5CF6A

Crystal structure of janus kinase 2 in complex with n,n-dicyclopropyl-10-[(2s)-2,3-dihydroxypropyl]-3-methyl-7-(methylamino)-3,5,8,10-tetraazatricyclo [7.3.0.02,6]dodeca-1(9),2(6),4,7,11-pentaene-11-carboxamide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
290
structure length
285
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Based Design of Selective Janus Kinase 2 Imidazo[4,5-d]pyrrolo[2,3-b]pyridine Inhibitors.
pubmed doi rcsb
molecule keywords Tyrosine-protein kinase JAK2
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
total genus 94
structure length 285
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5cf6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5cf6A01
3D15A 4BDIA 3RCDA 4O82A 2GQGA 4TWOA 5HI2A 3GXLA 3OUNB 4PDPA 4MBLA 3P7BA 5L2QA 1YOLA 3M1SA 5FP5A 4TXCA 3U87A 2PE1A 3A60A 3DFAA 1RQQA 2X6DA 4MYGA 2BTRA 1MUOA 3CC6A 4C8BA 1BYGA 4PNIA 3BCEA 3NZ0A 4IACA 4TKSA 4OT6A 3CTQA 3WZJA 4EOSA 1O9UA 1X8BA 4LFIA 2XUUA 5D11A 5A14A 3ZEPA 2JIIA 3R71A 3LLTA 3OT3A 2BZKB 1CTPE 4UWCA 3KC3A 4Y73A 1H4LA 3F5GA 3LOKA 3Q2MA 3Q5IA 4DEAA 5CF8A 5C4LA 3K2LA 3LFAA 4UX9A 3ZM9A 4EOMA 3PXQA 4D1XA 4FZ7A 1WAKA 1UV5A 3VBVA 3WYYA 4F64A 3ZLSA 1BL7A 4IWQA 5CVHA 3ZMMA 4EHGA 3FMEA 2J0MB 2YM6A 4O0UA 4E26A 4BDKA 2ITNA 3FLZA 5LVPA 4DFLA 4NM5A 3D5UA 5CEOA 2P3GX 3QGWA 5BVEA 2UZBA 4PNKA 5EDRA 2W9FB 1UWJA 4FVPA 5DI1A 5LVLA 3VBXA 4E20A 3BHUA 5L2TA 4U43A 2OW3A 3MGYA 3VS3A 4QPAA 3ZO1A 3LCTA 1H1PA 3LPBA 1U4DA 3GGFA 3MVHA 5A3XA 2R64A 2C6TA 4FG8A 3WE4A 4F9AA 2NRYA 3QQFA 3TKIA 4FUYA 4BGGA 4F4PA 2WMVA 3BRBA 2WMBA 4XRJA 1S9IA 4C4HA 4OW8A 3COHA 1J7LA 4W8DA 3DS6A 1M52A 4IADA 3C4EA 3VO3A 3NUXA 1KE7A 3TNQB 2WU7A 3NAXA 4DG2E 4UWBA 2VTIA 4LOOA 4FEVA 4R7IA 1K2PA 3TKUA 4I5PA 4OBPA 3R7IA 3RINA 4A4LA 3SRVA 3HV6A 3QFVA 4WRGA 3O2MA 3KFAA 3FHRA 4GW8A 5ANKA 1ZOGA 2YERA 3QKKA 3UO6A 3VUIA 1FGIA 1JNKA 3RALA 2XRUA 3VS2A 2JIUA 4MD8E 2Z7LA 5E8YA 2OF4A 3VUDA 5BPYA 3PSDA 4ACMA 3PSCA 2Z2WA 1ZARA 4IMYA 3UE4A 3Q96A 2CNUA 4A4OA 4EQMA 4D28A 2ZB1A 4AQCA 2ZAZA 4RLKA 2C0TA 3MV5A 4P5ZA 1PRYA 1B38A 4ZTSA 4DYMA 5AR3A 5HORA 4KS7A 3AC5A 5H3QA 2B7AA 5KMNA 4I94A 3BI6A 5AAGA 5J8IA 1J7UA 1PYEA 2FSLX 3QTRA 4V05A 4FSNA 1Q61A 4IC7A 4I3ZA 2ZV8A 2UZTA 2XBJA 4O0YA 4QP9A 1YI3A 4A07A 3PIXA 1BX6A 1UU7A 3JVSA 3FSKA 4C0TA 4CCBA 3HRFA 1ATPE 3QL8A 3BE9A 2F4JA 2RFNA 3IDPA 3VHKA 2OIBA 2C6MA 1JKSA 3FXXA 3O50A 3MPAA 4H3BA 4M8TA 4J71A 5JZNA 1Y8GA 1GIIA 2I0VA 4H1MA 3R1QA 4FKJA 4HYIA 1PXOA 2BTSA 4CT2A 4IX4A 2JGZA 2YIQA 1ND4A 3KRJA 2PVRA 4DAWA 5FRIA 3MVMA 1NA7A 5CEQA 1DAWA 3TNHA 3EH9A 4KB8A 4BRXA 4MK0A 4PMSA 3PPKA 1ZY5A 1Q8WA 2GU8A 3EJ1A 4IZ7A 5DBXA 1U46A 3B8RA 4O7YA 4RZWA 4EYMA 1Z9XA 2VO7A 5E8SA 4EK3A 1PHKA 4XV1A 5HG7A 2CN5A 3SG8A 4DG0E 3BKBA 2QOKA 5CWZA 4YZ9A 4IX5A 3LJ2A 3TDWA 4XG4A 5J9LA 4YBJA 3CD8A 5F1ZA 3EYGA 5FBOA 4C4EA 3GU4A 5L6OA 4FTCA 1Q62A 3IW5A 3ZSHA 4N0SA 3LQ3A 2CLXA 1V0BA 4KRDA 4XLIA 4ZTQA 4HYHA 4MWHA 5HE3A 3ZHPC 3ID6C 2OFVA 1T46A 2REIA 2XH5A 4PMMA 4CYJA 3FI2A 3RAIA 5ANJA 4RC4A 1CDKA 4XP0A 4X2JA 5E1EA 1P4OA 4WD5A 4ZSEA 4JJRA 4ACHA 4MXZA 3EL7A 1REJA 1WBOA 3ZC5A 4ASXA 4C4IA 5AUUA 4R7BA 1KE5A 4PTGA 3HV4A 3E8EA 5FM2A 3R28A 3ULZA 5LWNA 3UP7A 3BGPA 2H34A 4QTBA 4EOLA 1UU8A 4DEEA 4FV8A 2XK8A 2X2KA 3R9DA 4EI4A 3I1AA 4TN6A 5DA3A 3LFBA 4CSVA 5TOZA 5DRBA 2R3NA 2OIDA 4CTBA 1OPJA 1OUKA 4PUZA 3MYGA 1KV2A 2G01A 5KBQA 3DPKA 3VRYA 1H0VA 4C33A 1URWA 4FSUA 4PL5A 2FSOX 3LZBA 4H58A 4CFNA 4MKCA 1CKJA 1UA2A 3UZRA 1E1VA 2ETKA 3S3IA 4F0GA 1W98A 5M4CA 3B2TA 2QHMA 4M84A 4J99A 1NVQA 4IIRA 4RIXA 1OUYA 1OKVA 4JBVA 5KE0A 3WARA 4EHEA 5LCKA 3CBLA 4PX6A 1L8TA 4ZZNA 4Y5QA 2PTKA 4FIEA 2C6IA 3FLNC 4F6SA 3PP0A 3K54A 2GNLA 3ORLA 5IEVA 5IEXA 2JAMA 3GU6A 2VU3A 4ZTRA 1NVRA 2OI4X 5IA3A 2QC6A 3VN9A 2PZ5A 4MCVA 4FL1A 4WIHA 3R73A 1JSVA 3HDMA 4ASEA 4FTIA 1H1SA 2YM5A 5E1SA 5HE0A 2FA2A 4G6LA 4NKSA 2QD9A 4L68A 4K33A 3HP2A 3OS3A 3LQ8A 2XCKA 1WBTA 2XIKA 3ORNA 4IDVA 4K9YA 3FQSA 4BR3A 3FLYA 5LVNA 4CKJA 3NUPA 2XNNA 5IA1A 3DKOA 1XH6A 3SV0A 4P90A 1XR1A 2XBAA 3II5A 3Q3BA 4LRKA 4IWPA 5M06A 3MIAA 3ZO2A 2BCJA 5HO7A 4R1YA 1QCFA 4PMTA 1IG1A 4BI2A 3CXWA 4EQUA 3P1AA 3GBZA 3V01A 3V5TA 2HELA 2XKDA 5JN2A 3FEGA 4QMUA 4ZTMA 2C3JA 2XIYA 1J1BA 2CHLA 3P7CA 3R02A 2IVUA 4KAOA 5ETFA 1IASA 2UZEA 5C8MA 3D94A 1MQ4A 4CRLA 3ZLWA 4IB3A 4O0TA 4DGMA 1JSTA 3GCSA 4BCMA 3HZTA 5I3RA 2UZLA 4HOKA 3BEAA 4QQ5A 4WNOA 5HO6A 2VTNA 3TNPC 1H27A 3F3TA 2X0GA 3EQPA 4PQNA 5M51A 4JI9A 2OLCA 3E62A 4C59A 2Q0BA 3ZSGA 2C3KA 2WQMA 3LVPA 3AC8A 3DJ7A 4OT5A 3QYWA 2YIWA 5AX3A 2PZIA 3LFNA 4BICA 4E6AA 4JVGA 4EH3A 1KUTA 4W4YA 1LEWA 3PDTA 2XYNA 5IDNA 4RFMA 3ZLXA 4DH7A 3H3CA 4O7VA 4O84A 2Q0NA 1M7QA 4AAAA 2PUUA 3UYTA 3EQGA 3QTWA 4HVSA 4XV2A 3I6UA 4WBBB 4GSBA 3CR0A 4NTTA 4HCTA 3ZCLA 1WVWA 3O7LD 4GV1A 4EC9A 4MXOA 3LMGA 5IH6A 2UVYA 4YJOA 3GT8A 3O8PA 4GKIA 2CNQA 2R3FA 2AC3A 2H96A 3QCXA 2ZMDA 4R3CA 4F63A 2VV9A 4PDYA 4ZSGA 1GIHA 2QURA 3IDCA 3LXKA 3VUKA 4EWHA 4PP7A 3PWDA 5CAQA 3NUAA 5M4IA 5EYCA 3DBDA 2P55A 3LFCA 3ACJA 3KMMA 5CAUA 2O64A 1YWNA 2YDJA 4GUEA 4O7SA 1YXSA 4AS0A 4Q2AA 3P08A 5BUJA 3UPZA 1KE8A 3QD3A 4FTMA 4W4XA 3VS1A 4Z7GA 3UNKA 