5CF3A

Crystal structures of bbp from staphylococcus aureus
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
316
structure length
316
Chain Sequence
b'GSNNVNDLITVTKQMITEGIKDDGVIQAHDGEHIIYTSDFKIDNAVKAGDTMTVKYDKHTIPSDITDDFTPVDITDPSGEVIAKGTFDLNTKTITYKFTDYVDRYENVNAKLELNSYIDKKEVPNETNLNLTFATADKETSKNVKVEYQKPIVKDESNIQSIFSHLDTTKHEVEQTIYVNPLKLNAKNTNVTIKSGGVADNGDYYTGDGSTIIDSNTEIKVYKVASGQQLPQSNKIYDYSQYEDVTNSVTINKNYGTNMANINFGDIDSAYIVKVVSKYTPGAEDDLAVQQGVRMTTTNKYNYSSYAGYTNTILST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone sialoprotein-binding protein
molecule tags Protein binding
source organism Staphylococcus aureus
publication title Crystal structures of Bbp from Staphylococcus aureus reveal the ligand binding mechanism with Fibrinogen alpha
pubmed doi rcsb
total genus 78
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5cf3A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5cf3A02
4LEEA 4BBWA 2Y7MA 2F6AA 4F1ZA 4Q6KA 3IRZA 4FJ6A 4JE0A 2Y7LA 3AU0A 4RMBA 4MBRA 4B5ZA 1R17A 2VR3A 3ASWA 4LEBA 3IRPX 2Y7NA 4MBOA 4F20A 5CFAA 3AT0A 5CF3A 3V10A 4F27A 2Z1PA 4JDZA 1R19A 2Y7OA 2YLHA 1N67A 3IS0X 4B60A 4LE8A 5IHWA 2RALA 2F68X 3IS1X 4F24A 4JDZB
chains in the Genus database with same CATH superfamily
1HWHB 3MRKB 4NKMB 4QCIA 3WTXA 1A14L 2N7BA 3HS0C 3LQAC 2D9QB 5PCYA 3UAJA 1X44A 2FJUB 5GZOD 1KCUH 3GJEB 1WISA 5C0CA 1CU4H 3BN3B 4Z9KB 2HUHA 2PXYA 3VQ1C 2VIRA 5EV7A 5HYSG 2O6PA 2OCJA 5FF6B 3VD7A 1JF6A 4XHJC 4L8BA 1BCIA 4F80A 3MRCA 3QO1A 2V9QA 1ZS8B 4I87A 1CD1A 3G6JF 3QNYB 2A5UA 3FOLA 4NM8L 3IXTA 4J4PA 2HTLC 4DKFH 5DU7A 4AQ8C 2YMXL 3NCYP 4XP6L 1WFIA 1Q9OA 3BD4A 3GSXA 3GXPA 3OL2A 3VXRA 3ZTNL 1X5JA 4NHUB 2J5LB 2BP0A 3UABA 4S2SA 1K4DA 3PLYA 2AV1B 4K71C 3UTSA 1S4IA 3GTTA 3VQLA 3CVHB 3H6JA 4L0ZA 4ZFGL 1O6SB 2ZCLH 4PJHB 3MJ8B 5HYJB 2K3TA 5DHYB 2DEXX 5JIHA 3CZFA 2DQ6A 5KG9A 3W82A 2BSED 1PQZA 4NJAL 2B1HH 1IRAY 2XBTA 1TJGL 1KLFA 1U36A 4NCC2 1AS7A 3GUFA 4JDEB 1PY9A 4UNIA 2H2SC 1YEKH 1IGJA 1I1AB 2XWJB 1F4WH 4JRWA 1BQUA 5D7LB 3ETTA 5A6LA 4F8OA 3GSOB 5CBEA 3UBFA 5AKRA 3V4VB 4C83A 3ULUE 1P9MC 5DJ2A 2YD1A 3QEQE 4I5BA 4PB0L 3WAKA 1NH6A 2PLTA 1U3HC 2WKOA 3PREA 3GUTA 1P4UA 3NN8B 4NUJB 4N2BA 1LYQA 1MXGA 3O8XD 4X7TB 1YDPB 4XN8A 1AKJB 2VLLB 5DD1L 2B1AL 3LEXB 5F6HI 4EDXA 1BEXA 5HGBB 4PV8B 1CK0H 5L0QB 4R2GC 2AITA 2ZCZA 2B3IA 1KGJA 4YLBA 3Q2NA 3KPOA 4KZDL 5FYKE 5JO5B 5C0RL 3CVDA 1I1FA 5DEGA 1P6WA 2NY1C 2ADIA 4MNGE 2R56L 2OYPA 3ZQXA 2QLYA 2BDNH 2PPDA 4CVWA 3CFCL 4MA1C 2I07A 1S78C 2ICWA 4M3HA 2OR9H 4JM4H 5B7MA 4YQXH 1YUHB 3N9GH 4PJFE 4CNIB 1EAQA 3PXHA 5CJOL 3MRQB 1L6PA 4F9PA 2HRLA 4Q56A 3SDDA 4HPHA 5FYJU 2NTFA 2E27H 3LH9A 1UM6H 4QRUB 4G6FD 1T22B 3ZIMA 2C1OA 4HX1B 4N0FB 1M7IA 5DURD 4ZAKA 1JXFA 1MG3C 2WBJB 2VERA 4BFBD 2YGQA 1MCIA 1S9VB 2AXWA 3PHOB 4PS4L 5HD8D 5LGJA 3B2XA 5AVVB 2J8HA 1ZIBA 2XG5B 4W9FC 5KYYB 4YUEH 5JYMA 2ZXBA 1DSFH 2WINB 1DVFA 1V55B 5FUOH 3ET9F 3E38A 4XAWL 3PAVA 4HFUH 3O3EB 1E4XH 4HH8A 4F5CE 2B14A 4HWUA 4U1NA 2XJKA 3D08A 4RGND 4L3EA 12E8L 4XN4A 1FRGL 4IIQB 3S3SA 3GS7A 3FQUB 5DEFA 2WQ8A 2CALA 4ORGB 5LXGH 1F3JB 4ZG1A 4QLWA 3FYEB 2CO7A 3KAAA 4NQXB 4UM9D 2R4SL 3NP4A 5LGYA 2H0JA 2WVVA 4L8SA 1BVOA 5EU3A 1KJ2B 5IF0B 1J5HA 1SOXA 3BISA 2NR6C 4Q6IB 3BAWA 5FGSA 4KKQA 2FO8A 3VDAA 2PCYA 1KCRL 4W9LC 3WO4B 1OP3K 3O8XC 3KPSD 1S7RA 4AUJA 1KTJA 5DS1A 2JKLA 4P23B 1KGXA 2DAVA 1Q0EA 2OCCB 4JDTL 1DEDA 3IDMB 1HC1A 1P5UB 4H1LH 1FQ9C 1TZGH 5IR1A 1CDCA 1QSFB 5D1ZA 1V3KA 4XVUD 5K9QI 3MA7A 3OF6A 2E7CA 3EGSA 3FU6A 4UIKH 1NMCC 1QTSA 1OP4A 1D5XB 1TCRA 2MKWA 5IROA 3HN3A 1ZVSA 2OSXA 4XVSH 3CVCA 2XWRA 4F7MB 3O41B 2X70A 5C92A 1G4MA 2XTSA 2N56A 1G1YA 4Y2DC 3EYOA 5E6YA 5I2IB 2AXGB 2ZOKA 3VFRA 2BIPA 3I3BA 2Z31C 4PRHA 3DVNB 4NO3A 4D9RE 3STZA 3V4LA 2VLRD 3ARFA 5CEYA 5FECB 4W4NA 2TAAA 3QCUH 4EN3D 3BGMB 4G8GD 2BOCA 2ENPA 1MFBH 1EHLL 2CDEB 2VERN 2NDFA 5EZLB 4PREB 2FYVA 2KUTA 3L7EB 5ID0A 2NUPB 2AJSH 1GHFH 3WIIH 3HAEH 3Q6GH 1KTRL 4MA1B 2WLNA 1YMHB 4F1ZA 4R0LB 3B5HA 3FU3A 1UB5A 1UH3A 1TIUA 3RWEB 1OM9A 5DFTA 1XF3A 3GRWL 1SHWA 2BVPB 4WO4D 5AWNL 4HWZB 1KIQB 4L2YA 1R24A 3SYAA 3V8OA 1T0NB 3DIVA 1D9KB 1U41A 3OXRA 1RLBA 2G0KA 2Y1YA 4AM0B 1PZCA 3EHBB 3MNZB 3CBJB 5G4MA 3D9AH 2P80D 5BZXA 4NGHH 1IM3B 1JZ6A 5AYUH 3UYOD 4NCC1 3D3VE 5LG1A 3GO1H 5BPPA 3QUKB 5MERA 4OJDH 1OGAA 5C8JA 1EVUA 4GAJH 4PJCB 4U1LA 4H0GA 3RX8A 4B9PA 1JVLA 3Q2VA 1NGXA 4RSYA 5I1EH 1IUZA 5D7SH 1U3JA 3C5XA 5C07E 2BIIA 1EMTL 3WFBL 1UXSA 1BA9A 1UOWA 4WU7B 1U8JA 3S8WA 4J7RA 4KZ0A 1ITBB 5D7IA 5HJDA 4ZQKB 2OL3H 2JCCF 2WNWA 1I3GL 1QWHA 3QIWC 4XNDA 2BWDA 1CE1L 5CJOH 3T2NH 3Q7JA 1U3HB 1M05B 4HF5L 1UTDA 5LQBL 1BEYL 5JTWA 1IKNA 4KUCF 5D9SA 5GS0D 1JDCA 3DIDA 4UU9A 1SQ2N 2BWIA 1QBML 2KH2B 4X42A 1AANA 3L81A 3CHSA 4PVBA 1HL4A 3ARYA 3G6JB 5DMKB 3V5HA 5IMOA 2BK8A 2DBLL 3LQAH 4Q4IA 4TTGA 4APQA 3QEHA 5C1MB 4EN3C 5KYXB 2DYPD 3TN0B 3HLKA 1AXTH 2GJ6D 3EFOB 2WUCL 2DQFB 4HC1L 2YD0A 2ICEC 3SGKC 1GKEA 1HEHC 4KRNA 4W1TA 3HS0B 3O4LD 12E8H 5AW2B 1ZRUA 3DECA 2JLLA 4LNRA 3QQDA 2QZ5A 4OSUH 2J7LA 3QORA 5H37H 2CDFA 5CN1A 4J6RH 1EZUA 4LBEB 2PWHA 3CAFA 5HVGB 1HN1A 1YNKL 5FWQA 4LHUB 4ACPA 5EPMA 4C83B 3QFDB 4R96B 4FFVD 4FQQA 