5CF1A

Crystal structure of the m32v/m78v/i80v/l114f mutant of leh
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
139
structure length
139
Chain Sequence
IEQPRWASKDSAAGAASTPDEKIVLEFVDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVVSVDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNFSILGVFQLTEGKITGWRDYFDLREFEEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Crystal Structure of the M32V/M78V/I80V/L114F mutant of LEH
rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 38
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5cf1A00
5TGNA 1NDOB 1GYBA 3KSPA 5G2GA 3UNLA 1K41A 3EN1B 3JUQA 3MKIA 2CHCA 1GY6A 2XR8B 2BMQB 3EBYA 5JPPA 2R4IA 1OHOA 3H3HA 1HKXA 2GEYA 3FLJA 5D82A 2F99A 4XM4A 3RGAA 4J8TA 3DM8A 4XBYA 3F8HA 3MG3A 2YFLB 3CNMA 1E3RA 2B1XB 2GEXA 5AIIA 1OPYA 5AIHA 5EVHA 1STDA 4WP5A 2HMLB 4X2OA 3K0ZA 3KKGA 3B7CA 5KP3A 3OXAA 1W00A 3OWUA 3NUVA 4WWUC 5BXQA 3H51A 3NHXA 3EX9A 1O7HB 4L7KA 4K1VA 4PEJA 1W01A 5AIGA 4LGQA 3S5CA 1GS3A 1GY7A 4HM7B 5CXOA 2BMOB 5IG0A 1OHSA 1TP6A 3G8ZA 2BNGA 1IDPA 2GXFA 3BB9A 1U5OA 3A76A 4X2HA 3NBRA 4HM5B 2PZVA 1EA2A 4H3UA 3FZWA 1NU3A 3GZRA 2QIYA 2F86B 1UUWB 1BUQA 5HGRA 2I9WA 4KVHA 1W6YA 1NWWA 5STDA 2Z76A 3VSYA 2UX0A 2Z77A 3E99A 1VZZA 2HMOB 2B24B 1O7GB 2XSOB 1S5AA 1TUHA 3JUNA 2HMJB 3CNXA 3EC9A 5AEUB 3WMDA 1OGXA 4HM3B 5IF6A 5IERA 3KZTA 3K7CA 4R1KA 1ZX2A 1DMQA 3RGRA 5CLKA 3NV0B 3GZXB 1CQSA 3EF8A 1OGZA 4N3VA 1QMAA 2GBXB 3EJVA 7STDA 2OWPA 4HVNA 1OH0A 3FGYA 1ULIB 1W02A 4FCMA 2A15A 3SEDA 3SOAA 3EBTA 4HM2B 3T8NA 2K54A 1O7NB 2BMRB 1E3VA 1UUVB 4HZ9B 1QJGA 4LMIA 1O7MB 4GB5A 3NV0A 3MG1A 4HM8B 4HM6B 5JPUA 3JUOA 3DZLA 1EG9B 4WYKB 1OCVA 5IG5A 4LEHA 3EN8A 3B4OA 3CU3A 5IENA 2CKFB 4R9LA 1DMMA 3BLZA 3F8XA 4HM0B 3G0KA 1ISKA 3FF0A 2STDA 3B4PA 3FKAA 2RFRA 4XDWA 1OF5B 1WQLB 5D83A 3I0YA 1Q42A 3GZYB 3MG2A 4CDLA 4OVMA 3NXJA 5IG3A 3DMCA 4HKVB 2INXA 3FF2A 4WYKA 4XBXA 4ORLA 1C7HA 3KE7A 3LZAA 3F14A 3SOYA 1SJWA 2XSHB 3FSDA 3EQQB 3ROBA 4R9KA 4L8PA 1OUNA 4L8OA 4RZMA 1E97A 3STDA 5IG4A 4MJDA 1OF5A 3MHEA 2HMNB 3F7XA 1ULJB 3ER7A 5AIFA 3FH1A 1JKGB 2JQ5A 4XDVA 3OV4A 4U13A 1OHPA 5CF2A 4I4KA 4IIAA 3GWRA 5AEWB 5KP4A 3DUKA 1AR0A 4FCJA 1GY5A 3ECFA 4XB5A 3HZPA 2QGUA 2YFJB 3UJMA 1Q40B 1Z1SA 3OWSA 6STDA 3MSOA 1O7PB 3F9SA 3OWYA 2IMJA 3F40A 3LYGA 5AI1A 2F98A 1JKGA 2HMMB 3G16A 4HZBB 2XRXB 1JB2A 1JB4A 1JB5A 5DREA 5KP1A 4OUQA 2RCDA 3NM2A 4HM4B 2W2CA 5DRVA 4STDA 1Q40A 3Q90A 5CK6A 1JN5B 3OX9A 4K1UA 1DMNA 3CPOA 3MYTA 3IPTA 5CF1A 3JUMA 5IEOA 3VGNA 2YFIB 3F7SA 3GZBA 1ASKA 3M8CA 4J9AA 4XBTA 2HMKB 5FW5A 4Q53A 2GBWB 3DXOA 4HJLB 3EHCA 1ZO2A 3T8UA 1O7WB 3D9RA 3GRDA 5BVBA 3JUPA 3HX8A 1A2KA 2RGQA 5IEPA 1JN5A 5D81A 4HM1B 3B8LA 2Z7AA 3HK4A 8CHOA
chains in the Genus database with same CATH superfamily
1ROAA 5TGNA 2Y74A 1NDOB 1RGHA 3SLUA 1YGEA 3VF1A 1RGEA 1YJ93 5LC7A 1GYBA 3KSPA 4EBGA 2F5MA 2WGOA 5G2GA 3UNLA 2GSPA 1K41A 1B2SA 3EN1B 1B27A 1T2IA 3JUQA 1KWIA 3V92A 3MKIA 3IJEB 1M9GA 2CHCA 1GY6A 1LOXA 2GU3A 2KAAA 5M19A 2XR8B 1B20A 2BMQB 3EBYA 2BIRA 2W9QA 5JPPA 1BRIA 2UUGC 3LTDA 1LNHA 4N6NB 1KD14 1M1K4 1RGFA 1W2B2 2OTJ3 2R4IA 4LYLB 1I2EA 2KXGA 3CCQ3 3WOFB 1OHOA 3H3HA 1LOWA 2ZDJA 1HKXA 3CD63 2CFKA 1YJN3 2HOHA 3X41A 3UB1A 2CFWA 2GEYA 3LT9A 3FLJA 2KF5A 1EKMA 1YVBI 3NQYA 6GSPA 5JBSA 4KFEA 1TTOA 5D82A 1GOUA 4OK0A 2F99A 6RNTA 1I3FA 4XM4A 3RGAA 4J8TA 3KIIA 3DM8A 3BNEA 3F8HA 4XBYA 2F56A 3MG3A 4RNTA 1N8R4 1SPUA 1RLSA 3LXUX 2YFLB 1IK3A 3CNMA 1E3RA 2KF4A 2B1XB 1R4CA 2GEXA 2M7OA 4I5QA 5AIIA 3CCJ3 1PYLA 1OPYA 4FMAA 5AIHA 5EVHA 2WOFA 1N5HA 1STDA 3Q3FA 1TFOA 4WP5A 3DY5A 1UW1A 2HMLB 4X2OA 3K0ZA 4BL3A 4O3VA 1OACA 3KKGA 1A67A 3B7CA 5KP3A 2LQVA 3OXAA 1W00A 3OWUA 3HIGA 2ML5A 2AAEA 3NUVA 4WWUC 2RBIA 2CG1A 1BRJA 5BXQA 3Q2PA 1VQ63 4O8SA 5AYSC 3H51A 1X1YA 3CXC2 4RBNA 3NHXA 4N6MA 3CCS3 1YNVX 3EX9A 1QVF2 1A2VA 2OTL3 1O7HB 1UCLA 3EE1A 1GMPA 1IVWA 1AV4A 2H0GA 4L7KA 4K1VA 3PYJA 3X3YA 4O02B 1VQ83 2H0HA 4PEJA 1W01A 5AIGA 4LGQA 1L5GB 3UL6A 1BNFA 1RN1A 3AGOA 3S5CA 3EB8A 1K734 1GS3A 1GY7A 1B2UA 4HM7B 4JRFA 1MOLA 1UGIA 3S67A 3V99A 4BIRA 4J5KA 5CXOA 1BNEA 3I553 1MNLA 1BSEA 2BMOB 2MF7A 1MWSA 3AHWA 1OHSA 1TP6A 1FZUA 3G8ZA 1X1UA 5IG0A 2BNGA 5LC6A 2MC8A 1IDPA 4BTYA 3I563 1FW7A 2CIUA 2GXFA 4HOHA 3KSED 1BNJA 2ZA4A 3BB9A 1RNTA 1MWUA 4FMCA 1IT8A 4TX4A 3LH4A 1B2XA 1U5OA 3A76A 2P05A 3LMLA 