3BYVA 2R7BA 4IM3A 3CLYA 4QYEA 3A7GA 5AIRA 3E8DA 5DR6A 5DNRA 2P2IA 3DV3A 4YNEA 3LW0A 3LJ0A 2IW8A 1YOMA 5KMMA 4J52A 5EYDA 3TCPA 3S1HA 1GY3A 2C5YA 4O7TA 3O7LB 4HPTE 4ALVA 2DWBA 5AV2A 2YM3A 4G9RA 4KS8A 4KABA 4WNPA 4TTHB 4X6QC 2W5AA 3RAWA 2V62A 4K8AA 4WOVA 4ENYA 5J1WA 4DHFA 3ZH8A 5LMAA 5HQ0A 3R7OA 2V0DA 2ZOQA 1Y6AA 3SKCA 3C51A 2X7OA 4ZJIA 2A19B 3H9RA 4G6OA 3LIJA 3D5WA 4ZSAA 3LCSA 2R3OA 4YZDA 3UTOA 2W1EA 4IXPA 4QPSA 2C1AA 3RNYA 2ETMA 5HLNA 1FGKA 2YDIA 4AE6A 1M2RA 4U41A 3ZO4A 3W2OA 2W1FA 4O0VA 5AP7A 5AUVA 2JLDA 2EU9A 3CY3A 3JVRA 3OP5A 4WUAA 1J1CA 2XS0A 3B8QA 3ORPA 5I9XA 4FZFB 4Z7HA 2VWXA 4LGDA 4DLIA 4EYJA 2X9FA 2XIXA 3UO5A 2R3JA 2XRWA 3DTCA 1P4FA 3GUBA 1VZOA 3PVWA 3QAME 5I4NA 4LV8A 3TUCA 2H8HA 1J3HA 3FQHA 4QMXA 4NEUA 4U3YA 3ERKA 4F9WA 4XEYA 4X3FB 2VGOA 4BIBA 4B9DA 1UWHA 3REPA 3FMMA 5AP6A 1JBPE 2UW4A 4CKRA 2BZIB 2IWIA 1M7NA 1G5SA 5DT4A 1MRUA 2QOLA 3DBCA 2J9MA 4F08A 4LUEA 4QYFA 2BALA 3F5PA 4IJ9A 4WKQA 4L01A 4MXXA 2R3PA 3UQFA 3FXWA 3LM5A 1YDTE 2IJMA 3OT8A 3Q52A 2PVLA 4H3PA 3L9NA 3MFRA 2OH4A 3FKLA 3FLSA 3T3UA 4KINA 3RPVA 4BKZA 2YJRA 1SZMA 1WCCA 5EHYA 4I4FA 3CE3A 4CFXA 2OH0E 1LPUA 4IAIA 4IFCA 2B54A 3C1XA 3FLQA 4MNEA 3ROCA 2HY81 4GK3A 3VBQA 4AZSA 2EUFB 5HD4A 3EB0A 2ZVAA 4JBPA 5HD7A 3D0EA 4G3EA 3Q4TA 5AUYA 3T3VA 3JS2A 4B4LA 2CKEA 3EQCA 2WTDA 1B39A 2IZSA 3BIZA 3D83A 4EUTA 4YTHA 1WVYA 2JAVA 4GVAA 5DRDA 4DBXA 4KKHA 3OCBA 4TYHB 4FIHA 5F95A 3EN6A 5G6VA 4ZJVA 5JKGA 3KU2A 4E1ZA 4DTAA 1YWRA 2WMAA 2W4OA 1JOWB 4MAOA 3G5DA 4GEOA 1ERKA 3E3PA 4MVFA 4XS2A 2QQ7A 1XJDA 3MFTA 5TE0A 3MFUA 3DAJA 4HVDA 5A4EA 3V5QA 4NJDA 3BELA 4BDDA 3UZTA 2PUNA 1R78A 3E8NA 1ZYCA 5IDPA 2J7TA 4E5WA 4EK6A 4CG8A 5CU2A 3OHTA 5HG9A 3ENMA 2WHBA 3QRKA 3S0OA 5EM8A 4EQCA 3LXNA 4NL0A 2OJIA 3FMNA 3SXSA 2WMUA 2HYYA 4C36A 4L3LA 2RFEA 2ETRA 3NW5A 3PSBA 3QZFA 4BCPA 5A54A 4GYIA 3PRFA 1Q97A 4AN3A 3FYJX 2B9JA 5CSVA 5JT2A 2VWVA 3TWJA 4NZWB 1PXIA 5LARA 3QALE 5M07A 2ZV2A 3C5IA 5EDQA 4QPMA 3ALNA 4DEDA 2W1DA 3QLFA 4D1SA 4V0GA 5M57A 1OBGA 1H1QA 3AG9A 4CGAA 4Z9LA 4ZSLA 2WTCA 2HWOA 2EWAA 3GFEA 4ACDA 4CLJA 4XG6A 3GNIB 4FTOA 5HVYA 3NS9A 5BX0A 5IQHA 2X8IA 4AN2A 2HZ4A 3GFWA 4AU8A 2CGWA 4RJ5A 3R8ZA 3UPXA 4E93A 2QOQA 3FZ1A 3FUPA 4YHTA 4AXAA 2KTYA 4TZRA 3VUMA 4YLJA 4OTIA 3KXXA 1OL1A 4YZBA 4JL9A 2F57A 2O5KA 5K9IA 4W4VA 4O0RA 4TYGA 4BWXA 3DXPA 1W0XC 4PY1A 4IM0A 4FIIA 3TJCA 4EHVA 1W7HA 2UW6A 3GCPA 4K18A 2BFXA 4D2SA 5GIPE 4A9SA 1E9HA 3DBQA 5ANOA 3U9NA 1R0PA 2IZTA 1OL5A 5AUTA 5BMSA 3ET7A 3BYMA 5E92A 4FTTA 3U6JA 3PVGA 5LMKA 4CMTA 3P4KA 4EOOA 1Y8YA 3C7QA 5KHWA 4EH2A 5L6WL 3VRZA 3PE1A 2YAAA 4HYSA 2PVHA 3UOHA 3QRTA 2NO3A 3F3VA 2B4SB 3UIXA 3QTSA 4CT1A 1S9JA 1V0PA 2OGVA 1YDRE 2R3LA 2VUWA 3EOCA 3IS5A 4YJTA 5T3QA 3UC4A 4B8LA 5CU3A 3NRMA 4C37A 5IA5A 1M14A 3DQXA 4BHNA 1KSWA 2UW7A 4IDTA 1G3NA 4YJNA 4FSMA 3QYZA 2OZAA 4N6YA 1I44A 4YZMA 2FUMA 4FKSA 3RPYA 2ZMCA 4L3PA 4XRLA 3THBA 4M3QA 5HEZA 3SDJA 2PMNX 2QO7A 3DU8A 3JY0A 4KSPA 3RGFA 1AQ1A 5HBEA 5GZ9A 1CKIA 2WTKB 5IUGA 1WZYA 3DB6A 4QO9A 5DIAA 4DGNA 5ANDA 5LVMA 2HAKA 4CMOA 5EOBA 3DDQA 4FIFA 4EUUA 4FSWA 3KVWA 4QMOA 3QF9A 3FZSA 3VW8A 4LRMA 4M13A 2J0KA 3EN7A 2WO6A 3RK7A 3MH0A 4JQ8A 4IAZA 2ZDUA 4IANA 2BUJA 4W9WA 3DK3A 3VVHA 3FKNA 4F0FA 1RJBA 2XK3A 3CCNA 3DAEA 4FV0A 5AMNA 4I24A 4DN5A 5CAVA 1YDSE 4G31A 4ENXA 3ZYAA 2F7XE 2CKOA 4OBQA 3H9FA 4OTPA 4AFJA 3OROA 4CFFA 4NCTA 3FMDA 3QQUA 4AA4A 3KCFA 2F49A 4BHZA 4U8ZA 4FKIA 1XQZA 3EQHA 4A9TA 2GSFA 1NXKA 2Y6OA 3ZZWA 4ANQA 1SNUA 4EL9A 1Q8YA 2HXQA 4D4RA 4F7NA 5H8GA 4S32A 3FKOA 3R63A 2XNBA 3TV4A 4BBEA 4XG7A 4RJ7A 2XB7A 5EI6A 5DLSA 4DEGA 2VX3A 4U6RA 5HO8A 3ODYX 2PZYA 5JQ8A 3TG1A 4ERKA 4F9CA 4BF2A 3U9CA 2X7GA 3PZHA 4JDHA 2B9HA 1ZRZA 5HKMA 4DFNA 3HYHA 3BU5A 3NCGA 2XIRA 3ATTA 3LFEA 3SOCA 2QOIA 1H08A 2BROA 3IDBA 2VTRA 5IISA 3EQRA 2JDVA 2R9SA 4HGEA 3KB7A 2Y7JA 4G9CA 1XH4A 4BCKA 2VRXA 5EW3A 3RKBA 3HV5A 1UKIA 2X6EA 3ZBXA 5E8TA 2X1NA 3ZDIA 5A4LA 2YZLA 3W55A 5BYYA 4B0GA 1BUHA 4HCUA 3F6XA 2W7XA 4IWDA 3LKMA 3I79A 4O7LA 3SOAA 3FBVA 2IZRA 4QD6A 4B6LA 4TT7A 5HNBA 4JR3A 4FKTA 4LOQA 2J2IB 4C3FA 4RIWA 4ZIMA 4GMYA 2O65A 4IAFA 1ZXEA 4KKEA 3BLHA 4RT7A 2GNJA 3G6GA 3A7JA 2C69A 2DUVA 3WF8A 4PTCA 4EKLA 4IZAA 4FT7A 2A4LA 3W8QA 3TUDA 2YM4A 3OBJA 4OAVB 4XG2A 3QA8A 4LV5A 4YJPA 3MESA 3BYSA 3ATSA 4JDIA 4D4VA 4FT9A 4XOYA 3EKNA 3TIZA 4JQ7A 4O6LA 4CRSA 3GQIA 4AZEA 4LUDA 3G0FA 4GIIA 1G8AA 3IG7A 4WSYA 1ZYJA 3OCGA 4RQKA 5M4FA 3PPZA 2YIRA 1OZ1A 4O1OA 3R6XA 5CQUA 5CSPA 4DT8A 5JK3A 5DGZA 4FC0A 2ZV7A 3QRUA 3VUTA 3QTQA 4E4XA 3OOGA 3RPOA 3ZDUA 1IA8A 2XYUA 3D14A 3KQ7A 4M15A 4ZMFA 4FSZA 4USDA 4GJ2A 3QLGA 3RK9A 3JXWA 4JG8A 4IAKA 1ZOHA 4FNZA 1RDQE 3S95A 2WNTA 3Q53A 4FIJA 4NWMA 4I21A 3SHEA 3SVVA 4HNIA 2UZDA 1WBWA 5IMEA 3F5UA 3E8CA 2YCFA 3H10A 3PG3A 4H3QA 3BQCA 2GPHA 4L00A 3U51A 4DH8A 2OKRA 4RIOA 3QCSA 4IHPA 4DC2A 4DEIA 4UMUA 4K1BA 5IA2A 1DS5A 5AWMA 5I0BA 5KO1A 3GI3A 3R83A 2H9VA 3L1SA 4FF8A 4WA9A 2JBPA 4D2TA 3NNWA 3ROYA 4BFMA 4ZY5A 2YCQA 3PPJA 4NFMA 5M53A 5EM7A 4C58A 4GVJA 5L8LA 3A7IA 4IZ5A 5IF1A 2VTSA 3UIBA 4JRVA 3W2SA 4HZRA 3ODZX 3VC4A 4E6DA 4RLLA 3EFJA 2VTJA 2W0JA 4PPAA 4II5A 1A06A 4TNDA 1O6KA 2I6LA 4FOCA 3AGLA 3TZ7A 3WF7A 