1X3DA 3T2LA 4EBQH 2NY2B 3W2DH 3Q9QA 1UA7A 2FX7H 4MLIA 2H2PD 4M9OA 4GIOA 2VAAB 4NRYA 3MRNA 4HJEA 2GUOA 1A7BA 2A1WH 4XGZA 3RWCA 3TCTA 2ODIA 2CJSA 4J6RL 1FSKB 2XBZA 1LP9E 2EACA 5I0XA 4AT6B 4JFEA 2J1YA 4OLVL 4ZX4A 4PJ5A 3W0WE 4F57H 2VIRB 1HH6A 3RNQA 43C9A 2GBTA 5EWIL 1MCHA 4OT1L 1ORSA 1BAFH 2FECL 4NT6A 1UWYA 4QD2E 5BJTA 1RK7A 1U8IB 1MPAL 4XWGH 3FU7A 3SDCA 4LSSH 5F9DC 3ZYIA 1A02N 2FIKA 4FFZA 5ACZB 5DC2A 3QZWB 2E47A 3JVGA 1ED3B 4WQOA 4QRUA 4U6XB 4P59L 2WXLA 3T77B 4A04A 5I1AA 3L6FA 1KBKA 4ERSL 2WLHA 3IJSB 1XGTA 2MWCA 2X89D 5DC9B 2MFNA 2HLAA 2J8UF 3LKRB 1AZNA 4HP5A 4F2ME 2Q2EB 1NLDH 1KLFB 4GH7B 3SN6N 5CFHA 3DIFA 3S37X 3BPCB 1UQSB 4WWKC 2AJUH 4WRLA 4K3DL 5I18L 4FTVB 2XKSA 2RJMA 4ZNCD 1KB9K 3GUTB 3CZUB 3O2WL 4NKIL 4ONGH 3BUDA 4PJ7E 4Z7UB 3GM0A 5CNHA 4P4KA 4E36A 3IDNB 2B1HL 1RZIA 2IBZY 4ABQA 5C9JB 1QA9B 3IAQA 2J3SA 2ZX5A 3LKQA 3N0AA 4HGKC 4A7QA 3HE7A 1QBLL 4TS6A 1TXKA 3P3TA 1AO7A 1MCPH 1D9KD 1EFXB 4I0CC 5FK9B 3SYQA 1I8UA 1CDHA 2VOTA 2Z93B 4V33A 3DNKA 2W81C 3KLQA 4CVXA 5AALA 5E4IA 1V54B 1Z1WA 3GSRB 2PABA 3BP4A 5TDOB 3K6FA 4JZJA 5DQJB 2APWA 5I17B 4YXHH 3QT2A 5ILTL 1A3LL 1EEYB 1XMEB 2XPYA 2L7UA 1JYWA 2CAKA 2VZOA 1WE5A 2EAEA 2O5YH 4P2RB 5B38A 3NVQA 1K4CA 3SY0B 4JFQB 1C8PA 3U0PB 2IDUA 3PHAA 4LSDA 4QXTB 2ITCB 4JM4L 4BQ9A 1KCSH 3REVB 5KBLA 2Y36H 2YLHA 4I18B 5CJBA 2DJMA 4X7SL 3SE8L 2YGOA 2EC9U 2KLSA 3VH8A 1BZ8A 1UACL 4JFOA 5C0GA 1NTDA 1CFNB 1T7XA 3BH9A 5F93C 3VGAC 1FAIH 2ILLA 3BO8B 3IJEA 4OCXH 4L0YA 1R3KA 4IOFD 2CXGA 3PV6A 3QA3A 2HSIA 1SN5A 4GBXD 2NY7H 4KUZH 1KDIA 1CGUA 3MBWB 1O7DE 2MOQA 1BAFL 1JFHA 4DH2A 1JK8A 4JQVC 5KOMC 5EZOL 2CNZA 3T0EC 3E80A 4PI2A 3T6VA 4HIXH 1WV7T 4ZYKB 3T3PF 1SBSH 3V8CA 3PAUA 4PP2A 4ZO6A 1XGRA 1ESOA 1MWAL 3FTUA 2KKQA 1E9OB 1S7SA 4KO9A 5DJXB 2YQ3A 2VT0A 2ZCHH 1BZ9B 1OAZL 1MFCH 4I77L 4A6YA 4WWKA 4WI3A 3QEGL 4JO1L 1O75A 5LDSA 4MMXB 5GGUA 3G5VA 3WXWH 4XVJH 4LVHC 2OMWA 1GZPA 1MDAA 4TMPA 3LPGA 1UH4A 1TZ8A 5FUZH 3IYLW 4BRVA 5K59F 2NUTB 4LAQL 5DCCA 4DGVH 3F62A 3LTVA 1B9ZA 1MREH 1RZGB 3QXDA 4MNGA 4LLYA 4QRPE 2ISDA 3RU8L 5J6GA 5DRZB 1M57B 3D05A 2QQLL 3DV4A 4FGMA 4XCFH 5E56A 1WS8A 3K2UH 3R06B 4JQXA 3DXAA 3UH8A 3P3UA 5F9JA 3MNMA 2YFNA 3TNNA 1LDPL 2A77H 4NUGL 1BXXA 2X1OA 4I0PA 2EUXA 1EVTC 1KACB 4OFIA 1Q9WB 1GCYA 3QNZB 5FYKU 4I8DA 4UI2A 3U1SH 2LU5A 3QUZC 1CVSC 3U25A 4YSSA 4AL8L 2A3TA 1TNNA 3KH3A 4MMZC 4RCAA 2QELA 4MVBC 2UY7A 2W88A 4L8DB 5DK3A 5DRWA 3RIAF 4ETQB 2Q5BA 4PJBA 3RHWK 1I4FB 3D3VA 1UCBH 2P24B 2DM4A 1E5YA 1U58B 4R97C 3ZXAC 4ERSH 2V0AA 4IOFC 4XN5A 1OE3A 2C7UB 4N2DA 5ALCH 5KTEH 4MJIA 1UVQB 2VLKB 2AV7B 1DQDL 2WUCH 1UKTA 3FB8B 4OIBA 3L5WB 5K93A 4A7GA 2HFTA 4Z7WB 1S78D 3QZOA 4NNYA 3X12A 3M45A 1W0VA 4CGUB 5FF6A 3T1FB 4TRPH 1B2WL 2XT1B 3L4ZA 4QXUH 4EIUA 3W37A 3QIBC 4XNZC 1NCBH 4WEMB 4Y5VA 1J8KA 5E8OA 4G82A 1IEHA 3AREB 4JPWL 1TU2A 3LKSB 2QR0A 1RJLA 4UT7H 1BLNB 4XMLH 4BH8B 4OZFG 1LK2A 4APXA 4ES8A 2W80C 1AG6A 4BQCA 5F1NB 5FX3A 1YMME 2IH1A 3WIFB 1L0PA 5ITFB 5KVEE 1KTDA 2R69H 3JZ7A 4NBXB 4U3XA 1EEUA 3GNML 5LAXB 1LO5A 3QFGA 1IGYB 4MJ6B 5F7BA 1U8MA 4NXKA 4BE6A 1JF5A 2CA3A 2BP8B 1IGJB 1OAZH 2XWJA 5C0DA 1U2CA 1B3JA 4GO6B 3CC1A 5IW1A 4NZFA 5I1GL 5E8PB 3KWWB 1FNLA 4Q0XL 3QEUB 2NY0D 4LCWB 3WTWA 4KROC 4GS7C 5C0IA 2OPCA 1UC6A 2VDPL 5H35A 3NEEA 2X87A 1PZAA 1IAIL 3CX5K 4G42A 1RMFL 5A6IA 1L7TL 2NYYC 1CIDA 3BSZH 3HE6C 4XPHL 3OG4B 1MJ8L 4RFNC 4UQCA 4ZW7A 5I71C 3MGAA 4NO0D 3ALWA 1E28B 1II4E 3EDKA 1KV3A 1XX9C 3CPLA 5EIVA 1QWUA 3QDHA 3TN0A 2EIJB 2KZ1B 5CEXA 2BSCA 5FB8A 2YQGA 4ELKA 1OVZA 4X6BA 4GFTB 4NQEB 2EUVA 2MCMA 4U1KA 3B3IB 3MREA 4Y4FC 1U8OB 3RVXC 3PWNA 5IY5B 3CHQA 2MKLC 3L6FB 5HGHA 1RV6X 5AD0A 2QADD 5EU7C 2UZXB 1DE4A 1FGNL 1ZJAA 5K9JL 4AIEA 3AAZB 3RL2B 3IFPA 1TJHH 2A9BA 4PRDA 4IKNA 4UAHA 1KTKE 3VM7A 5F0PB 1CU4L 4I2XB 1RZJC 5AW0B 1B0GB 3IE9A 4ODHH 5BV7L 4G7SB 4KX8A 3MBXL 1MFAL 3IKCB 5CZRA 3VFMA 2QTVA 3DOSB 2WBJA 4MXQD 3C75A 1Q1PA 5EO9B 5HHQA 2GSIB 5E8DL 3FQRB 4HLEA 1DFBL 3TBYA 5I8KH 3DVIA 4JHZA 4XTRD 1G9MH 2D03L 4PRPD 2NW3A 3WN5A 3UCQA 3N41F 1O7DC 1BYNA 1MREL 1KZYA 1G4RA 3ULUH 4OQTH 4GINA 5F6HJ 4F2EA 3AY4A 4P5TC 3HB3B 4WUKL 3IAGC 4LP4A 1P4BL 1R3LA 1EFXA 5FK9A 5C09D 2ESVB 3EJCA 1R5VA 4HDIB 4PRPB 4PWFA 5TPWH 4JDZB 4U1MA 4BBWA 4GP4B 3EDJA 1K8DB 2XWDA 1WC7A 3IXTB 2DQIH 5B4MD 2FO1A 2ED7A 4GJTB 1E4XI 3MGTB 3ABLB 3IJ8A 3NCJL 4CVZB 5BRZE 5HPMA 1K4CB 2Y7LA 3SY0A 3KL5A 3GSNA 1WHOA 3X3FH 4BH7B 2WCPA 3PF2A 2VQUA 4PWJA 1AP2A 1QUNA 3HI6L 3B1UA 4G2AA 1FH5L 1SLXA 1UEYA 3BVUA 4M56A 1HTYA 3F04A 4G43A 4NUQA 5DD6B 4LCYB 3S36H 1R47A 4NJ9H 4PGCA 4QHKJ 2CUAA 4HPOH 3I75A 2AI0L 1BXVA 1I7TA 3N2JA 3ZTDC 1F2QA 1RLWA 5TPWL 3S3PA 6FABL 3PQYE 4PJDB 2C3VA 4XI5C 4UWQB 4X7DC 2OMVB 4K2UH 5FHAL 1K6QL 3B9DA 1UH2A 4BCYA 5LQBH 3LNHA 4S0TD 1JWSA 5KUKA 5D55A 2R1WA 3S5LA 4H2CA 3QAQA 4H26B 2CJUH 4ODSH 4OLUL 3ULUC 3S4SA 1JZ4A 2EDRA 3QUZB 1EV2E 4M4RA 1RPQA 3MLZH 4AC4A 2NY6D 4GQRA 5GSRB 4NQDA 5HHVL 2LAGB 2VLJA 3LSOB 3DVNA 2EDXA 5E6IB 1HSBA 3BT0A 4HXBL 1F41A 5D5ME 3RQ3A 3AQXA 2OSYA 1OAKL 4X9GA 2A6KB 1R3JB 4JPQA 3IDIA 2Y3NA 1SLWA 5D7KD 1DDTA 1I9IL 2LLGA 1DVFC 1V3MA 4KTDL 1HEJC 1QRND 3VXSB 4PJ6A 3FO1A 1QBLH 3GKWH 5IB5B 3NJVA 2J5WA 3UBXG 3MQIA 