1KSIA 4X2HA 3NBRA 4BU4A 1DE3A 4HM5B 3WOEB 2PZVA 3WODG 1EA2A 4H3UA 1BANA 1LQGC 3BNCA 3D5GA 1RMSA 2QA43 3FZWA 4R80A 1N8QA 1NU3A 1RGLA 3LT8A 2E2UA 4K61A 1QVG2 2L1SA 2BO9B 5EEOA 1NO3A 3GZRA 1BU4A 1VQL3 2UGIA 2QIYA 1TFKA 1JRQA 1IQ8A 1BRSA 1FGOA 3DGNA 1BSDA 4FMDA 1QAFA 1UUWB 2F86B 2FNQA 1BUQA 5I97A 5HGRA 2C11A 2I9WA 4CPKA 1JBSA 1GD4A 4IT7A 1W2ZA 4KFFA 4KVHA 1W6YA 1NWWA 1BUJA 5STDA 2KF6A 1A2PA 2Z76A 3ZG0A 1IU7A 3PZWA 1A90A 3VSYA 2UX0A 3BNBA 3PXMA 5RNTA 1UCKA 4WFOA 2H0IA 2Z77A 1WMNA 3DGOA 4LZIA 1SIIA 3E99A 1K28A 1VZZA 1EQKA 2HMOB 2B24B 4ILFA 3PCRA 1O7GB 1BAOA 1IV9A 1Y4KA 2XSOB 3K63A 1S5AA 1TUHA 3DGMA 1SQWA 2ML6A 3O8YA 4J5GA 4MMZB 3JUNA 1RGKA 2HMJB 3CNXA 3EC9A 5AEUB 3WMDA 7GSPA 3SXXA 1TJDA 4GL6A 2F5WA 1UCJA 2SBLA 1IQXA 3HOHA 1OGXA 1M1XB 4HM3B 1NB3I 5IF6A 2CH9A 5IERA 2CWVA 1V57A 1RKYA 5ELJA 3KZTA 4ZM8A 3K7CA 3KN4A 2KF3A 3RNTA 4BTXA 3S28A 1I0VA 4R1KA 1VQK3 1ZX2A 1DMQA 1UI8A 1V58A 2E2VA 5CLKA 3RGRA 2CG0A 3PCSA 4EW5A 2IA7A 3OW22 1I0XA 3NV0B 2K3DA 4KZ1A 1HU9A 3GZXB 3FG3A 3SVAA 1CQSA 2W6JH 2BT3A 3EF8A 1BRGA 3J7Yd 1OGZA 3CC23 1JV2B 1AQZA 2P09A 4MMXB 4MMYB 4N3VA 1QMAA 2IY2A 2GBXB 4CCVA 3EJVA 3QK9A 7STDA 2OWPA 1VQP3 1WNHA 4HVNA 2P0XA 2V1LA 3D5IA 1OH0A 1RGGA 2CFDA 3MPHA 3SX1A 3X3ZA 3FGYA 1BIRA 1ULIB 1W02A 3LOYA 1VQQA 1G96A 2FGTA 3ALAA 4FCMA 3S29A 4BTWA 2A15A 5M1AA 3SEDA 3SOAA 1RTUA 3EBTA 3CCV3 3CCM3 3HIIA 4HM2B 1FGTA 2XEPA 3RDEA 1WMOA 1T5YA 3Q1CA 2CWTA 1BNSA 2D1WA 1DYUA 1IVXA 1JZDA 2K54A 3T0UA 3T8NA 2C10A 3CPW2 5HOHA 1C54A 1BOXA 1YVSA 1D6UA 3DGYA 4EXRA 2XGNA 3U97A 1O7NB 2BMRB 1RCLA 1E3VA 1UUVB 4HZ9B 2PNCA 1QJGA 1N9JA 1T3BA 4HBRA 4LMIA 1O7MB 1IYYA 1B2MA 4GB5A 3NV0A 1BNIA 2WGQA 3KCHA 3LTAA 1LQMB 3MG1A 1BSCA 1STFI 3N54B 1WMPA 4HM8B 2P0MA 4FMBA 4HM6B 5JPUA 2CFGA 1GD3A 1LOVA 2CX1A 3JUOA 3DZLA 4FCZA 1DETA 1DVCA 2YX9A 1EG9B 4WYKB 1LOYA 3WA3A 2OQEA 1OCVA 2OCTA 4NPBA 2KRTA 4LEHA 3NBJA 4JF8A 5IG5A 2XGLA 1Q7Y4 3SYUA 1NB5I 1LXEA 1D6YA 3EN8A 5EQLA 3B4OA 3CU3A 5IENA 1EEJA 2CKFB 3FG1A 3WA2X 4R9LA 1BVIA 1RHLA 1DMMA 2W0QA 1QALA 3BLZA 5AYRB 1S723 3F8XA 4N6UA 2IUJA 4HM0B 3V98A 3G713 1NNVA 1V74A 3G0KA 3D79A 1ISKA 1VQN3 1GMQA 1IT7A 2IUKA 4RNZA 1W7CA 3WHOA 5A0OB 1Q814 2RNTA 1GSPA 1AVLA 3FF0A 1RRLA 2AADA 2STDA 1B3SA 3B4PA 3X40A 3FKAA 1TIJA 3FG4A 4FR9A 2O3OA 2RFRA 1BGSA 1UI7A 4XDWA 1OF5B 1WQLB 3CME3 1RDSA 8RNTA 5D83A 1N5PA 3I0YA 1Q42A 3GZYB 3IMAB 3MG2A 1I2FA 4GHOA 4WHAA 1YIT3 1VQ53 4HYZA 2BHMA 1RN4A 2CW9A 4OVMA 3NXJA 4CDLA 1KC84 5IG3A 3DMCA 1K9M4 4HKVB 3L0RA 2INXA 3FF2A 1KQS2 4WYKA 2R41A 1RNBA 1I8VA 3CCU3 2SARA 3BNDA 2CX0A 4KFDA 4EV2A 4XBXA 4AEQA 1YJW3 3QRDA 4AKYA 4ORLA 3DGLA 1BRNL 1C7HA 3KE7A 1W6CA 3LZAA 3F14A 3D4AA 3SOYA 1MWRA 3CCL3 1IVVA 1T2HA 1SJWA 1B21A 2OQEC 2XSHB 4QWTA 3FSDA 5G1KA 1ROVA 1FGMA 4N6TA 4BL2A 1RSNA 3KFQC 4EC6A 3EQQB 2CK3H 4GSPA 3ROBA 4R9KA 1BRKA 4L8PA 1OUNA 1PFPA 1Q864 3PS8A 5M18A 4L8OA 4RZMA 1E97A 1PU4A 1Q7HA 1WTHA 3STDA 2QEX3 1YHQ3 3AGNA 5IG4A 2K0MA 4MJDA 3CCR3 4DKIA 1OF5A 1UCIA 2O9UX 5GSPA 3NX0A 1I70A 1CYUA 3HI7A 3MHEA 2HMNB 2P38A 3DH2A 2E2TA 4R4KA 3F7XA 2GU1A 1ULJB 3ER7A 3K5TA 4LSOA 3NQZA 3BU4A 5AIFA 3FH1A 3NM7A 5FGOA 1CYVA 3X3XA 3MWZA 2CFLA 1JKGB 3LTBA 1LNIA 1FA3A 1UGHI 2JQ5A 4XDVA 3OV4A 4U13A 1K8A4 1RN7A 2W04A 1OHPA 4O2HA 5CF2A 3JVCA 2W56B 1VQ73 3URPA 4G1MB 4I4KA 4N6OB 4IIAA 2ZL8A 3GWRA 1FGRA 3AHSA 1X1WA 1JBRA 5AEWB 1JBTA 1CH0A 1FUSA 1UDII 5KP4A 3DUKA 1SIHA 1AR0A 2Z6BA 1AY7A 1BSBA 1Q9EA 1FYSA 4FCJA 1BNRA 3S27A 1GY5A 1W5ZA 3UL5A 3ECFA 1I2GA 4XB5A 1DVDA 3HZPA 2QGUA 2YFJB 3UJMA 1MGRA 2WO0A 3BIRA 4EV5A 1B2ZA 4H61A 3N8BA 1JJ22 1RJOA 1J2BA 1RGAA 1Q40B 1RRHA 2W03A 1Z1SA 2F4YA 3OWSA 4RNYA 6STDA 3MSOA 2JDIH 1VQ93 1O7PB 3CMA3 2BU4A 1SARA 3F9SA 3U1WA 3OWYA 2XH9A 2OOVA 1TRQA 2IMJA 3F40A 1ZS7A 1FUTA 1MGWA 3LYGA 4K90B 5AI1A 1RCKA 2F98A 1JKGA 3N9HA 2HMMB 1X1XA 1IV7A 1W6GA 3G16A 2Y73A 2W56A 2J8XB 3GSPA 4HZBB 4MEIA 1G02A 1JZOA 4NREA 4AKZA 2XRXB 1JB2A 2W9PA 1IQYA 1BSAA 1JB4A 1TRPA 4NHFA 5BIRA 1JB5A 5DREA 2LYXA 5KP1A 1BRHA 2XFSA 3WR2A 4OUQA 1EUIC 2RCDA 3NM2A 4HM4B 4CJNA 3G4S3 1VQ43 1I3IA 5IW9A 2W2CA 3AMOB 5ELUA 5DRVA 4STDA 3LTCA 1Q40A 2L4VA 1W4NA 3Q90A 9RNTA 5CK6A 4IPBA 1NJI4 1JN5B 3OX9A 4K1UA 2C4BA 1ZGXA 1DMNA 3CC73 3CPOA 3MYTA 3PGBA 2XF3A 3IPTA 5CF1A 3JUMA 1YGWA 1Q824 4N6V0 1US1A 5IEOA 1LRAA 3D3LA 1MWTA 1U8CB 7RNTA 1UUGB 1LVNA 4N6LA 4KT3B 3VGNA 3ZG5A 3ZFZA 1F8NA 1JNQA 2OOVC 1FUWA 3CCE3 2YFIB 3K9MC 1IVUA 3G6E3 1HZ1A 1YIJ3 3F7SA 3GZBA 4HAAA 1ASKA 2XFTA 3M8CA 3FCSB 2KCDA 3X42A 1TU5A 3WDGB 3A5EA 4J9AA 2HMKB 2D42A 4XBTA 2IYJA 5FW5A 4Q53A 1VQO3 1D6ZA 2GBWB 1GMRA 2RSXA 5BU4A 3CC43 3NBBA 3DXOA 4HJLB 2CC3A 3EHCA 1ZO2A 1G0TA 1N9EA 2FXTA 1O7WB 3D9RA 3T8UA 3GRDA 5BVBA 1AVKA 1FGQA 3JUPA 1YI23 1GOYA 3AMOA 1A2KA 3HX8A 1RGCA 1BNGA 2RGQA 4EYCA 2WOHA 5IEPA 1JN5A 1PY3A 1VQM3 2ZHXB 5D81A 1M904 4HM1B 3B8LA 1QAKA 2CWUA 3GAXA 1HYFA 1R4YA 1GOVA 1CEWI 2Z7AA 5G1LA 3TDGA 3HK4A 8CHOA 2Q07A