4AX8A 4I0TA 4YSMA 4O38A 4R5YA 3UJGA 2YABA 2J0LA 3OZ6A 5DWRA 2B52A 3BLQA 3ZS5A 1OVEA 5C8NA 4WNKA 2LAVA 3DZQA 2C5NA 4FOBA 3TNIA 2XNGA 4F70A 3R22A 4QTAA 2GNGA 3W2CA 2W5HA 4RVKA 4HW7A 2QR8A 3KRXA 3OTUA 4BWKA 2FVDA 2X4ZA 1Q8UA 2WQOA 1DAYA 2GNIA 3QTIA 3KULB 1UU3A 3MS9A 2B1PA 4BC6A 3WOWA 4FSTA 3VUHA 2UZOA 3SXFA 2CPKE 3MTFA 3FXZA 3FY0A 4R3RA 4LOPA 2BMCA 2WMWA 2P0CA 2XK7A 2YA9A 4FTNA 4BCNA 4BDBA 4BCQA 4HCVA 2XMYA 3N4TA 4ACGA 1QL6A 2BHEA 3BGQA 3L8XA 5IEYA 2C47A 3PIYA 3W16A 4ALWA 4U45A 5AADA 5LOHA 2V7OA 2BPMA 3L9LA 5CSWA 5LMBA 2O0UA 2R3HA 1SM2A 4RX7A 5D41A 5HGIA 3E64A 4BN1A 4L53A 4IB1A 5ACBC 3VJNA 4AZWA 4IJPA 2EB2A 4BCFA 5H8EA 2FO0A 5CALA 4BDGA 5GZ8A 3BLRA 3QD4A 4KIOA 2RFSA 2V5QA 5KMLA 3LFFA 3AC2A 2YHVA 4TYIA 2GHMA 4CD0A 3D7TB 2JD5A 4QTEA 3F7WA 4JXFA 4JRNA 2ERKA 3CTJA 4KKGA 5H8BA 3ANQA 4F6WA 4LYNA 4QMYA 4PPBA 4I93A 2JIVA 2QNJA 5E8VA 3HV7A 3OOMA 2WELA 3MVLA 1YXVA 3TL8A 5F9EA 2VZ6A 5KMJA 4O83A 5AP3A 5JRSA 4R5SA 1DM2A 1GOLA 2BRHA 5FLFA 2CGVA 2QI8A 1Q4LA 3AD5A 5C9CA 4DH3A 1BI8A 3LE6A 5CNNA 3KVXA 5D7AA 4G3GA 3IKAA 3FI3A 3FPMA 4HGTA 4J97A 2R3KA 5KMIA 5BUIA 3QKMA 4YZNA 3OG7A 4S2ZA 5TF9A 4C7TA 3C9WA 3UVPA 2JKMA 1IA9A 5EYMA 3KN6A 3S00A 5DT0A 2VO3A 4D2VA 2J6MA 5CU0A 4LG4A 4RIYB 3FL5A 4FIGA 1XBBA 4HYUA 4JX3A 4RRVA 3G51A 4FGRA 1Q5KA 5AP1A 5EKNA 3KMWA 2VD5A 3CGOA 3F9NA 4ANLA 5HOAA 3SXRA 3NW7A 2DS1A 3O8UA 3MY5A 4G34A 4XV9A 2BRNA 4W9XA 4ZEGA 5BNJA 5I5ZA 5KMOA 2NNWB 5HU3A 5I9VA 3OWJA 4FX3A 2PE0A 1OKWA 2C5VA 3KXGA 5EM5A 1CSNA 5E8UA 3D2KA 2CDZA 4U0IA 3R7VA 2FH9A 3IGGA 4R3PA 1PXKA 5JGDA 3VS5A 4RMZA 5C8KA 4B8MA 2PVNA 3KXNA 3RWPA 2YITA 2WIPA 4AZTA 1BMKA 3OCTA 2C6KA 4Q5EA 4GG7A 4X6RA 5EM6A 3P79A 1Q3WA 1OI9A 5EH0A 3ZONA 3EN5A 3AD6A 3NNUA 2XIZA 3QRJA 4X2NA 3GC7A 1JSUA 3MPTA 4GK4A 3FC2A 2C68A 2F2CB 4Y83A 2ITOA 1ZZLA 4U81A 5KUPA 4JIAA 3D2IA 3OD6X 3BHHA 3BWFA 3GU7A 1Q99A 3UG2A 3FSFA 2XVDA 5EOLA 3I6WA 4R6VA 4Q5HA 5A9UA 5ITAA 3NAYA 1BI7A 2YDKA 1CMKE 4UYNA 2XKEA 5J5SA 4XCUA 4ONAA 4AW2A 4MF0A 3UOKA 3PA5A 5JMSA 4RQVA 4GJ3A 4ZTNA 1FPUA 3VS4A 3MA3A 4CZTA 4D58A 2YWVA 1YWVA 1U59A 2W05A 2Q83A 4QP3A 4YHFA 3G0EA 4ZJJA 2C6LA 3F2RA 4QYYA 3MY1A 3IQ7A 3OEFX 4F9BA 3G9LX 3FMHA 5CS6A 5AUXA 3I7CA 5H2UA 4EBVA 4XH6A 2O2UA 4M12A 4AE9A 4BDFA 2ITUA 2BHHA 4EH8A 4QMQA 4QMTA 5LXMA 3MH2A 2WMRA 5KBRA 3VF8A 4F09A 1UNLA 5BVWA 3Q04A 4EONA 1H8FA 1IAHA 3DZOA 2J0JA 3P86A 4BZNA 4G5JA 4FV5A 2WKMA 1KE9A 3CJFA 2UZNA 2YN8A 3PY3A 1JAMA 4UXQA 2OBJA 4A06A 5J95A 4ANNA 3HLLA 5L2SA 5JEBA 2XF0A 5DR9A 3VQHA 4NUSA 1UNGA 3JR1A 2WEIA 3LCDA 3QCYA 2GQRA 5FTOA 4RA5A 1OBDA 4NYEA 3K3JA 4BGHA 3BYOA 3U4WA 4YSJA 4ZLOA 4USEA 5GNKA 3KXZA 5ANEA 4C4FA 1OB3A 1OIYA 1TVOA 1PJKA 2X7FA 4KIKB 2PZRA 3PXYA 5LQFA 4BDJA 2UVZA 3CKWA 5CF5A 3FJQE 3QQHA 4EK5A 1APME 2YISA 4NW6A 5T6KA 3R8VA 3KY2A 4FTKA 1TKIA 5EDPA 4DFXE 5CEMA 1TQMA 1OITA 3VHEA 5K4IA 3PRIA 2XEYA 5A4CA 2F9GA 2VWZA 2C6DA 3HMNA 4WG3A 4I6QA 1A48A 3HV3A 1ZMWA 5B2KA 4PTEA 3RI1A 3I7BA 4OTDA 3TN8A 5IU2A 2CJMA 5HESA 4FI1A 2X8DA 1H07A 3F7ZA 3IECA 4RGJA 3NIEA 2I7QA 2C3IB 4X2KA 1JWHA 4QP7A 4RC3A 2QOCA 4GIHA 4L7FA 4R8QA 2Z02A 5HVJA 4ACCA 5BUEA 3Q4ZA 2QOFA 3HMIA 4NKAA 2EXMA 3OVVA 3VUGA 3C0HA 3BEGA 1NT2A 4AOIA 3UGCA 4AN9A 1ZMVA 3NEWA 2J5EA 3PA3A 2YLFA 2JKOA 1U5QA 3HGKA 3MI9A 3P9JA 5GZAA 2ITYA 4WUNA 3QTXA 4G5PA 4EH7A 5EKOA 3L8PA 5HU9A 3F3ZA 4K2RA 1H28A 2W06A 3FAAA 1K3AA 5FDPA 1NY3A 3EIDA 3QHWA 4BDHA 2Y6MA 2FYSA 4E5BA 3RMFA 4N70A 4E5AX 4FMQA 3E7OA 1PKGA 2I0HA 3QTUA 4HGSA 2IPXA 5IQGA 4L44A 5IQIA 5KX8A 3ACKA 3AC1A 3AQVA 5E7RA 2PPQA 4M0YA 4JG7A 1YVJA 3DAKA 5J87A 5HCXA 4QYGA 3S2PA 2YACA 4ITHA 2W99B 5JFWA 5IH4A 4TW9A 2Y4IB 2F7EE 3SC1A 5AR5A 4I6FA 4HVHA 1H26A 2BFYA 3CPBA 3E3BX 3PFQA 4GG5A 3W33A 3MH1A 2HXLA 3PVUA 4D1ZA 1PXLA 3CPCA 4L9IA 4AGUA 2ZB0A 2VN9A 3OWKA 4D9UA 4UXLA 4NM0A 5CAOA 3PXKA 4BCOA 4L7SA 3ZU7A 4WO5A 3F69A 2IW9A 1XWSA 4FZ6A 5T68A 4AT4A 2C6EA 4AOTA 3JY9A 3MVJA 1F3MC 4PP9A 4S34A 3RTPA 4IVCA 5AR7A 3V8SA 3ZLYA 3W1FA 1P5EA 1U54B 2FGIA 1RW8A 3QC4A 1FVRA 4RJ3A 2CMWA 3OC1A 5A6OA 2VNWA 2BRGA 4UEUA 4ZK5A 2Z7SA 5AR8A 1KOAA 3EKKA 5I9YA 5LMKC 5CI7A 2HWPA 5F94A 4EH5A 5ANIA 3MDYA 4C57A 2VO0A 4FL2A 4YLLA 3ORTA 3P5KA 4APCA 2PL0A 3UC3A 2WXVA 2O63A 4YPDA 2BAQA 3Q60A 3QA0A 5C1QB 2B9FA 2EB3A 3R1SA 5HICA 5KMKA 3BHYA 4RZVA 4RWLA 4A9RA 3UOJA 4A4XA 2XEZA 3UODA 4X2FA 4QP1A 4D2PA 5KKRC 4FV9A 5CSHA 3BGZA 3GOPA 3UDBA 3K5VA 4QMMA 3RHXA 3ZRKA 4XJ0A 2IVSA 2QVSE 4YGAA 4KWPA 1PXNA 2ZYBA 3BBTB 1YQJA 4L8MA 4WBOA 4DFUA 3Q9YA 1JLUE 3KK9A 3IOKA 3MH3A 4DFZE 3COKA 4TYJA 5IZFA 2WIHA 1O6LA 4MQ1A 1AGWA 1H24A 5F4NA 5B0XA 4S30A 4XBUA 3NGAA 4WG5A 2XKFA 3NMUF 4RVLA 4JLCA 4EKKA 4O22A 3NYOA 4HNFA 2VX0A 5HIEA 2P2HA 3R7EA 2VNYA 5FM3A 4O1PA 3PLSA 4RWIA 4ASDA 3U55A 3RNIA 3A7HA 2BAJA 2Y9QA 4BGQA 5B7VA 3MSSA 4P2KA 4NCTC 4AA0A 3N4VA 4K77A 1ZYLA 4F7LA 3KGAA 1H25A 4K11A 4UV0A 5DVRA 2NRUA 3OMVA 5CAPA 4JX7A 2NPQA 1PMUA 5AA8A 1VYZA 4CKIA 4FKRA 4Y46A 1R1WA 4G16A 3U4UA 2HK5A 4UN0C 1W82A 1BL6A 3WZEA 3DKCA 3VS6A 3AT4A 4G17A 4LMUA 3RPSA 5L2IA 4QMWA 3R9NA 4FT3A 3W32A 4RX5A 2CLQA 2X8EA 4OUCA 3G6HA 4W4WA 4KNBA 2CN8A 4G3FA 2IG7A 3EFKA 3UIUA 5HNIX 3R01A 1M2QA 1QPDA 5AP5A 3UZPA 5EQYA 