2XSKA 4LOUC 2GHWB 4K7PL 3DJ9A 5ICXB 5CGBA 1KYDA 4CKQA 4YSRA 5EIIG 5EF2A 5D7KE 2F54E 2ITCA 4UTBH 1A22B 3JT2A 4F37K 1C12B 3AUWB 5I16A 4FN0A 4ZMPA 3KWXA 3ARGD 4HCGA 1IM9B 1J0YA 3FJTA 2XVBA 3BCDA 3AMKA 4LL1A 4OKVA 4B41A 2ZOLA 3DJTA 4K94C 4FJ6A 3H6AA 3L9BA 1PTZA 3QQ9D 5CEZE 3EJRA 3SEPA 4PTUB 1XGQA 3KXFE 1IC0A 3TYGL 4LP5A 4ZD3L 5IHLB 3MZGB 4BV1A 4CMHC 1THAA 1MIML 3MO1B 2ROYA 2BM3A 2XWBA 3QARA 5HVHC 5CIPB 3W0WD 3A6BL 5CJXA 3GLDA 3C09B 5EN2A 4QRAA 1G0YR 5HDWA 3UP6A 5JHLH 2WP3T 3DPBB 3SE9H 3J07A 2C7FA 1PX8A 1N3NB 3IKKA 1IAIM 2BIOA 2C9UA 4NNPL 2DB8A 3UAFA 1SVZA 4X0KB 4M43H 3GZKA 4PHXA 5FGBA 3LJ3A 3OKLA 2CNYA 1JV2A 3WNOA 2ZJSL 3G6JA 2ZOTA 2IANB 4PJ7A 1P5VA 2Z35B 2G75A 3IFNH 5ANMA 4M61A 4LCIH 3B6SB 5C70A 4U3SB 2TSAA 4NUPA 2XWTB 3LRMA 4BSVB 1IKNC 5CLXA 2DDQL 2KMWA 1OCWL 2COQA 4F93B 5I1EL 3LX9A 4OJCA 1QUPA 3EFOA 5BO0D 3L5HA 3KCPB 1K5WA 4BH8A 1F3RB 5IMOB 4GKNA 1Z3RA 3LNEA 3WU1A 3IDJA 4HIIB 4OD3L 2E7BA 4P9MH 1JTOA 1T0MB 3KR3L 5TQ2L 5JO5A 1KT2B 1KB3A 1IC4H 4UOJA 3SDAB 4G7VH 1E4XL 5A3IC 5IFJA 4JZOA 1XSKA 3UYPA 4DP2X 3LS5L 3O3BA 3H3KA 1BVLA 2F7PA 3HUJF 3FUMA 4BXVA 4OFKA 4XT1C 4X6DE 2X2JA 4H13C 4AVIA 3FOLB 3WEAA 3G7TA 5J6HB 2FJHB 1PIFA 2WZ6A 1L7IH 1JWMA 5CN2A 3BZEB 1FYTE 3FO9A 4AW4A 3GKWL 2AJZB 5DJDA 2I9LB 5JXAH 3MTXA 2UWEF 5E1AB 3GC3A 3VAEA 4IRJB 1T22A 5EPMB 1ZV2A 2V7NB 5EO0A 1YMMA 3UBHA 4W4OC 3FQTA 2XG4B 3IFOB 3STLB 2FJSA 3L5JA 5I8OL 1SHMA 2HT3C 3ARTA 1WGVA 3RTQB 2H32B 1MHHB 5HGGS 3NSDA 3TZVC 1MF2L 1P0SE 1I7RA 2PTUA 3LYRA 4Z7OE 4WEEA 3BQUA 4Y2LA 4CN4A 5HYQB 3AUVA 1OOWA 3VXUB 5I1KH 5F7WC 3MV9A 5K39A 2XA8L 1IC7L 2CO6B 2GTQA 2FEDC 2XFXB 4NN7B 4YBHA 1ZJBA 2D31A 3VNZA 5ACMA 1XZ0A 5HGAB 3L1FA 2XQYG 1IGMH 1EAOA 2J73A 3EGDA 4M5ZH 4ZS6D 3U6XA 5C0CD 3RJDA 3ZKQD 4HIXL 4ZQKA 4G1EB 2YR3A 4JGMA 1JN6A 2VWEC 3EGXA 3HB3D 4GBXC 4I48A 2IPUG 1WP6A 4XVTL 2ADIB 5FM4A 3VWJA 1S8DA 2KL6A 3GXIA 1A4AA 2WMPA 2I60L 4J3SA 1CLVA 1SF5A 3GMPB 4MXVF 2BIHA 5DD1H 5D6CB 2Z0UA 1ECZA 4L3EE 5I6XC 5JUEH 4JFZH 3UC2A 1D7DA 3D2TA 2XU9A 2BVYA 2CDGB 5IK3A 4JDZA 4DKTA 3SSGA 4LRIA 1VGEL 3AXLB 3H2WA 1QBAA 4OF3A 3SYCA 1ES0B 3CCHA 2DRUA 1CZ8L 2VMCA 2FT8A 3SBWA 4XNUL 2BCKB 4K3EH 2J1WA 4JL1A 1W2KT 4PRNA 2UYLA 4Z7UA 2XJLA 1A6VH 4LSVL 1ACYL 5E94A 4L9LA 4FFYL 3WFHB 3CFMA 4Y16D 5IB2A 4ZXBA 1GYWA 4ZAKC 2XYCA 1HIMH 2CDEA 1URIA 1TO4A 2YA0A 1OP9A 1QNZL 1Y1UA 3V10A 2R29H 1YN6A 1U33A 4YHMH 4UMSA 1VAHA 2W95A 4MWFB 4NM8H 1NCJA 3LXCA 4DKFL 3O3AB 4W81A 1D5ZB 1YNLL 1WZLA 1PVHA 5LDUA 3QIUD 3EYSL 3OGOE 1BJ1J 3QUZD 5JA9A 3SIKA 3WY4A 4E41D 3QIWB 3DLQR 1NJ9A 3R4DA 2V4LA 1K2DB 2P8PB 2IGFL 4WDIB 4D0DB 3KMDA 3FCSB 5FLVA 2BFVH 4XGZB 2CR0A 2MCAA 4KVCH 3HZYB 2R1YB 4FULA 1TFHA 3WJMB 2EDNA 3ZKMD 2ATKA 1QSFA 5C7XH 3LDBB 1RPUA 4NQCD 2DLIA 1GIGH 3CLEL 3HNSH 4JRYA 3VXPB 4B5EA 3UJTL 2X4NB 4I3RH 3LKNA 1MW1A 4JRFA 3UTTA 1VFMA 4CC1A 4OLWH 4Z7QE 1N8ZA 1UD3A 5DD3L 2Q8AL 1X7QB 2V33A 4C56B 1HDMA 4WNJA 4YC2C 4UM9B 2D7TH 4HAKA 3NPSC 4ZUTB 2KPWA 4G9FB 4O51B 4U1HB 4YSDA 3OKOA 3ARED 3APNA 2YN3A 4QAMB 3T0EE 4OZHB 4D9QD 1F3JA 4Y5YB 3CH1B 1IV8A 3HAEG 3MXVH 1MNUH 5BJTB 3TIEA 1JPSL 1ONQB 2HTLD 3LN9A 4JGJA 4L1SA 4R0LC 1WWAX 4L3ED 2MCPH 3CVBA 4GEIA 3FTXA 5L9DH 4V1DD 1C5CL 4JY5L 3UGEA 1BQHA 1XGQB 3K3QA 4N2OA 2BY2A 4HIQA 4AJWA 4XX1E 1R3HA 1GS8A 1JE6A 4OU3A 4HJ0D 1SY6H 1NBCA 3WEOA 2ZG1A 3MUY1 5EFIB 3MLYL 4FI7A 1SBSL 5FHBH 4DW2L 4TVSa 4HXAL 1RIHH 5EN2B 4JR9L 3S36X 1N70A 1YEEL 2P7TA 1Q38A 2XC8A 5L4MA 4M6NL 3KYMB 2F8OA 5HHOA 2DLEA 2YGNA 3RWJA 4M43L 1AHKA 1A21A 4IJ3C 4JO1H 4PRID 4ZO7A 4YLCA 2WQVA 2QVFB 1TVHB 2NYYD 2YEVB 3HE6D 1TZOA 2IBZX 4MD4B 1E27A 3T3MF 3FUIA 4OZGB 5KJRH 1KEGL 2IMMA 1MFUA 4QIRA 3KXFA 3GSVA 2C7UA 4XWOD 2WZPA 1QHOA 3ULSB 3P3YA 3SKMA 1PAZA 4TKWA 1NEZA 1YYMH 4KPHH 2XTJD 4KAQL 2QKIC 3IK2A 3U0PA 3C8HA 2APTA 2V6HA 4ZFFA 3VWJC 3RZCD 4YAQA 5IGXL 1OSZB 3Q48A 4HHGA 4TOYL 3QUXC 1PNDA 3QG7H 3ZL1A 4ZUWB 4C4KO 4Y4HA 2H7WA 4ZPTA 1WWWX 2R0WL 4YDVA 4LPYA 4UNTA 1DN2A 3UTZA 2CZNA 2L3BA 3ESOA 3DX1A 4M1GL 1HNYA 1KT2A 4N8PA 2IPUK 3UG4A 1KG0A 1DJXA 5KSAB 3GRBA 1H6TA 2XXGA 1UEMA 3DWTA 1MOEA 4PW3A 2N0MA 3A22A 4OZFB 3KPNB 2DMGA 2SODB 4W9DC 4YDJB 5CKAA 4NC2B 4IBYA 4N28A 4QHUA 2LHAA 3VFVB 2WQSA 4J28A 4FLQA 5CJQL 5HY9B 3ZOAA 3STBA 4KKAD 5GGVH 3EJYD 3QO0A 3L4TA 1VESA 4U4IA 3EO0A 3VFWB 1VEPA 1RZKC 1I1AD 2OP4L 3UACA 4UZSA 1HESA 2G2PA 2FGZA 4DZBB 5KVGL 3B8YA 4HJ0C 1YECL 5T3ZE 4MTMA 4OTXL 4A68A 3V79C 2ZONA 3AADB 2G2NA 1SVBA 3EYVB 3LKRA 2EYSB 1OPOA 1QACA 2Z91A 1CGYA 1I7ZA 2P8MB 4FQXB 1KDJA 2NX5A 2OMWB 5D4IA 4N6RA 5IMKB 2R83A 4KY1H 1GHFL 5D9SB 1AGEA 4ZOAA 2BOCB 4Z5RB 1BFOB 1GSKA 4A6YB 4N2IA 3WNIA 4NC1C 2DICA 2J6WA 1HOCB 3HOGA 4M5ZL 1NDTA 4ZPVB 5H2BB 1XZ0B 3MLRH 1X5ZA 1J9SA 4PD4K 3D09A 2KI6A 1SJEA 2YOCA 1ID2A 3O6KL 2QVKA 2PXYC 2OR7A 4ANKA 3IGUA 4OB5H 1IAOA 2OMBA 3IGKA 3NIGB 2VDKB 4N2KA 2NY7L 1ML0A 1QFUL 2VAJA 4H4NA 4KUZL 3ZHKA 3PDOA 4GRLD 3N85L 4FCAA 1ZSHA 3H56A 1IM3A 4JCLA 2YS4A 3D87B 1EAJA 2IH9A 4HAFA 3JWNC 1BYOA 2V3FA 3CSTA 4QXVA 2P48B 3V9CA 2MCPL 2OJZL 4OVUA 4WY7H 4ZFQA 2V2TB 1INDL 4FXLA 3BOVA 3DOSA 1HQRA 3NRPA 4B95C 1USQA 3CQPA 3DMMA 2JJTA 2FO4A 3R18A 3E3QC 1MSPA 4DNLA 1AAJA 1XB6A 3PFUA 3TT1H 2UVFA 4ZFOL 4FXGA 