chains in the Genus database with same CATH topology
1ROAA 5TGNA 2Y74A 1NDOB 3SLUA 3VF1A 1YGEA 1YJ93 5LC7A 1GYBA 3KSPA 4EBGA 2WGOA 5G2GA 3UNLA 1K41A 3EN1B 3JUQA 1KWIA 3V92A 3MKIA 3IJEB 1M9GA 2CHCA 1GY6A 1LOXA 2GU3A 2XR8B 2BMQB 3EBYA 2W9QA 5JPPA 3LTDA 1LNHA 4N6NB 1KD14 1M1K4 1W2B2 2OTJ3 2R4IA 2KXGA 3CCQ3 3WOFB 1OHOA 3H3HA 2ZDJA 1HKXA 3CD63 2CFKA 1YJN3 3X41A 3UB1A 2CFWA 2GEYA 3LT9A 3FLJA 1EKMA 1YVBI 3NQYA 5JBSA 4KFEA 5D82A 4OK0A 2F99A 4XM4A 3RGAA 4J8TA 3KIIA 3DM8A 3BNEA 3F8HA 4XBYA 3MG3A 1N8R4 1SPUA 3LXUX 2YFLB 1IK3A 3CNMA 1E3RA 3CCJ3 2B1XB 1R4CA 2GEXA 2M7OA 5AIIA 1OPYA 4FMAA 5AIHA 5EVHA 2WOFA 1N5HA 1STDA 1TFOA 4WP5A 3DY5A 1UW1A 2HMLB 4X2OA 3K0ZA 4O3VA 1OACA 3KKGA 1A67A 3B7CA 5KP3A 2LQVA 3OXAA 1W00A 3OWUA 3HIGA 2ML5A 3NUVA 4WWUC 2CG1A 5BXQA 3Q2PA 1VQ63 4O8SA 5AYSC 3H51A 3CXC2 4RBNA 3NHXA 4N6MA 3CCS3 3EX9A 1A2VA 2OTL3 1O7HB 3EE1A 1IVWA 1AV4A 4L7KA 4K1VA 3PYJA 3X3YA 4O02B 1VQ83 4PEJA 1W01A 5AIGA 4LGQA 1L5GB 3UL6A 3S5CA 3EB8A 1K734 1GS3A 1GY7A 4HM7B 4JRFA 1MOLA 3S67A 3V99A 3I553 5CXOA 1MNLA 2BMOB 2MF7A 5IG0A 1OHSA 1TP6A 3G8ZA 5LC6A 2MC8A 4BTYA 2BNGA 3I563 1IDPA 2CIUA 2GXFA 3KSED 4FMCA 3BB9A 4TX4A 1IT8A 3LH4A 1U5OA 3A76A 2P05A 3LMLA 1KSIA 4X2HA 3NBRA 4HM5B 3WOEB 2PZVA 3WODG 1EA2A 4H3UA 3BNCA 2QA43 3FZWA 4R80A 1N8QA 1NU3A 3LT8A 2E2UA 4K61A 1QVG2 2BO9B 5EEOA 1NO3A 3GZRA 1VQL3 2QIYA 1TFKA 1JRQA 1IQ8A 1FGOA 3DGNA 4FMDA 1QAFA 1UUWB 2F86B 2FNQA 1BUQA 5I97A 5HGRA 2C11A 2I9WA 1GD4A 4IT7A 1W2ZA 4KFFA 4KVHA 1W6YA 1NWWA 5STDA 2Z76A 1IU7A 3PZWA 1A90A 3VSYA 2UX0A 3BNBA 3PXMA 4WFOA 2Z77A 1WMNA 3DGOA 4LZIA 1SIIA 3E99A 1K28A 1VZZA 1EQKA 2HMOB 2B24B 3PCRA 1O7GB 3K63A 1IV9A 1Y4KA 2XSOB 3O8YA 1S5AA 1TUHA 3DGMA 1SQWA 2ML6A 4MMZB 1QVF2 3JUNA 2HMJB 3CNXA 3EC9A 5AEUB 3WMDA 3SXXA 4GL6A 2SBLA 1IQXA 1OGXA 1M1XB 4HM3B 1NB3I 5IF6A 2CH9A 5IERA 2CWVA 1RKYA 5ELJA 3KZTA 4ZM8A 3K7CA 3KN4A 4BTXA 3S28A 4R1KA 1VQK3 1ZX2A 1DMQA 1UI8A 2E2VA 5CLKA 3RGRA 2CG0A 3PCSA 2IA7A 3OW22 3NV0B 4KZ1A 1HU9A 3GZXB 3FG3A 3SVAA 1CQSA 2W6JH 2BT3A 3EF8A 3J7Yd 3CC23 1OGZA 1JV2B 2P09A 4MMXB 4MMYB 4N3VA 1QMAA 2GBXB 4CCVA 3EJVA 3QK9A 7STDA 2OWPA 1VQP3 1WNHA 4HVNA 2P0XA 2V1LA 1OH0A 3MPHA 2CFDA 3SX1A 3X3ZA 3FGYA 3LOYA 1ULIB 1W02A 1G96A 2FGTA 3ALAA 4FCMA 3S29A 4BTWA 2A15A 3SEDA 3SOAA 3EBTA 3CCV3 3CCM3 3HIIA 4HM2B 1FGTA 2XEPA 3RDEA 1WMOA 1T5YA 3Q1CA 2CWTA 2D1WA 1DYUA 1IVXA 2K54A 3T8NA 3T0UA 3CPW2 2C10A 4EXRA 1D6UA 2XGNA 3U97A 1O7NB 2BMRB 1E3VA 1UUVB 4HZ9B 2PNCA 1QJGA 1N9JA 4HBRA 4LMIA 1O7MB 4GB5A 3NV0A 3LTAA 2WGQA 3MG1A 3N54B 4HM8B 1STFI 1WMPA 2P0MA 4FMBA 4HM6B 5JPUA 2CFGA 1GD3A 3JUOA 3DZLA 4FCZA 1DVCA 2YX9A 1EG9B 4WYKB 3WA3A 2OQEA 1OCVA 2OCTA 2KRTA 4LEHA 3NBJA 4JF8A 5IG5A 2XGLA 1Q7Y4 1NB5I 1LXEA 1D6YA 3EN8A 5EQLA 3B4OA 3CU3A 5IENA 2CKFB 3FG1A 3WA2X 4R9LA 2W0QA 1DMMA 1QALA 3BLZA 5AYRB 1S723 3F8XA 4N6UA 2IUJA 4HM0B 3V98A 3G713 1V74A 3G0KA 1ISKA 1VQN3 1IT7A 2IUKA 4RNZA 1W7CA 5A0OB 1Q814 1AVLA 3FF0A 1RRLA 2STDA 3B4PA 3X40A 3FKAA 1TIJA 3FG4A 4FR9A 2O3OA 2RFRA 1UI7A 4XDWA 1OF5B 1WQLB 3CME3 5D83A 1N5PA 3I0YA 1Q42A 3GZYB 3IMAB 3MG2A 1VQ53 4WHAA 1YIT3 4HYZA 2BHMA 2CW9A 4OVMA 4CDLA 3NXJA 1KC84 5IG3A 3DMCA 1K9M4 4HKVB 3L0RA 2INXA 3FF2A 1KQS2 4WYKA 3CCU3 3BNDA 4KFDA 4EV2A 4XBXA 4AEQA 1YJW3 3QRDA 4AKYA 4ORLA 3DGLA 1C7HA 3KE7A 1W6CA 3LZAA 3F14A 3SOYA 3CCL3 1IVVA 1SJWA 2OQEC 2XSHB 4QWTA 3FSDA 1ROVA 1FGMA 4N6TA 3KFQC 4EC6A 3EQQB 2CK3H 3ROBA 4R9KA 4L8PA 1OUNA 1PFPA 1Q864 3PS8A 4L8OA 4RZMA 1E97A 1PU4A 1WTHA 3STDA 2QEX3 1YHQ3 5IG4A 2K0MA 4MJDA 3CCR3 1OF5A 2O9UX 3NX0A 1CYUA 3HI7A 3MHEA 2HMNB 2P38A 2E2TA 4R4KA 3F7XA 2GU1A 1ULJB 3ER7A 3K5TA 4LSOA 3NQZA 5AIFA 3FH1A 3NM7A 5FGOA 1CYVA 3X3XA 3MWZA 2CFLA 1JKGB 3LTBA 1FA3A 1K8A4 2JQ5A 4XDVA 3OV4A 4U13A 1RN7A 2W04A 1OHPA 4O2HA 5CF2A 3JVCA 2W56B 1VQ73 