3LFQA 2XK9A 3HMMA 4GRBA 4I20A 5K0KA 5JRQA 4HPUE 2J0IA 5DMZA 3EZRA 3CQEA 2QO2A 5IH5A 5K4JA 4CQGA 4FE2A 2JKQA 3NUYA 2H6DA 2OICA 3BV3A 3IW8A 4QMZA 4IVDA 1XBAA 4DGLC 3DJ5A 2PVFA 2NP8A 3ORXA 4L3JA 4JDKA 4R1VA 3VJOA 2PVKA 4ITIA 4AA5A 4AFEA 1FVVA 4X2GA 4BTFA 4BI1A 1BKXA 3I0QA 4HGLA 3KF7A 2WEVA 5FGKA 3WYXA 3L9MA 2W1CA 4FV7A 4IFGA 3GB2A 4KBCA 4X3FA 2FSTX 4RWJA 4C34A 2OJFE 5EHLA 1VR2A 2WD1A 3V5PA 4C4GA 1OIQA 3C4FA 1WMKA 2W1ZA 5I9WA 4NU1A 1YI6A 5JGAA 3E88A 4V0GB 5AR4A 4XOZA 4DINA 1G8SA 4KRCA 2WTVA 4TL0A 4Y72A 4XG8A 4TYEA 3KN5A 2G1TA 3OCSA 2CGXA 5AV1A 3TKHA 1VYWA 3O51A 4FKVA 2VTAA 5IQDA 4ZZMA 1R0EA 4C4JA 1F5QA 4O21A 1WBPA 2GHGA 1UNHA 1W84A 3HRCA 5C4KA 4FT5A 2BR1A 3OW3A 1XHAA 4BZDA 4M69B 2GDOA 1IRKA 2XKCA 4Y95A 2R0UA 2QU6A 4RC2A 2W1HA 3I81A 4X21A 3WE8A 4G1WA 4DGGA 5IPJA 5IQBA 5GINE 4YMJA 4IZYA 3OEZA 4G6NA 1SNXA 3HAMA 2X2MA 3QHRA 1ZYDA 2R3RA 2YM8A 4HZSA 4GH2A 4QQJA 4YO4A 4E4LA 4G3CA 4GS6A 3UOLA 3C0IA 4FTJA 4DTBA 2X2LA 1ZMUA 4TYHA 4ZOGA 4AF3A 2HZ0A 3T8OA 2CNVA 4RJ4A 5HE1A 3AC4A 4ANSA 5IQEA 4FZDB 3ELJA 2UVXA 1XO2B 3R8MA 1JKTA 3E5AA 4FZAB 4E73A 2PMOX 5CYIA 5EFQA 4ZTHA 5AEPA 4GYGA 2OJJA 4WSQA 4AWIA 4PL3A 2RIOA 3RAHA 2OXXA 5CASA 3A8XA 2OZAB 3COIA 3PTGA 4AOJA 1FVTA 3OWPA 4N4SA 3L9PA 2G2HA 4MBIA 1PMNA 4B7TA 4NM3A 4UBAA 1IAJA 1PW2A 4PV0A 5CI6A 4D5KA 4BTKA 5DEYA 4IWOA 2YWPA 4F9YA 3QGYA 4HVGA 4IVAA 2WZJA 5TO8A 1WFCA 3K3IA 2JEDA 3RK5A 4WNMA 4A9YA 3EQIA 2R3IA 3A99A 3QQGA 4IH8A 5DH3A 4CVAA 2BKZA 3KK8A 1FOTA 3NYXA 5ETCA 1L3RE 5IA0A 4FEWA 4PWNA 3KMUA 4M0ZA 3NUNA 3R0TA 2ITXA 3R8UA 3D5XA 4YTFA 4DF3A 3F82A 2WQBA 4BDEA 4EZ5A 1OECA 3IW6A 3A8WA 2C0OA 3F5XA 3C5UA 3NYNA 3OW4A 4F6UA 4O7WA 3OXIA 5DFPA 3Q9WA 3CP9A 4QP4A 2IVTA 2QG5A 1LP4A 3R04A 3UNZA 3QZHA 1OIRA 2VX1A 3OF0A 4ZTLA 1YXUA 4JBOA 4YP8A 3SW4A 4DH1A 5FBNC 2VTLA 3EFWA 4Y5HA 4EH9A 2JKKA 1H0WA 3DKFA 2XNEA 4D0WA 4DCEA 4BCHA 4U79A 4C3PA 5IA4A 3SW7A 2YM7A 2WGJA 3C4XA 2C5OA 4BL1A 1FINA 1XBCA 2V55A 3EWHA 3VBWA 4Z3VA 1V0OA 5EHOA 5HTCA 4PL4A 2P4IA 4AP7A 4LI5A 2WMXA 4FNWA 3EFLA 4AW0A 1JKLA 3ENHA 2BDJA 3SX9A 4UZDA 5CANA 4JG6A 3POOA 2QOBA 3UYSA 4UMPA 3DXQA 3CEKA 2O3PA 3ANRA 3RP9A 2VO6A 5IQAA 3RVGA 2W17A 3K5UA 3BQRA 5HBHA 4ERWA 4YURA 4S33A 5LWMA 4LQMA 3HVCA 3AC3A 3LQ5A 2YZAA 3PLAE 3Q32A 3QQJA 5CZHA 4RIWB 2CKPA 4JNWA 4I0RA 3TNWA 4I41A 3VS0A 4E8AA 5EQPA 2A0CX 2WB8A 4XP2A 1T45A 4C62A 2YLEA 2XK4A 3KRWA 5F20A 3GOKA 2OU7A 2J51A 4PPCA 4ZLYA 2QO9A 4GFGA 2J4ZA 3ZBFA 3PG1A 4QNYA 5D9HA 3GP0A 3IPHA 3V8TA 2VWBA 3TIYA 3HA6A 1YXXA 4FEUA 2JDTA 3HUBA 3LLAA 1FMOE 3OY3A 4QP2A 4FYNA 3ZO3A 4MEDA 1XH9A 4HVIA 2GQSA 5AAFA 2VWIA 3FHIA 3TZMA 4BZOA 3DDPA 3MIYA 4GT3A 3FZRA 4BIDA 4GKHA 2UZVA 3FI4A 2HZNA 5CXHA 4CLIA 5KHXA 4C35A 3Q9XA 4MHAA 4PRJA 4S31A 3CQWA 4QNAA 1QPCA 3AGMA 4IX6A 3HL7A 5DN3A 4EC8A 3PYYA 2OXDA 4K6ZA 4TWPA 2VWYA 2OF2A 1HCLA 2ITZA 5HCZA 4DITA 4EH4A 5DEWA 5DHJA 3GC8A 4AT5A 5BVFA 3H0YA 4IE9A 4E4NA 1HCKA 2RG5A 5FTQA 5ACKA 4I6HA 2ONLA 1WVXA 1QPEA 3DK7A 3R2BA 3A62A 4IBMA 4NIFA 1KE6A 4NW5A 3VULA 3ZUVA 4UMRA 5KZ0A 5I3OA 1K9AA 4RJ8A 3QD2B 4JBQA 4FVQA 3P7AA 3RCJA 4DGOA 4BY9E 3QXPA 3FMLA 3TUBA 3LM0A 1TQPA 2QKWB 2CSNA 4FTUA 4GL9A 2E2BA 4LM5A 4DTKA 2WMQA 2O8YA 3QX2A 4O2ZA 3RWQA 4Q9ZA 5CEKA 5E9EA 3R8LA 4NFNA 3MA6A 1PY5A 3FV8A 2PVYA 3GQLA 3KRRA 4GT4A 3VQUA 2VTOA 3FE3A 5L2WA 4L45A 5H9BA 1XH5A 2BAKA 2IW6A 4YPSA 3PVBA 1DI8A 4EOQA 2A1AB 1H00A 2PULA 5AFVA 1HOWA 1QPJA 2XNOA 3V04A 4FTAA 5J9ZA 3I0OA 3QX4A 1XH8A 3E92A 3PXRA 5JFXA 5AR2A 3DXNA 4R77A 4APPA 4JAIA 4O7RA 2C4GA 3TT0A 4CMUA 5AV4A 3MTLA 5JZJA 5D10A 2OG8A 3IK3A 4ZS4A 5CEPA 4DLJA 4JS8A 3VBTA 4Q9SA 4DG3E 3A2CA 3SRVB 1CM8A 4FV3A 4XMOA 3TZ9A 4FGBA 4BYJA 5CTPA 3I5ZA 5LCJA 4FV6A 5GJGA 5CEIA 2GTMA 3TEIA 3CIKA 1PF8A 3UVRA 5L4QA 4CFVA 3ZUTA 1J7IA 3VIDA 3BZ3A 3LFSA 4EK4A 5AA9A 4YC3A 4O0XA 4XHKB 4I22A 4GUBA 1VJYA 2Z7QA 3DNEA 3TXOA 3R1YA 4FSRA 5HTBA 4CQEA 4KUJA 3O23A 1DI9A 3RM7A 5GJFA 1Q8ZA 5JGBA 2R2PA 4M67A 4H05A 3KKVA 1R39A 2WTJA 2Y4PA 5A4TA 3LFDA 4CV8A 3FZTA 5HVKA 2W96B 4WT6A 4UALA 3JPVA 3ORZA 2WAJA 3DBFA 3KCKA 3L8VA 3QQKA 5M4UA 5DPVA 4CNHA 1MRVA 2AC5A 1SVGA 2PK9A 4LL0A 2IZUA 4FTQA 4D2WA 5C01A 3MJ2A 1GNGA 3T9IA 2G15A 4I92A 1H01A 1YHSA 5HHWA 3FLWA 1UU9A 3F3UA 3NIZA 4YZCA 3R8PA 4OAUC 4YBKA 4AT3A 5J1VA 2ITWA 2WTIA 4P4CA 3OUKA 4IB0A 4UY9A 5CNOA 3DA6A 5EW8A 1WBVA 2PVMA 5KCVA 3QZIA 2VAGA 3DFCB 4KIPA 4RSSA 2GCDA 3ORKA 4UB7A 1CKPA 5CENA 4BWPA 4I5CA 3LCKA 4J95A 2EXEA 4L46A 3NWWA 4NM7A 4TWCA 4U40A 5CU4A 3L8SA 5J7BA 4OTFA 5J9YA 3WILA 2HY0A 3R2YA 3ULIA 5IG1A 2QODA 3HDNA 2W5BA 3GC0A 4D5HA 2BRBA 5D1JA 4YJVA 4M14A 3Q4UA 3TACA 5HG5A 4JDJA 4D2RA 5DR2A 2QCSA 4FL3A 2HW7A 3PXZA 2PZPA 2IN6A 4MF1A 5CQWA 4IC8A 4LRJA 3ZRLA 3GCVA 3N51A 3UBDA 2GS6A 2WMSA 2R3GA 2E9VA 4R78A 3ZXTA 5TT7A 3NX8A 5GIOE 4WRSA 4YU2A 3EN4A 4D0XA 3A4OX 3DBEA 1MRYA 2A27A 4QTCA 3NYVA 2E9NA 1OL6A 4YTCA 2IO6A 3COMA 3AD4A 1FQ1B 5CT0A 3WZUA 1PMEA 1FMKA 2R5TA 2W4KA 2ACXA 4ZY6A 3CGFA 1PMVA 3KULA 4N6ZA 5AUWA 3FDNA 3V51A 2XK6A 4FKPA 5FXRA 2QONA 3PIZA 4O0SA 5HX6A 3BX5A 5BQ0A 3E87A 4ZMEA 5JFSA 4M66A 5HG8A 2BILB 4C2VA 3KEXA 3DLSA 5B2LA 4YLKA 1PXMA 3OBGA 4ZLZA 4YHJA 4EK8A 4XX9A 3UO4A 4E3CA 4O2PA 4FEXA 