5CF6A

Crystal structure of janus kinase 2 in complex with n,n-dicyclopropyl-10-[(2s)-2,3-dihydroxypropyl]-3-methyl-7-(methylamino)-3,5,8,10-tetraazatricyclo [7.3.0.02,6]dodeca-1(9),2(6),4,7,11-pentaene-11-carboxamide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
290
structure length
285
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Structure-Based Design of Selective Janus Kinase 2 Imidazo[4,5-d]pyrrolo[2,3-b]pyridine Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 285
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5cf6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5cf6A01
4H58A 4XLIA 4XMOA 5ETIA 2CLXA 2YCSA 3FLWA 3FYJX 5EHOA 2Q83A 3ORKA 1OZ1A 4EONA 3UZPA 2QLUA 2R3MA 5A4EA 3QLFA 4OGRA 4DT9A 4JBPA 4R5SA 2B0QA 5IQHA 1ZMVA 4TWCA 4H3BA 2BPMA 4L42A 3WE8A 2OWBA 3GU4A 3LJ0A 5FD2A 1YXVA 3I79A 3OMVA 4MBLA 2X7OA 4FSNA 4C2WA 1CM8A 3FI4A 3QC9A 2KULA 2P2HA 3EOCA 3LCTA 4ZTLA 3ZLSA 4TPTA 3Q6WA 2G9XA 4XUFA 3QXPA 3LXPA 1BX6A 5IMXA 4DGOA 4YTHA 5HD4A 4R78A 4RIOA 1ZZLA 2W1IA 3AT4A 3D94A 5E8UA 2X4FA 2ITXA 4I0TA 4HGLA 2GS6A 2VNYA 4XJ0A 4BCKA 2FUMA 1U5QA 3KXHA 2XIXA 4M0ZA 4LL5A 2V7AA 2OG8A 2R3QA 3GQIA 3BHHA 4KS8A 3ORMA 4FKUA 4D55A 1MRYA 2ITVA 4JR7A 3Q04A 4GFMA 4IC7A 2XEZA 5KMKA 4RX9A 4K77A 4I1ZA 4IIRA 4IAYA 4C38A 5HTBA 4JI9A 4IWQA 1OL6A 5AIRA 4PL3A 1YDSE 3FC2A 2UW6A 3LXNA 4TZRA 3AOXA 5BVDA 5BUJA 1IASA 2X1NA 2BRBA 2VGPA 2UZLA 3C5UA 4J1RA 3RTPA 3NNVA 2WOUA 5HU9A 2XP2A 4YHTA 4BVUA 1VR2A 2BTSA 4ZAUA 4BY9E 4YJTA 2HZ0A 3TNIA 4YLJA 1XWSA 4EZ7A 1NA7A 2JLDA 2JEDA 2VWVA 5FM2A 3PVGA 4J95A 1V0BA 2IVVA 3VRYA 3TIZA 3TZMA 1PMVA 3K5VA 4EOPA 3UO6A 3HP5A 3AC4A 3DA6A 3GC7A 3M42A 4BGHA 5LXMA 3RMFA 1JLUE 4E6DA 5FQDC 4IZ5A 5BQ0A 3DBDA 1OECA 5L2SA 3BHUA 4I22A 1ZYDA 4ACHA 3HMNA 4F6WA 1DI8A 3KXXA 4CMTA 4TWPA 2IZTA 4M8TA 1U54B 3MY1A 4UEUA 2OK1A 1K2PA 4XCUA 4L8MA 4D2VA 4DBXA 3FL5A 3QHWA 1LPUA 4UY9A 3GB2A 2J5FA 5FM3A 3WF5A 4DTKA 3QRJA 3WF7A 4EH8A 4LG4A 3U8WA 1YKRA 2CNQA 5JGAA 4OTDA 4FL3A 1YWNA 2O0UA 2XM9A 3A8XA 3BQCA 2XKFA 3QA8A 3G0FA 4RG0A 5FWKK 5BVEA 3ZRLA 5E4HA 4Q5HA 3MDYA 3FZTA 4FK6A 5CAQA 3QTWA 4DFUA 3KFAA 4V0GA 4DFNA 5L6PA 1H26A 4C4JA 4W4XA 1OIQA 4UWBA 3KRJA 5J7HA 4GKHA 4E4LA 4O7RA 4U5JA 3FV8A 5CVFA 1RQQA 2QD9A 2C3IB 3QWJA 1OIUA 1JBPE 3OWPA 5HCXA 2YIRA 3NYXA 3OXTA 4L67A 4BYJA 4BBFA 4Y72A 2YAAA 4BZOA 5C26A 1BUHA 1Q99A 3RVGA 1KE9A 3KRWA 3QU0A 3EQIA 4DLIA 3K3JA 4EKLA 3TL8A 3ZO2A 5M09A 1DI9A 1JNKA 4FT7A 3BPRA 3GU5A 3R8VA 2BDJA 2C0OA 4RGJA 2BRMA 1K9AA 4WT6A 5ETCA 1FVRA 4F1OA 4RVKA 3EKNA 2NNWB 4IVBA 2HK5A 4PUZA 4QT1A 2IZRA 3DTCA 1ZWSA 1PMNA 2AYPA 4L00A 3W18A 3C0HA 2ACXA 3CTJA 1FMOE 1UU9A 3MVHA 1PYXA 3AQVA 4QMZA 1Q8WA 2XK3A 3GU6A 3CXWA 5JT2A 4GT5A 2XBAA 4KIKB 4F9CA 4KRCA 4FTQA 1KOAA 4L9IA 3IG7A 2OXYA 3L9NA 2XZSA 4NSTA 2QONA 4WSYA 3R8MA 4BR3A 5HICA 1UV5A 3VS0A 2DS1A 4G17A 4BDFA 4FKQA 4ZMEA 4RJ7A 3AGMA 4NCTC 4BDAA 3TV7A 3H0ZA 3KVXA 3MVMA 4JQEA 2QU6A 3BYSA 3SV0A 3F3UA 5T6KA 3VHEA 5GIPE 1XH7A 3F5PA 2W1CA 5HIDA 1RE8A 2OZAA 2A1AB 4M69A 3TNQB 3UMXA 4IM0A 4ZTQA 4CCUA 5HLWA 3R7EA 1G8AA 3N4TA 2W06A 2VWUA 1A48A 2R3LA 3WIGA 5C8KA 3FZPA 5AMNA 1PJKA 5CI7A 3C4ZA 1JOWB 3COMA 4RIYB 5I9YA 1UA2A 4IX3A 2C5NA 3TXOA 2B9IA 1MRVA 3ROCA 1OUYA 4HYSA 2R3HA 3V5TA 4XV1A 3TN8A 4O81A 4TYHB 3C5IA 4XBUA 3BYVA 4G9RA 3UMWA 2ERKA 3U87A 3O71A 2OFUA 4HPUE 4IX5A 3O96A 2FYSA 2QR8A 3MTLA 4UYAA 4CGAA 2XNBA 2WTKB 4TWNA 1RW8A 4AT4A 4X6QC 3PXQA 4X2GA 1H00A 3CQEA 4BGGA 3KXNA 1QL6A 5HNGA 4IFGA 4P90A 4YGAA 1W0XC 4AXAA 2IZUA 4QYHA 5F95A 5J7BA 2BRGA 4ZS4A 3FKLA 4FEUA 3LXKA 4O6LA 3TJCA 2PE1A 5DHJA 1ERKA 4RJ5A 4JXFA 3ZHPC 4ASZA 4BCHA 5LMKA 3EFWA 1YHSA 4FG8A 2QOOA 4FV8A 4YLKA 3S0OA 3P78A 4W9XA 1AD5A 5IQIA 3LAUA 4HVHA 4KBKA 3HV7A 5AP1A 4ZS0A 3UVRA 2IW9A 4D4VA 1YI3A 3PVUA 4EOOA 4PL4A 5EK7A 4QTDA 5IH5A 3QXOA 5ETAA 2RG6A 5AUWA 5JK3A 2PVNA 3DQWA 4RQVA 5BMSA 2IJMA 4JS8A 4XG4A 5GZAA 5CAVA 2H6DA 4G2FA 4MHAA 3EN7A 2J0KA 3B2WA 3DFAA 3NGAA 3QX4A 3VIDA 3MPMA 1J1CA 3ANQA 4FKPA 3WZKA 2P33A 4EHGA 3FY2A 5LVNA 2RSVA 2VWXA 3MH1A 2WIPA 3TIYA 4F99A 3D5XA 1GAGA 4TNDA 5JZJA 3V6SA 4ZLZA 1JKLA 4MNEB 3H3CA 3V8WA 1PKGA 5CAOA 5CENA 4AA5A 3P79A 2C3JA 5JFSA 3VHKA 3F3TA 5E90A 4NU1A 5ANJA 4PPCA 5C8MA 4E8AA 4QP3A 4RA5A 4F9AA 4GVJA 3C4XA 4YJPA 5GZ9A 4E1ZA 2RFDA 2PU8A 4ITIA 3CKWA 4ASEA 2DWBA 3QQUA 2UUEA 4C0TA 3FUPA 2LAVA 4BIEA 3ULZA 3L9PA 3E3BX 1U5RA 4L7SA 2VAGA 3ZONA 3BBWA 3HA8A 4IEBA 2ZM4A 3QD2B 4UMQA 5I9UA 2GS2A 3MA6A 2PUPA 5HE3A 4CZYB 5IG1A 2WNTA 5HD7A 2GQRA 3IW4A 2XK4A 4C4EA 4CZUA 4HJOA 2EU9A 2WMXA 3Q5IA 4MWHA 2WAJA 4ANMA 3HNGA 2VGOA 4FSTA 4F7SA 4NYEA 3I6WA 3LM5A 1XO2B 4NUSA 4AZSA 2ZV2A 3AMYA 4AZWA 4O0SA 2IVTA 4FV9A 3RPVA 2W5AA 1H4LA 2NRYA 1Q62A 2AC5A 2B9HA 2VTHA 3GOPA 4RFZA 3W55A 4C02A 4CKRA 4KAOA 5CVGA 2CN8A 3VF8A 5I0BA 1AQ1A 3UPXA 4I6HA 2JKKA 2P0CA 4K2RA 4PF4A 4EUUA 3P7CA 3R9OA 4DN5A 2BHHA 4MF0A 5IQCA 1OUKA 3UC3A 3LLAA 4FIGA 3ZU7A 4AU8A 2B53A 4AWIA 4AN2A 2JFMA 4ID7A 4YZCA 3EZVA 2ITZA 3VBVA 4IBMA 4C3PA 1ZXEA 4JOAA 4KKEA 5H8BA 5ICPA 1ZARA 2WU6A 3NCZA 4I6BA 4LM5A 3UPZA 3U55A 4F9YA 3CKXA 4C59A 2ZDTA 5LVPA 2JDVA 2OBJA 5EOLA 1H0WA 5AR2A 4FKGA 