4G1MB 4I4KA 4N6OB 4IIAA 2ZL8A 3GWRA 1FGRA 5AEWB 5KP4A 3DUKA 1SIHA 1AR0A 2Z6BA 4FCJA 3S27A 1GY5A 1W5ZA 3UL5A 3ECFA 4XB5A 1DVDA 3HZPA 2QGUA 2YFJB 3UJMA 2WO0A 4EV5A 4H61A 3N8BA 1JJ22 1RJOA 1J2BA 1Q40B 1RRHA 2W03A 1Z1SA 3OWSA 4RNYA 6STDA 3MSOA 2JDIH 1VQ93 1O7PB 3CMA3 3F9SA 3U1WA 3OWYA 2XH9A 2OOVA 2IMJA 3F40A 3LYGA 4K90B 5AI1A 2F98A 3N9HA 1JKGA 2HMMB 1IV7A 1W6GA 3G16A 2Y73A 2W56A 4HZBB 4MEIA 4NREA 4AKZA 2XRXB 1JB2A 2W9PA 1IQYA 1JB4A 4NHFA 1JB5A 5DREA 2LYXA 5KP1A 2XFSA 1VQ43 4OUQA 2RCDA 3NM2A 4HM4B 3G4S3 5IW9A 2W2CA 3AMOB 5ELUA 5DRVA 4STDA 3LTCA 1Q40A 2L4VA 1W4NA 3Q90A 5CK6A 4IPBA 1NJI4 1JN5B 3OX9A 4K1UA 3CC73 1DMNA 3CPOA 3MYTA 3PGBA 2XF3A 3IPTA 5CF1A 3JUMA 1Q824 4N6V0 1US1A 5IEOA 3D3LA 1U8CB 1LVNA 4N6LA 3VGNA 1F8NA 1JNQA 2OOVC 1FUWA 3CCE3 2YFIB 3K9MC 1IVUA 3G6E3 1YIJ3 3F7SA 3GZBA 1ASKA 2XFTA 3M8CA 3FCSB 2KCDA 3X42A 1TU5A 3WDGB 4J9AA 4XBTA 2HMKB 2D42A 5FW5A 1VQO3 4Q53A 1D6ZA 2GBWB 2RSXA 3CC43 3NBBA 3DXOA 4HJLB 2CC3A 3EHCA 1ZO2A 1N9EA 2FXTA 3T8UA 1O7WB 3D9RA 3GRDA 5BVBA 1AVKA 1FGQA 3JUPA 1YI23 3AMOA 3HX8A 1A2KA 2RGQA 4EYCA 2WOHA 5IEPA 1JN5A 1VQM3 5D81A 1M904 4HM1B 3B8LA 1QAKA 2CWUA 3GAXA 1CEWI 2Z7AA 3TDGA 3HK4A 8CHOA 2Q07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TGN A;  1NDO B;  1GYB A;  3KSP A;  5G2G A;  3UNL A;  1K41 A;  3EN1 B;  3JUQ A;  3MKI A;  2CHC A;  1GY6 A;  2XR8 B;  2BMQ B;  3EBY A;  5JPP A;  2R4I A;  1OHO A;  3H3H A;  1HKX A;  2GEY A;  3FLJ A;  5D82 A;  2F99 A;  4XM4 A;  3RGA A;  4J8T A;  3DM8 A;  4XBY A;  3F8H A;  3MG3 A;  2YFL B;  3CNM A;  1E3R A;  2B1X B;  2GEX A;  5AII A;  1OPY A;  5AIH A;  5EVH A;  1STD A;  4WP5 A;  2HML B;  4X2O A;  3K0Z A;  3KKG A;  3B7C A;  5KP3 A;  3OXA A;  1W00 A;  3OWU A;  3NUV A;  4WWU C;  5BXQ A;  3H51 A;  3NHX A;  3EX9 A;  1O7H B;  4L7K A;  4K1V A;  4PEJ A;  1W01 A;  5AIG A;  4LGQ A;  3S5C A;  1GS3 A;  1GY7 A;  4HM7 B;  5CXO A;  2BMO B;  5IG0 A;  1OHS A;  1TP6 A;  3G8Z A;  2BNG A;  1IDP A;  2GXF A;  3BB9 A;  1U5O A;  3A76 A;  4X2H A;  3NBR A;  4HM5 B;  2PZV A;  1EA2 A;  4H3U A;  3FZW A;  1NU3 A;  3GZR A;  2QIY A;  2F86 B;  1UUW B;  1BUQ A;  5HGR A;  2I9W A;  4KVH A;  1W6Y A;  1NWW A;  5STD A;  2Z76 A;  3VSY A;  2UX0 A;  2Z77 A;  3E99 A;  1VZZ A;  2HMO B;  2B24 B;  1O7G B;  2XSO B;  1S5A A;  1TUH A;  3JUN A;  2HMJ B;  3CNX A;  3EC9 A;  5AEU B;  3WMD A;  1OGX A;  4HM3 B;  5IF6 A;  5IER A;  3KZT A;  3K7C A;  4R1K A;  1ZX2 A;  1DMQ A;  3RGR A;  5CLK A;  3NV0 B;  3GZX B;  1CQS A;  3EF8 A;  1OGZ A;  4N3V A;  1QMA A;  2GBX B;  3EJV A;  7STD A;  2OWP A;  4HVN A;  1OH0 A;  3FGY A;  1ULI B;  1W02 A;  4FCM A;  2A15 A;  3SED A;  3SOA A;  3EBT A;  4HM2 B;  3T8N A;  2K54 A;  1O7N B;  2BMR B;  1E3V A;  1UUV B;  4HZ9 B;  1QJG A;  4LMI A;  1O7M B;  4GB5 A;  3NV0 A;  3MG1 A;  4HM8 B;  4HM6 B;  5JPU A;  3JUO A;  3DZL A;  1EG9 B;  4WYK B;  1OCV A;  5IG5 A;  4LEH A;  3EN8 A;  3B4O A;  3CU3 A;  5IEN A;  2CKF B;  4R9L A;  1DMM A;  3BLZ A;  3F8X A;  4HM0 B;  3G0K A;  1ISK A;  3FF0 A;  2STD A;  3B4P A;  3FKA A;  2RFR A;  4XDW A;  1OF5 B;  1WQL B;  5D83 A;  3I0Y A;  1Q42 A;  3GZY B;  3MG2 A;  4CDL A;  4OVM A;  3NXJ A;  5IG3 A;  3DMC A;  4HKV B;  2INX A;  3FF2 A;  4WYK A;  4XBX A;  4ORL A;  1C7H A;  3KE7 A;  3LZA A;  3F14 A;  3SOY A;  1SJW A;  2XSH B;  3FSD A;  3EQQ B;  3ROB A;  4R9K A;  4L8P A;  1OUN A;  4L8O A;  4RZM A;  1E97 A;  3STD A;  5IG4 A;  4MJD A;  1OF5 A;  3MHE A;  2HMN B;  3F7X A;  1ULJ B;  3ER7 A;  5AIF A;  3FH1 A;  1JKG B;  2JQ5 A;  4XDV A;  3OV4 A;  4U13 A;  1OHP A;  5CF2 A;  4I4K A;  4IIA A;  3GWR A;  5AEW B;  5KP4 A;  3DUK A;  1AR0 A;  4FCJ A;  1GY5 A;  3ECF A;  4XB5 A;  3HZP A;  2QGU A;  2YFJ B;  3UJM A;  1Q40 B;  1Z1S A;  3OWS A;  6STD A;  3MSO A;  1O7P B;  3F9S A;  3OWY A;  2IMJ A;  3F40 A;  3LYG A;  5AI1 A;  2F98 A;  1JKG A;  2HMM B;  3G16 A;  4HZB B;  2XRX B;  1JB2 A;  1JB4 A;  1JB5 A;  5DRE A;  5KP1 A;  4OUQ A;  2RCD A;  3NM2 A;  4HM4 B;  2W2C A;  5DRV A;  4STD A;  1Q40 A;  3Q90 A;  5CK6 A;  1JN5 B;  3OX9 A;  4K1U A;  1DMN A;  3CPO A;  3MYT A;  3IPT A;  5CF1 A;  3JUM A;  5IEO A;  3VGN A;  2YFI B;  3F7S A;  3GZB A;  1ASK A;  3M8C A;  4J9A A;  4XBT A;  2HMK B;  5FW5 A;  4Q53 A;  2GBW B;  3DXO A;  4HJL B;  3EHC A;  1ZO2 A;  3T8U A;  1O7W B;  3D9R A;  3GRD A;  5BVB A;  3JUP A;  3HX8 A;  1A2K A;  2RGQ A;  5IEP A;  1JN5 A;  5D81 A;  4HM1 B;  3B8L A;  2Z7A A;  3HK4 A;  8CHO A; 