4OTGA 3W8LA 4KBKA 3QZGA 4K0YA 4YJQA 1O6YA 3UMXA 2GFCA 5HNGA 4A7CA 3GENA 4I5MA 4O27B 3PUPA 4O0WA 4XG3A 4BVUA 4M97A 4DFYA 5EYKA 4IQ6A 4I0SA 1GZ8A 5M44A 2C0IA 4MH7A 4M68A 2IVVA 4FTRA 3D7TA 4CTCA 3H0ZA 2XZSA 5CVFA 3O71A 4KA3A 2FB8A 4RIXB 3FZOA 4I6BA 3ETAA 2C6OA 2XNMA 4DFBA 5E8ZA 2BDWA 3IO7A 5DE2A 2X39A 4FA2A 3DLZA 4CG9A 4JOAA 3WIKA 5BYLA 2I0YA 4RPVA 4XBRA 4CXAA 2Y4IC 3HX4A 3LAUA 4RVTA 4QMNA 2CGUA 4RBLA 3NSZA 2WQEA 4BI0A 3QCQA 2HCKA 2C3LA 3D5VA 4BCJA 4EZ7A 2J50A 1GIJA 5K5NA 3TDVA 4TY1A 4ASZA 3RZFA 3S4QA 2PWLA 3BBWA 1Z5MA 4RIYA 5DYJA 1MQBA 4D4YA 2GNHA 2UW0A 2YFXA 1QMZA 1BLXA 4GT5A 3AOXA 1H1RA 2G9XA 3U8WA 5CF4A 4YR8A 4JQEA 4MQ2A 4YJSA 1EH4A 3W10A 3QWJA 3ZEWA 3EN9A 1REKA 4U80A 3WI6A 5C26A 4NTSA 2VTMA 2UW9A 4KBAA 2PYWA 5IQFA 3G2FA 3C4CA 4QQCA 3R7UA 4XUFA 2XJ1A 4CFMA 3NNXA 4H36A 2OJ9A 1XH7A 4J96A 4RA4A 2E9UA 2UW5A 3G33A 4KSQA 5FD2A 3SQQA 4ZP5A 4QP8A 4E4MA 3FL4A 1KWPA 1OIUA 2C30A 3NUSA 4BTJA 2OJGA 5CSXA 3UG1A 3VNTA 5K3YA 3HNGA 4L43A 5DOSA 4X0MA 3LMHA 4QMPA 3JUHA 5M55A 4QT1A 1A9UA 2V22A 4ZS0A 1YW2A 2R3QA 3GCUA 4RFZA 5I9ZA 1JQHA 4U7ZA 2BDFA 3TZ8A 3VAPA 5EQEA 1YKRA 2AUHA 2CCHA 4FV2A 3NPCA 2OZOA 5FEDA 4J1RA 3AMAA 2WPAA 3RAKA 5HZNA 2QHNA 4O86A 4TRLA 4FKWA 4GCJA 5E90A 4EOIA 1SVEA 4DE4A 2YIYA 4BBMA 2OWBA 4ZY4A 1Q3DA 4JR7A 5AV0A 1GZNA 2ESMA 3D7ZA 1YHVA 1Y91A 5EK7A 3E7VA 4BKJA 3G15A 5FEQA 3LXLA 3PY0A 1Q24A 4GFOA 3UNJA 1NW1A 3QRIA 4IB5A 4V04A 4X3FC 5IUIA 4L52A 1JKKA 4Y85A 5ETAA 1Y57A 3I60A 3R7GA 2Z8CA 3R9OA 3BU6A 4AGDA 2DQ7X 3DGKA 3ZXZA 5HX8A 4CEGA 1P2AA 4ALUA 5A4QA 1WBNA 5BVDA 2QLUA 2XM9A 5CZIA 2GHLA 2B55A 2E9OA 3CS9A 3R1NA 2GMXA 3DTWA 3FY2A 5EI2A 2WOUA 2BKKA 4O81A 3MFSA 4DCAA 4EOJA 2YIXA 4M7IA 3VS7A 3TTIA 1PKDA 5M09A 4FVRA 4FSQA 3DNDA 2FSMX 3NCZA 4IM2A 4NJ3A 5FXQA 4CCUA 5C03A 3ZSIA 4YJUA 4DBNA 3DK6A 1Y6BA 3QKLA 5EI8A 1ZWSA 2PE2A 5HCYA 4KIKA 4X7QA 3WF5A 2WQNA 4OBOA 2HZIA 3NW6A 3DY7A 4NSTA 4YNOA 3GU8A 3MWUA 3HRBA 5FP6A 4UWYA 5J5TA 3EHAA 3Q6WA 3A4PA 5FWKK 3QQLA 3HEGA 5ANGA 3VW6A 3ZFYA 3H30A 4YJRA 4TPTA 3V5JA 3E63A 1H1WA 4JAJA 2Y0AA 4BDAA 2PUIA 1JVPP 3NVMB 2ITVA 3ITZA 5FTGA 1W83A 2PY3A 3DOGA 5AM6A 3RBWA 4KIQA 5AM7A 3WF9A 2UW8A 4LL5A 3PWYA 4C2WA 4F65A 5BVOA 4BKYA 3R9RA 4NK9A 2XJ2A 4F1MA 3QU0A 3TI1A 3TV6A 4FR4A 2RSVA 4O6EA 4ZXTA 1GZOA 5ICPA 4ID7A 1SMHA 2JDOA 2VTQA 4EORA 4EZ3A 2XCHA 2PHKA 3MW1A 4C61A 2E9PA 3IW7A 2JDRA 2G2FA 3W2QA 2W4JA 4AZVA 3JYAA 4IEBA 2BVAA 5A46A 2I1MA 3R9HA 3PE2A 3LXPA 4UZHA 1OPLA 2PVJA 3HKOA 3V5WA 4BIEA 2ITPA 4ZZOA 4F7JA 4QMVA 3U6HA 2W9ZB 3PA4A 4F99A 4EHZA 1ZLTA 4Y8DA 3O96A 4MXAA 2AYPA 2QOHA 3FYKX 3ZZEA 3ZFMA 4F7SA 1ZAOA 3UMWA 2X81A 3CSVA 2XJ0A 4TWNA 3BE2A 3HMPA 3N9XA 4DEBA 5HBJA 2B9IA 3EZVA 3CQUA 5CT7A 4EOPA 1IR3A 3DKGA 2RF9A 3LCOA 4FEQA 5E4HA 4MTAA 3CD3A 4J8NA 3DB8A 3HAVA 5L8JA 4B99A 2J5FA 1OMWA 3IOPA 3LHJA 4L42A 3KL8A 2B53A 4FTLA 2PUPA 4MD7E 2V7AA 5G1XA 3CY2A 4RJ6A 3RZBA 1KV1A 4FK3A 2RGPA 1ZYSA 2HOGA 4QP6A 4PF4A 3A61A 3NDMA 3Q2JA 1PXJA 3QBNA 4IAAA 3FZPA 4FV4A 4UYAA 2ZM4A 4FV1A 5TR6A 2XM8A 5JH6A 2KULA 3M2WA 2YCRA 4HJOA 1PXPA 2ZM1A 4YUQA 1U54A 3QC9A 4E6CA 1Z57A 4QTDA 1JPAA 2GS2A 1OL7A 2XP2A 2LGCA 2GFSA 4FKQA 5D12A 4FKGA 5L8KA 3WF6A 2R4BA 4U9AA 4WG4A 4AG8A 4MNEB 4RWKA 3R7YA 4QYHA 4BB4A 4IAYA 4D9TA 5FXSA 5FUTA 2JFMA 1U5RA 2ZJWA 4ZAUA 1OKZA 3NUUA 3V6SA 4EEVA 3C50A 2GTNA 4NT4A 4MXCA 4U97A 1LEZA 1W8CA 3PZEA 4YTIA 4I23A 4DEHA 2X9EA 2YJSA 4MD9E 4RVMA 3SG9A 2QLQA 2B0QA 5KZIA 3SGCA 4UMQA 5JQ5A 4QOXA 5K5XA 3LJ1A 2UZWE 1OL2A 3KRLA 5AAEA 2WTKC 5CXZA 4I1ZA 3Q9ZA 5FEEA 3MPMA 2VWUA 3C0GA 4G2FA 4C38A 3F3WA 2VTHA 3B2WA 3HECA 5FQDC 5HLWA 1TQIA 3E93A 4FNXA 4P7EA 4E6QA 1OKYA 3GEQA 1ZOEA 1OPKA 5ETIA 5L6PA 2JC6A 3PJ2A 4L6QA 2HIWA 3EMGA 4FUXA 3P78A 4BBFA 4EJNA 4LGGA 2R3MA 3V8WA 1YI4A 4ANOA 4OTQA 1Q41A 3OXTA 3ZFXA 4AW5A 3N4UA 2W1IA 1GAGA 1Q8TA 3EQBA 5LVOA 1J91A 3VF9A 3AMBA 2ITTA 5M08A 2OK1A 5TKDA 3DCVA 3RPRA 3O8TA 2ZDTA 3QTZA 5K0XA 3C4ZA 3DQWA 1P14A 5E8XA 3PXFA 4MXYA 4USFA 3SA0A 2OXYA 2JDSA 3D4QA 3HUCA 1URCA 2UW3A 2QOOA 3QUDA 3VWAA 3P0MA 2JITA 2ONLC 4BYIA 5KNJA 3TV7A 3FWQA 4EH6A 3SAYA 3FC1X 3KXMA 2BIKB 2RL5A 3MY0A 3ZRMA 3QUEA 3IONA 4AGCA 4TNBA 3G90X 4ARKA 2VTPA 4OR5A 5CF6A 4RX8A 3EQFA 4YO6A 4GU9A 2R0IA 3WBLA 4PMPA 5DT3A 3NLBA 2P33A 1I09A 3Q6UA 4NH1A 4U44A 3RHKA 4ANMA 3PJ8A 2UZUE 5J7HA 3PJ1A 4I4EA 5IKWA 3HMOA 4CFWA 3F61A 3EL8A 3R00A 3M11A 5EW9A 3BYUA 2QG7A 5CLPA 3M42A 3PJCA 4DA5A 1GJOA 2BRMA 2OIQA 3H4JA 4J53A 4BDCA 5FDXA 3MB6A 3UVQA 3O0GA 4XV3A 3G9NA 3TJDA 1IEPA 1KOBA 3FPQA 4O7NA 4FG9A 2OSCA 1F0QA 1VEBA 2QU5A 2OFUA 4FYOA 2GNFA 3CKXA 1UKHA 2HENA 1E1XA 4GU6A 4J8MA 3QXOA 4ITJA 2JBOA 5L3AA 3TM0A 1M17A 5HIBA 3KREA 3HP5A 4RX9A 5B2MA 1SVHA 5BVKA 3BHVA 2YAKA 3D9VA 3MB7A 5CU6A 2WOTA 3BV2A 3ZUUA 4F0IA 3KF4A 3QD0A 3NR9A 5KKRB 3H9OA 2YEXA 3WIGA 4YC6A 4EWQA 4ANBA 3V3VA 3VBYA 2BZHB 3POZA 4H39A 4CYIA 2VWWA 4FBXA 2WFYA 4XG9A 4IW0A 3PP1A 3C4WA 3FMKA 2PMIA 4FKLA 2X4FA 4KD1A 3PJ3A 2SRCA 4M69A 4C02A 2UUEA 5DG5A 5EG3A 1GZKA 1M2PA 3OXZA 5BMMA 3R30A 2RG6A 4O91A 5CVGA 1UVRA 3W2RA 4BCGA 3OFMA 2ERZE 5JFVA 3BPRA 1R3CA 3AMYA 5AX9A 3RM6A 4BCIA 3SLSA 4CZYB 4C3RA 2A2AA 3ZOSA 4WHZA 4PDSA 4V01A 5E91A 3FI8A 3ALOA 4A9UA 