2JKOA 5AUTA 5HTIA 5AFVA 2X0GA 2UW3A 3TCPA 3HRCA 4A06A 3UNJA 4KIPA 2RF9A 5AP5A 3NYNA 3UOLA 4HCVA 4IB0A 1GIJA 5C27A 5F9EA 2VO7A 5JGBA 4BCMA 3IECA 4AACA 3LFFA 5AUVA 2PVYA 3RAWA 3EQFA 3F88A 3QRIA 4FSRA 2EXEA 4OTGA 2W5HA 3NLBA 3NUSA 4EH3A 4O7SA 4N6YA 5EI6A 4D28A 2B54A 1YQJA 5C01A 4FKTA 4E73A 5CLPA 3RALA 4J96A 4R1VA 2GS7A 3JXWA 4BCGA 4M97A 1IEPA 1YHWA 4APPA 5HZNA 3UP7A 4BI2A 3M1SA 5HHWA 1TQMA 3N4VA 5KMLA 4RC3A 2E9OA 2HENA 1MP8A 4QYGA 5M56A 2C0IA 3R02A 2ZV9A 3QGYA 3UO5A 1ZAOA 3I6UA 4AQCA 4F9BA 3S4QA 3PDTA 2BUJA 5DA3A 3KRRA 3MBLA 3PRIA 5CU6A 4BIBA 3OUNB 3S00A 3VJOA 3VVHA 1SM2A 2XYUA 3MFTA 2OJJA 5D1JA 3RHKA 3M11A 5AX9A 4D5KA 4EC8A 2J51A 3PJ1A 2QI8A 2VX1A 5BUEA 5JFWA 4Q2AA 1MQ4A 3LCOA 3OBGA 4ZY5A 4LOQA 2J4ZA 3M2WA 2WMQA 3MFUA 2FVDA 5JN2A 4PNKA 4CKJA 4FTRA 2F57A 3MA3A 4QP6A 4QP1A 1ATPE 5I3OA 3FC1X 2GNGA 2UW4A 3G33A 1GZNA 5E8VA 4EOSA 2BAQA 4FTJA 1OBGA 4ZOGA 3N4UA 3QHRA 3Q60A 2ZMCA 4ASXA 3QALE 3EQRA 3Q5ZA 1STCE 5D7AA 4EK4A 4UX9A 4RSSA 3VUDA 3C9WA 3OFMA 1APME 1JSVA 1OMWA 3Q4CA 4FNYA 1WBOA 2BKZA 4CYJA 4ENYA 1R0EA 2BR1A 1WVYA 2UZNA 4X3FC 5H9BA 4FGBA 2UVYA 1F5QA 3TUBA 3FSKA 3LXLA 5F1ZA 4AFEA 5J1VA 2ITQA 2C1AA 5J87A 3DGKA 3VBXA 3HKOA 4WNOA 2RFNA 5C9CA 4YR8A 3Q53A 4NZWB 2WTJA 3FMEA 4I3ZA 4RJ6A 4AZTA 4EH9A 4Y5HA 4ZLOA 5C4LA 1Q8ZA 3NYVA 4JX3A 4DH8A 3F3ZA 1B38A 4HZRA 4JRVA 3SXSA 4EL9A 4HCUA 4QQ5A 5CQUA 1O9UA 2P55A 4O21A 2IVUA 2WMTA 4BIDA 4I5MA 3OG7A 2FO0A 4GRBA 3VW8A 2C6DA 3DLZA 5DI1A 1OL2A 3EL8A 4Y46A 3NUPA 3IOPA 5BUIA 2HAKA 1WZYA 4FUYA 3LMHA 2W4KA 2RG5A 3DB8A 3DPKA 2GFCA 2XUUA 5M51A 1U46A 2IG7A 2VZ6A 3O8UA 5K9IA 4QTCA 4FV1A 5HEZA 2W4OA 3ZXZA 1QPCA 4XBRA 4ZK5A 3UQGA 2ZOQA 3RP9A 4RIWB 3A7GA 2VX0A 1WCCA 2ZM1A 2NO3A 3E63A 4RLKA 4OT5A 2XKDA 4QRCA 2J50A 5HBEA 4YTCA 4ZTRA 5H8GA 3TKUA 4F08A 4EBWA 4U40A 4CV8A 1AGWA 1J7IA 2XJ2A 4O27B 5HE2A 4K9YA 3HRBA 4U45A 1OGUA 1XH6A 2JDTA 1U54A 5L3AA 5A3XA 3II5A 3R7VA 2AC3A 3U6HA 2VO6A 3MYGA 2YDKA 2ITPA 4IAZA 3EQDA 4FT9A 4GK2A 4UBAA 3FKNA 5EI2A 4O0WA 2X2LA 3MV5A 3A60A 4I94A 4XP0A 5HGIA 4F6SA 1KE6A 2XNGA 5K4JA 1Y8YA 3ORNA 3F5XA 4L43A 4YU2A 3ZYAA 3FAAA 4FZDB 2H9VA 4K0YA 4YO6A 4AUAA 3COIA 4UMUA 4GCJA 4ANNA 3PA4A 1IA9A 3QFVA 3MB7A 4PTCA 3CE3A 3MFSA 3EH9A 3HYHA 4FIJA 3Q52A 3NW6A 3RCJA 4OTQA 2W5BA 4YJRA 2J0MB 3E64A 5DT4A 4CRLA 3KRXA 5FG8A 3PZHA 2Y8OA 2R3JA 3SDJA 4PDSA 3E7VA 5CYIA 2FA2A 2R5TA 3LCKA 4XLVA 3MH2A 3PP1A 4O83A 4JBQA 4QMMA 3A7IA 3HMOA 3SOCA 1OL7A 4FIIA 4CSVA 5IUHA 5E9EA 2WTCA 2JBPA 5H3QA 1S9JA 1Z5MA 2W99B 4WBOA 2HY0A 4YJVA 4X0MA 4J8NA 5IQAA 4APCA 3HGKA 3OOGA 5AR7A 4WO5A 3QKMA 2CNUA 4A7CA 4F0IA 1YOLA 2VUWA 1CSNA 2QOQA 3FHIA 3HV4A 4D2SA 4F7NA 5JKGA 4O82A 2CGVA 3UZRA 4J99A 4FT3A 3WOWA 3Q2JA 2XNPA 3R9NA 3OW4A 5E1EA 4NWMA 4XG9A 3EWHA 2VTPA 1L3RE 2J7TA 3FEGA 3CGFA 4PV0A 1E1XA 3BEGA 3GCVA 4AE6A 3DK7A 3KF7A 4E5BA 3BGQA 3OY1A 5AX3A 3SG9A 2OXXA 3CY2A 4FKWA 4BICA 2X6DA 1LUFA 3ATSA 1BI7A 3TZ7A 4LUEA 4DG2E 3DOGA 3R9DA 3LE6A 3BHTA 4FK3A 4I20A 4JL9A 5ANGA 3VBQA 4ALUA 3UOJA 3KC3A 4L45A 2PMLX 1PXNA 4ACGA 3R6XA 3E88A 3D2KA 4LQMA 2QVSE 4D1XA 4F65A 1RJBA 3FBVA 4FR4A 4EHZA 4KABA 5DRDA 2W1ZA 3SXFA 2VU3A 4YJSA 4IM3A 3OCBA 4XV3A 1EH4A 1IAHA 4LOPA 2VWBA 5J5TA 4EBVA 2C6OA 3D9VA 4E5AX 3C4FA 3ET7A 4S2ZA 3JR1A 3TM0A 4H1MA 4I4FA 3R9HA 3DDPA 2X4ZA 4A9UA 5KBRA 3CQUA 4RA4A 2NPQA 5BVWA 1BKXA 2VNWA 3KVWA 5FGKA 4FV3A 3ZLYA 4RIYA 3ORLA 2C6LA 3FXWA 4A9TA 4J71A 5AV1A 5B0XA 2WU7A 3UBDA 1H24A 4UMRA 3RWPA 1OVEA 4AW0A 4JDHA 3WARA 4FUXA 3PUPA 4FTAA 5CEKA 2Y0AA 3ROYA 4AZVA 3QRKA 4ZY6A 4BC6A 1XHAA 3DT1A 3QQFA 4G5JA 5K3YA 1Y6AA 2XK9A 3PJ3A 4O2PA 2J2IB 2XJ1A 4HGTA 5HO7A 3QQHA 3U9CA 5CEPA 3QF9A 4FTNA 3NDMA 3PLSA 5AR3A 3ZFXA 3MGYA 4YMJA 5EI8A 1ZYCA 3NUAA 3UYSA 4XV9A 2R0UA 2XEYA 3DAEA 3KXMA 4MVFA 2QG7A 2YM6A 1XBBA 3KN5A 5LJJA 3OY3A 4FSMA 3Q4ZA 5KBQA 3AMAA 3MPAA 1BMKA 4U42A 3CEKA 3DKGA 4D4SA 3UIUA 5B2LA 4G6LA 3ZUUA 5EQYA 3QTRA 2YM7A 4GMYA 4X21A 2YDIA 4EWHA 4P4CA 5AIKA 4PMPA 3QAME 2A27A 4DEAA 3MJ1A 4DFXE 4XG3A 1O6LA 4B7TA 4FNWA 1NVQA 4FKRA 4YHFA 2C6EA 4HYIA 3CY3A 4KKHA 3E93A 4CFUA 2ONLC 4MNEA 4NTSA 5AR5A 2X8DA 3IGGA 4J98A 4O0YA 3F5UA 2WKMA 3OXZA 4O7ZA 1OL1A 3PXKA 4JJRA 1H01A 1OM1A 4UZHA 2I7QA 2W9ZB 2R3PA 2XNNA 4Y5QA 4ONAA 3R8PA 2JIVA 4USEA 2HW7A 3OVVA 3QUDA 4UZDA 4G31A 4O96A 1KOBA 3DZOA 4U8ZA 3C51A 4GEOA 4F9WA 4GJ2A 4KS7A 5IA1A 2DQ7X 3MVLA 5DGZA 4D1SA 4KWPA 5HG5A 4FZ6A 3PE1A 4JDIA 3CD3A 3OCTA 3S1HA 4HYUA 2QQ7A 4G3FA 3FLZA 2FSOX 4YO4A 3NUNA 1Q5KA 2UW5A 2PUUA 5IQFA 4K8AA 5GZ8A 4TYGA 5JMSA 3R7YA 4FC0A 4FI1A 4U79A 3TV4A 3DAJA 2JDOA 4XEYA 3W2PA 4BKZA 3FJQE 3QL8A 3D7ZA 3ORZA 2GCDA 4P5ZA 5CU4A 3RI1A 3DCVA 3ALOA 1UNHA 2F9GA 4JT3A 3V01A 4BI1A 3ZRMA 2WTDA 3B2TA 4QYYA 4LL0A 3UVPA 4NM3A 4F0GA 1E1VA 2PVMA 3A8WA 4EOJA 4EQCA 3RPSA 4ZTMA 2VTNA 1J3HA 4E20A 5CT0A 3KULB 2R3FA 4DGNA 2GMXA 4PPAA 2ZAZA 4BCOA 2E9UA 3CJGA 4ZSLA 2HWPA 2GQSA 2EB3A 5K0XA 4OBOA 4R1YA 3W33A 3QTXA 1YWVA 5M4IA 3BGPA 3KN6A 1W7HA 3LJ1A 5J8IA 2YZLA 3C13A 5EDRA 3RK5A 2R7BA 5IPJA 5CQWA 2PYWA 4KNBA 5DEWA 5TT7A 4EUTA 1X8BA 4RVMA 2YABA 3DLSA 4S31A 3OF0A 5B2MA 2PL0A 3G6GA 4AOJA 3NWWA 2XIKA 4II5A 4GKIA 3RJCA 4E6QA 2ITNA 2X39A 4FL2A 3UOKA 