5CF6A

Crystal structure of janus kinase 2 in complex with n,n-dicyclopropyl-10-[(2s)-2,3-dihydroxypropyl]-3-methyl-7-(methylamino)-3,5,8,10-tetraazatricyclo [7.3.0.02,6]dodeca-1(9),2(6),4,7,11-pentaene-11-carboxamide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
290
structure length
285
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Structure-Based Design of Selective Janus Kinase 2 Imidazo[4,5-d]pyrrolo[2,3-b]pyridine Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 285
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5cf6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5cf6A01
4HZRA 5KBQA 2C5YA 4QPMA 4AE6A 5CEQA 1NW1A 4YJRA 4H05A 3SXFA 3W32A 2OG8A 3SAYA 3H9OA 2IN6A 2ZYBA 3LJ2A 4FC0A 5FM2A 3U55A 1YOLA 5B2LA 4HJOA 3JUHA 4WG5A 4DCEA 2X1NA 1V0BA 2XM9A 4G6OA 4O0SA 5CI7A 5CALA 2BRNA 4ACHA 5IH6A 4QMLA 2ZVAA 4AGCA 4R3PA 4O0VA 2YACA 3BWJA 3DDQA 4RX9A 3KCFA 3OF0A 2W4JA 3P4KA 4JX3A 4E73A 2PVLA 5AADA 5IUHA 2YLFA 4QYHA 4IC8A 5ANEA 3O51A 3QTUA 4L46A 4JAIA 4PV0A 3GCUA 4WNPA 2FYSA 4H39A 4AFEA 2J5EA 4LV5A 1OPJA 3UGCA 4FNWA 4IAKA 5AR7A 4XV3A 4M3QA 3VQHA 3LE6A 4JXFA 3FC1X 3MB7A 3BLQA 3PZEA 5HG8A 3RHKA 4RJ7A 3SRVA 1Q99A 2UZBA 3QZGA 1EH4A 3TNIA 4Z7GA 3UE4A 3AC5A 2QLQA 3E63A 4WO5A 2J0MB 3PSDA 4K18A 4BTMA 3MH2A 1Q41A 4CMOA 2WQBA 4CQGA 4ZJVA 2YIYA 4EOSA 4FKLA 3HRBA 4JI9A 4V01A 4NKAA 5JKGA 2Y7JA 4ZS4A 2BTRA 2UZWE 3FV8A 3AT3A 2OXYA 3ZM9A 2W0JA 1J7UA 3GCPA 3PG1A 4J97A 2O5KA 4BHNA 3FL4A 2BVAA 5CNNA 4WUAA 2X9FA 3QQGA 3O7LD 2J0KA 1FVRA 4ZSAA 4K33A 4ZZOA 4APCA 2C47A 4O6LA 3RMFA 5K5NA 4IFGA 2OWBA 1M52A 2RKUA 4AW2A 3QCQA 3W2RA 5DIAA 5KMLA 4QMMA 2W99B 3ZLWA 3PXQA 2QURA 3DBCA 3QAME 4G3CA 3ORXA 3PJCA 4KA3A 4FZAB 2HZ4A 3MFRA 1UU3A 5HBHA 2IW8A 3WF9A 2JIVA 4FTQA 4IQ6A 4JT3A 3LAUA 2F2UA 3R2BA 3UO5A 4FUXA 1YOJA 1PYXA 5CEOA 2WMTA 4BR3A 1J1CA 1OIRA 4YZCA 5EW8A 1WVXA 3O71A 4UMTA 3FI8A 4AOJA 3NW6A 2WU6A 4M13A 3HMIA 5CENA 