4IRSB 4LOUD 1NAML 2Q20A 1D5IL 3PWPD 2CG9X 4HSCX 4HCRL 4WHTB 4XMPL 3VI4F 3H7BB 2WB1A 1UOKA 1DQKA 5HI5D 4I4WA 5CGMA 2OBGA 4QLRA 1X9LA 3H9SB 3VI3F 2GI0A 4Z3GA 4OJEH 2ZUYA 4WJG3 4ZSOB 3QS3A 4TVPH 2XUWA 4HISA 3PWPE 3MLVL 3I2CH 5DA0B 1A6TB 1NLDL 1N9PA 3HC2A 1DQMH 2K9FB 5C9JA 5LXGL 5FC9A 5IQLA 1IIKA 2V3EA 3II2A 2F53A 1O9ZA 4OCYH 5LAXA 3T3ME 2AQ3A 5D1XC 1F90H 4HC1H 1G7JA 4EDXB 2B15A 3O3UN 2LR4A 4DP4X 5DVNA 1IL1A 5L2KD 3EDEA 3QH3B 1XIWC 2WV3A 3OMZA 2EC9T 5AVSB 4BGDA 1DO6A 5JYLA 4POYA 4P2QD 1QNIA 4AUYA 1AKJD 3DX7B 3WD5H 4ELMB 1K5NA 2H41A 2PYEE 1LK3H 5DI8A 3V4PL 3MRJB 2DTSA 3SCMA 2GIYA 1GYAA 2BNUB 2Z4QA 3BSHA 1DQIA 2VZTA 4RVBA 2Y6TE 2X89A 4S1DD 5EUKA 4HEPG 4OF0A 2A1WL 1ADQL 3V0WH 2DWEA 5CMAA 4GQ9L 5HDLA 1A3LH 4OZHE 4AI7A 1MCFA 3ZZQA 4NRYB 2AQNA 4R5VA 2F8XC 5JLZB 3VFTB 4K2UL 5HHNB 1M7IB 4U1NB 2FBOJ 3R8BB 1DE4B 3WMQA 3OZ9H 1P4LB 4HOXA 1EBAA 1TYJA 4Z77B 4TTDD 4IIQA 1FO0A 4JRYE 1AO7B 4X8GA 3H0TA 3AITA 1DVFB 2FD6L 1GC1L 1CBJA 1MVFA 5EZJA 2JELH 3PWUB 1AH1A 3CFKA 1OF0A 2G4EA 1RZ7H 2VLRE 3LRGA 1XH0A 5GZNC 2J2ZA 1WBYA 2B1AH 4GSDL 5E1HB 5HI5C 2Y22A 3CIAA 5D2LB 2ICWJ 1CLYL 1W72B 1WRFA 5C7ZA 5SWZE 4DPAX 4U7MA 3SE4C 4HBCH 3AGVA 1VADA 4JCMA 2XY2A 5KSBB 4HGWA 3VXTA 1BWWA 3BJLA 2X09A 1KLGA 4Y4KD 4FFVC 3NIFF 4PBVC 5H94B 3O4OC 1BIIB 2BFVL 3ZRCC 1RZGA 4LSPL 2XN1A 3C5ZA 5ERWA 4FNUA 3W9EB 3ZDYF 1HNFA 1IBFA 2YD7A 4X9HA 5AL0A 1DBKH 5EBGA 2YFOA 2Y5EA 2UXTA 1N8ZB 2I5YL 3NEOA 4OCLC 4GAGH 2LU3A 4Y88A 2COVD 1NGPL 3PQYD 1DVSA 3TZVD 3FUEA 1DLHB 2WQWA 4MMYA 2L7EA 3TO2B 2JMRA 3O0RL 1H3XA 1KJ3H 3MXWL 4WF7A 5GSVA 4R9HA 5C6PB 4YHKL 4IM8A 2F7OA 2XX0A 3SDDC 1E9OA 1S7SB 3FRPG 1JK9B 4X8JA 5HJGA 1AY1H 4F7TB 4FMVA 4HHAB 4DTGL 1Y0LA 4O4YL 4UBDC 2EZ0C 1BF8A 3ASOB 3V4VL 3ZTCC 4BFKA 3K2UL 4Z7NB 3L1OH 5A43C 1FBIL 1WH0A 5T1DH 4K73A 1MIMH 4Z7UE 5T1MA 4AY0A 1AR1C 2X53A 5DHVH 2QSVA 3S5LB 5KOVC 4Z7OF 3HB3C 3L9EA 5C0ND 3BYYA 3AGWA 2JQMA 4JY5H 2F18A 1UJ3C 3GXMA 5C0AA 3SJVD 4BIKA 1BZDA 1I3RA 1FFTB 1VGEH 4P46B 3OKEA 3A67H 4HWEL 4NQDB 3WYRA 2WXNA 3Q6FA 2MPAL 2FNBA 4FQXD 4O2FB 2OXHA 4HIEB 2R8SH 3HMWH 5F6IC 3D06A 4PJEB 5EC2B 2A7BA 1MFMA 1BD2B 3RWEA 2VLMD 3I6GB 3QJQB 3QUXA 3IFPB 3WFCH 4K7FA 3T0XA 3RTQD 3T4AB 4XNYL 4LK4A 1DZ0A 4XP1H 2JCWA 3LZNA 2EXWC 2YC1A 5DYOA 5C0FB 5FUCE 4XVTH 1UXSB 3LMJH 4MYPA 4XCCL 5IB5A 2Q3AA 3BPLB 4Y4KC 4NHCL 3U2SB 3MA9L 1U58A 2VKXA 3VRLF 4TF4A 3WNLA 1ZS2A 5ESAA 1NCUA 5C8JB 4HPYL 4WJ5B 2WXRA 1FL5A 2OMYA 4E42B 1E90A 1NCAH 2W60A 3FT4A 4KK6C 1DSWA 3SPVA 2G5BB 1PY0A 1CE6B 2TRYA 3VRJB 1BD2D 2BVUA 2R27A 2EQDA 1AGDB 3NSCA 4RFNB 3QDMA 1UFUA 4U1JA 3GHBL 3V4PH 5KSAA 3RKPA 3CSGA 4ZO9A 5E2WH 1BMWA 4J2QA 3BSGA 2YRZA 3CXFA 2OA9A 1M6OB 2BNRD 4LSTH 2VDOB 1CG9B 1JXGA 1EWHA 2VKWA 4OGAC 2CUIA 3IMBA 2XQYK 3CPLB 3BWUC 4OZIE 2Q6WB 1Y6KR 2A6DB 5T33L 5DTFB 2KQNA 2H4EA 5IUSA 3N40F 1H5BB 4EO5A 2BS8A 2ZWNA 1AACA 2FEEL 5CXPA 2MTPA 1OGTB 4PSPA 2XTLA 3QUMH 3TA4D 1OAQL 2VDPH 1OWRM 2LV4A 4YHOL 5EA0L 3RNKA 4HS6A 1LO5B 3T0ED 1TEYA 2YGVA 4PGEB 3D48R 3DKHA 4P4RA 3UJJH 2OJEA 2R7EA 3C9NA 3AREC 3HRZC 2WN3A 4MAZA 4JZJC 3ABMB 3ME0A 5AW3B 4JRLA 2A9ML 4WSKA 1BGXH 2GJZB 3Q5OA 3RRQA 3SJVE 3FBQA 4XNZB 1FP5A 2EDFA 3R4RA 4PSRA 2K78A 3ARPA 1DQML 4ZX6A 5BZWA 2GB2A 5F7LB 1T6VN 3FB7B 2P8LB 4XCEB 4MJIB 2IG2H 2AMUA 2PCPA 2BXYA 2FYYB 5FCUH 1GCFA 1TF4A 4U33A 3Q1SL 3GLZA 1ZLWK 1NDMA 4AYGA 3QFDA 2NY0B 2ZCLL 3U30C 43C9B 1L9OA 3M17A 3ZKXB 4AE1A 5A2JH 4YBLC 4QTHB 4C8XA 1AJ7H 3HHRB 4UIMB 4YDLC 4AZUA 4EOWL 5AW4B 1SZNA 1J1PL 3QQ4B 5E2UH 3RHWF 1ND0A 4W9CC 2ZWLT 5IBLC 1A3RH 1FVEA 3SE9L 1CXHA 4FNPA 4J3TA 4RAHA 1YDPA 5C0BD 2G3MA 3ZTJG 4DAGH 3O3BB 1RK0A 1B9KA 2YPLE 2FDBP 4MVBD 4DJMA 5F1NA 1CLZL 4KK9D 5FA3A 3SYPA 1HHHA 3E6FB 2J44A 1JG9A 3VXRE 4XWOC 5SX5K 5DJ8A 4TNEA 1BVNT 3L3HB 5E2JA 3EOBB 3NCJH 4MDJA 4OUUA 3QAZC 2R56H 3VFOA 3D0AA 3BXNA 4PRAB 2OQJA 1WK0A 4KVNH 3MV7D 4N5EC 5D2NE 4HPOL 1QR1A 2Y1ZA 5D96B 3KBPA 1AQDA 3VRIA 2VW6A 3EYSH 1WBZA 2FRGP 3BZFA 4QO1B 1U8LB 4LRNL 5BXFA 3ZHFA 3NK4A 4JKMA 1ASQA 1MCJA 5CJ8A 4XHJD 4K07A 1RI8A 3BSZL 5EU4A 1JN6B 2DQGH 2WY3B 3OKOB 4E68A 2ZUUA 1M6UA 3HHSB 1HAWA 3FQNA 4QT5A 1LEGA 5E9DD 3QC5X 2QKSA 4QRSA 3T65B 4FNRA 1NMAH 4M29A 5KSBE 1KXVA 3HG3A 4KKAC 4U1GB 4AGLA 2ZAGA 1E50A 4OJFH 1EZLA 1T3FB 1S9XB 3AXHA 4KKCD 5IKCA 1KPUA 2CO2A 5BV7H 1DBML 1T03H 1BFVH 2CUMA 5ENWA 1MCSA 3GBNH 2QHRH 2R2EA 5LCVL 1AQHA 1RUQH 3HC0B 1J10A 4RDQF 1KGCD 3MZTA 4XXCC 3GHBH 2IAAC 4Y9CA 1DFBH 2J6EA 4L8CA 4RMWA 1I9IH 2QPDB 3KPRD 3VSTA 5JXEA 4IBZA 2WKGA 1DJGA 3ZMRA 1MQKH 1KCUL 3ECWA 1JZJA 3K6NA 1CYWA 4H8PA 4CRPA 1IKFH 3WN5B 4K23H 1BVLB 4M9PA 5AVUB 2D7MA 3ORJA 1QATA 4N68A 1Q94B 1U3HD 5E6IA 5EN3A 2OL3L 3FH7A 4XXDB 1J12A 3AU1B 2GY5A 3HKZA 1H3PL 3TO4D 3QAZB 1KWKA 4ODBD 4XCNA 4FG6D 4U1SB 4FHBD 3RA7L 1R5IA 3HC3L 4LQFH 4NM4L 2NXZC 3ZKXC 3HG1B 4N8VG 1KFAH 3FQXA 2VMDA 3O3AA 3MLUH 2WXQA 4LSQL 4ELMF 5AENA 3VJ6B 4L9LB 3MRFB 2BNRB 3WFHA 5H37G 3PHQB 5D7JC 3UBGA 1IKFL 2E9IA 4ZUVA 3MGTA 4CVZA 5KVGE 2AI0H 4DP6X 4N8UA 2F5AH 1QRNA 1J5OH 3K4AA 5E5RB 2X1XR 2Z9TA 1SEQH 4L3CB 1CLYH 5IVNA 2AQPA 2XZZA 4H44C 1M3IA 1Y1DA 4N9GB 4DPRA 3KLKA 2ZX9A 3V7AG 5ICYA 4WWKB 2KHAA 3W5NA 3BKML 5AG9A 2WHVA 1IBBA 1U8CB 3MODH 5CCKH 