#chains in the Genus database with same CATH topology
 1ROA A;  5TGN A;  2Y74 A;  1NDO B;  1RGH A;  3SLU A;  1YGE A;  3VF1 A;  1RGE A;  1YJ9 3;  5LC7 A;  1GYB A;  3KSP A;  4EBG A;  2F5M A;  2WGO A;  5G2G A;  3UNL A;  2GSP A;  1K41 A;  1B2S A;  3EN1 B;  1B27 A;  1T2I A;  3JUQ A;  1KWI A;  3V92 A;  3MKI A;  3IJE B;  1M9G A;  2CHC A;  1GY6 A;  1LOX A;  2GU3 A;  2KAA A;  5M19 A;  2XR8 B;  1B20 A;  2BMQ B;  3EBY A;  2BIR A;  2W9Q A;  5JPP A;  1BRI A;  2UUG C;  3LTD A;  1LNH A;  4N6N B;  1KD1 4;  1M1K 4;  1RGF A;  1W2B 2;  2OTJ 3;  2R4I A;  4LYL B;  1I2E A;  2KXG A;  3CCQ 3;  3WOF B;  1OHO A;  3H3H A;  1LOW A;  2ZDJ A;  1HKX A;  3CD6 3;  2CFK A;  1YJN 3;  2HOH A;  3X41 A;  3UB1 A;  2CFW A;  2GEY A;  3LT9 A;  3FLJ A;  2KF5 A;  1EKM A;  1YVB I;  3NQY A;  6GSP A;  5JBS A;  4KFE A;  1TTO A;  5D82 A;  1GOU A;  4OK0 A;  2F99 A;  6RNT A;  1I3F A;  4XM4 A;  3RGA A;  4J8T A;  3KII A;  3DM8 A;  3BNE A;  3F8H A;  4XBY A;  2F56 A;  3MG3 A;  4RNT A;  1N8R 4;  1SPU A;  1RLS A;  3LXU X;  2YFL B;  1IK3 A;  3CNM A;  1E3R A;  2KF4 A;  2B1X B;  1R4C A;  2GEX A;  2M7O A;  4I5Q A;  5AII A;  3CCJ 3;  1PYL A;  1OPY A;  4FMA A;  5AIH A;  5EVH A;  2WOF A;  1N5H A;  1STD A;  3Q3F A;  1TFO A;  4WP5 A;  3DY5 A;  1UW1 A;  2HML B;  4X2O A;  3K0Z A;  4BL3 A;  4O3V A;  1OAC A;  3KKG A;  1A67 A;  3B7C A;  5KP3 A;  2LQV A;  3OXA A;  1W00 A;  3OWU A;  3HIG A;  2ML5 A;  2AAE A;  3NUV A;  4WWU C;  2RBI A;  2CG1 A;  1BRJ A;  5BXQ A;  3Q2P A;  1VQ6 3;  4O8S A;  5AYS C;  3H51 A;  1X1Y A;  3CXC 2;  4RBN A;  3NHX A;  4N6M A;  3CCS 3;  1YNV X;  3EX9 A;  1QVF 2;  1A2V A;  2OTL 3;  1O7H B;  1UCL A;  3EE1 A;  1GMP A;  1IVW A;  1AV4 A;  2H0G A;  4L7K A;  4K1V A;  3PYJ A;  3X3Y A;  4O02 B;  1VQ8 3;  2H0H A;  4PEJ A;  1W01 A;  5AIG A;  4LGQ A;  1L5G B;  3UL6 A;  1BNF A;  1RN1 A;  3AGO A;  3S5C A;  3EB8 A;  1K73 4;  1GS3 A;  1GY7 A;  1B2U A;  4HM7 B;  4JRF A;  1MOL A;  1UGI A;  3S67 A;  3V99 A;  4BIR A;  4J5K A;  5CXO A;  1BNE A;  3I55 3;  1MNL A;  1BSE A;  2BMO B;  2MF7 A;  1MWS A;  3AHW A;  1OHS A;  1TP6 A;  1FZU A;  3G8Z A;  1X1U A;  5IG0 A;  2BNG A;  5LC6 A;  2MC8 A;  1IDP A;  4BTY A;  3I56 3;  1FW7 A;  2CIU A;  2GXF A;  4HOH A;  3KSE D;  1BNJ A;  2ZA4 A;  3BB9 A;  1RNT A;  1MWU A;  4FMC A;  1IT8 A;  4TX4 A;  3LH4 A;  1B2X A;  1U5O A;  3A76 A;  2P05 A;  3LML A;  1KSI A;  4X2H A;  3NBR A;  4BU4 A;  1DE3 A;  4HM5 B;  3WOE B;  2PZV A;  3WOD G;  1EA2 A;  4H3U A;  1BAN A;  1LQG C;  3BNC A;  3D5G A;  1RMS A;  2QA4 3;  3FZW A;  4R80 A;  1N8Q A;  1NU3 A;  1RGL A;  3LT8 A;  2E2U A;  4K61 A;  1QVG 2;  2L1S A;  2BO9 B;  5EEO A;  1NO3 A;  3GZR A;  1BU4 A;  1VQL 3;  2UGI A;  2QIY A;  1TFK A;  1JRQ A;  1IQ8 A;  1BRS A;  1FGO A;  3DGN A;  1BSD A;  4FMD A;  1QAF A;  1UUW B;  2F86 B;  2FNQ A;  1BUQ A;  5I97 A;  5HGR A;  2C11 A;  2I9W A;  4CPK A;  1JBS A;  1GD4 A;  4IT7 A;  1W2Z A;  4KFF A;  4KVH A;  1W6Y A;  1NWW A;  1BUJ A;  5STD A;  2KF6 A;  1A2P A;  2Z76 A;  3ZG0 A;  1IU7 A;  3PZW A;  1A90 A;  3VSY A;  2UX0 A;  3BNB A;  3PXM A;  5RNT A;  1UCK A;  4WFO A;  2H0I A;  2Z77 A;  1WMN A;  3DGO A;  4LZI A;  1SII A;  3E99 A;  1K28 A;  1VZZ A;  1EQK A;  2HMO B;  2B24 B;  4ILF A;  3PCR A;  1O7G B;  1BAO A;  1IV9 A;  1Y4K A;  2XSO B;  3K63 A;  1S5A A;  1TUH A;  3DGM A;  1SQW A;  2ML6 A;  3O8Y A;  4J5G A;  4MMZ B;  3JUN A;  1RGK A;  2HMJ B;  3CNX A;  3EC9 A;  5AEU B;  3WMD A;  7GSP A;  3SXX A;  1TJD A;  4GL6 A;  2F5W A;  1UCJ A;  2SBL A;  1IQX A;  3HOH A;  1OGX A;  1M1X B;  4HM3 B;  1NB3 I;  5IF6 A;  2CH9 A;  5IER A;  2CWV A;  1V57 A;  1RKY A;  5ELJ A;  3KZT A;  4ZM8 A;  3K7C A;  3KN4 A;  2KF3 A;  3RNT A;  4BTX A;  3S28 A;  1I0V A;  4R1K A;  1VQK 3;  1ZX2 A;  1DMQ A;  1UI8 A;  1V58 A;  2E2V A;  5CLK A;  3RGR A;  2CG0 A;  3PCS A;  4EW5 A;  2IA7 A;  3OW2 2;  1I0X A;  3NV0 B;  2K3D A;  4KZ1 A;  1HU9 A;  3GZX B;  3FG3 A;  3SVA A;  1CQS A;  2W6J H;  2BT3 A;  3EF8 A;  1BRG A;  3J7Y d;  1OGZ A;  3CC2 3;  1JV2 B;  1AQZ A;  2P09 A;  4MMX B;  4MMY B;  4N3V A;  1QMA A;  2IY2 A;  2GBX B;  4CCV A;  3EJV A;  3QK9 A;  7STD A;  2OWP A;  1VQP 3;  1WNH A;  4HVN A;  2P0X A;  2V1L A;  3D5I A;  1OH0 A;  1RGG