3JVSA 3FMLA 1QL6A 5HD4A 3NX8A 2WZJA 1OKVA 1XH9A 3D2KA 3QA8A 4Z3VA 1O6YA 1PXIA 4YTFA 3U9CA 4X0MA 1XQZA 5LMKA 3NRMA 4CZYB 4LRKA 1ZYSA 4G31A 3HDMA 5M51A 2Q0NA 5M44A 2XP2A 3NUSA 3QL8A 4FKIA 2FSMX 4YLKA 1Q8TA 3G2FA 4JRVA 4N0SA 4FKTA 5M4FA 4ENXA 2WEVA 4F9BA 2XJ0A 4FYNA 2YFXA 2C0OA 1M7NA 2WHBA 3FJQE 3VRZA 3GU7A 3R1NA 4XS2A 4TY1A 5DVRA 4FKSA 3W2SA 4KABA 4O7YA 3FLWA 3ZFXA 3K2LA 4NW5A 4UXQA 2XJ2A 4NFMA 3K54A 3TM0A 2JGZA 3QX4A 2R5TA 2E9VA 4PL3A 1PY5A 3SXRA 1LPUA 2R9SA 3DV3A 3EQDA 4TT7A 3ZRKA 4MBIA 5CLPA 4A7CA 4CFWA 4EKLA 3CKXA 1IASA 3AD5A 4DINA 4ZTMA 3FEGA 2P2IA 3SQQA 3UBDA 4ERWA 3F88A 4C3RA 2HW7A 2JLDA 4NT4A 4GVAA 2YZAA 1WBTA 4MQ1A 3AC4A 2Q83A 4IBMA 4FSMA 2OH0E 3R9OA 4CCBA 3QTSA 3RAWA 1OUYA 4FT0A 4Y83A 4I5PA 3TV7A 3V6RA 3WZUA 4AS0A 2VRXA 5FQDC 4O7VA 5IQHA 2BRMA 4GK3A 4RIYB 2GS2A 3BELA 3MV5A 2J5FA 5JRQA 1OIUA 4IX3A 3OEZA 4I5HA 5BUEA 2XNEA 3MH3A 3OS3A 1GZNA 3FXXA 2YM5A 2CNVA 3NYOA 3QZHA 4LUEA 4LM5A 4U3ZA 4JDIA 2PUIA 3F3VA 4YJPA 3CTQA 4NTSA 2OIQA 5LVLA 3SOCA 4IANA 2BIYA 3AT2A 1YXSA 2C3KA 4NM7A 3C4EA 5DOSA 4FF8A 2B9HA 4WD5A 4HGTA 3R7EA 5ITAA 2NRUA 4TN6A 3ZUTA 4QTDA 5IMXA 4XG3A 3FLNC 4RQVA 4PDYA 4EH8A 3OUNB 4CT1A 1RW8A 3QZIA 4ZOGA 3OC1A 4Q9ZA 3PTGA 4MBJA 2IVTA 4BYJA 2HWPA 2R0IA 3H0YA 3B8QA 2HW6A 4G3GA 4ACGA 4AZVA 4D4VA 2X7FA 5IEVA 4RIWA 2RSVA 3P7CA 3SA0A 3IGOA 1CKJA 3KCKA 2B0QA 2A27A 3COKA 5L6PA 4BCKA 4JQ8A 4C37A 1OPKA 3MFUA 3P7BA 5FG8A 3FUPA 2ZV2A 4F9YA 5IH4A 4DYMA 5GJFA 5KUPA 5IG1A 3JY0A 4I0SA 1DAWA 5BMMA 2HCKA 3KULA 4U97A 5EHYA 4O7TA 3MFTA 1NY3A 2R4BA 4TYHA 3PRIA 4IAZA 4PWNA 4H3QA 3ZM4A 3LCTA 4G17A 3KREA 2BDJA 1O6LA 4ZXTA 2O64A 3H9RA 3HAMA 3EFWA 4FKJA 2ITNA 4C34A 3I79A 2BAJA 2DYLA 2YWPA 1FMKA 1W84A 4II5A 4J1RA 3KA0A 3R8LA 2YWVA 1GIIA 4KSPA 3ZO3A 4P5ZA 3TXOA 1M17A 3ZMMA 5B2MA 4QQ5A 5J1VA 2YM4A 1OIYA 5E9EA 4YTHA 4KINA 4M69B 4MD7E 3I1AA 3G33A 2B4SB 4B8LA 4O0WA 4FSTA 4IDTA 4QMZA 4YGAA 5A4LA 4FG8A 5CSVA 3TV6A 3OCGA 4FX3A 