1H15A 3QZNA 3BAKA 4PP1D 3ARVA 2NYKA 1JYVA 4GPVA 2AJSL 3ARGA 4OM0H 3KYAA 2R69L 1HH9B 3FFDB 5EEVA 4MQSB 5EEZA 5F97E 1M9WA 3MRHB 4Z7UF 2QV2A 5L2JA 5GGTA 4J23A 2AHIA 2ZKXA 3MCKB 4RAUA 4R7VA 1JNLH 3CD4A 3NJLA 4EZKA 5FOJA 2WWNA 1B4TA 3VMPA 3LKPA 1TITA 1OSYA 1AQMA 5K9KA 2F1AA 4QRTA 1MVUA 4YHPB 4UT9H 3FC8A 2AEPH 4XXWA 5HVFB 2EYRB 3IEAA 3QG6B 4KRPB 4WY7L 4XNMA 2H0EA 1ZLEA 1NMAL 4LLDB 1SYSB 4F3FB 5J13C 4G3YL 2AJZA 4P9ML 5FA4B 1AI1L 5JDSB 1HJCA 2F74A 4Y8DC 3O0RH 5L6YL 5JPMA 3BUPA 2OTUB 4YXKL 4AQ1B 5MEND 4IEFB 4N2CA 1JPST 3EJZC 4PR5A 4JPIB 5EO1A 5ICZB 4TYUA 4XVUC 3QJFB 1OAYH 4TNWF 1NPNA 1BX2B 2XQBH 4HIIA 3ULUD 3OKDA 1HFUA 1HSAA 3GBDA 4K5LA 5EFIA 2WBKA 4X8CA 1AIFA 2J8UB 5HGDB 1MHEA 3OR6A 4HF5H 5DJ0B 4X4YB 5F7DA 3UYPB 2YJLA 2Q0ZX 4DGVL 3GZPA 1H9VA 5A2BA 2R29L 4LE8A 4JREB 4DFHA 3F58L 4BXSV 2HPTA 4ISVB 3C2AH 1M4KA 4E5XG 3HI5L 4IS6A 1OQOA 4B7IA 2BMKB 2X9XA 3OHXC 2P28B 2R4RH 4OVVA 1E27B 5CIPA 3VSVA 4Q7DA 2ARJB 2P4AB 2PNDA 4L37A 3HI1B 4PP1C 1FZMB 4P2OD 5DD5H 1T03L 4UZGA 3V6FB 2MNUA 2O5YL 1FYHB 1HQ4A 3U4AA 3BPNC 3VXUD 1RFDL 2N0KA 2ZXWB 4M7ZB 5BRZD 2WJ5A 3FU5A 1WFNA 5C0IB 1SEQL 2LU4A 2NZ9C 5DFAA 5J11B 5I0VA 3KPSA 5CP3H 3NRFA 1JZIA 4B9KC 3O6FD 3MSPA 3OJDB 3KWUA 2VWEE 4IDLA 3V0WL 1CG9A 1CFSA 3HKFA 1FE8H 3B7SA 3MODL 3OKKB 4JFPA 4QHUB 3RJQB 3QQ4A 6PAZA 5EF1A 5D1ZD 3QFJB 1Q9OB 4G9FA 1KJ2H 4O51A 1JPGB 4HEPA 4Z7AA 2EDQA 2EILB 4F8PA 2PN5A 2WXJA 3JQOB 4NB7A 3L4CA 1HE8A 3T71A 1AC0A 2AK1H 3RA7H 1ZLVH 5BVJB 3OC8A 3RWIA 3TIEB 3MPCA 2D0GA 3GJFB 4LNVA 5JIDA 2EADA 1FVDA 3QEQD 2X0UA 1QSEB 2M1KA 1BZ7A 1AR1B 1SJHA 3IS0X 4R4FL 4NHUA 3EJZD 2Q8BL 2V5YA 5KVEH 2YUZA 3BESR 1YY8A 5H4YA 3EXLA 3L3JB 1KTBA 3ARFD 5DJ2B 3WS6A 1X5AA 5HHVH 3I02B 2R23B 5DC4B 1DQQB 2WLZA 3C6LA 3HZKB 3EHBC 4I3SL 5F96H 3ZDXB 4YFEA 3KPPA 5C09E 5I1GH 1ZXQA 1KGUA 5IUCA 3ISYA 3U4BL 2F0CA 2X40A 4Y2DA 4ENZA 3F12B 1SJEB 1E42A 2B59A 1LO4L 3QCVH 5JHDB 4AJYV 3FUNA 4DVBB 1PZUB 4UDTA 1QFWL 4XC3L 5I30H 1NC2B 2Y7MA 4B9IA 1Q0YH 2I85A 3T4YB 4JVWA 5C2UB 4NXSA 3AY4C 2K3HA 4IIZA 4P5TA 2YXMA 1S7VA 1D7BA 4BQ8A 2GFBB 4J3OG 2QHRL 2JH2A 4CADB 1MCRA 1JZ7A 4F15B 1CN4A 1F6AA 3GSNB 1YN6B 2B0SL 5PAZA 5D7HA 3US9A 3BDYH 5LUMA 4ZTPL 2WQXA 4AH2B 4FQIL 4E0RA 3MA9H 1TTCA 4DEWA 4RFOL 3C60B 4BZ2H 4ZDHB 5M94B 1RUPL 4H88L 3SBRA 3VXUE 3ZK0A 3GSQB 4G1EA 2JWYA 3DARA 3AVEA 3VDCA 1YPZA 1P4IL 2MOVA 1PNCA 1IFGA 4RZKA 2H1LM 3NABL 4HGWB 5J6SA 2R1YA 1OZTG 4GAYB 3MV8A 4PCKA 3PHSA 4FFYA 3HC3H 4LQFL 4JMXA 5KJ4A 1SXBA 3U6RA 3MN8A 5DZPA 2OQJB 1I31A 3V7AE 3QUZA 1HCYA 1EHKB 3NAAH 3GI9L 4MX7B 3DUHA 4F2MA 3VQMA 3WEMA 1I8MB 1S46A 2O4EA 3SZ6A 1AXTL 2JB5L 1GTFA 2BNRE 3P73A 5EU3B 2YA2A 4ATTA 4G5AA 4ODUA 4NQTA 2GTZA 5E1QA 2MQ3A 3BGFB 3B9KA 3IGAB 1JZ2A 5DEFB 5GGQL 4P9HH 4TQIA 4O2CB 3VXSA 4YO0A 5C07D 5HHPB 3KGSA 1JCVA 2ED6A 5C0RH 2ZQKA 4FX5A 3INOA 4GQZA 1KJ2A 1F4HA 8FABB 1YNKH 4H25A 2X4PB 4OGZA 4X4KA 1NIDA 2CCWA 2ADFL 4HU8A 2OZ4H 4PJCE 4QYOB 1NC4D 4DWHA 4AGQA 1UADC 1VSCA 4DFIA 4O2FA 3SDXA 5I19L 4L8CB 3BP7B 3LNDA 3EYFA 1JRHI 4W9JC 3D33A 4A39A 2W8CA 4QJ4B 3H7LA 1IAOB 4KO5A 5D7SL 4QHKI 3FZUD 2X9YA 3QPQC 1FYTD 2P5WA 3BPOB 3OKEB 2VM4A 1GJUA 1KYFA 5J1TC 3GZOA 4EF3A 2XNAB 1NPJA 2P3YA 1SMAA 1S5HB 3IBEA 3MTRA 4AKQA 1RU9L 3QDJA 3MLSH 1N19A 4YNYA 2ITEA 2C9AA 1KIRB 1NFAA 1SGKA 2G60H 2X7LB 3LZOA 4DP7X 4G7RB 1OAQH 3LPOA 1H8SA 4OLWL 1S5IH 5DRNB 3S5ZA 3TIDA 2J6EH 1ILUA 1UB6A 2VXVL 4X80L 1BXAA 1OHZA 2FHCA 4IBUA 5E95B 3DV4B 3GRWH 4FEIA 1BBJB 4X4XB 2PR4L 3KGUA 3OKNB 5IVZA 5KVFH 4JFSA 3ARFB 3LPFA 3M7FB 4WLCA 2V2WB 1KFAL 4QNPE 3T5WA 3HVDA 2XXFA 4IBLT 3H0TB 4HCRA 1W0YT 2F08A 2IWFA 5EOTB 3CJJA 3KXFD 1NANI 1VCAA 4M61B 3CH1A 4PWKA 4WI9A 4LSRL 3GK8L 2EO9A 4PVLA 2XN2A 3VFPB 3LKOA 1IT9H 1G7MA 4YBQD 5H94A 2A38A 3ELQA 2Y25A 1E8WA 3WIAA 3ABZA 5DJAB 5CZXD 5F7DB 4N2EA 1BQHB 1NCGA 4JDVB 4NNPH 3C6SA 3DRTA 5KSBA 1GAFH 3GI8L 3G5YA 5GISH 2AV7A 1KJVA 1NLBH 3L1GA 1AD0A 4JR9H 3BIKA 4KV5F 4AMXA 2J25A 2R1XA 1NMBL 4UUJB 3S5YA 3VWKD 3ZKMC 3PIQA 4ZW6A 2F53B 1XH3B 3WE6A 5T1LB 4MJ2A 2VR6A 2APVA 2J4WL 1LE9A 1W8NA 4HKXA 5E2UL 3APMA 4JG0L 4PGEA 3L3DA 2DQCL 2HVJB 5IG7B 4N5ED 1FCGA 1U8QB 2FBJL 1HCZA 2WYIA 3MJ8A 2BSTA 1FC2D 1IO4C 5I8CB 3CZFB 1HHJB 4UT6H 5KG9B 5I82A 1NBZA 3HE7D 4XNMB 1JVOA 3QP3A 4FKHA 2IF7A 2HFEA 2IBGA 3BP6B 4FYQA 1CYXA 1MLCA 2IH3B 2R0LL 3RB7A 4KZEL 4APXB 1MFBL 1I1AA 1ZA6B 4K9JA 5JUEL 1EHLH 5ALBL 4HIHA 1R19A 2VDQB 5TDNA 3C5JA 4LLWA 3ZPDA 4PJ8A 2OLDA 3I74A 3UIYA 3K2KA 2FO4B 2JFCA 4FXTA 3D4GA 3VRLE 1XVSA 2AZUA 1CGSL 1Z7JA 2NXYB 5CZVH 2WLYA 4BCXA 4BFOA 3IDUA 1C7SA 1VEOA 1HU8A 4FG4A 4Y2OA 3RPKA 1E7VA 4PJGF 3UO1H 3TPUB 4G1MB 5GIRB 1FNGB 3RPIA 2DQHL 3AMLA 2XRAL 1SF3A 3UZQA 1ZWIA 4O9HH 4Z3HA 3CC5A 1F6FB 5CR1A 4QRRD 4HSAC 4NPJA 1R34A 5I0ZA 1ILSA 1GPOL 1HINH 5G4NA 1VENA 1Q9KB 4JKNA 3KW7A 4ZSOA 2DLTA 3TBSA 2WLMA 2VR8A 4YVNA 3FTVA 5GZOA 3VDBA 2QL1A 3FRPA 3DURB 4XMXA 2HT4C 2Y72A 4PJ9D 5J12C 1K6QH 1WLHA 2HTKC 3CFCH 4RMQA 5CBAB 4KJPD 4YBQC 1JGVH 1U9KA 4JRXB 5HY9A 1NCOA 1KOAA 4I48B 4XMKL 2X4RB 4TSBH 5CZXC 3B3IA 3NT0A 3Q1SH 1Q9LA 3G5WA 1MFEH 2BSSB 4OH2A 4WCYL 3FT4B 1LD9A 1XSJA 4LFHD 3O9WA 3GMPA 1GPOH 4DZBA 5ABAA 4OIFA 1ET7A 5L4JA 5FKPA 4GG6F 5K1NA 4A2EA 2AEWA 