A;  2CFD A;  3MPH A;  3SX1 A;  3X3Z A;  3FGY A;  1BIR A;  1ULI B;  1W02 A;  3LOY A;  1VQQ A;  1G96 A;  2FGT A;  3ALA A;  4FCM A;  3S29 A;  4BTW A;  2A15 A;  5M1A A;  3SED A;  3SOA A;  1RTU A;  3EBT A;  3CCV 3;  3CCM 3;  3HII A;  4HM2 B;  1FGT A;  2XEP A;  3RDE A;  1WMO A;  1T5Y A;  3Q1C A;  2CWT A;  1BNS A;  2D1W A;  1DYU A;  1IVX A;  1JZD A;  2K54 A;  3T0U A;  3T8N A;  2C10 A;  3CPW 2;  5HOH A;  1C54 A;  1BOX A;  1YVS A;  1D6U A;  3DGY A;  4EXR A;  2XGN A;  3U97 A;  1O7N B;  2BMR B;  1RCL A;  1E3V A;  1UUV B;  4HZ9 B;  2PNC A;  1QJG A;  1N9J A;  1T3B A;  4HBR A;  4LMI A;  1O7M B;  1IYY A;  1B2M A;  4GB5 A;  3NV0 A;  1BNI A;  2WGQ A;  3KCH A;  3LTA A;  1LQM B;  3MG1 A;  1BSC A;  1STF I;  3N54 B;  1WMP A;  4HM8 B;  2P0M A;  4FMB A;  4HM6 B;  5JPU A;  2CFG A;  1GD3 A;  1LOV A;  2CX1 A;  3JUO A;  3DZL A;  4FCZ A;  1DET A;  1DVC A;  2YX9 A;  1EG9 B;  4WYK B;  1LOY A;  3WA3 A;  2OQE A;  1OCV A;  2OCT A;  4NPB A;  2KRT A;  4LEH A;  3NBJ A;  4JF8 A;  5IG5 A;  2XGL A;  1Q7Y 4;  3SYU A;  1NB5 I;  1LXE A;  1D6Y A;  3EN8 A;  5EQL A;  3B4O A;  3CU3 A;  5IEN A;  1EEJ A;  2CKF B;  3FG1 A;  3WA2 X;  4R9L A;  1BVI A;  1RHL A;  1DMM A;  2W0Q A;  1QAL A;  3BLZ A;  5AYR B;  1S72 3;  3F8X A;  4N6U A;  2IUJ A;  4HM0 B;  3V98 A;  3G71 3;  1NNV A;  1V74 A;  3G0K A;  3D79 A;  1ISK A;  1VQN 3;  1GMQ A;  1IT7 A;  2IUK A;  4RNZ A;  1W7C A;  3WHO A;  5A0O B;  1Q81 4;  2RNT A;  1GSP A;  1AVL A;  3FF0 A;  1RRL A;  2AAD A;  2STD A;  1B3S A;  3B4P A;  3X40 A;  3FKA A;  1TIJ A;  3FG4 A;  4FR9 A;  2O3O A;  2RFR A;  1BGS A;  1UI7 A;  4XDW A;  1OF5 B;  1WQL B;  3CME 3;  1RDS A;  8RNT A;  5D83 A;  1N5P A;  3I0Y A;  1Q42 A;  3GZY B;  3IMA B;  3MG2 A;  1I2F A;  4GHO A;  4WHA A;  1YIT 3;  1VQ5 3;  4HYZ A;  2BHM A;  1RN4 A;  2CW9 A;  4OVM A;  3NXJ A;  4CDL A;  1KC8 4;  5IG3 A;  3DMC A;  1K9M 4;  4HKV B;  3L0R A;  2INX A;  3FF2 A;  1KQS 2;  4WYK A;  2R41 A;  1RNB A;  1I8V A;  3CCU 3;  2SAR A;  3BND A;  2CX0 A;  4KFD A;  4EV2 A;  4XBX A;  4AEQ A;  1YJW 3;  3QRD A;  4AKY A;  4ORL A;  3DGL A;  1BRN L;  1C7H A;  3KE7 A;  1W6C A;  3LZA A;  3F14 A;  3D4A A;  3SOY A;  1MWR A;  3CCL 3;  1IVV A;  1T2H A;  1SJW A;  1B21 A;  2OQE C;  2XSH B;  4QWT A;  3FSD A;  5G1K A;  1ROV A;  1FGM A;  4N6T A;  4BL2 A;  1RSN A;  3KFQ C;  4EC6 A;  3EQQ B;  2CK3 H;  4GSP A;  3ROB A;  4R9K A;  1BRK A;  4L8P A;  1OUN A;  1PFP A;  1Q86 4;  3PS8 A;  5M18 A;  4L8O A;  4RZM A;  1E97 A;  1PU4 A;  1Q7H A;  1WTH A;  3STD A;  2QEX 3;  1YHQ 3;  3AGN A;  5IG4 A;  2K0M A;  4MJD A;  3CCR 3;  4DKI A;  1OF5 A;  1UCI A;  2O9U X;  5GSP A;  3NX0 A;  1I70 A;  1CYU A;  3HI7 A;  3MHE A;  2HMN B;  2P38 A;  3DH2 A;  2E2T A;  4R4K A;  3F7X A;  2GU1 A;  1ULJ B;  3ER7 A;  3K5T A;  4LSO A;  3NQZ A;  3BU4 A;  5AIF A;  3FH1 A;  3NM7 A;  5FGO A;  1CYV A;  3X3X A;  3MWZ A;  2CFL A;  1JKG B;  3LTB A;  1LNI A;  1FA3 A;  1UGH I;  2JQ5 A;  4XDV A;  3OV4 A;  4U13 A;  1K8A 4;  1RN7 A;  2W04 A;  1OHP A;  4O2H A;  5CF2 A;  3JVC A;  2W56 B;  1VQ7 3;  3URP A;  4G1M B;  4I4K A;  4N6O B;  4IIA A;  2ZL8 A;  3GWR A;  1FGR A;  3AHS A;  1X1W A;  1JBR A;  5AEW B;  1JBT A;  1CH0 A;  1FUS A;  1UDI I;  5KP4 A;  3DUK A;  1SIH A;  1AR0 A;  2Z6B A;  1AY7 A;  1BSB A;  1Q9E A;  1FYS A;  4FCJ A;  1BNR A;  3S27 A;  1GY5 A;  1W5Z A;  3UL5 A;  3ECF A;  1I2G A;  4XB5 A;  1DVD A;  3HZP A;  2QGU A;  2YFJ B;  3UJM A;  1MGR A;  2WO0 A;  3BIR A;  4EV5 A;  1B2Z A;  4H61 A;  3N8B A;  1JJ2 2;  1RJO A;  1J2B A;  1RGA A;  1Q40 B;  1RRH A;  2W03 A;  1Z1S A;  2F4Y A;  3OWS A;  4RNY A;  6STD A;  3MSO A;  2JDI H;  1VQ9 3;  1O7P B;  3CMA 3;  2BU4 A;  1SAR A;  3F9S A;  3U1W A;  3OWY A;  2XH9 A;  2OOV A;  1TRQ A;  2IMJ A;  3F40 A;  1ZS7 A;  1FUT A;  1MGW A;  3LYG A;  4K90 B;  5AI1 A;  1RCK A;  2F98 A;  1JKG A;  3N9H A;  2HMM B;  1X1X A;  1IV7 A;  1W6G A;  3G16 A;  2Y73 A;  2W56 A;  2J8X B;  3GSP A;  4HZB B;  4MEI A;  1G02 A;  1JZO A;  4NRE A;  4AKZ A;  2XRX B;  1JB2 A;  2W9P A;  1IQY A;  1BSA A;  1JB4 A;  1TRP A;  4NHF A;  5BIR A;  1JB5 A;  5DRE A;  2LYX A;  5KP1 A;  1BRH A;  2XFS A;  3WR2 A;  4OUQ A;  1EUI C;  2RCD A;  3NM2 A;  4HM4 B;  4CJN A;  3G4S 3;  1VQ4 3;  1I3I A;  5IW9 A;  2W2C A;  3AMO B;  5ELU A;  5DRV A;  4STD A;  3LTC A;  1Q40 A;  2L4V A;  1W4N A;  