3POOA 4LL5A 5AUUA 2OH4A 4KAOA 4B6LA 3FMNA 5DR9A 3W18A 3T8OA 1BL7A 4F9WA 2NPQA 4MVFA 4YHJA 4OT6A 2CNQA 4JS8A 5AUZA 2ITTA 3UPXA 2RG5A 3PYYA 3Q96A 4FT7A 1OI9A 3D9VA 3EFJA 4PDPA 4WRGA 2R7IA 3DU8A 4EOKA 4I6BA 4YPDA 2UVYA 1JVPP 3ORMA 3P78A 3O23A 2E9UA 3DBDA 4C4GA 2XK8A 5I9ZA 3P0MA 4IM0A 4TL0A 1JKTA 3D5WA 1CKIA 1UKHA 2QOQA 3QZFA 1DI8A 2VD5A 2BKKA 3FZRA 3LVPA 3DAKA 2XH5A 3GXLA 4IVBA 3TTIA 3UJGA 3G6HA 3OW3A 4UWCA 4IZAA 2VAGA 1GY3A 2HIWA 5FM3A 3EQCA 5BUJA 2I0YA 3HECA 4IVAA 2J50A 2XNBA 2VTOA 2BMCA 5EI8A 2PVMA 4DG0E 4AT3A 5ETFA 4DH7A 4D2TA 2IG7A 2I0VA 3M1SA 2GTMA 2WTWA 4M68A 1UWHA 3V5JA 3TACA 2Y4PA 2GNGA 3UYTA 2ITWA 5K3YA 5L8JA 4DTBA 5AR4A 1H1WA 2WO6A 1YXVA 2VTPA 3V6SA 5C8NA 3DAJA 3E3BX 3E8EA 3OP5A 3U51A 4U81A 5J9ZA 4GFOA 4I5MA 5DG5A 5GZ9A 1OPLA 2VTHA 3VBVA 4L68A 2EXMA 4USFA 1KOBA 4OGRA 1YXXA 4FTIA 4RFMA 4GG5A 4DEEA 2HY0A 4QP8A 4D58A 1H4LA 3ZXZA 3DJ5A 3VHKA 3GB2A 4BZDA 5HLWA 2NP8A 4U44A 1JNKA 3D7TB 2R3IA 1FVTA 5TF9A 4AN3A 3DAEA 5HG5A 4IZ5A 4Y5QA 2GNFA 3Q4UA 4MXOA 5D10A 3ZDIA 2Y4IB 1P14A 2X2LA 5F9EA 3Q9ZA 5HTCA 2PPQA 5GINE 2BHHA 4V05A 1M14A 3L8XA 4WNKA 4EK4A 2ITQA 3BLRA 4GMYA 2YCSA 3CY2A 4J8NA 3NW5A 2C6TA 2QR8A 4FTLA 4L3LA 3W10A 2CCHA 2JKOA 3HVCA 4S33A 5EH0A 5CZIA 4CZTA 3K5VA 5AV3A 2HXQA 2QG5A 3ORLA 3W2QA 5I3RA 5GJDA 4UMPA 2CGWA 5D1JA 5AIKA 5LVMA 2C3IB 2VX1A 4U7ZA 1ZXEA 3IO7A 2XKFA 1ZMWA 5CU3A 3PXFA 4FOCA 4EYJA 3EKKA 3DBFA 3SDJA 1JPAA 3EFKA 4E4XA 2XIYA 5DT3A 2X8EA 1TVOA 3WF7A 1UNHA 2WU7A 4ZTNA 2YJSA 4GV1A 2PVNA 3ZO4A 4DAWA 3FDNA 1FINA 4MEDA 5HCZA 3JYAA 2XRUA 1PKGA 3I60A 1DM2A 3I81A 5FTQA 3Q53A 2OZOA 2QLUA 1XBCA 3BHYA 2HYYA 5KMMA 3QCYA 1PHKA 3KXMA 3TJDA 4DTKA 1B39A 4NWMA 4RZWA 4RT7A 3N4VA 4CMTA 4M66A 1Y6BA 1J91A 4CTCA 4TWNA 5AP6A 3QC4A 5E8TA 3BYMA 4OR5A 1ZY4A 3OVVA 4O7ZA 3F82A 3L9LA 3EQHA 4E3CA 3ZEWA 2WXVA 5CZHA 5IH5A 1XO2B 3AGMA 5H8BA 3VS1A 1XBAA 2YA9A 3MH0A 3UZPA 4CG9A 2F4JA 3AMYA 4QMVA 1PMEA 3ORIA 5E7RA 4ANMA 2J4ZA 