3D83A 2EUFB 3NUXA 4DFLA 5A4CA 5C8NA 5I9XA 4YUQA 3E7OA 5AP3A 4CVAA 5M57A 3BELA 3PVBA 3PVWA 4FX3A 2F2UA 1GY3A 1SNXA 3PPKA 4FTTA 2IW8A 4FEVA 5JSMA 1T45A 3OWLA 4JX7A 2ZYBA 3SW7A 4EZ3A 2WEIA 4E4NA 3OZ6A 5CZHA 3VUHA 3QX2A 1JKTA 1UWHA 3DY7A 4EH2A 5CEIA 4X7QA 1UKIA 3R2YA 2JFLA 4JBVA 4C35A 2R3KA 4PDPA 3HA6A 3LFDA 4S33A 5IA5A 3NNUA 4EJNA 4LRJA 1RDQE 3RZFA 4DH1A 4MEDA 5CZIA 4JIKA 2QHMA 2X7GA 4HZSA 1Z9XA 4IDTA 2I0HA 2VN9A 3L9MA 4GUEA 4FV5A 3ORIA 1PYEA 4ZZMA 5AV0A 4MXXA 5EW8A 4DITA 2J90A 5G6VA 3NRMA 4QMLA 5DEYA 5CX9A 1OB3A 2G2FA 1H1RA 3E92A 3QUEA 2HCKA 3QYZA 4IWPA 4E4MA 4NEUA 3P7BA 2JAVA 3UIXA 5K4IA 3EQHA 3SOAA 3OCGA 5AV4A 5AP2A 5AP7A 3NEWA 4ZSJA 4CG9A 1BI8A 3LFQA 3PJ8A 1OPLA 3QTZA 4Q5EA 4DEBA 4NIFA 4DH7A 4ZTSA 1UVRA 3TZ8A 4XP3A 4IACA 1R3CA 2VX3A 2ITUA 3S95A 2XJ0A 2CLQA 4RBLA 3OTVA 2Y6MA 3PXFA 4S30A 3HAMA 4DEDA 3IO7A 1JAMA 4LV5A 2XF0A 5AUYA 3MH0A 4C7TA 4CEGA 4KSQA 1HCLA 5CXZA 5KHWA 3R7IA 3V8SA 3ZUVA 5KCVA 2X7FA 3AD6A 3SVVA 3MJ2A 5ANEA 4OTIA 2BAJA 3FLSA 3ZUTA 5M07A 3BBTB 4BDCA 3F2AA 3QCXA 2C1BA 2HXLA 2WELA 3E62A 3LFEA 4L68A 2R3IA 4EOMA 3E8CA 4DGMA 1I44A 2FSLX 3LMGA 3EQPA 2WMBA 3JS2A 4FSUA 4R7BA 4ZMFA 2YJSA 4XV2A 2VTIA 5CEMA 5IQBA 5DPVA 1Q97A 1CKPA 1GIIA 3W2CA 4PDOA 4RX7A 4NM7A 4YSJA 3OW3A 2WQMA 3OC1A 3O8PA 2UW8A 4ACDA 4FE2A 5KMMA 1M7QA 3DU8A 5C1QB 1H1PA 4I92A 5A6NA 3BV3A 3ZM4A 1E9HA 2CMWA 4GYIA 4PX6A 1BLXA 3BX5A 1SVEA 4FSZA 4BCQA 2WPAA 4XG7A 4GUBA 2Y4IB 4R6VA 4ALWA 5DRBA 4QMTA 4EHVA 2CHLA 2UVXA 2F4JA 4QPMA 2UV2A 3OT3A 4TTHB 3RINA 4FA2A 4QTEA 2OXDA 2WOTA 4C58A 2WTIA 4JAJA 5EM5A 2Z60A 4IX6A 5HNBA 1VJYA 3UIMA 3TNPC 3KU2A 5DVRA 2QURA 4O7WA 4DAWA 3C7QA 4QQTA 5LWNA 4XOZA 4A07A 3IW6A 5I4NA 2OZOA 4RIWA 3DS6A 4UXLA 2CSNA 3T3UA 2ZB1A 2BVAA 1IR3A 1ZOEA 4ANOA 5IH4A 2V55A 4L44A 4QQJA 2C6TA 3PA5A 2VTMA 3H9FA 1CKIA 3ORPA 4GH2A 2YIWA 2RIOA 4AGWA 3HDMA 3FQHA 3D5WA 3ZOSA 4W4YA 4XYFA 2XMYA 4V05A 4WSQA 3RAKA 2VO0A 3HUCA 1XH4A 4EHEA 1Q3DA 2XK7A 4FIEA 1OKYA 5HU3A 4USDA 3LQ8A 3IW7A 5EQPA 3VS6A 2BKKA 4YJUA 2CGWA 2QG5A 2XM8A 3QZHA 3F3VA 2OJIA 4MTAA 5CAPA 4F63A 5DYJA 3AD4A 4ITHA 4GSBA 3TJDA 2PY3A 5JZNA 3DJ6A 4IB1A 4NW5A 4O0TA 3U54A 4BTKA 4XRJA 3ODYX 2Y9QA 2J0JA 2YFXA 4KINA 5TO8A 3A61A 5KKRC 2VWYA 4JAIA 3CP9A 3EQCA 4L3PA 5T68A 4BHNA 4ZTHA 2WZJA 2UZEA 3SD0A 2YIYA 4ANLA 4X6RA 3ZMMA 3MPTA 1LP4A 3LVPA 4HGEA 5GJDA 2HW6A 3MY0A 3TV6A 3R21A 4HNIA 2Z7QA 3BKBA 3V5WA 3GU7A 4PNIA 3G2FA 2HZNA 4G6OA 3RWQA 3HVCA 3UNZA 4CNHA 3DKOA 3P9JA 4EI4A 3MESA 4F64A 1YOMA 1YI4A 1DM2A 1SNUA 4MXZA 3R73A 4C61A 3D5UA 3O7LD 5CY3A 2JGZA 3FMMA 3D2IA 3PJ2A 1U59A 3QA0A 4KBAA 3ZC6A 4ASDA 4O7LA 2G01A 4KB8A 3VUGA 4CD0A 3BHVA 2PZPA 3BLRA 3RK7A 4N57A 4JRNA 4ANSA 4LV8A 4KBCA 3CTQA 3AC3A 1M52A 3MVJA 4FODA 4NFMA 3LW0A 3PWYA 5HBHA 3UP2A 2OIDA 2RGPA 2Z7LA 4MBJA 3SW4A 4DE4A 2WTKC 2XNEA 2HZIA 2X2MA 4GIIA 5LARA 2BZIB 5D9HA 4IW0A 4KA3A 2R9SA 3KKVA 4E93A 4MXCA 3PIYA 4A9SA 2GNJA 5A14A 5F4NA 4EJ7A 3UYTA 1PXIA 4IJPA 2PVLA 4C57A 2IPXA 3F69A 3NMUF 3CR0A 3EN6A 3I0OA 4O0UA 4OW8A 5DLSA 4YSMA 4QPSA 2RFSA 3JUHA 2G2HA 5HE1A 4OLIA 3W8QA 3GGFA 4U44A 3SHEA 2BFYA 4JLCA 3LQ3A 3R1NA 4L01A 4RJ3A 4KKGA 1S9IA 4GJ3A 1BYGA 4B9DA 1VZOA 4IFCA 2C68A 1FGIA 3CS9A 3HEGA 4I5PA 3QTIA 5L2TA 3B8RA 3T3VA 4MD7E 2XCKA 3HRFA 4F70A 4QMPA 3GCPA 4FIFA 5HBJA 5DH3A 5A4QA 4FL1A 3ZDUA 4L7FA 3EN9A 2R3RA 2XIYA 2YM8A 4P2KA 4FTCA 1MUOA 5ACKA 5L4QA 4Z55A 4OTRA 4X2NA 1NVRA 4QOXA 4CRSA 2OJ9A 1Q4LA 4DLJA 2XB7A 3VRZA 3OROA 1JQHA 4G3CA 1TKIA 3I60A 3LIJA 3NUUA 5LVMA 3PJCA 2QOBA 4QP2A 5DT3A 1B39A 3HV5A 3OD6X 4LGGA 5L6OA 3BWJA 3R7GA 3ZBXA 2XKEA 4M68A 2R4BA 2BROA 1IAJA 3UNKA 4DEGA 3PIZA 5I5ZA 4XX9A 3GENA 3RZBA 3FMNA 3K5UA 3KK8A 3VF9A 1YXXA 4LGDA 5AJQA 4H3PA 1H0VA 4B8LA 2Z7SA 3FI8A 2XS0A 4IAFA 5KZ0A 2YZAA 2ZJWA 3DZQA 3RAHA 4XH6A 3ZZEA 4HVDA 4MCVA 5E8WA 5LMAA 4RWIA 3AD5A 4IB3A 4CKIA 5BMMA 2WMWA 3FY0A 2XA4A 2SRCA 3WF9A 3MSSA 5D7VA 4B6LA 1VEBA 3ERKA 2ZMDA 5KMIA 4YJNA 5AP6A 2VTRA 3QZIA 1ZY4A 4YHJA 3Q3BA 4IZAA 3UJGA 4FMQA 2GDOA 3D15A 4NL0A 1H08A 4FZFB 3VWAA 2ZM3A 5I9VA 3A4OX 1URWA 3G0EA 1U4DA 3LPBA 4WUAA 5CWZA 2VV9A 5AUXA 3F5GA 4DG0E 4X2JA 4YZDA 1W8CA 4NM5A 1QPEA 4FV2A 4FKLA 3RM6A 3GQLA 4LGHA 4CLJA 3HECA 4J53A 5EKNA 2FSTX 4YTIA 3JVRA 4KRDA 3SQQA 2B9JA 2I0EA 5E7RA 5AR4A 3W10A 4BGQA 5M4UA 4KUJA 3NZ0A 2C5XA 4NIFB 2H8HA 3O0GA 5JFXA 4XG8A 3BQRA 5GJGA 4ZP5A 3V51A 5CSXA 4MWIA 3PXZA 5DFPA 4DT8A 4I0RA 4RZVA 4CFWA 4MF1A 1URCA 1FVTA 4BZDA 3Q6UA 5D12A 2PK9A 3BEAA 2CJMA 4RWKA 5HI2A 2QO9A 4WRSA 4J8MA 3D0EA 4CTBA 1YHVA 4ERWA 3W2OA 5K5NA 2DYLA 1XQZA 2XKCA 3ORTA 2R7IA 3RPRA 3Q4TA 4MK0A 1YOJA 4RC2A 5DIAA 1GOLA 1FOTA 2Q0BA 3LFAA 4I4EA 4MXAA 3IDBA 4TYEA 4L3JA 2OO8X 2W1DA 1ZRZA 2WMUA 2C47A 2YLFA 2OU7A 3BE9A 3GUBA 3A2CA 5IUGA 5F20A 2YIQA 1Y6BA 2F7EE 3GI3A 3QUPA 3ZFMA 2ITTA 4O38A 2I6LA 4WA9A 3KREA 3RCDA 2X8EA 3FZOA 2WQBA 3I7BA 4DFBA 4GK3A 4PMMA 2UZDA 3R8UA 3ZSIA 2OW3A 4F09A 5M06A 2A2AA 1SVHA 3KULA 1YRPA 2HWOA 5LOHA 1Y57A 3LFCA 4ZJIA 3W8LA 4RLLA 4DG3E 5EYKA 5HIEA 3GXLA 4FEXA 2XYNA 2HOGA 4LMUA 4UB7A 4QMWA 3IONA 5DWRA 1BL7A 1R0PA 2ETMA 2HELA 3T9IA 4A9RA 3H9RA 2W7XA 1HCKA 5KX8A 3W1FA 1PXLA 2JIIA 2YITA 4LOOA 3W2SA 2RFEA 