3QWKA 4H1JA 4OTRA 3WZDA 3FMJA 2ITQA 4AUAA 1OGUA 5HTIA 4GFMA 1LR4A 1YXTA 3DJ6A 3P23A 2Z7RA 3MN3A 2XA4A 3OWLA 5AP2A 3U6IA 2EVAA 4G3DA 3BWJA 4W8EA 3UIMA 2JFLA 4MBJA 5HLPA 4J7BA 4J98A 3Q5ZA 3KXHA 1YOJA 2J90A 3NNVA 4RFYA 4RG0A 5I9UA 4Z16A 3F66A 2WTWA 2Z60A 3ORMA 3CJGA 4FICA 3KA0A 3ZM4A 4UMTA 4IX3A 5IUHA 5C27A 3A7FA 5JSMA 4F1OA 3AT2A 4FG7A 3GC9A 4OLIA 2C5XA 5IMXA 3T9TA 3UP2A 3F88A 3F2NA 4MX9A 2EXCX 5AV3A 4N57A 3W2PA 2PSQA 3GVUA 2WU6A 4Z55A 4U42A 1RE8A 5BVNA 4IVBA 4CFUA 4JT3A 4QMLA 4YC8A 3ZTXA 1ZZ2A 3O17A 1SYKA 3UQGA 2RFDA 3CTHA 4R7HA 4FT0A 5HE2A 5IQCA 1FBNA 4L67A 4U3ZA 1MP8A 4PDOA 3OTVA 1YHWA 3TTJA 5M56A 1AD5A 4CV9A 1STCE 2VTTA 1XKKA 2CCIA 4FKUA 5FG8A 4EBWA 1WBSA 2I0EA 3MBLA 4XP3A 2HW6A 4ZSJA 5HIDA 3QUPA 3NVKI 4P5QA 4U5JA 1YRPA 4LMNA 4O96A 3V5LA 1NVSA 3OY1A 3HA8A 3LMIA 5AUZA 3GCQA 1V1KA 2GS7A 4XLVA 3RJCA 4AACA 4QRCA 3EQDA 5GJDA 3ORIA 5AP4A 3F2AA 2F2UA 4LGHA 3AT3A 3C13A 4FODA 3SD0A 4CZUA 2ZV9A 4NIFB 2I40A 3WZKA 4AGWA 1ZY4A 4D4SA 2XNPA 4FSYA 3FQEA 3I4BA 3DT1A 4EOKA 3ZC6A 3V6RA 5LJJA 4AZFA 4XYFA 5CY3A 2W1GA 2PMLX 2C1BA 5GHVA 2UV2A 4FNYA 3Q4CA 2CKQA 2QR7A 4QMSA 4D55A 3EYHA 3R21A 2RKUA 4BTMA 4E7WA 5AJQA 2QKRA 5CX9A 5A6NA 4XNEA 5AIKA 3W18A 1PYXA 4OGRA 2YCSA 4MWIA 5J79A 2BZJA 5AP0A 4DT9A 1LUFA 1B6CB 4FK6A 4ORKA 4OTHA 4OTWA 2F7ZE 3U54A 1OM1A 2BIYA 3IGOA 2OO8X 3IW4A 3BU3A 5E8WA 4DH5A 4X3JA 4I5HA 5BYZA 4JIKA 4AW1A 3I5NA 4F1TA 4EJ7A 3MJ1A 3GU5A 3UQCA 3PY1A 3BHTA 4MNFA 2VGPA 4FKOA 4O7ZA 3AXWA 2PU8A 2Y8OA 4GK2A 5D7VA 4QQTA 2ZM3A 2R7IA 2DYLA 2G2IA 2WMTA
chains in the Genus database with same CATH superfamily
3D15A 4BDIA 3RCDA 4O82A 2GQGA 4TWOA 5HI2A 3GXLA 3OUNB 4PDPA 4MBLA 3P7BA 5L2QA 1YOLA 3M1SA 5FP5A 4TXCA 3U87A 2PE1A 3A60A 3DFAA 1RQQA 2X6DA 4MYGA 2BTRA 1MUOA 3CC6A 4C8BA 1BYGA 4PNIA 3BCEA 3NZ0A 4IACA 4TKSA 4OT6A 3CTQA 3WZJA 3W0SA 4EOSA 1O9UA 1X8BA 4LFIA 2XUUA 5D11A 5A14A 3ZEPA 2JIIA 3R71A 3LLTA 3OT3A 2BZKB 1CTPE 4UWCA 3KC3A 4Y73A 1H4LA 3F5GA 3LOKA 3Q2MA 3Q5IA 4DEAA 5CF8A 5C4LA 3K2LA 3LFAA 4UX9A 3ZM9A 4EOMA 3PXQA 4D1XA 4FZ7A 1WAKA 1UV5A 3VBVA 3WYYA 4F64A 3ZLSA 1BL7A 4IWQA 5CVHA 3ZMMA 4EHGA 3FMEA 2J0MB 2YM6A 4O0UA 4E26A 4BDKA 2ITNA 3FLZA 5LVPA 4DFLA 4NM5A 3D5UA 5CEOA 2P3GX 3QGWA 5BVEA 2UZBA 4PNKA 5EDRA 2W9FB 1UWJA 4FVPA 5DI1A 5LVLA 3VBXA 4E20A 3BHUA 5L2TA 4U43A 2OW3A 3MGYA 3VS3A 4QPAA 3ZO1A 3LCTA 1H1PA 3LPBA 1U4DA 3GGFA 3MVHA 5A3XA 2R64A 2C6TA 4FG8A 3WE4A 4F9AA 2NRYA 3QQFA 2X0QA 3TKIA 4FUYA 4BGGA 4F4PA 2WMVA 3BRBA 2WMBA 4XRJA 1S9IA 4C4HA 4OW8A 3COHA 1J7LA 4W8DA 3DS6A 1M52A 1W2CA 3C4EA 4IADA 3NUXA 3VO3A 1KE7A 3TNQB 2WU7A 3NAXA 4DG2E 4UWBA 2VTIA 4LOOA 4FEVA 4R7IA 1K2PA 3TKUA 4I5PA 4OBPA 3R7IA 3RINA 4A4LA 3SRVA 3HV6A 3QFVA 4WRGA 3O2MA 3KFAA 3FHRA 4GW8A 5ANKA 1ZOGA 2YERA 3QKKA 3UO6A 3VUIA 1FGIA 1JNKA 3RALA 2XRUA 3VS2A 2JIUA 4MD8E 2Z7LA 5E8YA 2OF4A 3VUDA 5BPYA 3PSDA 4ACMA 3PSCA 3TYKA 2Z2WA 1ZARA 4IMYA 3UE4A 3Q96A 2CNUA 4A4OA 4EQMA 4D28A 2ZB1A 4AQCA 2ZAZA 4RLKA 2C0TA 3MV5A 4P5ZA 1PRYA 1B38A 4ZTSA 4DYMA 5AR3A 5HORA 4KS7A 3AC5A 5H3QA 2B7AA 5KMNA 4I94A 3BI6A 5AAGA 5J8IA 1J7UA 1PYEA 2FSLX 3QTRA 4V05A 4FSNA 1Q61A 4IC7A 4I3ZA 2ZV8A 2UZTA 2XBJA 4O0YA 4QP9A 1YI3A 4A07A 3AKLA 3PIXA 1BX6A 1UU7A 3JVSA 3FSKA 4C0TA 4CCBA 3HRFA 1ATPE 3QL8A 3BE9A 2F4JA 2RFNA 3IDPA 3VHKA 2OIBA 2C6MA 1JKSA 3FXXA 3O50A 3MPAA 4H3BA 4M8TA 4J71A 5JZNA 1Y8GA 1GIIA 2I0VA 4H1MA 3R1QA 4FKJA 4HYIA 1PXOA 2BTSA 4CT2A 4IX4A 2JGZA 2YIQA 1ND4A 3KRJA 2PVRA 4DAWA 5FRIA 3MVMA 1NA7A 5CEQA 1DAWA 3TNHA 3EH9A 4KB8A 4BRXA 4MK0A 4PMSA 3PPKA 1ZY5A 1Q8WA 2GU8A 3EJ1A 4IZ7A 5DBXA 1U46A 3B8RA 4O7YA 4RZWA 4EYMA 1Z9XA 2VO7A 5E8SA 4EK3A 1PHKA 4XV1A 5HG7A 2CN5A 3SG8A 4DG0E 3BKBA 2QOKA 4O4BB 4YZ9A 4IX5A 5CWZA 3LJ2A 3TDWA 4XG4A 5J9LA 3W0RA 4YBJA 3CD8A 5F1ZA 3EYGA 5FBOA 4C4EA 3GU4A 5L6OA 4FTCA 1Q62A 3IW5A 3ZSHA 4N0SA 3LQ3A 2CLXA 1V0BA 4KRDA 4XLIA 4ZTQA 4HYHA 4MWHA 5HE3A 3ZHPC 3ID6C 2XAMA 2OFVA 1T46A 2REIA 2XH5A 4PMMA 4CYJA 3FI2A 3RAIA 5ANJA 4RC4A 1CDKA 4XP0A 4X2JA 5E1EA 1P4OA 4WD5A 4ZSEA 4JJRA 4ACHA 4MXZA 3EL7A 1REJA 1WBOA 3ZC5A 4ASXA 4C4IA 5AUUA 4R7BA 1KE5A 4PTGA 3HV4A 3E8EA 5FM2A 3R28A 3ULZA 5LWNA 3UP7A 3BGPA 2H34A 4QTBA 4EOLA 1UU8A 4DEEA 4FV8A 3W0QA 2XK8A 2X2KA 3R9DA 4EI4A 3I1AA 4TN6A 5DA3A 3LFBA 4CSVA 5TOZA 5DRBA 2R3NA 2OIDA 4CTBA 1OPJA 1OUKA 4PUZA 3MYGA 1KV2A 2G01A 5KBQA 3DPKA 3VRYA 1H0VA 4C33A 1URWA 4FSUA 4PL5A 2FSOX 3LZBA 4H58A 4CFNA 4MKCA 1CKJA 1UA2A 3UZRA 1E1VA 2ETKA 3S3IA 4F0GA 1W98A 5M4CA 3B2TA 2QHMA 4M84A 4J99A 1NVQA 4IIRA 4RIXA 1OUYA 1OKVA 4JBVA 5KE0A 3WARA 4EHEA 2XANA 5LCKA 3CBLA 4PX6A 1L8TA 4ZZNA 4Y5QA 2PTKA 4FIEA 2C6IA 3FLNC 4F6SA 3PP0A 3K54A 4QDVA 2GNLA 3ORLA 5IEVA 5IEXA 2JAMA 3GU6A 2VU3A 4ZTRA 1NVRA 2OI4X 5IA3A 2QC6A 3VN9A 2PZ5A 4MCVA 4FL1A 4WIHA 3R73A 1JSVA 3HDMA 4ASEA 4FTIA 1H1SA 2YM5A 5E1SA 5HE0A 2FA2A 4G6LA 4NKSA 2QD9A 4L68A 4K33A 3HP2A 3OS3A 3LQ8A 2XCKA 1WBTA 3TMOA 2XIKA 3ORNA 4IDVA 4K9YA 3FQSA 4BR3A 3FLYA 5LVNA 4CKJA 3NUPA 2XNNA 5IA1A 3DKOA 1XH6A 3SV0A 4P90A 1XR1A 2XBAA 3II5A 3Q3BA 4LRKA 4IWPA 5M06A 3MIAA 3ZO2A 2BCJA 5HO7A 4R1YA 1QCFA 4PMTA 1IG1A 4BI2A 3CXWA 4EQUA 3P1AA 4JMQA 3GBZA 3V01A 3V5TA 2HELA 2XKDA 5JN2A 3FEGA 