3MTFA 5JQ5A 4X2FA 1WFCA 3E93A 3KC3A 3G15A 1UNGA 3ROCA 5DT4A 3BBWA 3DNEA 1M2RA 4QQCA 3EYGA 4KIPA 3S2PA 2VZ6A 3Q52A 4CVAA 2IZTA 5C01A 4R1VA 3RAHA 1FMOE 1Y8YA 3QX2A 3U6HA 3TNPC 1SYKA 2HZNA 2LGCA 3HUBA 4FKPA 4FK3A 4QD6A 2EWAA 3VIDA 4ALUA 4FVRA 4MK0A 5AUWA 3RPRA 4PP7A 3KXHA 2ZMCA 3EQGA 3WF8A 1WBNA 3VS3A 3K5UA 1YXUA 2UW3A 5CTPA 3EL8A 4MWIA 3R7OA 4O81A 2C6EA 4FT5A 4RA5A 5L3AA 3F6XA 3WIKA 1JLUE 4GS6A 1I44A 2VWXA 2WTVA 3NZ0A 3FMKA 4FV9A 4G5JA 3DXQA 4FGRA 3OY1A 5HIDA 5J87A 2IWIA 4JBQA 1Y6AA 1V0PA 3UNKA 5IDPA 3KK9A 1SZMA 3QKMA 3R1YA 4O21A 4BDFA 4MHAA 3RNYA 4E6AA 4FKGA 3OBJA 2ITUA 4FI1A 4EOMA 2BPMA 3OY3A 2ONLA 4YBJA 2W4OA 4NEUA 2C4GA 4A9UA 3AXWA 4DLJA 2ITOA 2IVVA 4FV3A 4CGAA 1HOWA 4DBNA 4I0RA 3U8WA 4D1XA 3TKUA 1VYWA 2Z02A 5JT2A 5IQGA 4IX4A 3QALE 5HE2A 4O38A 2IZUA 2PTKA 4AT4A 5CF4A 3ORTA 4PF4A 4ANBA 3FY2A 4GIIA 5EKOA 1PKDA 5K9IA 1H01A 4NTTA 3HZTA 3FYJX 3GUBA 4EC8A 2A4LA 4D2SA 4YO4A 3KRJA 5BMSA 3OXIA 3SC1A 5HTBA 3QLFA 3LCOA 4IX5A 2GNHA 2FGIA 3R8UA 1M2QA 3ZTXA 4OAVB 2XKCA 3VBTA 3I6WA 4G6LA 4C35A 2PHKA 4BDKA 4C0TA 4C36A 4IAAA 4ZMFA 3FL5A 4X3FC 3LM5A 3ORZA 4BFMA 3LJ0A 3OWPA 3EN5A 4GYGA 4ARKA 2JFLA 3AMAA 4IWQA 1H08A 4OW8A 3WZEA 1PXNA 3QTWA 5DGZA 5FP6A 4BBFA 1BLXA 2WQOA 5HHWA 2Z7QA 4LFIA 1OM1A 4QP2A 3RM6A 5FEDA 3V8WA 2CLQA 2XMYA 5KZ0A 4UMQA 4UWBA 1ZAOA 4BIBA 4R78A 3FKOA 1DS5A 2FB8A 2QD9A 3LMGA 1OKYA 4PPAA 3IECA 4GL9A 2EUFB 4O6EA 2C68A 3UO6A 1VZOA 3UIBA 2IZSA 4MXXA 3D83A 3JPVA 4FTJA 5L2WA 3TG1A 4IZYA 3C0GA 4R7BA 4QP6A 4EH4A 3F3UA 4K1BA 5BYZA 3CLYA 3ZOSA 4GUEA 2XK6A 1ZY5A 3NNXA 4B7TA 3IW6A 3FMDA 2FSOX 4DH8A 2JAVA 3EN7A 4L45A 4DH1A 4QMNA 3E3PA 3IDPA 3Q4ZA 5TOZA 4BDIA 2VGOA 4E6DA 2CKOA 2PMOX 1E1XA 1H0VA 2V22A 2W4KA 3ORPA 4EEVA 5GHVA 2GFCA 5CQWA 3ELJA 5HLPA 3NYNA 3CTHA 3R01A 3LFAA 2Z2WA 4FA2A 5D7AA 2HZIA 4CD0A 5J9LA 3ERKA 4KSQA 5EI6A 4M7IA 2NRYA 3IOPA 2IJMA 3QWJA 3CBLA 3DXPA 2WQEA 5FP5A 4LOQA 2ERZE 4M84A 2WMSA 2WELA 2DQ7X 2ZMDA 