4O0RA 2A19B 2YCQA 4G16A 4AS0A 2YERA 3IS5A 1P4FA 1ZYLA 3DXPA 3A7JA 3PG3A 4AT5A 5LMBA 5CSHA 2HYYA 5EM7A 5J9ZA 3GC9A 4HPTE 5CF8A 4WG5A 5IKWA 3C50A 5J9LA 2O5KA 4P5QA 5JQ8A 1NXKA 3FQEA 4QMSA 5HVYA 1QMZA 3POOA 3QQJA 3O2MA 5J5SA 2I40A 4ZEGA 1DAWA 5AADA 3KXGA 4KIOA 2QKWB 1NVSA 4FBXA 4FSWA 4BBMA 4DH3A 5ITAA 4BHZA 3RPYA 1REKA 5HCYA 3FSFA 4F1TA 1PXOA 4R8QA 4BCFA 4DGGA 3P4KA 1XH5A 4EQMA 1UKHA 3QZFA 5HO6A 1ZY5A 3C0IA 2JC6A 3R63A 3KMUA 2P4IA 3WYYA 5CU0A 5FLFA 2BZHB 3EQBA 4U41A 4PTGA 3CC6A 4HCTA 1CKJA 5HO8A 5EKOA 4AA0A 4DBNA 3F7WA 2CNVA 4XG6A 2CKQA 1Q8UA 3Q2MA 2O2UA 4QMXA 3UG1A 2WQNA 1W83A 4IE9A 4YZNA 1YXTA 3DXNA 5AWMA 5KUPA 3BGZA 4EH6A 4D0WA 4HW7A 5HLNA 4BDDA 4QQCA 2ITOA 2QHNA 4RWLA 2W17A 3CSVA 4LYNA 2CN5A 5AR8A 4FG7A 4U6RA 1NW1A 4MNFA 3HAVA 1YDRE 5L2IA 2PZYA 2UZBA 3D4QA 1PMUA 5GHVA 3I7CA 3HL7A 5TF9A 3QGWA 3H0YA 5AUUA 4K33A 3F82A 3UDBA 3TUCA 2GNHA 2Z7RA 3PYYA 4Y8DA 3UVQA 5TR6A 2YN8A 4D1ZA 5IEVA 2XRUA 1CMKE 3E8EA 5EOBA 4MQ2A 3CLYA 3ZLXA 1PXJA 1ZLTA 2O65A 4FVRA 1FGKA 4R77A 3GFEA 4J52A 5M08A 3FI3A 1V0OA 4O91A 4GFGA 4E6CA 1W84A 3VS7A 2YM3A 2IZSA 4EK8A 4O86A 4BZNA 3GCQA 3SRVB 2OICA 3E8NA 4FEWA 4QYFA 3OT8A 5F94A 3IOKA 4YPSA 4E3CA 2YIXA 3QCSA 4FV7A 4TYJA 4JVGA 3OUKA 3VUTA 3IPHA 3GEQA 1CDKA 2BDWA 3FQSA 4BKYA 5KMNA 3R30A 1FPUA 3I0QA 4QMOA 3UIBA 2YISA 4MD9E 1JWHA 2W1FA 4NJDA 4AGCA 3LMIA 2IN6A 4AT3A 2JAMA 2VTLA 3DFCB 5CALA 3A7HA 2EXMA 2QNJA 2VWZA 2XK8A 4RC4A 4CCBA 3HDNA 4FYNA 1P2AA 4IMYA 3PLAE 4QYEA 4HOKA 2B4SB 4M14A 2YCFA 3G51A 2WFYA 3KQ7A 3QQGA 4XHKB 4IWOA 2GNIA 5A9UA 4TN6A 4YC3A 4HNFA 4NM0A 5LMKC 1OPJA 3EYGA 1GZKA 1H8FA 2W1EA 3U9NA 3K3IA 4QMNA 1WBTA 1A06A 2PZ5A 3BIZA 2PZRA 1JSUA 5E8TA 4O7NA 4MD8E 4D2WA 5GIOE 3PP0A 2QCSA 1WBVA 4I5HA 4M7IA 3UO4A 4EOIA 3SLSA 4U7ZA 4GU9A 5A4TA 5HOAA 3AG9A 5CEOA 4J97A 5IDNA 3PXYA 4O0XA 5IISA 4IZYA 3DAKA 4FKVA 5BYLA 3TTJA 1Q41A 3R2BA 4GL9A 4BDHA 4TXCA 3IDPA 3AT3A 3ZEPA 1XH8A 5AA8A 3TACA 4JG8A 2YM4A 2VTJA 3NYOA 1WBNA 3ORXA 4M84A 4RT7A 4ZIMA 4EC9A 3AT2A 4AZEA 3DKFA 5IA3A 2IO6A 4FVQA 2X6EA 4C2VA 3O17A 4CFFA 3LFSA 4O22A 3P0MA 4RX8A 2W05A 4BCNA 4FKSA 3IGOA 4BBEA 4IXPA 3IW8A 4GYGA 1J7LA 3FI2A 2BRHA 3PRFA 2BIYA 3QYWA 3LZBA 3TG1A 4MXYA 5I9WA 1H27A 4JIAA 4JNWA 4U3YA 1M2RA 2JBOA 3NUYA 4QP9A 4AW5A 1OIRA 5LCJA 2X8IA 2BTRA 5GINE 4PRJA 4RRVA 4OAUC 4BDJA 1Q24A 1PF8A 2XNOA 2PMIA 4D4YA 4FV4A 4WKQA 5IA0A 4R7IA 2CKPA 2PUIA 1ZMUA 3JY9A 3R1SA 4YNOA 3EHAA 3HMIA 1F0QA 5FDXA 5L8JA 5TE0A 4D9UA 2IVSA 1Q61A 3ODZX 3DNEA 3N9XA 4ARKA 3QRTA 5L8LA 3HV6A 3VBWA 2JIUA 2QC6A 5ANDA 3DJ5A 4K18A 4RX5A 1YWRA 3G9LX 4AX8A 4BDBA 4AOTA 2GTMA 5IDPA 3SGCA 1H28A 2WB8A 3BU3A 3NX8A 4UN0C 3L9LA 5L8KA 3BLHA 5JQ5A 1IG1A 2VTTA 2QU5A 2WXVA 4IZ7A 3EMGA 1WBSA 3JPVA 2WTWA 2I0VA 3TZ9A 3QD3A 3P5KA 2XCHA 3OP5A 4F4PA 3FLQA 2X9FA 4PMSA 5M55A 3WZEA 3D14A 5J95A 4IAIA 3D7TB 4BFMA 3RK9A 2GNFA 4YJOA 3RKBA 3EQGA 5LVOA 2C5OA 1O6KA 3SXRA 1KUTA 4A4XA 1I09A 4K11A 1WMKA 5TOZA 5EFQA 4U80A 3FL4A 4JG7A 3L8XA 4NH1A 3RHXA 2XRWA 4CTCA 5FTQA 4AN9A 2PULA 4GVAA 3R8ZA 4IJ9A 2OJGA 3F2NA 3UODA 2HZ4A 4L52A 4C4IA 2WEVA 4JQ8A 2REIA 1DAYA 4AAAA 2QOIA 4FTKA 2AUHA 1OI9A 5ACBC 3MI9A 2OLCA 3POZA 2CCIA 3AC8A 2BZJA 4GT4A 4U3ZA 2CCHA 3O23A 4FGRA 3R1QA 3BHYA 3QD4A 2C5VA 1Y91A 3I5ZA 4LMNA 3ACKA 2E9VA 3JVSA 2PSQA 2ITWA 2JDRA 3MN3A 3PSDA 4IVCA 5ANIA 4D2RA 4BTJA 3R01A 5CASA 3GBZA 4B99A 4DFYA 5CI6A 3OTUA 2ZVAA 3NS9A 3WF6A 1T46A 4ACCA 3NW7A 3R71A 4MKCA 4R3RA 3BYUA 4GV1A 4A4LA 3LQ5A 1KV1A 3R83A 3NNXA 2QODA 2R64A 3R7UA 3ZLWA 2R3NA 4MQ1A 4W8DA 4Y85A 4EWQA 4QPAA 4TW9A 4EOLA 5FXQA 4HVIA 2F7ZE 4OTPA 4O6EA 1LEWA 3ENMA 3GNIB 3MB6A 3R00A 3VBTA 3ZO1A 2WD1A 4JDJA 4ANQA 5A6OA 3OEFX 4I0SA 4XOYA 1J1BA 4QMQA 4BCPA 3D5VA 1GNGA 3V04A 1P5EA 5IEYA 5AP0A 5FXSA 4C37A 4O0VA 3PY1A 4DEEA 3AMBA 4XP2A 5CEQA 3DXQA 2W9FB 2QOCA 2QOFA 4IVDA 3WF8A 2W96B 3F3WA 5HX8A 1M14A 4CYIA 2YM5A 4F6UA 2A0CX 3ITZA 3GCSA 4EZ5A 4Q9ZA 5IU2A 5AM6A 4TT7A 3ZH8A 1O6YA 2VTOA 2OIBA 2ZV8A 3Q9XA 4IVAA 1IA8A 3MIAA 4CMOA 4L6QA 5EYDA 4RFYA 3PWDA 4BTFA 2FGIA 5EHLA 4D9TA 3DBFA 3NPCA 4BN1A 3ZO3A 4CV9A 4UWCA 4C62A 3MY5A 3BWFA 3AGLA 3IQ7A 5KNJA 2OFVA 1FMKA 1ZYSA 1ZMWA 4H36A 1OL5A 3EYHA 2YDJA 4QMVA 4X3FA 1H1QA 4BF2A 3ID6C 2YCRA 4X2FA 1H1WA 3G5DA 1J7UA 2PVHA 2J5EA 2R0IA 5ANOA 3V8TA 4AFJA 4ERKA 3NVMB 4F0FA 4EOKA 3CPCA 3PSBA 5KZIA 3VS2A 2CDZA 3NAXA 5FP5A 2C3LA 2HIWA 4I21A 4TKSA 1G3NA 4DHFA 4UYNA 4X3JA 2B9FA 5DOSA 5DNRA 5FEQA 5IA4A 3EB0A 3BZ3A 5B2KA 4FVPA 4FT5A 3WBLA 2QKRA 4A4OA 4S34A 2H96A 5EDPA 2C0TA 3T8OA 3H30A 2WIHA 1XKKA 3DJ7A 4FZ7A 2NRUA 4ACMA 2UZVA 3OS3A 4CLIA 4BCJA 4Q9SA 4C4HA 1WBPA 4D4RA 4DGLC 4RIXB 4NTTA 2XH5A 4AOIA 3L8VA 4QP4A 3C4WA 1M2PA 3HMMA 3LOKA 5HG8A 4EOQA 2XIRA 3C4EA 2ERZE 1PMEA 3V6RA 2HY81 1LEZA 4K1BA 1XBAA 1UWJA 4FZAB 3QCYA 2GHMA 3I81A 3IKAA 2B55A 3OXIA 5A4LA 5M4CA 3LLTA 4R3PA 3SG8A 3R7OA 4KIQA 5EDQA 4XNEA 4YBJA 3DTWA 5KMOA 4IHPA 3VO3A 2XK6A 1H07A 4G9CA 2WMVA 4YZMA 4CQEA 2W1GA 4N6ZA 1GIHA 4NK9A 3F7ZA 2JD5A 1NY3A 4N0SA 2V22A 3I4BA 1MQBA 4O7TA 4ZY4A 3U6JA 5DMZA 3TKHA 3C0GA 3I5NA 4MAOA 4TRLA 3GCUA 3WZDA 4ZZNA 4CFNA 3V5JA 3ZRKA 4C8BA 1ZZ2A 2BDFA 3QTQA 4EEVA 3TDVA 3L8SA 1XBCA 2JKQA 4WBBB 1WBWA 