4QMUA 4ZTMA 2C3JA 2XIYA 3ML1A 4AXFA 1J1BA 2CHLA 3P7CA 3R02A 2IVUA 4KAOA 5ETFA 1IASA 2UZEA 5C8MA 3D94A 1MQ4A 4CRLA 3ZLWA 4IB3A 4O0TA 4DGMA 1JSTA 3GCSA 4BCMA 3HZTA 5I3RA 2UZLA 4HOKA 3BEAA 4QQ5A 4WNOA 5HO6A 2VTNA 3TNPC 1H27A 3F3TA 2X0GA 3EQPA 4PQNA 5M51A 4JI9A 2OLCA 3E62A 4C59A 2Q0BA 3ZSGA 2C3KA 2WQMA 3LVPA 3AC8A 3DJ7A 4OT5A 3QYWA 2YIWA 5AX3A 2PZIA 3LFNA 4BICA 4E6AA 4JVGA 4EH3A 1KUTA 4W4YA 1LEWA 3PDTA 2XYNA 5IDNA 4RFMA 3ZLXA 4DH7A 3H3CA 4O7VA 4O84A 3VONA 2Q0NA 1M7QA 4AAAA 2PUUA 3UYTA 3EQGA 3QTWA 4HVSA 4XV2A 3I6UA 4WBBB 4GSBA 3CR0A 4NTTA 4HCTA 3ZCLA 1WVWA 3O7LD 4GV1A 4EC9A 4MXOA 3LMGA 5IH6A 2UVYA 4YJOA 3GT8A 3O8PA 4GKIA 2CNQA 2R3FA 2AC3A 2H96A 3QCXA 2ZMDA 4R3CA 4F63A 2VV9A 4PDYA 4ZSGA 1GIHA 2QURA 3IDCA 3LXKA 3VUKA 4EWHA 4PP7A 3PWDA 5CAQA 3NUAA 5M4IA 5EYCA 1OGYA 3DBDA 2P55A 3LFCA 3ACJA 3KMMA 5CAUA 2O64A 1YWNA 2YDJA 4GUEA 4O7SA 1YXSA 4AAYA 4AS0A 4Q2AA 3P08A 5BUJA 3UPZA 1KE8A 3QD3A 4FTMA 4W4XA 3VS1A 4Z7GA 3UNKA 3BYVA 2R7BA 4IM3A 3CLYA 4QYEA 3A7GA 5AIRA 3E8DA 5DR6A 5DNRA 2P2IA 3DV3A 4YNEA 3LW0A 3LJ0A 2IW8A 1YOMA 5KMMA 5BV3A 4J52A 5EYDA 3TCPA 3S1HA 1GY3A 2C5YA 4O7TA 3O7LB 4HPTE 4ALVA 2DWBA 5AV2A 2YM3A 4G9RA 4KS8A 4KABA 4WNPA 4TTHB 4X6QC 2W5AA 3RAWA 2V62A 4K8AA 4WOVA 4ENYA 5J1WA 4DHFA 3ZH8A 5LMAA 5HQ0A 3R7OA 2V0DA 2ZOQA 1Y6AA 3SKCA 3C51A 2X7OA 4ZJIA 2A19B 3H9RA 4G6OA 3LIJA 3D5WA 4ZSAA 3LCSA 2R3OA 4YZDA 3UTOA 2W1EA 4IXPA 4QPSA 2C1AA 3RNYA 2ETMA 5HLNA 1FGKA 2YDIA 4AE6A 1M2RA 4U41A 3ZO4A 3W2OA 2W1FA 4O0VA 5AP7A 5AUVA 2JLDA 2EU9A 3CY3A 3JVRA 3OP5A 4WUAA 1J1CA 2XS0A 3B8QA 3ORPA 5I9XA 4FZFB 4Z7HA 2VWXA 4LGDA 4DLIA 4EYJA 2X9FA 2XIXA 3UO5A 2R3JA 2XRWA 3DTCA 1P4FA 3GUBA 1VZOA 3PVWA 3QAME 5I4NA 4LV8A 3TUCA 2H8HA 1J3HA 3FQHA 4QMXA 4NEUA 4U3YA 3ERKA 4F9WA 4XEYA 4X3FB 2VGOA 1TFFA 4BIBA 4B9DA 1UWHA 3REPA 3FMMA 5AP6A 1JBPE 2UW4A 4CKRA 2BZIB 2IWIA 1M7NA 1G5SA 5DT4A 1MRUA 2QOLA 3DBCA 2J9MA 4F08A 4LUEA 4QYFA 2BALA 3F5PA 4IJ9A 4WKQA 4L01A 4MXXA 2R3PA 3UQFA 3FXWA 3LM5A 1YDTE 2IJMA 3OT8A 3Q52A 2PVLA 4H3PA 3L9NA 3MFRA 2OH4A 3FKLA 3FLSA 3T3UA 4KINA 3RPVA 4BKZA 2YJRA 1SZMA 1WCCA 5EHYA 4I4FA 3CE3A 4CFXA 2OH0E 1LPUA 4IAIA 4IFCA 2B54A 3C1XA 3FLQA 4MNEA 3ROCA 2HY81 4GK3A 3VBQA 4AZSA 2EUFB 5HD4A 3EB0A 2ZVAA 4JBPA 5HD7A 3D0EA 4G3EA 3Q4TA 5AUYA 3T3VA 3JS2A 4B4LA 2CKEA 3EQCA 2WTDA 1B39A 2IZSA 3BIZA 3D83A 4EUTA 4YTHA 1WVYA 2JAVA 4GVAA 5DRDA 4DBXA 4KKHA 3OCBA 4TYHB 4FIHA 5F95A 3EN6A 5G6VA 4ZJVA 5JKGA 3KU2A 4E1ZA 4DTAA 1YWRA 2WMAA 2W4OA 1JOWB 4MAOA 3G5DA 4GEOA 1ERKA 3E3PA 4MVFA 4XS2A 2QQ7A 1XJDA 3MFTA 5TE0A 3MFUA 3DAJA 4HVDA 5A4EA 3V5QA 4NJDA 3BELA 4BDDA 3UZTA 2PUNA 3W0NA 1R78A 3E8NA 1ZYCA 5IDPA 2J7TA 4E5WA 4EK6A 4CG8A 5CU2A 3OHTA 5HG9A 3ENMA 2WHBA 3QRKA 3S0OA 5EM8A 4EQCA 3LXNA 4NL0A 2OJIA 3FMNA 3SXSA 2WMUA 2HYYA 4C36A 4L3LA 2RFEA 2ETRA 3NW5A 3PSBA 3QZFA 4BCPA 5A54A 4GYIA 3PRFA 1Q97A 4AN3A 3FYJX 2B9JA 5CSVA 5JT2A 2VWVA 3TWJA 4NZWB 1PXIA 5LARA 3QALE 5M07A 2ZV2A 3C5IA 5EDQA 4QPMA 1G8JA 3ALNA 4DEDA 2W1DA 3QLFA 4D1SA 4V0GA 5M57A 1OBGA 1H1QA 3AG9A 4CGAA 4Z9LA 4ZSLA 1G8KA 2WTCA 2HWOA 2EWAA 3GFEA 4ACDA 4CLJA 4XG6A 3GNIB 4FTOA 5HVYA 3NS9A 5BX0A 5IQHA 2X8IA 4AN2A 2HZ4A 3GFWA 4AU8A 2CGWA 4RJ5A 3R8ZA 3UPXA 4E93A 2QOQA 3FZ1A 3FUPA 4YHTA 4AXAA 2KTYA 4TZRA 3VUMA 4YLJA 4OTIA 3KXXA 1OL1A 4YZBA 4JL9A 4DHIB 2F57A 2O5KA 5K9IA 4W4VA 4O0RA 4TYGA 4BWXA 3DXPA 1W0XC 4PY1A 4IM0A 4FIIA 3TJCA 4EHVA 1W7HA 2UW6A 3GCPA 4K18A 2BFXA 4D2SA 5GIPE 4A9SA 1E9HA 3DBQA 5ANOA 3U9NA 1R0PA 2IZTA 1OL5A 5AUTA 5BMSA 3ET7A 3BYMA 5E92A 4FTTA 3U6JA 3PVGA 5LMKA 4CMTA 3P4KA 4EOOA 1Y8YA 3C7QA 5KHWA 4EH2A 2XALA 5L6WL 3VRZA 3PE1A 2YAAA 4HYSA 2PVHA 3UOHA 3QRTA 2NO3A 3F3VA 2B4SB 3UIXA 3QTSA 4CT1A 1S9JA 1V0PA 2OGVA 1YDRE 2R3LA 2VUWA 3EOCA 3IS5A 4YJTA 5T3QA 3UC4A 4B8LA 5CU3A 3NRMA 4C37A 5IA5A 1M14A 3DQXA 4BHNA 1KSWA 2UW7A 4IDTA 1G3NA 4YJNA 4FSMA 3QYZA 2OZAA 4N6YA 1I44A 4YZMA 2FUMA 4FKSA 3RPYA 2ZMCA 4L3PA 4XRLA 3THBA 4M3QA 5HEZA 3SDJA 2PMNX 2QO7A 3DU8A 3JY0A 4KSPA 3RGFA 1AQ1A 5HBEA 4O4DA 5GZ9A 1CKIA 2WTKB 5IUGA 1WZYA 3DB6A 4QO9A 5DIAA 4DGNA 5ANDA 5LVMA 2HAKA 4CMOA 5EOBA 3DDQA 4FIFA 4EUUA 4FSWA 3KVWA 4QMOA 3QF9A 3FZSA 3VW8A 4LRMA 4M13A 2J0KA 3EN7A 2WO6A 3RK7A 3MH0A 4JQ8A 4IAZA 2ZDUA 4IANA 2BUJA 4W9WA 3DK3A 3VVHA 3FKNA 4F0FA 1RJBA 2XK3A 3CCNA 3DAEA 4FV0A 5AMNA 4I24A 4DN5A 5CAVA 1YDSE 4G31A 4ENXA 3ZYAA 2F7XE 2CKOA 4OBQA 3H9FA 4OTPA 4AFJA 3OROA 4CFFA 4NCTA 3FMDA 3QQUA 4AA4A 3KCFA 2F49A 4BHZA 4U8ZA 4FKIA 1XQZA 3EQHA 4A9TA 2GSFA 1NXKA 2Y6OA 3ZZWA 4ANQA 1SNUA 4EL9A 1Q8YA 2HXQA 4D4RA 4F7NA 5H8GA 4S32A 3FKOA 3R63A 2XNBA 3TV4A 4BBEA 2NYAA 4XG7A 4RJ7A 2XB7A 5EI6A 5DLSA 4DEGA 2VX3A 4U6RA 5HO8A 3ODYX 2PZYA 5JQ8A 3TG1A 4ERKA 4F9CA 4FRFA 4BF2A 3U9CA 2X7GA 3PZHA 4JDHA 2B9HA 1ZRZA 5HKMA 4DFNA 3HYHA 3BU5A 3NCGA 2XIRA 3ATTA 3LFEA 3SOCA 2QOIA 1H08A 2BROA 3IDBA 2VTRA 5IISA 3EQRA 2JDVA 2R9SA 4HGEA 3KB7A 2Y7JA 4G9CA 1XH4A 4BCKA 2VRXA 5EW3A 3RKBA 3HV5A 1UKIA 2X6EA 3ZBXA 5E8TA 2X1NA 3ZDIA 5A4LA 2YZLA 3W55A 5BYYA 4B0GA 1BUHA 4HCUA 3F6XA 2W7XA 4IWDA 3LKMA 3I79A 4O7LA 3SOAA 3FBVA 2IZRA 4QD6A 4B6LA 4TT7A 5HNBA 4JR3A 4FKTA 4LOQA 2J2IB 4C3FA 4RIWA 4ZIMA 4GMYA 2O65A 4IAFA 1ZXEA 4KKEA 3BLHA 