5GJSH 4WW2A 4X5XB 4DQOH 3K1DA 4JEGB 5IVZB 1HHJA 1U92A