5BVOA 3BYMA 4OTWA 4PMTA 4BDIA 3Q9WA 4ZSAA 4EORA 3G9NA 5AAEA 5KKRB 2EVAA 4FF8A 2BAKA 2I0YA 4M12A 3NR9A 3FLYA 4YC6A 3H9OA 5IQEA 3N51A 3GC0A 2BIKB 4RJ8A 2YWPA 4UALA 5GJFA 2UZWE 4CT1A 3EFLA 1CTPE 1WVWA 1F3MC 3JYAA 4FTIA 3PE2A 1V0PA 2I1MA 5FEDA 4EK6A 5JH6A 4C3FA 3VW6A 4OT6A 1FQ1B 5AV3A 3VUKA 3Q9ZA 2XIZA 3QLGA 4BL1A 5L2WA 3Q4UA 3TDWA 4RJ4A 4YZBA 3OHTA 2GHLA 4HYHA 5CNNA 5EW9A 5E8XA 5EM8A 3E8DA 4YBKA 4BWKA 4Y73A 3OWJA 3DBEA 1PHKA 2G1TA 4GFOA 4BTMA 4G1WA 5K0KA 2GFSA 2VTSA 2YAKA 3VBYA 3DBCA 2OI4X 4FKJA 3VQUA 1KWPA 3LHJA 3U51A 3KMWA 1YXUA 4E4XA 4HVGA 4BYIA 2VO3A 3UQCA 4ZXTA 2BMCA 2E9NA 3PPZA 3AC5A 4AP7A 3ZXTA 3TNWA 4CFXA 5D10A 4K6ZA 4W8EA 3ULIA 3PTGA 3V5QA 4Z16A 2KTYA 3R9RA 4AN3A 3KF4A 3LCDA 4UMPA 3CTHA 3MTFA 4WIHA 3TTIA 2F7XE 4R5YA 5HE0A 2FSMX 2VTQA 2ZV7A 3QC4A 4UWYA 4DCAA 3FLNC 3LKMA 2Y4IC 2PHKA 2ESMA 3UC4A 1VYZA 4O1OA 3RM7A 2UW7A 3ACJA 3ANRA 4ZZOA 4L46A 3FHRA 3FMLA 2CKEA 5CSWA 4GU6A 5AA9A 4GIHA 2OF4A 4OBPA 3Q32A 5DR2A 3SRVA 2Z02A 1QCFA 2C3KA 2OKRA 2UZTA 3QTSA 4XRLA 1B6CB 5HX6A 4NT4A 2GHGA 4EKKA 3ZFYA 3OEZA 5ETFA 4M67A 2Z8CA 1JVPP 4YNEA 3THBA 5CAUA 3RPOA 5FTGA 3U4UA 4RFMA 4CZTA 3FYKX 3NCGA 3TKIA 1WVXA 3EKKA 1ZYJA 3EN5A 4FTOA 2C5YA 2WGJA 4ORKA 2X81A 4G6NA 3LFBA 4IDVA 3VS5A 3TT0A 3UZTA 3O51A 4G3DA 4UXQA 4BDKA 4DTAA 4EH4A 1FBNA 3GVUA 3MIYA 4P7EA 2RL5A 3QKKA 3T9TA 3PZEA 4FYOA 4BDEA 2PVJA 3FE3A 4F7JA 5AAGA 4YLLA 4PDYA 3F2RA 1Q8YA 4EK3A 1PKDA 5DN3A 3FPQA 3K2LA 5L2QA 1G8SA 4MXOA 5EYMA 3V3VA 5EH0A 1UNGA 4Z3VA 4FOBA 1JKSA 5FTOA 5JRSA 3V5PA 3KGAA 4AE9A 4GS6A 4EQUA 2JDSA 3UOHA 3IW5A 2ZDUA 1XH9A 4FKOA 5IH6A 4IB5A 4DA5A 3PY3A 1OKWA 3GOKA 5TKDA 4WG3A 3WI6A 4M0YA 3E5AA 4PPBA 5DR6A 2BHEA 4DEIA 3VS4A 3ELJA 1PW2A 2GU8A 2J6MA 4WOVA 3U6IA 2Y4PA 3TI1A 2V7OA 4M13A 4M3QA 4MX9A 4DINA 5KHXA 1JPAA 3R0TA 3EN4A 3MH3A 4TWOA 4U81A 2O3PA 3ZBFA 4NKSA 3DQXA 2WMRA 2ONLA 1QPJA 3KK9A 2V62A 4LI5A 4UMTA 1Q8TA 4FSYA 2P3GX 1KSWA 1XJDA 2X2KA 5DE2A 4JDKA 5E8ZA 2PMNX 2F49A 4PP7A 3PIXA 4BRXA 3SC1A 4DCEA 3IK3A 3OWKA 5A46A 4G3EA 5CS6A 3A62A 3A99A 1PXPA 2BILB 3GT8A 2B1PA 3RGFA 5EW3A 5CSPA 2RKUA 3BE2A 3FKOA 2VTAA 4WNPA 5CNOA 2O63A 3O50A 4TNBA 4L3LA 3UE4A 1KV2A 2QO7A 3F6XA 4KD1A 4Y95A 5HIBA 4O7VA 2QLQA 4TY1A 4TL0A 4LRMA 1TVOA 5C03A 4IAKA 2Y7JA 3Q96A 1REJA 2Y6OA 4O1PA 4IWDA 2BCJA 5DBXA 4HGSA 2W0JA 5HG7A 2F2CB 2JKMA 2E2BA 3VS1A 4WNMA 1R78A 2BALA 2GNLA 2CPKE 2PVRA 3FMKA 4AF3A 3RNYA 4YPDA 4X3FB 1YDTE 3MW1A 5FUTA 4EK5A 4GT3A 2NP8A 5AP4A 3SKCA 4U97A 3FPMA 2J9MA 2PZIA 3MWUA 3MFRA 3PY0A 3VS3A 3CGOA 2ETRA 3LCSA 3PG1A 5EG3A 5IUIA 4RWJA 2WTVA 3V5LA 3WZJA 4FTLA 2JITA 3LJ2A 4MBIA 2P2IA 5IEXA 3P23A 4Z7GA 2V0DA 1SYKA 1H25A 5D11A 3FZRA 3SX9A 3ZDIA 3R28A 3SA0A 1OITA 2UVZA 5HESA 3D7TA 3CPBA 5IZFA 1OKZA 4FG9A 4O7YA 3DK3A 4M66A 2XNMA 2OH4A 4C4GA 3R1YA 3ALNA 1HOWA 4LFIA 2PE2A 4GG7A 1OPKA 2QO2A 1V1KA 3Q9YA 4QNYA 2OJFE 3CD8A 3ETAA 4WG4A 4CFMA 3B8QA 4F1MA 4V0GB 5HLPA 3OBJA 3VQHA 3BI6A 3FZ1A 4IX4A 2VRXA 1YXSA 2ITYA 3P7AA 3PSCA 5FBNC 3W16A 5AEPA 5BYYA 1UU8A 4FICA 4QD6A 1WAKA 5CF5A 2V5QA 4WNKA 1GJOA 5AUZA 4C3RA 4Z7HA 3ZM9A 3DKCA 3QD0A 1Z57A 4ZTNA 3WILA 2C4GA 2YWVA 4NW6A 2E9PA 4R3CA 1W82A 2BZKB 3UQFA 3GP0A 3G90X 4FEQA 2FB8A 1M2QA 3FMDA 5IMEA 3U4WA 5K5XA 2YJRA 2C6MA 5LQFA 3OOMA 5JFVA 2ZB0A 5FXRA 4YZ9A 2J0IA 4J7BA 5BNJA 5KO1A 3FXZA 2C6KA 4IH8A 5CXHA 4EH5A 4V04A 5JGDA 2OSCA 4RPVA 3R04A 3LFNA 3AC1A 2QR7A 2VWIA 3BYOA 3EZRA 3FZSA 4OAVB 3O8TA 5HQ0A 4B0GA 1PRYA 4D5HA 4AGDA 2CGUA 4USFA 2GPHA 1UNLA 3W2QA 5M53A 4FOCA 4IANA 4RMZA 5D41A 4BDGA 5JEBA 1L8TA 3KMMA 4BKJA 2WQOA 1WFCA 2IW6A 4QTBA 3DV3A 3FXXA 4H39A 3FMJA 5FP6A 5FDPA 4I23A 2B52A 5JRQA 4WRGA 2GSFA 2Q0NA 4H3QA 4PY1A 3ZTXA 2IWIA 4YC8A 3PPJA 3WYXA 4H1JA 5ANKA 3EJ1A 4WUNA 3VUMA 4OTHA 4CFVA 4JQ7A 2CKOA 2OH0E 4PL5A 2WMAA 3ATTA 2H34A 3FWQA 4CQGA 3GC8A 3HP2A 3EIDA 5LCKA 4PQNA 1IRKA 2UW0A 4MH7A 2X9EA 4W9WA 1JSTA 2OZAB 4RZWA 2PTKA 4M69B 4PP9A 4W4VA 1P14A 3IDCA 3WZUA 3HX4A 2YHVA 5DG5A 4DF3A 3RNIA 2OF2A 3UGCA 2WQEA 5AM7A 2PWLA 3F61A 4I5CA 5IF1A 1G5SA 2O8YA 2PVKA 2GQGA 4BWPA 2C69A 2DUVA 2OIQA 3F66A 3QQLA 2ETKA 4QMYA 3UTOA 4ENXA 4U43A 2VD5A 4FNXA 3VUIA 4AGUA 5DR9A 5CVHA 5KMJA 4WHZA 3E87A 4DH5A 2EB2A 1KE8A 3KCFA 4I24A 4YJQA 1MRUA 4LRKA 4RVLA 3A4PA 1JKKA 5A54A 1NT2A 3GFWA 3KXZA 4N70A 4C34A 5E1SA 4BI0A 5BVNA 5CF6A 4U0IA 2PPQA 3W2RA 2YA9A 1VYWA 4KSPA 2Z2WA 4OBQA 3UG2A 4NCTA 4QMUA 3AC2A 5CU3A 3NIZA 5E91A 1SZMA 1OIYA 4D2TA 4AA4A 1OBDA 5J79A 1M7NA 2YLEA 3COKA 4IC8A 2EWAA 4I93A 4OTFA 3ZSHA 5J1WA 4G34A 4FNZA 4C33A 3ENHA 2XVDA 2EXCX 2UZOA 1K3AA 3QRUA 3QTUA 3TNHA 1FVVA 4NKAA 4G5PA 3NW5A 4GK4A 3WIKA 3ZEWA 4B4LA 3BRBA 2PMOX 3G6HA 4BB4A 4GW8A 1GZOA 4I6FA 4RIXA 3CQWA 4QP8A 1LR4A 1J91A 2R3GA 1YW2A 1KE5A 4RQKA 2C30A 1XR1A 3DDQA 5CSVA 3R22A 4FV6A 5EQEA 4MYGA 5IQDA 3BV2A 3NIEA 3QKLA 4O2ZA 4PTEA 5HKMA 4GG5A 2A4LA 3BU6A 3RBWA 5LWMA 3E3PA 4FT0A 5I3RA 2G2IA 3HV3A 4A9YA 3VC4A 3WE4A 5M44A 3DK6A 3KCKA 4OR5A 5HVJA 4XG2A 3CCNA 3MS9A 3TWJA 3DB6A 4FKIA 5LVLA 3HMPA 4FSQA 3H10A 2UW9A 5EYCA 3REPA 2R2PA 3H4JA 3QCQA 4I6QA 3RAIA 4CT2A 2C6IA 2YEXA 3I1AA 5FEEA 4CXAA 5HORA 3LM0A 4LUDA 5T3QA 2WO6A 4E26A 5C4KA 3NVKI 3AXWA 4FIHA 2R3OA 