4LGGA 3VC4A 4YUQA 5K0XA 4FEWA 1TQMA 4XG9A 3LQ8A 4O22A 4YR8A 3P7AA 3LFBA 3IQ7A 2WOUA 5D41A 4OBPA 2OIBA 3DZQA 3QTXA 3P86A 2V0DA 3LXLA 2QOIA 3FI3A 2Y0AA 4N70A 4BGGA 2RGPA 4M14A 3RK9A 3BYUA 2JKQA 5CT0A 4EZ3A 4IVDA 2WIHA 2C6MA 3ALNA 4M69A 3ZHPC 3CE3A 4EK5A 2W9FB 3B8RA 3GU8A 4YURA 3GC9A 4KBKA 4UBAA 2XBAA 4RFYA 4E5WA 3LFCA 4DFUA 5AUVA 4XRLA 4Y5HA 1KE8A 3IW4A 5HTIA 4GFMA 5JFXA 3OEFX 3QRKA 1OECA 2J0IA 4FK6A 4GG7A 3WE8A 5KMNA 3S00A 5CSWA 4QTBA 1QPDA 4F0IA 2C6IA 4E4LA 5AAEA 5J5TA 5CU4A 3NUNA 2XIXA 4AOIA 5J5SA 3I6UA 4DGOA 4TRLA 4UZHA 3NAYA 5C03A 4PMPA 2XUUA 3FKNA 5FGKA 4PQNA 1GZOA 3D0EA 3PXYA 4DG3E 4F7LA 2X81A 2VUWA 4F4PA 1Q8WA 1Z9XA 3VQUA 1U54B 3C4CA 3FZOA 4B99A 4QQJA 5G6VA 5EYKA 2VWVA 3C51A 3ETAA 2HOGA 4U79A 4QOXA 3DKCA 3HV4A 3QQJA 1PW2A 4EORA 4FE2A 1KV2A 1LEZA 5AUTA 3DB6A 4QT1A 2FUMA 3EFLA 4C02A 4O0UA 4EL9A 3SV0A 4USDA 2ZJWA 4FV0A 3DGKA 4XX9A 1PYEA 3W16A 3Q6UA 5IUIA 2PVRA 3JVRA 4OTPA 4CSVA 1YXTA 4DEBA 1REKA 1K2PA 3IG7A 3R7GA 4ZEGA 3G5DA 4ZSLA 1H00A 5AIRA 4C58A 4F64A 4GSBA 3SKCA 1CM8A 3LFQA 3QXPA 5AJQA 1A06A 4QTCA 5DN3A 2ITXA 4DGMA 5HNIX 3T3VA 3VJNA 2I40A 3KVWA 3BHTA 4EUUA 4Y8DA 4RWKA 3IOKA 3D7TA 4NW6A 3DQXA 4L01A 2WMWA 2WMUA 5GZ8A 5CU6A 1GAGA 2R3MA 4AZSA 4QNAA 4V04A 1K9AA 3UZTA 4R7HA 3BWFA 5IISA 3TZ7A 5LXMA 3VUKA 4C4JA 5K0KA 4N6YA 2EVAA 4H58A 4XMOA 3H4JA 4R7IA 3CR0A 2FO0A 2W1EA 1WBSA 2H9VA 4YLJA 1SVGA 3F9NA 1W7HA 2R3GA 4O83A 3OWKA 4KIQA 5DRBA 4YP8A 3GQIA 1G3NA 3HYHA 3K3JA 3NPCA 4Z55A 2CPKE 4FSUA 4BIEA 4U45A 4G5PA 4RWLA 3CS9A 4YHTA 3DK3A 3AD4A 4QMOA 3TDVA 3DK7A 3I0QA 3UYSA 2QO7A 3FQEA 2PL0A 4BDGA 4JRNA 1Y91A 3HMOA 3NDMA 4C4IA 4EOIA 1DI9A 1Q4LA 4QYYA 3BEGA 3GU4A 3FZSA 5ANIA 2F49A 3UQFA 1I09A 3SOAA 5IQFA 4JDKA 3QD2B 5GIPE 3OBGA 3KMWA 4ZTRA 4MH7A 4G9RA 3P23A 1E9HA 3VUHA 5AM7A 3A4PA 5T68A 4Y73A 3GNIB 5ICPA 3D7ZA 4JQ7A 4RIXA 3Q2JA 2Y6OA 2UW5A 2HK5A 5E1EA 1A9UA 3VBQA 1ZOHA 3IKAA 5H8GA 3SX9A 3FXWA 2YHVA 3C1XA 4A4OA 5J9YA 