3V6OA 3DTXB 2O61A 3KHQA 1PQZB 3HEIB 3O9WC 3SKNA 4E41B 1KYOK 2OX5A 1WIPA 4GSQA 2OI9B 3RVTC 1E43A 1GC1C 2AGJH 2M83A 3SPVB 1OP3H 4W70A 3MJ9L 2WVTA 4BZYA 3N1QC 1HILA 2QDWA 4XXCA 3WTUA 2I60H 1F00I 3D18B 4LPVA 4RGOL 5EZIH 5SWZA 2BH0A 2YXWA 3WL9A 3FUHA 2IADB 3HUJA 2MOGA 1IBZA 3F7RA 4L1BA 5DZVA 4PLOB 3C60A 5GRVL 1TQCC 1D5BB 4JFZL 3IWVA 5CR8A 5CINL 3KEHA 3RGBA 3CZJA 1G9EA 2V9TA 2ZF8A 3ARBD 3QDGB 3I85A 5EU5B 1IGML 5IFAL 3CFNA 1ERNA 3O8XA 4W9GC 3V4UL 3ES6B 4MS8C 1QASA 5BZDA 3JWDH 1IE4A 4YR6B 2TRHA 3IDMA 5T1DL 2X4UB 5A16A 3RGVA 4TLSA 4QMEA 4B7LA 3VD9A 3BIAX 2JJWA 3KLHC 2EDEA 2JIXD 3BVXA 4MD5B 4Z76B 4POZC 4Y9FA 3BJ91 5DJ6B 3FFCB 2IEPA 1SXNA 4PJXB 1WAPA 4KZDH 1E40A 4L4TE 1IGTA 5DQ9B 3AY2A 3WBDA 3LH2H 4KROD 3DX8A 3PABB 4PJ9C 4PJEA 5EC2A 4YC2B 4OD2B 1JDAA 1A1OB 1FA4A 5HHME 5TDPA 2OR9L 3KJ4C 3VFGL 2IAMB 1A9BB 1CICC 4LMQI 5CU5A 5BS0B 1YPZE 3S3DB 4LDLB 3EO1A 1S3KL 2I27N 1DCEA 5TDOA 5D2NC 3LD8C 1BF2A 3Q9PA 3QULA 1NBVH 1GYVA 3FT2B 1F18A 1QA9A 4M4PA 3S4SB 1OWWA 4D0CA 4M6OL 3ZDXF 1KCLA 5ADOH 1W6WA 2VN6A 3ZZSA 1KF9B 5DHMC 2D3LA 5GSVB 3RVTD 4C4UA 1LL1A 1WT5A 2X6BA 4LDEB 4F7TA 5J1AA 1F1AA 2CHDA 1C5BL 4FXKA 2HX7A 2WGNB 3FTGB 4H2AA 5T1LD 1QBBA 1L6XA 7PCYA 2W07A 4N2FA 3ULUF 1X5HA 5BNXD 2YD5A 1BOYA 1RFDH 1LJMA 1E4WH 1U95B 2CLRB 1UASA 5E2TL 4F7PA 2ADGB 5BV7C 5LGJB 4P2OC 1YY9C 1EBPA 3BH9B 2DD8L 2EXTA 3JV6B 4BZ2L 4OUOA 1U8PB 5DHXB 1KPRA 1UATA 2WXKA 3IRCA 4P2QB 3Q13A 4PG2A 3Q6FB 2R15A 3Q8CA 3KPMB 3Q1EA 3BVNA 1OY3B 3WKQA 5CJQH 3WFDH 1ZSDA 3PP4L 2VLKE 4RBPH 1AKPA 2A4CA 5I1HH 2Z64C 5DMYA 2I24N 1CGWA 4L8SC 3GMLA 5IBUG 3WTVA 4Z7WE 4MD4A 1VDGA 1D2PA 4HS6B 4DSYA 5FUZL 3GK8H 2WNGA 4ANUA 3BH8A 3X1FA 1J8HB 1NSNH 3O4LB 1G5GA 2D7TL 4ORGA 5D1ZC 3GM8A 2EABA 4U2YA 3VFTA 4JG5A 2OTUA 4PWEA 3RY6A 5EEWA 3OLDA 3KLAB 4WAFA 1IGCH 1A9EA 1GGYA 4QCIB 3QISA 4KHXL 4Y4FA 3C6SB 5D1QC 1UM4H 3QJZA 5JDSA 1SMDA 4AYBA 5JOFB 3QGVA 4AC2A 1CFVL 3BIKB 5DO2D 1HAUA 3EYFB 1NICA 3ETBJ 4AK1A 2EC8A 2AF2A 1JHLL 1XH3A 4G5ZL 3RG1C 2BVPA 4GMTH 1XF5A 4X7SH 4LLYB 4F1SA 2FJGA 2XHNA 3TBTB 3MCYA 2HRGA 1S5HA 3PDDA 1L9TA 1ZS8A 4BYHA 1EJOH 5J7CC 4NEHB 4M6NH 5AEAA 4HJGA 1D5MA 2WXPA 3FUDA 5E9AA 3TJEH 3MACH 3STZB 1NKOA 2PTVA 2VSMB 1BJ1H 3CK0H 4MSWA 2JKWA 4WV1A 1G94A 4PGBB 1A7QL 1ZDQA 4IRJC 2QHLA 4Y9EA 1DLHA 2XZAH 1OGAD 2YUVA 3P0YL 2VXTH 4MMYB 1VZGA 1HXYA 3ULVD 3EO9L 4HS3B 4X6CB 3T08A 1IAMA 4L37B 5SX4I 3P4NB 3DO7A 3VFWA 5T3XH 1KMGA 2BY3A 3FQXB 5A2CA 35C8L 3MLTB 4M7LT 5MI0B 5EZOH 4X7EC 3G5XB 5T33H 3RFZC 2DIAA 4XPBL 4I5BB 3WXWL 3D0VB 4FKEA 4RFEA 5JR1H 1KC5L 1OTTC 5MENB 1BJMA 5IB1B 2APSA 1KIQA 3QG7L 1WIUA 1SNRA 3JTTB 4JO3L 3RUGF 1ZDSA 3DSNB 3IFLL 2GCYB 5FO7A 2YPLA 4L4JA 5CSBA 5KYUA 2ZX8A 3WLBA 4R5XA 1OF2A 1VFAB 3BRDA 2IDCA 5I76B 5ESQA 2YK1L 3MROA 3QJSB 2OW7A 4QTIL 5AVZB 5GS2H 2VMEA 4JUTA 1UD8A 2LU7A 2QKIA 2R2BB 4AYFA 4NYLB 4OLYL 1QEXA 3NDYE 5TFSL 4BFJA 1V10A 4L4VD 1N0LB 4IU3B 5A2AA 4RNRA 3RNKB 1DQQA 3C6LB 3VXNA 2GJ6A 1T89A 3K5RA 4PW9A 1QAWA 2IXQB 3NJFA 4KXBA 2A77L 3HC0A 1V5JA 4DK6A 2K4AA 2D3VA 5C0FA 1JGDB 1UCBL 1QFOA 1B88A 4WUKH 3LNIA 2ZF9A 4D9RD 3K71B 1YEDA 2G2RB 1LMKA 2JJSC 5FB8B 4G8GE 3VTAA 4Z7WF 4OLEA 5F70A 1I82A 1NCTA 2P1YA 5T5FA 3D52A 4RETB 2GBAA 1MUJB 3QB7C 5DZNA 4DP1X 5CN3A 4MNHB 5I28A 2GITB 2HP4A 1UXWA 1RCYA 3AM8C 5INDB 1KCVH 2ENJA 3I50L 2WMPB 4UQ9A 1DUZB 2LE9A 1MCPL 1QP1A 3UP1A 1JUFA 4OLXH 1KY6A 4M7JH 3PRZA 1P53A 1MEXH 1RZJL 4JKWA 3HCVB 4WSJA 3B2VL 4U1KB 3L1EA 5LNGA 3ULVC 2Q76B 3HBZA 1E5CA 4AKPA 1FG9C 1JZFA 1QW9A 3FQYA 4UANA 3QPQD 5E4AA 5GZNA 1ORQA 4A67A 5KBDA 1QFUH 2H9GA 4RGNB 3DX9A 2D4DA 2EJ1A 1IARB 3BRFA 1IQWL 5E6IC 5AZ2H 5LNDA 1SUJA 3AJ7A 1QVOB 4DGYH 1JL8A 3GHEL 2CIIA 5CP7A 3HUJE 5E9NA 4F9PC 4E0RB 4R3SB 3QJHA 3EG9A 4QWWD 1KPUB 4WWID 5DK0B 4OZIB 1OK8A 2PO6C 1MH5B 3VI3E 3E3QE 5KN5A 4GAGL 4YSTA 2A6JA 4LLMA 4DEUA 1S7RB 1JHLH 4G5ZH 4KO7A 1JYNA 3H42L 4KKRA 2CUHA 1R33A 2VRAA 3SCMC 4QHNA 1TSRA 1SXCA 1B6DA 3EH5B 4WFFD 2C34A 3FMGL 1YNLH 3DGCR 2BZ7A 3KVDD 3BKJL 2DWEB 3S9DB 5EOQL 3UZVB 2J1KA 1DBJL 4N1EA 3B2PA 1SRDA 1MRFH 3CXDL 1CXIA 3D85A 4XO5A 4QTIH 3EKCA 4ZMWA 4GW1A 4ESKA 3SCMB 5GS1B 1QSEA 1L9MA 1NQBA 3T8VA 4FXKB 3CE1A 5D1QE 4PREA 2GTZB 2OMTA 5CS7A 4IJTA 5CMAB 1KELH 25C8H 5C71A 4HK3J 5JW4N 4PRHB 5IHUH 1VEMA 4RMRA 2ERJB 5IFAH 1KCKA 1EEYA 5F9OH 3TVMA 3QC6X 4ZUTA 1CCZA 1BZ7B 4M4RB 4PJIF 5C6TL 1U8PA 4U05A 4QUOA 4L3FA 1RAMA 1AO7D 3WXVH 1D9KA 4JO5A 1A6ZA 3CVHL 4LOFA 5I23A 3IF1A 2ATAA 2BIQA 2YUXA 2H3NB 2XN9B 1TPXC 3DO4A 1FG2B 4Y19A 2E6QA 1H8LA 5I1DA 4M8QB 4JFWA 1EHAA 1TZHB 4WFFE 4HZLA 1S9VA 1V7MH 3PHOA 5AZEL 3I9AA 1AIFB 4XVOA 2X3AA 1DBAL 3QNZA 3QIWD 4WI0B 4XMZA 2IANE 3AC0A 4LU5L 1ZHBA 1NIFA 2VR3A 3DJRA 2P42B 3L5XL 1A6UL 1UZ6F 1GZHC 3BPNB 5AQ0A 3PY9A 3GBEA 1QLRB 4ISVA 1IGIH 2H8PB 2Y7QA 1ZPLA 2YAFA 5DA4A 1BIIA 3HTLX 4QOKD 2IPKA 5SX5H 2ARJA 5DS2A 4Y4FB 3VXMD 4XWGL 1J88A 1XD0A 2UWEE 2CO7B 2VLKA 4NN6C 5J89A 4M6AA 4TPRH 1DVXA 3MV01 4MCYA 4EZLA 4HBQA 4JREC 4X4ZA 2V5TA 3GDBA 3VFNB 1PZ5B 1N8OE 1S3KH 4MAYB 3TWYA 3FOMA 1CQYA 3RURA 2YZ1A 1OZUA 3TCLB 1BQLH 1C12A 4N1HB 4HUXA 1CFMA 4ODWB 1BFVL 3QEHB 2X2IA 2VL5B 4RBPK 1JMXA 2AFNA 3NSXA 4DN3H 1IGFL 4KDTA 1Y18B 4NO5B 2RIKA 3RWFB 1CC3A 1QLEB 