5BX0A 1ND4A 4G3GA 4D2PA 4ZJJA 4B8MA 4QNAA 2FH9A 3L1SA 3QWKA 4JBOA 3BCEA 4KIKA 4EYJA 3KB7A 4DC2A 3K54A 4CG8A 2WMSA 2QOKA 2BFXA 3A7FA 1KE7A 2BRNA 4EH7A 2OGVA 1SVGA 3FDNA 3S3IA 3EFJA 3P1AA 1QPDA 4BCIA 4C4FA 5DT0A 5I9ZA 1Q3WA 5E8SA 5BVFA 2LGCA 4YURA 2B7AA 4I41A 4S32A 4CMUA 1YVJA 5BVKA 3ZSGA 3C1XA 3P86A 2W1HA 3GU8A 2QOLA 3NSZA 5G1XA 1PY5A 3QZGA 5CF4A 4IQ6A 3KA0A 3BLQA 5AAFA 3O7LB 4IAAA 2PE0A 5CU2A 5B7VA 5BPYA 3JY0A 5J9YA 2CGXA 4FV0A 5FBOA 4PWNA 4DTBA 4NFNA 1TQPA 4F7LA 5HVKA 3PXRA 2UZUE 1P4OA 1UU7A 1ZOHA 3ZZWA 1YI6A 3KL8A 3HLLA 3DBQA 3QQKA 3R8LA 4N4SA 5HTCA 4ITJA 4ANBA 1GZ8A 5H8EA 5EM6A 4NJ3A 3CIKA 5HG9A 4IM2A 5E8YA 3ZS5A 4U9AA 4TYHA 5EHYA 4AW2A 1BL6A 2J0LA 1OKVA 4YTFA 4QTAA 4TYIA 3VAPA 5M4FA 3L8PA 3PA3A 3HZTA 3W32A 4OUCA 4E5WA 3BU5A 5E92A 3P08A 4DYMA 3CJFA 5IA2A 1Y8GA 4E7WA 4DFZE 1M17A 1ZOGA 4QO9A 1PXKA 4AG8A 3TEIA 5CTPA 2YACA 4UV0A 4H05A 5L6WL 2PVFA 4BWXA 4WD5A 4AZFA 5HCZA 4D58A 4X2KA 4L53A 3DNDA 4EYMA 2XBJA 2GTNA 1FINA 3OCSA 1DS5A 1UU3A 4O84A 2G15A 4DEHA 1W98A 3COHA 3G15A 3EL7A 4ALVA 4AW1A 1R1WA 3KY2A 4C36A 4IADA 4JR3A 2QOHA 4W4WA 4M15A 3CBLA 5CANA 3PFQA 3NAYA 3SAYA 4ZJVA 2VWWA 3TUDA 2PUNA 5KE0A 5BYZA 3KEXA 3C4CA 3KRLA 4FTMA 5H2UA 3FMHA 4R7HA 4V01A 4ZSEA 4D0XA 1SMHA 3VN9A 4Z9LA 1A9UA 3VJNA 3QBNA 5FRIA 4ZLYA 2W4JA 3ZO4A 3ZCLA 4FTUA 4JG6A 2HXQA 5CT7A 3F9NA 4E6AA 3EFKA 2O64A 5AV2A 5IQGA 4YP8A 3HUBA 5GNKA 3NNWA 1H1SA 1PXMA 4Y83A 2WHBA 3VNTA 4RVTA 3VULA 4ZSGA 5HNIX 3S2PA 3ZC5A 4HVSA 1TQIA 4XS2A 1R39A 4QP7A
chains in the Genus database with same CATH superfamily
4H58A 4XLIA 4XMOA 5ETIA 2CLXA 2YCSA 3FLWA 3FYJX 5EHOA 2Q83A 3ORKA 1OZ1A 4EONA 3UZPA 2QLUA 2R3MA 5A4EA 3QLFA 4OGRA 4DT9A 4JBPA 4R5SA 2B0QA 5IQHA 1ZMVA 4TWCA 4H3BA 2BPMA 4L42A 3WE8A 2OWBA 3GU4A 3LJ0A 5FD2A 1YXVA 3I79A 3OMVA 4MBLA 2X7OA 4FSNA 4C2WA 1CM8A 3FI4A 3QC9A 2KULA 2P2HA 3EOCA 3LCTA 4ZTLA 3ZLSA 4TPTA 3Q6WA 2G9XA 4XUFA 3QXPA 3LXPA 1BX6A 5IMXA 4DGOA 4YTHA 5HD4A 4R78A 4RIOA 1ZZLA 2W1IA 3AT4A 3D94A 5E8UA 2X4FA 2ITXA 4I0TA 4HGLA 2GS6A 2VNYA 4XJ0A 4BCKA 3UDTA 2FUMA 1U5QA 3KXHA 2XIXA 4M0ZA 4LL5A 2V7AA 2OG8A 2R3QA 3GQIA 3BHHA 4KS8A 3ORMA 4FKUA 4D55A 1MRYA 2ITVA 4JR7A 4DHZA 3Q04A 4GFMA 4IC7A 2XEZA 5KMKA 4RX9A 4K77A 4I1ZA 4IIRA 4IAYA 4C38A 5HTBA 4JI9A 4IWQA 1OL6A 5AIRA 4PL3A 1YDSE 3FC2A 2UW6A 3LXNA 4TZRA 3AOXA 5BVDA 5BUJA 1IASA 2X1NA 2BRBA 2VGPA 2UZLA 3C5UA 4J1RA 3RTPA 2XALA 3NNVA 2WOUA 5HU9A 2XP2A 4YHTA 4BVUA 1VR2A 2BTSA 4ZAUA 4BY9E 4YJTA 2HZ0A 3TNIA 4YLJA 1XWSA 4EZ7A 1NA7A 2JLDA 2JEDA 2VWVA 5FM2A 3PVGA 4J95A 1V0BA 2IVVA 3VRYA 3TIZA 3TZMA 1PMVA 3K5VA 4EOPA 3UO6A 3HP5A 3AC4A 3DA6A 3GC7A 3M42A 4BGHA 5LXMA 3RMFA 1JLUE 4E6DA 5FQDC 4IZ5A 5BQ0A 3DBDA 1OECA 5L2SA 3BHUA 4I22A 1ZYDA 2X0OA 3HMNA 4ACHA 4F6WA 1DI8A 3KXXA 4CMTA 4TWPA 2IZTA 4M8TA 1U54B 3MY1A 4UEUA 2OK1A 1K2PA 4XCUA 4L8MA 4D2VA 4DBXA 3FL5A 3QHWA 1LPUA 3W0SA 4UY9A 3GB2A 2J5FA 5FM3A 3WF5A 4DTKA 3QRJA 3WF7A 4EH8A 4LG4A 3U8WA 1YKRA 2CNQA 5JGAA 4OTDA 4FL3A 1YWNA 2O0UA 2XM9A 3A8XA 3BQCA 2XKFA 3QA8A 3G0FA 4RG0A 5FWKK 5BVEA 3ZRLA 5E4HA 4Q5HA 3MDYA 3FZTA 4FK6A 5CAQA 3QTWA 4DFUA 3KFAA 4V0GA 4DFNA 5L6PA 1H26A 4C4JA 4W4XA 1OIQA 4UWBA 3KRJA 5J7HA 4GKHA 4E4LA 4O7RA 4U5JA 3FV8A 5CVFA 1RQQA 2QD9A 2C3IB 3QWJA 1OIUA 1JBPE 3OWPA 5HCXA 2YIRA 3NYXA 3OXTA 4L67A 4O4BB 4BBFA 4Y72A 2YAAA 4BYJA 4BZOA 5C26A 1BUHA 1Q99A 3RVGA 1KE9A 3KRWA 3QU0A 3EQIA 4DLIA 3K3JA 4EKLA 3TL8A 3ZO2A 5M09A 1DI9A 1JNKA 4FT7A 3BPRA 3GU5A 3R8VA 2BDJA 2C0OA 4RGJA 2BRMA 3W0PA 1K9AA 4WT6A 5ETCA 1FVRA 4F1OA 4RVKA 3EKNA 2NNWB 4IVBA 2HK5A 3W0QA 4PUZA 4QT1A 2IZRA 3DTCA 1ZWSA 1PMNA 2AYPA 4L00A 3W18A 3C0HA 2ACXA 3CTJA 1FMOE 1UU9A 3MVHA 1PYXA 3AQVA 4QMZA 1Q8WA 2XK3A 3GU6A 3CXWA 5JT2A 4GT5A 2XBAA 4KIKB 4F9CA 4KRCA 4FTQA 1KOAA 4L9IA 3IG7A 2OXYA 4QEBA 3L9NA 2XZSA 4NSTA 2QONA 4WSYA 3R8MA 4BR3A 5HICA 1UV5A 3VS0A 2DS1A 4G17A 4BDFA 4FKQA 4ZMEA 4RJ7A 3AGMA 4NCTC 4BDAA 3TV7A 3H0ZA 3KVXA 3MVMA 4JQEA 2QU6A 3BYSA 3SV0A 3F3UA 5T6KA 3VHEA 5GIPE 1XH7A 3F5PA 2W1CA 5HIDA 1RE8A 2OZAA 2A1AB 4M69A 3TNQB 3UMXA 4IM0A 4ZTQA 4CCUA 5HLWA 3R7EA 1G8AA 3N4TA 2W06A 2VWUA 1A48A 2R3LA 3WIGA 5C8KA 3FZPA 5AMNA 1PJKA 5CI7A 3C4ZA 1JOWB 3COMA 4RIYB 5I9YA 1UA2A 4IX3A 2C5NA 3TXOA 2B9IA 1MRVA 3ROCA 1OUYA 4HYSA 2R3HA 3V5TA 4XV1A 3TN8A 4O81A 4TYHB 3C5IA 4XBUA 3BYVA 4G9RA 3UMWA 2ERKA 3U87A 3O71A 2OFUA 4HPUE 4IX5A 3O96A 2FYSA 2QR8A 3MTLA 4UYAA 4CGAA 2XNBA 2WTKB 4TWNA 1RW8A 4AT4A 4X6QC 3PXQA 4X2GA 1H00A 3CQEA 4BGGA 3KXNA 1QL6A 5HNGA 4IFGA 4P90A 4YGAA 1W0XC 4AXAA 2IZUA 4QYHA 5F95A 5J7BA 2BRGA 4ZS4A 3FKLA 4FEUA 3LXKA 4O6LA 3TJCA 2PE1A 5DHJA 1ERKA 4RJ5A 4JXFA 3ZHPC 4ASZA 4BCHA 5LMKA 3EFWA 1YHSA 4FG8A 2QOOA 4FV8A 4YLKA 3S0OA 3P78A 4W9XA 1AD5A 5IQIA 3LAUA 4HVHA 4KBKA 3HV7A 5AP1A 4ZS0A 3UVRA 1VLRA 2IW9A 4D4VA 1YI3A 3PVUA 4EOOA 4PL4A 5EK7A 4QTDA 5IH5A 3QXOA 5ETAA 2RG6A 5AUWA 5JK3A 2PVNA 3DQWA 4RQVA 5BMSA 2IJMA 4JS8A 4XG4A 5GZAA 5CAVA 2H6DA 4G2FA 4MHAA 3EN7A 2J0KA 3B2WA 3DFAA 3NGAA 3QX4A 3VIDA 3MPMA 1J1CA 3ANQA 4FKPA 3WZKA 2P33A 4EHGA 3FY2A 5LVNA 2RSVA 2VWXA 3MH1A 2WIPA 3TIYA 4F99A 3D5XA 1GAGA 4TNDA 5JZJA 3V6SA 4ZLZA 1JKLA 4MNEB 3H3CA 3V8WA 1PKGA 5CAOA 5CENA 