2P4IA 5E4HA 4RX8A 5GNKA 2VU3A 3ZZEA 1SNUA 4N57A 4FTOA 3R30A 1V1KA 2ITPA 2X7OA 4FV2A 3RWPA 4GUBA 4OT5A 1T46A 4KBCA 5ANKA 3D94A 4GIHA 3BPRA 5EDQA 5HESA 5KCVA 3PP0A 4DE4A 4HPUE 4X6QC 3R9HA 4X2GA 4I41A 4PL4A 4E1ZA 3E8CA 1H1PA 4O2PA 5L2QA 4FL2A 3TIZA 3DKOA 4UMRA 3VW8A 3R00A 4ASXA 3HNGA 3RK5A 4JIAA 3HV3A 4TYJA 4ZZNA 4A4XA 1FBNA 3C4ZA 4GVJA 3SXSA 2CKQA 4W8DA 4F9AA 2Z60A 4EOJA 5LMKC 1NT2A 3ZH8A 3NNUA 1H8FA 3PA4A 3VS0A 1GOLA 3KL8A 3FMHA 4KS7A 3WIGA 4EBWA 1Q62A 4JLCA 3KRXA 4XP3A 5AX3A 1OMWA 2PVFA 3FSFA 4ASZA 1Q3DA 3UO4A 2BZJA 3ZFMA 4M67A 5H2UA 4QMUA 4HCUA 3Q9XA 3LXKA 3OXZA 2Y8OA 1H26A 4XG8A 4EH7A 5JQ8A 3FC2A 4K9YA 4WG4A 3UDBA 3NVKI 4XJ0A 3C5IA 2J9MA 4FVPA 4EOLA 2BROA 4GJ3A 3L8PA 2WOTA 3EN9A 3W8LA 4L67A 4S31A 1G8AA 2X8IA 3QTIA 3NCGA 4FTAA 3UPZA 3K3IA 4BCFA 4YU2A 4GK4A 3GCVA 3AMBA 3TJCA 4XLIA 3TEIA 4IEBA 4E8AA 2P55A 4KIKB 3FPQA 2KULA 4LI5A 5AR5A 4O7WA 4HVGA 1W98A 3ZSHA 5IA3A 4IXPA 5A54A 1BI8A 2QNJA 3O8UA 4CG8A 4APPA 3QQKA 5E90A 4MXCA 2GHGA 5A9UA 5BUIA 2X6EA 4QMXA 2VN9A 4W4VA 4JG7A 5AUYA 2WQMA 4XBRA 1WAKA 4ORKA 3QC9A 4A9YA 5IPJA 2QOHA 4O0YA 3VW6A 4G34A 3ANRA 2XK3A 4LYNA 4YZDA 4FSRA 5AP7A 3KY2A 5FLFA 4K11A 1ZZ2A 2C5OA 2PZ5A 1LP4A 4ALWA 3DY7A 3HMNA 1IR3A 4O27B 3MVMA 3NNWA 5LWMA 2ZDTA 5C8MA 3I7BA 1NVQA 4YZ9A 1YWNA 3FMMA 3ZS5A 4A9SA 2VWZA 2Z7LA 3AD6A 2OXDA 3QCSA 4OLIA 2GQRA 3KFAA 2XCKA 3VBXA 1K3AA 3PJ8A 4P7EA 1PF8A 4RC4A 2R3RA 3TUDA 5IA2A 2YEXA 4CXAA 3R1SA 4CFUA 5C8KA 4AA5A 5H9BA 3KRLA 4BICA 2WEIA 3BU6A 2VTIA 3NNVA 3UG1A 2ETMA 2OZAA 2WAJA 2XEZA 4FKWA 4JAJA 4MNEB 3DS6A 2OK1A 5KE0A 4BI1A 5DI1A 2JD5A 5E91A 2RFSA 5KZIA 4LGDA 3VBYA 3RBWA 5FDXA 3P08A 4E6QA 4YBKA 2YM3A 4PTEA 5DRDA 5CSHA 3PJ3A 5HU9A 4U40A 2YITA 3Q9YA 2BDFA 4EUTA 2WTJA 3PPZA 1PMUA 1RE8A 3HV6A 4R6VA 2PY3A 4K0YA 2O3PA 3EYHA 4RC2A 2UZUE 4J7BA 4IDVA 3ULZA 3S1HA 1PMNA 2VTMA 2ZB0A 4FICA 5IA5A 5ACKA 3U54A 2F7EE 3F2NA 4AA4A 3MFSA 2YM7A 3ORKA 4B9DA 4EK3A 5BNJA 1NA7A 