1XXFC 4OZ4A 4MHHI 1TETH 5F1OB 3R06A 3X1BA 4LT7A 1DJWA 3FO2A 5I75B 3ZHLA 4MZIA 4XPGH 1EZVY 1EGJH 4DP5X 4MXWL 4OCNC 4J2XA 4S1QH 1HIML 2IH3A 4FTDA 1NOFA 1RUKH 1TG8A 4DGUA 4GO8A 2X4OA 3X2QB 5J13B 3BLBA 5CEYB 3LZFL 3RFZB 4ZMOA 3O41A 2HKAA 2OXGB 5KS9F 2KC0A 4Z8FH 1HHJA 5IM7B 3ZE0E 3UJJL 1JERA 1LWHA 4FQIH 3QIBB 4FD0A 2LW3A 3P0VL 2IG2L 1ZLDA 3IGAA 4HMCA 4WFED 5IMMB 2D7PA 1EGJL 2BVQB 2CPUA 5C2BL 1RJCA 4HMEA 2VL4A 1MJ7L 4M1DH 2R29A 1MWOA 2FT7A 1UFGA 2EDHA 3PG2A 5TF1H 2C9RA 2PPCA 3MCLH 4APQC 5JHMA 3B7TA 1OE2A 2Y9RT 4KXDA 4N8VA 1EGJA 3W3BA 3KLHD 3BFOA 4DZ8B 1UA6H 1D5RA 3QDJB 1WA2X 2G5BA 3OLIA 1U4FA 1ADQH 4XXWC 3R1GH 3SDCC 2E6JA 1JZ3A 4P3DB 3VD3A 3FSAA 1AZZC 2HUEA 1PCSA 4P46D 1XH2A 1AZRA 5DJYA 1GW6A 1FGNH 2Z7UA 1MG2C 1C08B 3C5SB 1JGDA 2E9JA 4JY4B 4MCNA 3UJIH 2X4SA 4R4NC 3T77A 4KRLB 3LH8A 5FKPB 2W0FB 2O6CA 2V2WA 3FU7B 3QHFL 4G8GB 5I8EA 1UA3A 5IB4B 4ZW5A 3U1QA 1H9DA 4X83A 1B6UA 1ZIAA 2R4SH 2NXZB 3BLKA 2Z7YA 2XTJC 3GIVB 3ZT7A 1F13A 1J0JA 3LZQA 4LLAA 5JPNB 5D7JD 1G7HA 1OARL 2BRRL 4JN1H 1A6VL 4LCWA 4NNYB 4HUUA 1NCAL 2B77A 2NTFB 5E0FA 1ZLWH 1MHHA 3FTSA 4G8FB 1MAMH 3PAYA 2XIIA 1TQWA 3B5TA 1CIUA 1QEWB 3LEVL 4MZ2A 4HX1A 2YPVA 4HW6A 4UZUA 4F7KA 1O7SA 4OLZH 4PUBL 3VXUA 3E0GA 2R0LH 1SVCP 1I8IA 1JPFB 5JIMA 4JQIL 1QLEL 5BRZB 1T5WB 1J8RA 5D6DA 2CRYA 4GSXA 4P8QA 1TCMA 4V2CB 3D5OF 3OZ9L 5F88B 2GG1A 2Z93A 4OD3H 3WKMH 4HD5A 2IADA 3HUJB 3U9UA 3UMTA 5JW4Q 3ILPA 4PJCF 4PS3A 3EJUA 2HRHA 2ZOUA 2E9GA 3KPTA 3NIFB 3PQYB 4PJDE 4LL9A 4J3WA 1BECA 4XN7A 2CDFB 3SGEI 1PF3A 4MJ6A 5AB9A 2CHWA 2HVBA 4JVUA 4FXGC 4I88A 1PKQA 5SWSD 3L3JA 2HZHA 4N0RA 4LVEA 6PCYA 1JHKH 1ZD6A 4MA7H 1UT2A 4P3CH 1G7QB 2NPLX 3MRQA 2OMUB 2WJ7A 4K23L 3GMRA 4XP9H 2AANA 3QUYC 1JHTB 3T0EB 3W39A 2W9EH 3DVGB 5ECJE 5F7MC 1IT9L 4LEBA 2AK4D 3HZMA 1ZHKA 3AXLA 4FJZA 4XMKH 2C1OB 4W9EC 3UZQB 4R26H 5HYJA 1FNFA 2WBJD 4DAGL 1SYVB 3C8KA 1F4XL 1BFTA 2ZKHH 3RTLA 3DUUB 5FCUL 4AITA 5BS0A 1ACXA 2G60L 3LZLA 4N2HA 5IVXB 3LZPA 1WGOA 3O6ML 5I8OH 1Z66A 5HDBB 2GUOB 4JAMB 3QULB 1J0IA 3OMNB 2OYKA 4QDGA 1X5FA 2Z4QB 4JO4L 1LEKA 1I75A 3BDBA 4ZMQA 5E6UB 4JM2C 3LZFH 2EVIA 1XGPB 1G7LA 3IMTA 5E03A 1BV8A 4PB0H 5FO2A 3ATFA 1IM9A 1KTCA 2CO3A 4F7PB 5IHHA 3QEQB 1TKWA 4YBLB 1MCNA 1JV5A 3WNNA 3I9GL 2NY2D 2NY6B 4FDWA 1EUUA 5LGHL 3LNFA 4KFMA 1EERB 4KKBC 4F58L 2KZWA 5G5DB 2H6UA 4G70B 4IGBC 1J0ZA 1OL0A 1QFPA 1D7CA 2NQ3A 2DYPB 5EU7E 1RHFA 5FLUA 1OGPA 1NAMH 1MAML 4LF3B 5E4OA 4KJQD 3F83A 5ENWB 1C8QA 3O11A 4Y1AE 2CMRH 3O6FB 3L3DB 5I66A 1TLMA 2FGWL 2PYEA 2V5MA 3SDYL 4O58H 1SDAB 3V4PA 3ARRA 3H54A 5ISZB 3VFNA 1SJMA 2WTRA 1UM6L 3KYNA 5GZOC 1IC5L 2UZYB 4WHCA 3ARDB 3ZL4L 4AKOA 2HJLA 3K91A 2IDSA 4OLUH 4X9BA 3RP1A 4NQDD 4PJ7B 3HN8A 4FFWD 5T5FH 3RVVC 1I8KA 1KGCE 3H2PA 3MBEA 4MYWB 2YAPA 4WUUA 4Y7OC 3TA3D 1AGFB 1TMCB 2FEJA 4CJ1A 4Z7VA 1NFIA 2M2DA 3L7EA 1X9RA 5ID0B 4XBEH 2OMVA 2BNQB 4FQJH 4NLAA 4XNXH 5ABZA 4Y4HC 5CCHE 2LVCA 3N43B 3RPBA 1G87A 1IAKB 1P7BA 3CZEA 4PIRF 3KYKH 4DETA 2UWEA 2IV8A 1DBBL 1TSHA 2WZ0A 1PPIA 3DHMA 3VG0L 1Z9SB 4GAJL 2YARA 4E5XA 4YDKL 5IESL 2YD3A 5EOCJ 4BK5C 3S35H 4E9SA 2DKSA 3IFLH 4G6KH 3WUWB 1VERA 4WU5B 4GP8B 5KJ7E 1OTUC 1R3KB 4S11A 4NQQA 4AIOA 1FLTX 3KWVA 4JMNA 4Z8FL 4HIPA 3ZDZF 1IGTB 4S1DC 4GRWB 3DURA 1I9RL 1KN4L 5AYTA 3SKOA 1P4BH 3U6RB 3TFBA 5KZCB 3I6KB 3A47A 4PB9H 3SGEH 4XZUA 4RIRA 5K33A 4LP8A 1JK8B 3GS0A 1E6OH 5I1IL 2IAMA 2UXVA 1YQVH 2E4TA 2B9AA 1HOEA 2WXMA 3V6ZB 3PV6B 4J3XA 3BZ5A 4K3JL 4P5KA 3DROB 1YC8A 4TSBL 3ULSA 1NEZG 3UTZB 2FATL 4BM7A 2QGBA 2XICA 3VU1A 1PSKL 1NBZB 5C08A 2UY6A 4MAYA 3U4KA 5K9QG 1KB5H 2ZOWA 1NLBL 4YZFE 4N24A 2UZIL 5MHSE 2BWQA 4KOCA 2AQ2A 3VW3L 2JJUA 3T6XA 2GHZA 2W9DH 4QRTB 3LIZA 4HIHB 3RB5A 2QGDA 1T5XB 3OD3A 1CTNA 4XP5H 5D1QA 5HP5A 2C9SA 2M26A 3FHEA 3MV7B 1T2XA 4O5LL 4ONFL 2MIZA 4FQQB 4P2QA 5DMGD 3BVDB 2ICEB 3U36A 4AZ8A 4KWUA 3N06B 5JNYB 3OAWA 5ID1B 5LN8A 3MOQA 3AS1A 4YGAB 4KVNL 5EU6E 4ZX5A 5D93B 2ZWKA 3SO5A 4LSPH 1EANA 2YAMA 5EOQH 3ILQC 3VFVA 5FPIA 3OXSB 4NOBA 3KM2A 5HVWA 4X6BB 1PLAA 1KJMA 2F58H 2F19L 4BSWA 3TU6A 5L6YH 4IMKC 4NP4L 5AB2A 5IFJB 1JSYA 1MCWM 1M3JA 3L3IA 5HD8C 3KL0A 3P9MA 1BFSA 3PWNB 5JPNA 3E8VA 2A9NH 1O9VA 2CIKB 1I4FA 3VVWA 2CXKA 4X0KA 1HWWA 4I85A 2H0FA 1NBYA 3FQWB 5TE6L 4Z23A 3SYOA 4I2XA 1G6VK 4OCMC 2QPEB 4HS8H 3FO0H 5CCJA 1KYOJ 1RZQA 2UUDH 4IKLA 3TT3H 2K4WA 2WW8A 3D2UB 4IRZH 1ZCRA 2EE2A 1J9QA 3B2UC 2G30A 3F7VA 3QI9C 4KK8D 4NPYA 2YWYA 4K8RH 3QXWA 1NOAA 4HDIA 4LEXL 2QPUA 4JDEA 5TE7L 4IK6A 2NR6D 1I7RB 1TR7A 3CFDA 2VXTL 5ESVA 1PD6A 5J3HC 1DSFL 1JPEA 4BKTC 3OKKA 3TF4A 4UNUA 4D9LL 1TMQA 2LAAA 4DKEH 3QDME 1EJFA 2D31B 4X6EA 3NN8A 2SEBB 3ZX1A 3QNXB 3F65A 3D25A 5GRUL 2P5EE 2Y5TA 4IBQA 5CGYC 4KKLC 3BQUD 4PGCB 5GRJL 3AROA 1MELA 1A6WL 1KJVB 1NEPA 2BSRB 1P7KA 3IJHB 4K3GA 4Q52A 4R7DA 2W9EL 2IH1B 1NDMB 4YHKH 3PL6C 2E7LC 1X4YA 4QI3A 5LBSL 2WLJA 4CSPA 5ACZA 3C5ZC 5C9KA 3CFUA 4NZTH 2XLLA 3FCSA 4LCVA 2HVJA 4PWHA 3KWTA 2ICWB 4H8HA 5E4EB 5A2KH 2BVOB 1ZLVK 3RE0A 4B5ZA 1YJDH 4PJ9A 4U1IB 3GRWA 3DUSB 1KBWA 1REIA 3KYKL 3S2CA 4B9JA 2Z31B 1KENH 4XPAL 5T3ZL 4DOHB 1FVEB 1YCSA 4JRYB 1CL7H 3VXPA 1T6BX 1KPRB 1IMHC 1CK0L 4LKCB 3TONA 1GMEA 5B8CA 2NTSP 3GSWB 1G1KA 3NSYA 1YY8B 4G8FA 