4AA5A 3P79A 2C3JA 5JFSA 3VHKA 3F3TA 5E90A 4NU1A 5ANJA 4PPCA 5C8MA 4E8AA 4QP3A 4RA5A 4F9AA 4GVJA 3C4XA 4YJPA 5GZ9A 4E1ZA 2RFDA 2PU8A 4ITIA 3CKWA 4ASEA 2DWBA 3QQUA 2UUEA 4C0TA 3FUPA 2LAVA 4BIEA 3ULZA 3L9PA 3E3BX 1U5RA 4L7SA 2VAGA 3ZONA 3BBWA 3HA8A 4IEBA 2ZM4A 3QD2B 4UMQA 5I9UA 2GS2A 3MA6A 2PUPA 5HE3A 4CZYB 5IG1A 2WNTA 5HD7A 2GQRA 3IW4A 2XK4A 4C4EA 4CZUA 4AAYA 4HJOA 2EU9A 2WMXA 3Q5IA 4MWHA 2WAJA 4ANMA 3HNGA 2VGOA 4FSTA 4F7SA 4NYEA 3I6WA 3LM5A 1XO2B 4NUSA 4AZSA 2ZV2A 3AMYA 4AZWA 4O0SA 2IVTA 4FV9A 3RPVA 2W5AA 1H4LA 2NRYA 1Q62A 2AC5A 2B9HA 2VTHA 3GOPA 4RFZA 3W55A 4C02A 4CKRA 4KAOA 5CVGA 2CN8A 3VF8A 5I0BA 1AQ1A 3UPXA 4I6HA 2JKKA 2P0CA 4K2RA 4PF4A 3PFYA 4EUUA 3P7CA 3R9OA 4DN5A 2BHHA 4MF0A 5IQCA 1OUKA 3UC3A 3LLAA 4BJJB 2IEWA 4FIGA 3ZU7A 4AU8A 2B53A 4AWIA 4AN2A 2JFMA 4AXFA 4ID7A 4YZCA 3EZVA 2ITZA 3VBVA 4IBMA 4C3PA 1ZXEA 4JOAA 4KKEA 5H8BA 5ICPA 1ZARA 2WU6A 3NCZA 4I6BA 4LM5A 3UPZA 3U55A 4F9YA 3CKXA 4C59A 2ZDTA 5LVPA 2JDVA 2OBJA 5EOLA 1H0WA 5AR2A 4FKGA 2JKOA 5AUTA 5HTIA 5AFVA 2X0GA 2UW3A 3TCPA 3HRCA 4A06A 3UNJA 4KIPA 2RF9A 5AP5A 3NYNA 3UOLA 4HCVA 4IB0A 1GIJA 5C27A 5F9EA 2VO7A 5JGBA 4BCMA 3IECA 4AACA 3LFFA 5AUVA 2PVYA 3RAWA 3EQFA 3F88A 3QRIA 4FSRA 2EXEA 4OTGA 2W5HA 3NLBA 3NUSA 4EH3A 4O7SA 4N6YA 5EI6A 4D28A 2B54A 1YQJA 5C01A 4FKTA 4E73A 5CLPA 3RALA 4J96A 4R1VA 2GS7A 3JXWA 4BCGA 4M97A 1IEPA 1YHWA 4APPA 5HZNA 3UP7A 3AKLA 4AQKA 4BI2A 3M1SA 5HHWA 1TQMA 3N4VA 5KMLA 4RC3A 2E9OA 2HENA 1MP8A 4QYGA 5M56A 2C0IA 3R02A 2ZV9A 3QGYA 4QDEA 3UO5A 1ZAOA 3I6UA 4AQCA 4F9BA 3S4QA 3PDTA 2BUJA 4MUQA 5DA3A 3KRRA 3MBLA 3PRIA 5CU6A 4BIBA 3OUNB 3S00A 3VJOA 3VVHA 1SM2A 2XYUA 3MFTA 2OJJA 5D1JA 3RHKA 3M11A 5AX9A 4D5KA 4EC8A 2J51A 3PJ1A 2QI8A 2VX1A 5BUEA 5JFWA 4DHIB 4Q2AA 1MQ4A 3LCOA 3OBGA 4ZY5A 4LOQA 2J4ZA 3M2WA 2WMQA 3MFUA 2FVDA 5JN2A 4PNKA 4CKJA 4FTRA 2F57A 3MA3A 4QP6A 1ST0A 3ML1A 4QP1A 1ATPE 5I3OA 3FC1X 2GNGA 2UW4A 3G33A 1GZNA 5E8VA 4EOSA 2BAQA 4FTJA 1OBGA 4ZOGA 3N4UA 1ST4A 3QHRA 3Q60A 2ZMCA 4ASXA 3QALE 3EQRA 3Q5ZA 1STCE 5D7AA 4EK4A 4UX9A 4RSSA 3VUDA 3C9WA 3OFMA 1APME 1JSVA 1OMWA 3Q4CA 4FNYA 1WBOA 2BKZA 4CYJA 4ENYA 1R0EA 2BR1A 1WVYA 2UZNA 4X3FC 4LDTA 5H9BA 4FGBA 2UVYA 1F5QA 3TUBA 3FSKA 3LXLA 5F1ZA 4AFEA 5J1VA 2ITQA 2C1AA 5J87A 3DGKA 3VBXA 3HKOA 4WNOA 2RFNA 5C9CA 4YR8A 3Q53A 4NZWB 2WTJA 3FMEA 4I3ZA 4RJ6A 4AZTA 4EH9A 4Y5HA 4ZLOA 5C4LA 1Q8ZA 3NYVA 4JX3A 4DH8A 3F3ZA 1B38A 4HZRA 4JRVA 3SXSA 4EL9A 4HCUA 4QQ5A 5CQUA 1O9UA 2P55A 4O21A 2IVUA 2WMTA 4BIDA 4I5MA 3OG7A 2FO0A 4GRBA 3VW8A 2C6DA 3DLZA 5DI1A 1OL2A 3EL8A 4Y46A 3NUPA 3IOPA 5BUIA 2HAKA 1WZYA 4FUYA 3LMHA 2W4KA 2RG5A 3DB8A 3DPKA 2GFCA 2XUUA 5M51A 3KIOC 1U46A 2IG7A 2VZ6A 3O8UA 5K9IA 4QTCA 4FV1A 5HEZA 2W4OA 3ZXZA 1QPCA 4XBRA 4ZK5A 3UQGA 2ZOQA 3RP9A 4RIWB 3A7GA 2VX0A 1WCCA 2ZM1A 2NO3A 3E63A 4RLKA 4OT5A 2XKDA 4QRCA 2J50A 5HBEA 4YTCA 4ZTRA 5H8GA 3TKUA 4F08A 4EBWA 4U40A 4CV8A 1AGWA 1J7IA 2XJ2A 4O27B 5HE2A 4K9YA 3HRBA 4U45A 1OGUA 1XH6A 2JDTA 1U54A 5L3AA 5A3XA 3II5A 3R7VA 2AC3A 3U6HA 2VO6A 3MYGA 2YDKA 2ITPA 4IAZA 3EQDA 4FT9A 4GK2A 4UBAA 3FKNA 5EI2A 4O0WA 2X2LA 3MV5A 3A60A 4I94A 4XP0A 5HGIA 3AKKA 4F6SA 1KE6A 2XNGA 5K4JA 1Y8YA 3ORNA 3F5XA 4L43A 4YU2A 3ZYAA 3FAAA 4FZDB 2H9VA 4K0YA 4YO6A 4AUAA 3COIA 4UMUA 4GCJA 4ANNA 3PA4A 1IA9A 3QFVA 3MB7A 4PTCA 3CE3A 3MFSA 3EH9A 3HYHA 4FIJA 3Q52A 3NW6A 3RCJA 4OTQA 2W5BA 4YJRA 2J0MB 3E64A 5DT4A 4CRLA 3KRXA 5FG8A 3PZHA 2Y8OA 2R3JA 3SDJA 4PDSA 3E7VA 5CYIA 2FA2A 2R5TA 3LCKA 4XLVA 3MH2A 3PP1A 4O83A 4JBQA 4QMMA 3A7IA 3HMOA 3SOCA 1OL7A 4FIIA 4CSVA 5IUHA 5E9EA 2WTCA 2JBPA 5H3QA 1S9JA 1Z5MA 2W99B 4WBOA 2HY0A 4YJVA 4X0MA 4J8NA 5IQAA 4APCA 3HGKA 3OOGA 5AR7A 4WO5A 3QKMA 2CNUA 4A7CA 4F0IA 1YOLA 2VUWA 1CSNA 2QOQA 3FHIA 3HV4A 4D2SA 4F7NA 5JKGA 4O82A 2CGVA 3UZRA 4J99A 4FT3A 3WOWA 3Q2JA 2XNPA 3R9NA 3OW4A 5E1EA 4NWMA 4XG9A 3EWHA 2VTPA 1L3RE 2IF8A 2J7TA 3FEGA 3CGFA 4PV0A 1E1XA 3BEGA 3GCVA 4AE6A 3DK7A 3KF7A 4E5BA 3BGQA 3OY1A 5AX3A 3SG9A 2OXXA 3CY2A 4FKWA 4BICA 2X6DA 1LUFA 3ATSA 1BI7A 3TZ7A 4LUEA 4DG2E 3DOGA 3R9DA 3LE6A 3BHTA 4FK3A 4I20A 4JL9A 5ANGA 3VBQA 4ALUA 3UOJA 3KC3A 4L45A 2PMLX 1PXNA 4ACGA 3R6XA 3E88A 3D2KA 4LQMA 2QVSE 4D1XA 4F65A 1RJBA 3FBVA 4FR4A 4EHZA 4KABA 5DRDA 2W1ZA 3SXFA 2VU3A 4YJSA 4IM3A 3OCBA 4XV3A 1EH4A 1IAHA 4LOPA 2VWBA 5J5TA 4EBVA 2C6OA 3D9VA 4E5AX 3C4FA 3ET7A 4S2ZA 3JR1A 3TM0A 4H1MA 4I4FA 3R9HA 3DDPA 2X4ZA 4A9UA 5KBRA 3CQUA 4RA4A 2NPQA 5BVWA 1BKXA 2VNWA 3KVWA 5FGKA 3W0MA 4FV3A 3ZLYA 4RIYA 3ORLA 2C6LA 3FXWA 4A9TA 4J71A 5AV1A 5B0XA 2WU7A 3UBDA 1H24A 4UMRA 3RWPA 1OVEA 4AW0A 4JDHA 3WARA 4FUXA 3PUPA 4FTAA 5CEKA 2Y0AA 3ROYA 4AZVA 3QRKA 4ZY6A 2NYAA 4BC6A 1XHAA 3DT1A 3QQFA 4G5JA 5K3YA 1Y6AA 2XK9A 3PJ3A 4O2PA 2J2IB 2XJ1A 4HGTA 5HO7A 3QQHA 3U9CA 5CEPA 3QF9A 4FTNA 3NDMA 3PLSA 5AR3A 3ZFXA 3MGYA 4YMJA 5EI8A 1ZYCA 3NUAA 3UYSA 4FRFA 4XV9A 2R0UA 2XEYA 3DAEA 3KXMA 4MVFA 5A6OA 2QG7A 2YM6A 1XBBA 3KN5A 5LJJA 3OY3A 4FSMA 3Q4ZA 5KBQA 3AMAA 3MPAA 1BMKA 4U42A 3CEKA 3DKGA 4D4SA 3UIUA 5B2LA 4G6LA 3ZUUA 5EQYA 3QTRA 2YM7A 4GMYA 4X21A 2YDIA 4EWHA 4P4CA 5AIKA 4PMPA 3QAME 2A27A 4DEAA 3MJ1A 4DFXE 4XG3A 1O6LA 4B7TA 4FNWA 1NVQA 4FKRA 4YHFA 2C6EA 