3Q90 A;  9RNT A;  5CK6 A;  4IPB A;  1NJI 4;  1JN5 B;  3OX9 A;  4K1U A;  2C4B A;  1ZGX A;  1DMN A;  3CC7 3;  3CPO A;  3MYT A;  3PGB A;  2XF3 A;  3IPT A;  5CF1 A;  3JUM A;  1YGW A;  1Q82 4;  4N6V 0;  1US1 A;  5IEO A;  1LRA A;  3D3L A;  1MWT A;  1U8C B;  7RNT A;  1UUG B;  1LVN A;  4N6L A;  4KT3 B;  3VGN A;  3ZG5 A;  3ZFZ A;  1F8N A;  1JNQ A;  2OOV C;  1FUW A;  3CCE 3;  2YFI B;  3K9M C;  1IVU A;  3G6E 3;  1HZ1 A;  1YIJ 3;  3F7S A;  3GZB A;  4HAA A;  1ASK A;  2XFT A;  3M8C A;  3FCS B;  2KCD A;  3X42 A;  1TU5 A;  3WDG B;  3A5E A;  4J9A A;  2HMK B;  2D42 A;  4XBT A;  2IYJ A;  5FW5 A;  4Q53 A;  1VQO 3;  1D6Z A;  2GBW B;  1GMR A;  2RSX A;  5BU4 A;  3CC4 3;  3NBB A;  3DXO A;  4HJL B;  2CC3 A;  3EHC A;  1ZO2 A;  1G0T A;  1N9E A;  2FXT A;  1O7W B;  3D9R A;  3T8U A;  3GRD A;  5BVB A;  1AVK A;  1FGQ A;  3JUP A;  1YI2 3;  1GOY A;  3AMO A;  1A2K A;  3HX8 A;  1RGC A;  1BNG A;  2RGQ A;  4EYC A;  2WOH A;  5IEP A;  1JN5 A;  1PY3 A;  1VQM 3;  2ZHX B;  5D81 A;  1M90 4;  4HM1 B;  3B8L A;  1QAK A;  2CWU A;  3GAX A;  1HYF A;  1R4Y A;  1GOV A;  1CEW I;  2Z7A A;  5G1L A;  3TDG A;  3HK4 A;  8CHO A;  2Q07 A; 
#chains in the Genus database with same CATH homology
 1ROA A;  5TGN A;  2Y74 A;  1NDO B;  3SLU A;  3VF1 A;  1YGE A;  1YJ9 3;  5LC7 A;  1GYB A;  3KSP A;  4EBG A;  2WGO A;  5G2G A;  3UNL A;  1K41 A;  3EN1 B;  3JUQ A;  1KWI A;  3V92 A;  3MKI A;  3IJE B;  1M9G A;  2CHC A;  1GY6 A;  1LOX A;  2GU3 A;  2XR8 B;  2BMQ B;  3EBY A;  2W9Q A;  5JPP A;  3LTD A;  1LNH A;  4N6N B;  1KD1 4;  1M1K 4;  1W2B 2;  2OTJ 3;  2R4I A;  2KXG A;  3CCQ 3;  3WOF B;  1OHO A;  3H3H A;  2ZDJ A;  1HKX A;  3CD6 3;  2CFK A;  1YJN 3;  3X41 A;  3UB1 A;  2CFW A;  2GEY A;  3LT9 A;  3FLJ A;  1EKM A;  1YVB I;  3NQY A;  5JBS A;  4KFE A;  5D82 A;  4OK0 A;  2F99 A;  4XM4 A;  3RGA A;  4J8T A;  3KII A;  3DM8 A;  3BNE A;  3F8H A;  4XBY A;  3MG3 A;  1N8R 4;  1SPU A;  3LXU X;  2YFL B;  1IK3 A;  3CNM A;  1E3R A;  3CCJ 3;  2B1X B;  1R4C A;  2GEX A;  2M7O A;  5AII A;  1OPY A;  4FMA A;  5AIH A;  5EVH A;  2WOF A;  1N5H A;  1STD A;  1TFO A;  4WP5 A;  3DY5 A;  1UW1 A;  2HML B;  4X2O A;  3K0Z A;  4O3V A;  1OAC A;  3KKG A;  1A67 A;  3B7C A;  5KP3 A;  2LQV A;  3OXA A;  1W00 A;  3OWU A;  3HIG A;  2ML5 A;  3NUV A;  4WWU C;  2CG1 A;  5BXQ A;  3Q2P A;  1VQ6 3;  4O8S A;  5AYS C;  3H51 A;  3CXC 2;  4RBN A;  3NHX A;  4N6M A;  3CCS 3;  3EX9 A;  1A2V A;  2OTL 3;  1O7H B;  3EE1 A;  1IVW A;  1AV4 A;  4L7K A;  4K1V A;  3PYJ A;  3X3Y A;  4O02 B;  1VQ8 3;  4PEJ A;  1W01 A;  5AIG A;  4LGQ A;  1L5G B;  3UL6 A;  3S5C A;  3EB8 A;  1K73 4;  1GS3 A;  1GY7 A;  4HM7 B;  4JRF A;  1MOL A;  3S67 A;  3V99 A;  3I55 3;  5CXO A;  1MNL A;  2BMO B;  2MF7 A;  5IG0 A;  1OHS A;  1TP6 A;  3G8Z A;  5LC6 A;  2MC8 A;  4BTY A;  2BNG A;  3I56 3;  1IDP A;  2CIU A;  2GXF A;  3KSE D;  4FMC A;  3BB9 A;  4TX4 A;  1IT8 A;  3LH4 A;  1U5O A;  3A76 A;  2P05 A;  3LML A;  1KSI A;  4X2H A;  3NBR A;  4HM5 B;  3WOE B;  2PZV A;  3WOD G;  1EA2 A;  4H3U A;  3BNC A;  2QA4 3;  3FZW A;  4R80 A;  1N8Q A;  1NU3 A;  3LT8 A;  2E2U A;  4K61 A;  1QVG 2;  2BO9 B;  5EEO A;  1NO3 A;  3GZR A;  1VQL 3;  2QIY A;  1TFK A;  1JRQ A;  1IQ8 A;  1FGO A;  3DGN A;  4FMD A;  1QAF A;  1UUW B;  2F86 B;  2FNQ A;  1BUQ A;  5I97 A;  5HGR A;  2C11 A;  2I9W A;  1GD4 A;  4IT7 A;  1W2Z A;  4KFF A;  4KVH A;  1W6Y A;  1NWW A;  5STD A;  2Z76 A;  1IU7 A;  3PZW A;  1A90 A;  3VSY A;  2UX0 A;  3BNB A;  3PXM A;  4WFO A;  2Z77 A;  1WMN A;  3DGO A;  4LZI A;  1SII A;  3E99 A;  1K28 A;  1VZZ A;  1EQK A;  2HMO B;  2B24 B;  3PCR A;  1O7G B;  3K63 A;  1IV9 A;  1Y4K A;  2XSO B;  3O8Y A;  1S5A A;  1TUH A;  3DGM A;  1SQW A;  2ML6 A;  4MMZ B;  1QVF 2;  3JUN A;  2HMJ B;  3CNX A;  3EC9 A;  5AEU B;  3WMD A;  3SXX A;  4GL6 A;  2SBL A;  1IQX A;  1OGX A;  1M1X B;  4HM3 B;  1NB3 I;  5IF6 A;  2CH9 A;  5IER A;  2CWV A;  1RKY A;  5ELJ A;  3KZT A;  4ZM8 A;  3K7C A;  3KN4 A;  4BTX A;  3S28 A;  4R1K A;  1VQK 3;  1ZX2 A;  1DMQ A;  1UI8 A;  2E2V A;  5CLK A;  3RGR A;  2CG0 A;  3PCS A;  2IA7 A;  3OW2 2;  3NV0 B;  4KZ1 A;  1HU9 A;  3GZX B;  3FG3 A;  3SVA A;  1CQS A;  2W6J H;  2BT3 A;  3EF8 A;  3J7Y d;  3CC2 3;  1OGZ A;  1JV2 B;  2P09 A;  4MMX B;  4MMY B;  4N3V A;  1QMA A;  2GBX B;  4CCV A;  3EJV A;  3QK9 A;  7STD A;  2OWP