1HCLA 4KKGA 5AP0A 3KXNA 1O9UA 3OT8A 5EG3A 3NUAA 5M06A 2X2KA 1ZRZA 4GYIA 4WNOA 4D4YA 2JDTA 1F0QA 1J3HA 4HW7A 2JIUA 4H3BA 2WKMA 3MSSA 4HVHA 2DUVA 4NJ3A 1W83A 4QMYA 5ETAA 3GC0A 4FG7A 3MJ1A 1IEPA 2OJIA 2XNNA 3PUPA 1PJKA 4W9XA 4X3FB 3KXXA 4J71A 4OTGA 4U0IA 3UOKA 4AW0A 4ZLYA 4AAAA 4RVKA 3ZSIA 2JC6A 4X6RA 3F69A 5TR6A 2E9NA 3NWWA 1H0WA 2QHNA 3CIKA 4MXAA 4RX5A 2UW7A 5J7HA 5AA9A 1QPCA 1Z5MA 3A61A 3A7JA 2C6OA 2ETKA 3LKMA 1R3CA 3ZC6A 4A9TA 3QBNA 1H25A 4TWPA 4RG0A 2IVSA 4CEGA 4HGLA 4QPSA 4QYFA 4HYSA 4HNIA 3GU6A 3HV5A 4IAFA 3KU2A 2R3NA 5HE3A 3VUGA 4CFMA 4MCVA 3P1AA 3C5UA 4R5SA 3LCKA 2C3JA 2R3PA 5HVJA 4ANSA 1YDTE 3MGYA 2XA4A 4NSTA 2E2BA 1Q5KA 2OSCA 2X4ZA 4M15A 4TNBA 2VO7A 3VRYA 3PVBA 2QOCA 2QOFA 3AGLA 3KXZA 5LWNA 4RJ8A 3ZDUA 4C4EA 3MS9A 3SW7A 3R04A 2QODA 4ITIA 2UZEA 4EOQA 1OIQA 2EU9A 5EHOA 4AA0A 4LOOA 1PXOA 2OGVA 1DAYA 4WUNA 4D0XA 5IQEA 4I0TA 2R2PA 3BZ3A 4D0WA 5IDNA 4CT2A 1YWRA 3R83A 1GZ8A 3EMGA 5JFWA 4W9WA 1URWA 3GI3A 4BDHA 2PWLA 4CLJA 1BL6A 1MUOA 3FWQA 3R6XA 1LUFA 2DS1A 3TUBA 3DJ7A 4FV4A 4F7SA 2VNYA 3FKLA 4YJUA 4D2WA 5M56A 4OBOA 4OTWA 2R7BA 2F57A 4P5QA 4BN1A 3PIXA 3THBA 1Q8YA 3EN6A 4C4FA 5JK3A 5KMIA 5HVKA 4QO9A 2BFXA 4NCTA 1GJOA 3PJ2A 2G2FA 2I0EA 4YSMA 4RGJA 3NS9A 4ERKA 1JBPE 3WZKA 1BUHA 2C5NA 2WTKC 3FQHA 1UKIA 4MXYA 3A8XA 2W5BA 5M53A 4RJ5A 2QG7A 3QCXA 4L00A 5TKDA 4E4NA 1STCE 3NVMB 4S30A 4DF3A 2GQSA 4YJTA 1ZMUA 2CN8A 2GNLA 3OCSA 4EK6A 2E9OA 4IX6A 2GU8A 4HNFA 4CNHA 5C9CA 3OTVA 4IVCA 4WBBB 4FIGA 2VO3A 3V5PA 5E8XA 3PLSA 3FMJA 4FEQA 3L1SA 4PMTA 5IU2A 3QQFA 2CGVA 2UV2A 2YDJA 3PVGA 5D9HA 5HNBA 4ZK5A 3UP2A 4AT5A 2EXCX 2YCQA 1IAJA 1ERKA 3ZZWA 3EQBA 4QP7A 3M2WA 2J2IB 3UMXA 3EWHA 4AG8A 3CSVA 3N4TA 5CEMA 4IH8A 2UVZA 3PDTA 5FTGA 3GT8A 3TL8A 2W5AA 4PDSA 5HD7A 2B9JA 3M42A 4I6QA 3G90X 5HLNA 3VHEA 1JKKA 3AC3A 2B9FA 2G2IA 3QRJA 4F0GA 4FTUA 4C38A 4L9IA 4FTTA 4CYIA 3PXKA 3OROA 1XWSA 3SLSA 1G5SA 2XVDA 5I3OA 4BB4A 2PMNX 3BYSA 4EWQA 4ZIMA 