4HYIA 3CY3A 4LV7A 4KKHA 3E93A 4CFUA 2ONLC 4MNEA 4NTSA 5AR5A 2X8DA 3IGGA 4J98A 4O0YA 3F5UA 2WKMA 3OXZA 4O7ZA 1OL1A 3PXKA 4JJRA 1H01A 1OM1A 4UZHA 2I7QA 2W9ZB 2R3PA 2XNNA 4Y5QA 4ONAA 3R8PA 2JIVA 4USEA 2HW7A 3OVVA 3QUDA 4UZDA 4G31A 4O96A 1KOBA 3DZOA 4U8ZA 3C51A 4GEOA 4F9WA 4GJ2A 4KS7A 5IA1A 2DQ7X 3MVLA 5DGZA 4D1SA 4KWPA 5HG5A 4FZ6A 3PE1A 4JDIA 3CD3A 3OCTA 3S1HA 4HYUA 2QQ7A 4G3FA 3FLZA 2FSOX 4YO4A 3NUNA 1Q5KA 2UW5A 2PUUA 5IQFA 4K8AA 5GZ8A 4TYGA 5JMSA 3R7YA 4FC0A 4FI1A 4U79A 3TV4A 3DAJA 2JDOA 4XEYA 3W2PA 4BKZA 3FJQE 3QL8A 3D7ZA 3ORZA 2GCDA 4P5ZA 5CU4A 3RI1A 2XAOA 3DCVA 3ALOA 1UNHA 2F9GA 4JT3A 3V01A 4BI1A 3ZRMA 2WTDA 3B2TA 4QYYA 4LL0A 3UVPA 4NM3A 4F0GA 1E1VA 2PVMA 3A8WA 4EOJA 4EQCA 3RPSA 4ZTMA 2VTNA 1J3HA 4E20A 5CT0A 3KULB 2R3FA 4DGNA 2GMXA 4PPAA 2ZAZA 4BCOA 2E9UA 3CJGA 4BJJA 4ZSLA 2HWPA 2GQSA 2EB3A 5K0XA 2X0PA 4OBOA 4R1YA 3W33A 3QTXA 1YWVA 5M4IA 3BGPA 3KN6A 1W7HA 3LJ1A 5J8IA 2YZLA 3C13A 5EDRA 3RK5A 2R7BA 5IPJA 5CQWA 2PYWA 4KNBA 5DEWA 5TT7A 4EUTA 1X8BA 4RVMA 2YABA 3DLSA 4S31A 3OF0A 5B2MA 2PL0A 3G6GA 4AOJA 3NWWA 2XIKA 4II5A 4GKIA 3RJCA 4E6QA 2ITNA 2X39A 5BV3A 4FL2A 3UOKA 3D83A 2EUFB 3NUXA 4DFLA 5A4CA 5C8NA 5I9XA 4YUQA 3E7OA 5AP3A 4CVAA 5M57A 3PUFC 3BELA 3PVBA 3PVWA 4FX3A 2F2UA 1GY3A 1SNXA 3PPKA 4FTTA 2IW8A 4FEVA 5JSMA 1T45A 3OWLA 4JX7A 2ZYBA 3SW7A 4EZ3A 2WEIA 4E4NA 3OZ6A 5CZHA 3VUHA 3QX2A 1JKTA 1UWHA 3DY7A 4EH2A 5CEIA 4X7QA 1UKIA 3R2YA 2JFLA 4JBVA 4AXEA 4C35A 2R3KA 4PDPA 3HA6A 3LFDA 4S33A 5IA5A 3NNUA 4EJNA 4LRJA 1RDQE 3RZFA 4DH1A 4MEDA 5CZIA 4JIKA 2QHMA 2X7GA 4HZSA 1Z9XA 4IDTA 2I0HA 2VN9A 3L9MA 4GUEA 4FV5A 3ORIA 1PYEA 4ZZMA 5AV0A 4MXXA 5EW8A 4DITA 2J90A 5G6VA 3NRMA 4QMLA 5DEYA 5CX9A 1OB3A 2G2FA 1H1RA 3E92A 3QUEA 2HCKA 3QYZA 4IWPA 4E4MA 4NEUA 3P7BA 2JAVA 3UIXA 5K4IA 3EQHA 3SOAA 3OCGA 5AV4A 5AP2A 5AP7A 3NEWA 4ZSJA 4CG9A 1BI8A 3LFQA 3PJ8A 1OPLA 3QTZA 4Q5EA 4DEBA 4NIFA 4DH7A 4ZTSA 1UVRA 3TZ8A 4XP3A 4IACA 1R3CA 2VX3A 2ITUA 3S95A 2XJ0A 2CLQA 4RBLA 3OTVA 3UDZA 2Y6MA 3PXFA 4S30A 3HAMA 4DEDA 3IO7A 1JAMA 4LV5A 2XF0A 5AUYA 3MH0A 4C7TA 4CEGA 4KSQA 1HCLA 5CXZA 5KHWA 3R7IA 3V8SA 3ZUVA 5KCVA 2X7FA 3AD6A 3SVVA 3MJ2A 5ANEA 4OTIA 2BAJA 3FLSA 3ZUTA 5M07A 3BBTB 4BDCA 3F2AA 3QCXA 2C1BA 2HXLA 2WELA 3E62A 3LFEA 4L68A 2R3IA 4EOMA 3E8CA 4DGMA 1I44A 2FSLX 3LMGA 3EQPA 2WMBA 3JS2A 4FSUA 4R7BA 4ZMFA 2YJSA 4XV2A 2VTIA 5CEMA 5IQBA 5DPVA 1Q97A 1CKPA 1GIIA 3W2CA 4PDOA 4RX7A 4NM7A 4YSJA 3OW3A 2WQMA 3OC1A 3O8PA 2UW8A 4ACDA 4FE2A 5KMMA 1M7QA 3DU8A 5C1QB 1H1PA 4I92A 3P5JC 5A6NA 3BV3A 3ZM4A 1E9HA 2CMWA 4GYIA 4PX6A 1BLXA 3BX5A 1SVEA 4FSZA 4BCQA 2WPAA 4XG7A 4GUBA 2Y4IB 4R6VA 4ALWA 5DRBA 4QMTA 4EHVA 2CHLA 2UVXA 2F4JA 4QPMA 2UV2A 3OT3A 4TTHB 3RINA 4FA2A 4QTEA 2OXDA 2WOTA 1G8KA 4C58A 2WTIA 4JAJA 4DDIA 5EM5A 2Z60A 4IX6A 5HNBA 1VJYA 3UIMA 3TNPC 3KU2A 5DVRA 2QURA 4O7WA 4DAWA 3C7QA 4QQTA 5LWNA 4XOZA 4A07A 3IW6A 5I4NA 2OZOA 4RIWA 3DS6A 2XARA 4UXLA 2CSNA 3T3UA 2ZB1A 2BVAA 1IR3A 1ZOEA 4ANOA 5IH4A 2V55A 4L44A 4QQJA 2C6TA 3PA5A 2VTMA 3H9FA 1CKIA 3ORPA 4GH2A 2YIWA 2RIOA 4AGWA 3HDMA 3FQHA 3D5WA 3ZOSA 4W4YA 4XYFA 2XMYA 4V05A 4WSQA 3RAKA 2VO0A 3HUCA 1XMLA 1XH4A 4EHEA 1Q3DA 2XK7A 4FIEA 1OKYA 5HU3A 4USDA 3LQ8A 3IW7A 5EQPA 3VS6A 2BKKA 4YJUA 2CGWA 2QG5A 2XM8A 3QZHA 3F3VA 2OJIA 4MTAA 5CAPA 4F63A 5DYJA 3AD4A 4ITHA 4GSBA 3TJDA 2PY3A 5JZNA 3DJ6A 4IB1A 4NW5A 4O0TA 3U54A 4BTKA 4XRJA 3ODYX 2Y9QA 2J0JA 2YFXA 4KINA 5TO8A 3A61A 5KKRC 2VWYA 4JAIA 3CP9A 3EQCA 4L3PA 5T68A 4BHNA 4ZTHA 2WZJA 2UZEA 3SD0A 2YIYA 4ANLA 4X6RA 3ZMMA 3MPTA 1LP4A 3LVPA 4HGEA 5GJDA 2HW6A 3MY0A 3TV6A 3R21A 4HNIA 2Z7QA 3BKBA 3V5WA 3GU7A 3W0RA 4PNIA 3G2FA 2HZNA 4G6OA 3RWQA 3HVCA 3UNZA 4CNHA 3DKOA 3P9JA 4EI4A 3MESA 4F64A 1YOMA 1YI4A 1DM2A 1SNUA 4MXZA 3R73A 4C61A 3D5UA 3O7LD 5CY3A 2JGZA 3FMMA 3D2IA 3PJ2A 1U59A 3QA0A 4KBAA 3ZC6A 4ASDA 4O7LA 4O4EA 2G01A 4KB8A 3VUGA 4CD0A 3BHVA 2PZPA 3BLRA 3RK7A 4N57A 4JRNA 4ANSA 4LV8A 4KBCA 3CTQA 3AC3A 1M52A 3MVJA 4FODA 4NFMA 3LW0A 3PWYA 5HBHA 3UP2A 1XMMA 2OIDA 2RGPA 2Z7LA 4MBJA 3SW4A 4FJVA 4DE4A 2WTKC 2XNEA 2HZIA 2X2MA 4GIIA 5LARA 2BZIB 5D9HA 4IW0A 4KA3A 2R9SA 3KKVA 4E93A 4MXCA 3PIYA 4A9SA 2GNJA 5A14A 5F4NA 4EJ7A 3UYTA 1PXIA 4IJPA 2PVLA 4C57A 2IPXA 3F69A 3NMUF 3CR0A 3EN6A 3I0OA 4O0UA 4OW8A 5DLSA 4YSMA 4QPSA 2RFSA 3JUHA 2G2HA 5HE1A 4OLIA 3W8QA 3GGFA 4U44A 3SHEA 2BFYA 4JLCA 3LQ3A 3R1NA 4L01A 4RJ3A 4KKGA 1S9IA 4GJ3A 1BYGA 4B9DA 1VZOA 4IFCA 2C68A 1FGIA 3CS9A 3HEGA 4I5PA 3QTIA 5L2TA 3B8RA 3T3VA 4MD7E 2XCKA 3HRFA 4F70A 3BL9A 4QMPA 3GCPA 4FIFA 5HBJA 5DH3A 5A4QA 4FL1A 3ZDUA 4L7FA 3EN9A 2R3RA 2XIYA 2YM8A 4P2KA 4FTCA 1MUOA 5ACKA 5L4QA 4Z55A 4OTRA 4X2NA 1NVRA 4QOXA 4CRSA 2OJ9A 1Q4LA 4DLJA 2XB7A 3VRZA 3OROA 1JQHA 4G3CA 1TKIA 3I60A 3LIJA 3NUUA 5LVMA 3PJCA 2QOBA 4QP2A 5DT3A 4AXDA 1B39A 3HV5A 3OD6X 4LGGA 5L6OA 3BWJA 4O4FA 3R7GA 3ZBXA 2XKEA 4M68A 2R4BA 2BROA 1IAJA 3UNKA 4DEGA 3PIZA 5I5ZA 4XX9A 3GENA 3RZBA 3FMNA 3K5UA 3KK8A 3VF9A 1YXXA 4LGDA 5AJQA 4H3PA 3UDSA 1H0VA 4B8LA 2Z7SA 3FI8A 2XS0A 4IAFA 5KZ0A 2YZAA 2ZJWA 3DZQA 3RAHA 4XH6A 3ZZEA 4HVDA 4MCVA 5E8WA 5LMAA 4RWIA 3AD5A 4IB3A 4CKIA 5BMMA 2WMWA 3FY0A 2XA4A 2SRCA 3WF9A 3MSSA 5D7VA 4B6LA