4XP5L 1CFQA 3T3PB 1A6TA 1WWBX 5IQ9B 2BOBB 4JAMA 4Z7QB 3DX8B 3N0PB 3V0JA 1CFNA 4G7QB 3SJVA 3H3PH 4A7VA 5FYKD 3RDTD 1N10A 1INEH 4X5RA 1DCLA 1NMCB 4YDNA 5DGQA 5GSRA 2FUTA 4PUBH 3IMWA 4AMKL 4IIQC 2Y7NA 1T66C 1FZJB 1Z2KA 2EDJA 2P80A 3K8MA 4WO4C 5AW8B 5FW6A 1IL1B 4PN6A 4WWPA 3P9LB 3OV6A 3B2UD 4GI9A 2CK0H 4YL4A 1DLFL 4XNBA 1NUDA 2NLJB 1QPPA 4FE9A 1AE6L 4RGMB 5I9QC 1W9XA 5L4IA 2HVKA 3NBNA 3Q44A 4ZYKA 5DMIL 3M46A 8CGTA 2Y5QA 3D4CA 4DW2H 4O02A 4ONHA 5C3IA 5I30L 3WOVA 2LLLA 4OFYA 3IDGA 3TVMB 5IQOA 3DK2A 2BC4A 3H2QA 3UOAB 3NK3A 3BFWA 1JD9A 3JSSA 2G3ZA 4NOFA 4ETYA 2EO1A 3MLWH 3PABA 1MN4A 3HZYA 2J88H 1FFOB 5FW7A 2FIRT 4G6ML 5JIIA 4L0PB 2AJYL 2ICES 2XZQL 1U3YA 3VA6A 2WD0A 2Y07L 3QDMD 3ARDA 2JIXA 3GINA 2FQFA 2Q3ZA 4LVOB 3L3GB 3FXIC 4WI0A 4G6AC 5DRZA 2VRKA 5HDOA 1XCWA 3Q43A 4TVUA 2DQDL 3RI5K 1K3IA 2BZDA 4PLKD 4APQD 1OD7A 4J8RB 4DPBX 3P73B 3SE3A 3N43F 1YHPA 1K3ZA 1J18A 2VE6B 1U91A 2ARJQ 1G0XA 4NQCA 4L29B 1DBBH 3WIHA 4F2MB 4IKIA 4PBWD 1X9QA 5AOMA 3NJXA 2AJYH 2XZQH 2OCFD 3QRBA 3O4LA 3QJTB 3VACA 1GOGA 2BLFA 1SDDB 1O5PA 3HNSL 2KT6A 2LGNA 4NZUL 4PD4J 2B0SH 4MCYB 2HTKD 5T3XD 3ZGHA 2C26A 3MLVH 4WU5A 4EZJA 2DH2A 3KLAA 3ULVH 2EEAA 4GSUA 2D7NA 3FOMB 4R4ND 4YGVA 1HI6A 2P47B 1D6EA 1BDYA 5F1IA 3UAJD 1CURA 2FZ3B 2YBRA 5HDBF 1OPGH 3GSRA 4EBQL 4QGYA 3DX6A 4R2GB 4EAEA 3T0VA 1OIOA 4OCSL 4BGLA 1ADWA 1JZ8A 3MFFA 4RLDA 4UB0H 1A3QA 4PJIA 3ESMA 1XWVA 2A4EA 2FX9L 4JFQA 4TQ8A 4MZRA 2JI1A 5AW1B 5E5MB 4GG6E 5IMLA 1VJSA 1CFTA 4NAQA 3HW7A 1YAIA 4OTXH 1PKQE 3MR9B 4GKNB 4WW2F 1ZSDB 1CZ8H 2R1WB 3KYMA 4DCQB 1OK0A 5HHOB 1LNUA 2B2XH 4N3TA 3GBLA 3M8OL 3DRQB 3NZ8A 3WKML 1MCOH 2XWXA 4KZEH 3ARZA 3IPBA 2E7MA 3VGDA 1SDYA 3NCFB 3SY6A 2GW5A 2WYZA 3BLPX 5EUOA 3WDIA 5ADPH 4M93C 3BKMH 3IGFA 1A4BA 4N4YB 3QYMA 3DDGA 3T9WA 3NIDB 5B1KA 4TNGA 1HT6A 5FAAA 1ODAA 1A66A 2ZKMX 5BS0E 3MCG1 1IGYA 2DKUA 1OARH 2BRRH 3F6IA 1R0AL 3DO7B 3OHXB 4NQSB 4XO4A 1T2QH 2HX9A 2FR4B 1G9MC 1W16A 4FQJL 4XNXL 4ZPTB 2E5EA 5JHDD 4FQHA 2Z7ZA 2NY5L 3ZTEA 3D3VD 1QTPA 2RMNA 2DKMA 3RX9A 3T4AA 3X12B 1GGCL 4OGXL 4UQEA 4K9EH 1J9RA 2FJGB 5TE4H 3R7RA 1FGVL 5FFGA 1YYML 3RZCA 4MB3A 2NQDA 5DD0L 2VH5L 2WIIB 3BGFC 4G3YH 1BPVA 3FH5A 4QRBA 4PJBE 1A7OH 1DQTA 3QFJD 5I76A 4I3GA 5T3XL 2V17L 1ITCA 3TBCA 1ZHNA 1TTFA 2HKFL 3TWCH 1BEYH 4KV5E 4LHJB 2P44B 3KXFB 4JDVA 5SV3A 3EBGA 1ZGLP 1PAMA 3MNWA 4MJIE 2ITDA 1PLCA 3HIZA 3LIZL 1HQRB 5E8EA 1F4YL 4YWGH 1G7HB 4M3KB 4C59B 3OKDB 3DV6A 3ZVVA 1MVYA 4XBGB 4HUUB 3DBXB 3L9RA 3ZSSA 1MH5A 1Q9WA 1TJIL 2E46A 5EEXA 2IDQA 1P5VB 1WFTA 2Z35A 4D9QE 2Z0BA 4UAOB 5FYJE 4GRWF 3X3GL 1SEBB 3FQ2A 2EDBA 4N90D 4ZAKD 2CA4A 1E4WL 4WI2A 1H3TA 2VO5A 3C60C 2VDMB 4HHWA 4HKBB 3MJ9H 4XB3A 3TCLA 5I73B 1DQJB 3F58H 4JX0A 5CINH 2NX5D 2DD8H 4KY2A 5E94B 5ID1A 3PWPB 2WTOA 4KQ4H 4ZZFA 1PW3A 3UJTH 4U3SA 3WLBB 5EBLB 3A67L 1ZGLM 1OCRB 1UZGA 4HUWB 4PU2A 5G4OA 4PCYA 3TM6A 2VSDA 4HFUL 3GSXB 3VXRB 3GTVA 1H3UA 1BQRA 4Z7IA 4BSWB 4BFRA 3AQDA 4QAWA 4YHIB 1RH8A 3QWRD 1LO0L 5CGTA 5AAWC 2JV6A 3F6LA 1I85C 2BO0A 4G8IB 1KENL 3FONB 5T3ZH 4NM4H 1KTLB 4NO0A 2NY4D 5GGTL 3UTOA 2ZUTA 1I1CA 1AZCA 3DX9B 4X5WB 2LT9A 4XO8A 5EBWB 2C9PA 1FN4A 2JCCB 1HEZB 1U21A 2EYSA 2AVFA 4BH7A 2IXQA 4DQOH 4AV4A 4IMLB 3WHXA 2V9RA 4YSQA 1FHNA 3KS0J 4G43B 5DD6A 4ZMAT 1D5ZA 2ADFH 3DHJA 4M5YL 5IQMA 5H37A 5D7JB 3ZGIA 1CI5A 3PGCA 3UEQA 1U8NB 3MRIA 1PFOA 4L1DA 4D94A 3TA3C 3TV8A 1ZT7B 3QIBA 4JUSA 5JORB 2R51A 3OF6D 1Q0XL 2X4NA 3CMOL 5GGTH 3ZT5A 1DJYA 3UDWA 1UXWB 5INDA 1XCQA 1WG3A 4D3CL 1N5YH 2PWEA 1FZOA 3VM5A 4BE5A 2PTTB 5AOJA 2AERT 1YMMB 4MAUL 3TYGH 4LCCA 3V0IA 3JWOH 3J7HA 2WKLA 2Y1AA 1NGYA 2N7SA 4PRPA 2E6PA 3P3RA 3QE5A 3LSOA 1W80A 3ZY7A 3DYMA 3VVVA 2AK4E 3IU3A 3VH8G 3A6BH 1J87A 3CIQA 3HMXA 4Y19E 5FO7B 2VLRB 2ZUVA 5F0LB 4XZ4A 4GYBA 1F58L 4WGVB 4MB4A 3KPLB 5D2LA 1J1OH 1FVCA 4K3JH 1QO3A 3LEVH 3SQOH 4HJTA 3SGDH 2WNKA 5SWZB 3WHE0 3D0LA 4HWBH 1AGBA 1WHPA 1XB3A 4ZAKB 4AQOA 3DUSA 1A5FL 4W4OA 3TFKC 2UX7A 1K85A 4QNPF 2GJ6B 3A21A 3RWFA 4MD0B 4XMVA 1OO2A 4XNAA 3MRDA 1WFJA 4LLMB 1MFNA 1JWUA 3N42F 3GIVA 4KH2A 5F3BA 3N50A 1E9PA 2NZ9D 5TK4A 2NY4C 2VE6A 4EE2A 1KJ3L 3MXWH 5D6CA 2DBLH 2AGJL 1LE5A 3HHSA 3M6DA 4JFDE 4I2XE 1NGPH 3T65A 1NMBH 3WHE1 3QUHA 3G08B 3VWKC 1I7UB 3LRHA 2AKRA 1A1NA 1VACA 3WIHH 4X8JB 1DUZA 1AYOA 1JCKA 3BN9C 4JLRA 3T8XA 1E5BA 1UWFA 5AKVA 3QJRB 1NCDL 3LH2L 4ZS7H 5IB3B 1DDHA 4JB9L 4BFEA 1R4XA 1SBBA 3CSBA 4LVNB 4RZCA 2DYSB 1KB5L 1ZT4B 3GI9H 1I8LC 1K8DA 3DX6B 3BAYA 1P7QB 2J2ZB 2NRDA 3BVTA 4PJAB 2VXQH 4YPJA 2EIEA 3F00A 3UC0H 4M7KL 5DQDH 2DJ4A 2DN7A 3GSNL 4NQDE 2OMXB 1IFHH 1FL3A 5E70A 1OSZA 3UTSD 3CLFH 1M71A 1MLBA 4HUXB 1ZGLB 2C3HA 3RZWA 3EHBD 2IFFH 5DUMH 5JPNC 3IS1X 4PBXA 4F7MA 1GC1H 3TOPA 5L7XL 2LOEA 1CL7I 3C8KB 2R8SL 1A0QL 1RMFH 2I26N 4AENA 1OGAE 3WCYA 1J1XH 1A6PA 2ZSVA 3A6CH 4A7SA 3QCUL 4TL5A 1EUTA 2DLGA 1HCFX 3ML8A 4U0RB 2YPVL 4XXDA 1MFDH 3QUGA 4MFHA 2DWSA 3ZMEA 3AT8A 1RUAH 4RMSA 1DL7H 4U49A 4BHUA 1KBGH 3MOBH 1MCCA 1UGKA 4FQCL 2ZAIA 4IGBB 4WGWB 1KXTB 3SDAA 3FSVA 3TGXA 3RWDB 3V0VA 3K6IA 4GAFB 3QCTL 1TJXA 4N0UA 5EU6D 2OYLA 5AW5B 3D2UD 3D85B 2UY7B 4R4BB 1IEAA 3K4ZA 3QEQA 5EC1B 3CXDH 2NNFA 2P24A 3RVXD 4M6MH 1LEKB 5D70L 3BD5A 5J6HA 3BQUC 4IRZL