4RT7A 2GNJA 3G6GA 3A7JA 2C69A 2DUVA 3WF8A 4PTCA 4EKLA 4IZAA 4FT7A 2A4LA 3W8QA 3TUDA 2YM4A 3OBJA 4OAVB 4XG2A 3QA8A 4LV5A 4YJPA 3MESA 3BYSA 3ATSA 4JDIA 4D4VA 4FT9A 4XOYA 3EKNA 3TIZA 4JQ7A 4O6LA 4CRSA 3GQIA 4AZEA 4LUDA 3G0FA 4GIIA 1G8AA 3IG7A 4WSYA 3AKJA 1ZYJA 3OCGA 4RQKA 5M4FA 4QDEA 3PPZA 2YIRA 1OZ1A 4O1OA 3R6XA 5CQUA 5CSPA 4DT8A 5JK3A 5DGZA 4FC0A 2ZV7A 3QRUA 3VUTA 3QTQA 4E4XA 3OOGA 3RPOA 3ZDUA 1IA8A 2XYUA 3D14A 3KQ7A 4M15A 4ZMFA 4FSZA 4USDA 4GJ2A 3QLGA 3RK9A 3JXWA 4JG8A 4IAKA 1ZOHA 4FNZA 1RDQE 3S95A 2WNTA 3Q53A 4FIJA 4NWMA 4I21A 3SHEA 3SVVA 4HNIA 2UZDA 1WBWA 5IMEA 3F5UA 3E8CA 2YCFA 3H10A 3PG3A 4H3QA 3BQCA 2GPHA 4L00A 3U51A 4DH8A 2OKRA 4RIOA 3QCSA 4IHPA 4DC2A 4DEIA 4UMUA 4K1BA 5IA2A 1DS5A 5AWMA 5I0BA 5KO1A 3GI3A 3R83A 2H9VA 3L1SA 4FF8A 4WA9A 2JBPA 4D2TA 4LV7A 3NNWA 3ROYA 4BFMA 4ZY5A 2YCQA 3PPJA 4NFMA 5M53A 5EM7A 4C58A 4GVJA 5L8LA 3A7IA 4IZ5A 5IF1A 2VTSA 3UIBA 4JRVA 3W2SA 4HZRA 3ODZX 3VC4A 4E6DA 4RLLA 3EFJA 2VTJA 2W0JA 4PPAA 4II5A 1A06A 4TNDA 1O6KA 2I6LA 4FOCA 3AGLA 3TZ7A 3WF7A 4AX8A 4I0TA 4YSMA 4O38A 4R5YA 3UJGA 2YABA 2J0LA 3OZ6A 5DWRA 2B52A 3BLQA 3ZS5A 1OVEA 5C8NA 4WNKA 2LAVA 3DZQA 2C5NA 4FOBA 3TNIA 3PFYA 2XNGA 4F70A 3R22A 4QTAA 2GNGA 3W2CA 2W5HA 4RVKA 4HW7A 2QR8A 3KRXA 3OTUA 4BWKA 2FVDA 2X4ZA 1Q8UA 2WQOA 1DAYA 2GNIA 3QTIA 3KULB 1UU3A 3MS9A 2B1PA 4BC6A 3WOWA 4FSTA 3VUHA 2UZOA 3SXFA 2CPKE 3MTFA 3FXZA 3FY0A 4R3RA 4LOPA 2BMCA 2WMWA 2P0CA 2XK7A 2YA9A 4FTNA 4BCNA 4BDBA 4BCQA 4HCVA 2XMYA 3N4TA 4ACGA 1QL6A 2BHEA 3BGQA 3L8XA 5IEYA 2C47A 3PIYA 3W16A 4ALWA 4U45A 5AADA 5LOHA 2V7OA 2BPMA 3L9LA 5CSWA 5LMBA 2O0UA 2R3HA 1SM2A 4RX7A 5D41A 5HGIA 3E64A 4BN1A 4L53A 4IB1A 5ACBC 3VJNA 4AZWA 4IJPA 2EB2A 4BCFA 5H8EA 2FO0A 5CALA 4BDGA 5GZ8A 3BLRA 3QD4A 4KIOA 2RFSA 2V5QA 5KMLA 3LFFA 3AC2A 2YHVA 4TYIA 2GHMA 4CD0A 3D7TB 2JD5A 4QTEA 3F7WA 4JXFA 4JRNA 2ERKA 3CTJA 4KKGA 5H8BA 3ANQA 4F6WA 4LYNA 4QMYA 4PPBA 4I93A 2JIVA 2QNJA 5E8VA 3HV7A 3OOMA 2WELA 3MVLA 1YXVA 3TL8A 5F9EA 2VZ6A 5KMJA 3NFFB 4O83A 5AP3A 5JRSA 4R5SA 1DM2A 1GOLA 2BRHA 5FLFA 2CGVA 2QI8A 1Q4LA 3AD5A 5C9CA 4DH3A 1BI8A 3LE6A 5CNNA 3KVXA 5D7AA 4G3GA 3IKAA 3FI3A 3FPMA 4HGTA 4J97A 2R3KA 5KMIA 5BUIA 3QKMA 4YZNA 3OG7A 4S2ZA 5TF9A 4C7TA 3C9WA 3UVPA 2JKMA 1IA9A 5EYMA 3KN6A 3S00A 5DT0A 2VO3A 4D2VA 2J6MA 5CU0A 4LG4A 4RIYB 3FL5A 4FIGA 1XBBA 4HYUA 4JX3A 4RRVA 3G51A 4FGRA 1Q5KA 5AP1A 5EKNA 3KMWA 2VD5A 3CGOA 3F9NA 4ANLA 5HOAA 3SXRA 3NW7A 2DS1A 3O8UA 3MY5A 4G34A 4XV9A 2BRNA 4W9XA 4ZEGA 5BNJA 5I5ZA 5KMOA 2NNWB 5HU3A 5I9VA 3OWJA 4FX3A 2PE0A 1OKWA 2C5VA 3KXGA 5EM5A 1CSNA 5E8UA 3D2KA 2CDZA 4U0IA 3R7VA 2FH9A 3IGGA 4R3PA 1PXKA 5JGDA 3VS5A 4RMZA 5C8KA 4B8MA 2PVNA 3KXNA 3RWPA 2YITA 2WIPA 4AZTA 1BMKA 3OCTA 2C6KA 4Q5EA 4GG7A 4X6RA 5EM6A 3P79A 1Q3WA 1OI9A 5EH0A 1ST0A 3ZONA 3EN5A 3AD6A 3NNUA 2XIZA 3QRJA 4X2NA 3GC7A 1JSUA 3MPTA 4GK4A 3FC2A 2C68A 2F2CB 4Y83A 2ITOA 1ZZLA 4U81A 5KUPA 4JIAA 3D2IA 3OD6X 3BHHA 3BWFA 3GU7A 1Q99A 3UG2A 3FSFA 2XVDA 5EOLA 3I6WA 4R6VA 4Q5HA 5A9UA 5ITAA 3NAYA 1BI7A 2YDKA 1CMKE 4UYNA 2XKEA 5J5SA 4XCUA 4ONAA 4AW2A 4MF0A 3UOKA 3PA5A 5JMSA 4RQVA 4GJ3A 4ZTNA 1FPUA 3VS4A 3MA3A 4CZTA 4D58A 2YWVA 1YWVA 1U59A 2W05A 2Q83A 4QP3A 4YHFA 3G0EA 4ZJJA 2C6LA 3F2RA 4QYYA 3MY1A 3IQ7A 3OEFX 4F9BA 3G9LX 3FMHA 5CS6A 5AUXA 3I7CA 5H2UA 4EBVA 4XH6A 2O2UA 4M12A 4AE9A 4BDFA 2ITUA 2BHHA 4EH8A 4QMQA 4QMTA 5LXMA 3MH2A 2WMRA 5KBRA 3VF8A 4F09A 1UNLA 5BVWA 3Q04A 3UDZA 4EONA 1H8FA 1IAHA 3DZOA 2J0JA 3P86A 3NFGB 4BZNA 4G5JA 4FV5A 2WKMA 1KE9A 3CJFA 2UZNA 2YN8A 3PY3A 1JAMA 4UXQA 2OBJA 4A06A 5J95A 4ANNA 3HLLA 5L2SA 5JEBA 2XF0A 5DR9A 3VQHA 4NUSA 1UNGA 3JR1A 2WEIA 3LCDA 3QCYA 2GQRA 5FTOA 4RA5A 1OBDA 4NYEA 3K3JA 4BGHA 3BYOA 3U4WA 4YSJA 4ZLOA 4USEA 5GNKA 3KXZA 5ANEA 4C4FA 1OB3A 1OIYA 1TVOA 1PJKA 2X7FA 4KIKB 2PZRA 3PXYA 5LQFA 4BDJA 2UVZA 3CKWA 5CF5A 3FJQE 3QQHA 4EK5A 1APME 2YISA 4NW6A 5T6KA 3R8VA 3KY2A 4FTKA 1TKIA 5EDPA 4DFXE 5CEMA 1TQMA 1OITA 3VHEA 5K4IA 3PRIA 2XEYA 5A4CA 2F9GA 2VWZA 2C6DA 3HMNA 4WG3A 4I6QA 1A48A 3HV3A 1ZMWA 5B2KA 4PTEA 3RI1A 3I7BA 4OTDA 3TN8A 5IU2A 2CJMA 5HESA 4FI1A 2X8DA 1H07A 3F7ZA 3IECA 4RGJA 3NIEA 2I7QA 2C3IB 4X2KA 1JWHA 4QP7A 4RC3A 2QOCA 4GIHA 4L7FA 4R8QA 2Z02A 5HVJA 4ACCA 5BUEA 3Q4ZA 2QOFA 3HMIA 4NKAA 2EXMA 3OVVA 3VUGA 3C0HA 3BEGA 1NT2A 4I6LA 4AOIA 3UGCA 4AN9A 1ZMVA 2X0PA 3NEWA 2J5EA 3PA3A 2YLFA 2JKOA 1U5QA 3HGKA 3MI9A 3P9JA 5GZAA 2ITYA 4WUNA 3QTXA 4G5PA 4EH7A 5EKOA 3L8PA 5HU9A 3F3ZA 4K2RA 1H28A 2W06A 3FAAA 1K3AA 5FDPA 1NY3A 3EIDA 3QHWA 4BDHA 2Y6MA 2FYSA 4E5BA 3RMFA 4N70A 4E5AX 4FMQA 3E7OA 1PKGA 2I0HA 3QTUA 4HGSA 2IPXA 5IQGA 4L44A 5IQIA 5KX8A 3ACKA 3AC1A 3AQVA 5E7RA 2PPQA 4M0YA 4JG7A 1YVJA 3DAKA 5J87A 5HCXA 4QYGA 3S2PA 2YACA 4ITHA 2W99B 5JFWA 5IH4A 4TW9A 2Y4IB 2F7EE 3SC1A 5AR5A 4I6FA 4HVHA 1H26A 2BFYA 3CPBA 3E3BX 3PFQA 4GG5A 3W33A 3MH1A 2HXLA 3PVUA 4D1ZA 1PXLA 3CPCA 4L9IA 4AGUA 2ZB0A 4AXDA 4AXEA 2VN9A 3OWKA 4D9UA 4UXLA 4NM0A 5CAOA 3PXKA 4BCOA 4L7SA 3ZU7A 4WO5A 3F69A 2IW9A 1XWSA 3P5JC 4FZ6A 5T68A 4AT4A 2C6EA 4AOTA 3JY9A 3MVJA 1F3MC 4PP9A 4S34A 3RTPA 4IVCA 5AR7A 3V8SA 3ZLYA 3W1FA 1P5EA 1U54B 2FGIA 1RW8A 3QC4A 1FVRA 4RJ3A 2CMWA 3OC1A 5A6OA 2VNWA 2BRGA