A;  1VQP 3;  1WNH A;  4HVN A;  2P0X A;  2V1L A;  1OH0 A;  3MPH A;  2CFD A;  3SX1 A;  3X3Z A;  3FGY A;  3LOY A;  1ULI B;  1W02 A;  1G96 A;  2FGT A;  3ALA A;  4FCM A;  3S29 A;  4BTW A;  2A15 A;  3SED A;  3SOA A;  3EBT A;  3CCV 3;  3CCM 3;  3HII A;  4HM2 B;  1FGT A;  2XEP A;  3RDE A;  1WMO A;  1T5Y A;  3Q1C A;  2CWT A;  2D1W A;  1DYU A;  1IVX A;  2K54 A;  3T8N A;  3T0U A;  3CPW 2;  2C10 A;  4EXR A;  1D6U A;  2XGN A;  3U97 A;  1O7N B;  2BMR B;  1E3V A;  1UUV B;  4HZ9 B;  2PNC A;  1QJG A;  1N9J A;  4HBR A;  4LMI A;  1O7M B;  4GB5 A;  3NV0 A;  3LTA A;  2WGQ A;  3MG1 A;  3N54 B;  4HM8 B;  1STF I;  1WMP A;  2P0M A;  4FMB A;  4HM6 B;  5JPU A;  2CFG A;  1GD3 A;  3JUO A;  3DZL A;  4FCZ A;  1DVC A;  2YX9 A;  1EG9 B;  4WYK B;  3WA3 A;  2OQE A;  1OCV A;  2OCT A;  2KRT A;  4LEH A;  3NBJ A;  4JF8 A;  5IG5 A;  2XGL A;  1Q7Y 4;  1NB5 I;  1LXE A;  1D6Y A;  3EN8 A;  5EQL A;  3B4O A;  3CU3 A;  5IEN A;  2CKF B;  3FG1 A;  3WA2 X;  4R9L A;  2W0Q A;  1DMM A;  1QAL A;  3BLZ A;  5AYR B;  1S72 3;  3F8X A;  4N6U A;  2IUJ A;  4HM0 B;  3V98 A;  3G71 3;  1V74 A;  3G0K A;  1ISK A;  1VQN 3;  1IT7 A;  2IUK A;  4RNZ A;  1W7C A;  5A0O B;  1Q81 4;  1AVL A;  3FF0 A;  1RRL A;  2STD A;  3B4P A;  3X40 A;  3FKA A;  1TIJ A;  3FG4 A;  4FR9 A;  2O3O A;  2RFR A;  1UI7 A;  4XDW A;  1OF5 B;  1WQL B;  3CME 3;  5D83 A;  1N5P A;  3I0Y A;  1Q42 A;  3GZY B;  3IMA B;  3MG2 A;  1VQ5 3;  4WHA A;  1YIT 3;  4HYZ A;  2BHM A;  2CW9 A;  4OVM A;  4CDL A;  3NXJ A;  1KC8 4;  5IG3 A;  3DMC A;  1K9M 4;  4HKV B;  3L0R A;  2INX A;  3FF2 A;  1KQS 2;  4WYK A;  3CCU 3;  3BND A;  4KFD A;  4EV2 A;  4XBX A;  4AEQ A;  1YJW 3;  3QRD A;  4AKY A;  4ORL A;  3DGL A;  1C7H A;  3KE7 A;  1W6C A;  3LZA A;  3F14 A;  3SOY A;  3CCL 3;  1IVV A;  1SJW A;  2OQE C;  2XSH B;  4QWT A;  3FSD A;  1ROV A;  1FGM A;  4N6T A;  3KFQ C;  4EC6 A;  3EQQ B;  2CK3 H;  3ROB A;  4R9K A;  4L8P A;  1OUN A;  1PFP A;  1Q86 4;  3PS8 A;  4L8O A;  4RZM A;  1E97 A;  1PU4 A;  1WTH A;  3STD A;  2QEX 3;  1YHQ 3;  5IG4 A;  2K0M A;  4MJD A;  3CCR 3;  1OF5 A;  2O9U X;  3NX0 A;  1CYU A;  3HI7 A;  3MHE A;  2HMN B;  2P38 A;  2E2T A;  4R4K A;  3F7X A;  2GU1 A;  1ULJ B;  3ER7 A;  3K5T A;  4LSO A;  3NQZ A;  5AIF A;  3FH1 A;  3NM7 A;  5FGO A;  1CYV A;  3X3X A;  3MWZ A;  2CFL A;  1JKG B;  3LTB A;  1FA3 A;  1K8A 4;  2JQ5 A;  4XDV A;  3OV4 A;  4U13 A;  1RN7 A;  2W04 A;  1OHP A;  4O2H A;  5CF2 A;  3JVC A;  2W56 B;  1VQ7 3;  4G1M B;  4I4K A;  4N6O B;  4IIA A;  2ZL8 A;  3GWR A;  1FGR A;  5AEW B;  5KP4 A;  3DUK A;  1SIH A;  1AR0 A;  2Z6B A;  4FCJ A;  3S27 A;  1GY5 A;  1W5Z A;  3UL5 A;  3ECF A;  4XB5 A;  1DVD A;  3HZP A;  2QGU A;  2YFJ B;  3UJM A;  2WO0 A;  4EV5 A;  4H61 A;  3N8B A;  1JJ2 2;  1RJO A;  1J2B A;  1Q40 B;  1RRH A;  2W03 A;  1Z1S A;  3OWS A;  4RNY A;  6STD A;  3MSO A;  2JDI H;  1VQ9 3;  1O7P B;  3CMA 3;  3F9S A;  3U1W A;  3OWY A;  2XH9 A;  2OOV A;  2IMJ A;  3F40 A;  3LYG A;  4K90 B;  5AI1 A;  2F98 A;  3N9H A;  1JKG A;  2HMM B;  1IV7 A;  1W6G A;  3G16 A;  2Y73 A;  2W56 A;  4HZB B;  4MEI A;  4NRE A;  4AKZ A;  2XRX B;  1JB2 A;  2W9P A;  1IQY A;  1JB4 A;  4NHF A;  1JB5 A;  5DRE A;  2LYX A;  5KP1 A;  2XFS A;  1VQ4 3;  4OUQ A;  2RCD A;  3NM2 A;  4HM4 B;  3G4S 3;  5IW9 A;  2W2C A;  3AMO B;  5ELU A;  5DRV A;  4STD A;  3LTC A;  1Q40 A;  2L4V A;  1W4N A;  3Q90 A;  5CK6 A;  4IPB A;  1NJI 4;  1JN5 B;  3OX9 A;  4K1U A;  3CC7 3;  1DMN A;  3CPO A;  3MYT A;  3PGB A;  2XF3 A;  3IPT A;  5CF1 A;  3JUM A;  1Q82 4;  4N6V 0;  1US1 A;  5IEO A;  3D3L A;  1U8C B;  1LVN A;  4N6L A;  3VGN A;  1F8N A;  1JNQ A;  2OOV C;  1FUW A;  3CCE 3;  2YFI B;  3K9M C;  1IVU A;  3G6E 3;  1YIJ 3;  3F7S A;  3GZB A;  1ASK A;  2XFT A;  3M8C A;  3FCS B;  2KCD A;  3X42 A;  1TU5 A;  3WDG B;  4J9A A;  4XBT A;  2HMK B;  2D42 A;  5FW5 A;  1VQO 3;  4Q53 A;  1D6Z A;  2GBW B;  2RSX A;  3CC4 3;  3NBB A;  3DXO A;  4HJL B;  2CC3 A;  3EHC A;  1ZO2 A;  1N9E A;  2FXT A;  3T8U A;  1O7W B;  3D9R A;  3GRD A;  5BVB A;  1AVK A;  1FGQ A;  3JUP A;  1YI2 3;  3AMO A;  3HX8 A;  1A2K A;  2RGQ A;  4EYC A;  2WOH A;  5IEP A;  1JN5 A;  1VQM 3;  5D81 A;  1M90 4;  4HM1 B;  3B8L A;  1QAK A;  2CWU A;  3GAX A;  1CEW I;  2Z7A A;  3TDG A;  3HK4 A;  8CHO A;  2Q07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...