4J98A 3R8ZA 2IO6A 4ANQA 2J0LA 4X2NA 4CLIA 4JBPA 4NJDA 3T9IA 4D2PA 4YSJA 4GKHA 3D2IA 2YIRA 2OJ9A 5EK7A 1M2PA 4JDHA 4HZSA 5AV0A 1OKWA 3BRBA 4YNEA 2C5XA 2HWOA 4MTAA 3OUKA 4O0TA 3VULA 4EHVA 4F6UA 5A6OA 1KSWA 2X0GA 4EOPA 4FTMA 3A4OX 4HVDA 5LJJA 3N51A 5AR3A 4N4SA 4OUCA 5CAQA 4B8MA 4GK2A 5HE0A 1OL5A 4BI2A 5BVOA 3DA6A 3R0TA 5EM8A 3F7WA 3RNIA 3UP7A 4EQCA 4Y46A 1Y57A 4GW8A 5C26A 5HZNA 4PTGA 4FG9A 1MRVA 5A3XA 4C3PA 3EZVA 3V3VA 4DA5A 2W1IA 2O2UA 1FPUA 4ZY5A 3FHRA 3PIYA 3S4QA 2ERKA 4RBLA 2WMAA 4FR4A 4B4LA 4ANOA 5L2IA 1WZYA 1AQ1A 1PXKA 2R3KA 3T9TA 2B9IA 3JS2A 1Q97A 3BHHA 4I92A 5BVDA 4BIDA 2WMVA 1Y8GA 3BYOA 2V7AA 1J7IA 2HENA 4W4XA 2PVKA 4FIIA 4PPCA 4U43A 3R9NA 5M08A 4RC3A 2ETRA 4NIFB 5E8YA 3TZ9A 3UC4A 5L8LA 3ORNA 3AT4A 3SRVB 2SRCA 4PPBA 3PSBA 4XEYA 2VX0A 4MF0A 4ZY6A 5I9WA 2X6DA 4IWOA 3MWUA 4EWHA 5CAUA 2CCIA 1RQQA 1UU8A 2EB3A 3GFEA 4X7QA 3WOWA 4J95A 4L8MA 3FY0A 3MA6A 4IWPA 2ZV7A 4O96A 3DQWA 3LQ5A 5EYDA 5LVOA 4UX9A 4O7RA 4EBVA 4U42A 2PYWA 5HIBA 4YJQA 2BUJA 2ONLC 4EI4A 2RFEA 2IW9A 4M8TA 4TWCA 3PVWA 1MQBA 4BCIA 2R0UA 3KN6A 2QU5A 5KMOA 1XH6A 5ANDA 4DFNA 2R3LA 4BVUA 4MX9A 4AFJA 5M4CA 2CSNA 1UV5A 4TPTA 2WGJA 2YDIA 2ZV8A 4JIKA 5E8WA 2LAVA 2OO8X 3D5XA 4LQMA 4E93A 4D5HA 3CJGA 5KBRA 4PMMA 5ETIA 1XH5A 1H07A 1ZARA 3WBLA 3GCSA 4PNIA 4DC2A 5DEYA 4AXAA 5L2TA 4NU1A 2AC5A 4AW1A 2XK4A 4BF2A 5JH6A 4MYGA 3BV2A 2G01A 2BZKB 2GCDA 2FH9A 4RJ6A 3V5QA 5I0BA 3C7QA 4CRSA 4EZ5A 1ZYLA 4DCAA 1XH4A 4XNEA 4FNYA 4RJ3A 5G1XA 5DBXA 3I4BA 4QP1A 4EKKA 5BYYA 3QRTA 4IB5A 3V5LA 3ZO2A 5JZJA 2NNWB 5DPVA 1U59A 1ZMVA 3RPOA 4AWIA 4F6WA 2XYUA 3O8TA 3BGQA 5KO1A 4O7NA 4YJNA 3IPHA 4BCOA 2YM6A 2NO3A 2PK9A 3WZDA 2UZDA 2XK7A 3LCDA 3U4WA 4O7SA 1H28A 3BX5A 3QA0A 3E8DA 5DH3A 3F5XA 3A99A 2ITVA 4YZNA 4EOOA 3L9MA 4WA9A 3DZOA 3U4UA 5GZAA 1OITA 5IF1A 5HCYA 3TKIA 4FSNA 4RIYA 4O1OA 5LCJA 2A0CX 3GENA 2BZHB 4WKQA 3RZFA 3Q5IA 4FEUA 2C0IA 4I4EA 4ANLA 4Z7HA 5HEZA 3MH1A 4FTRA 4H3PA 4YNOA 5GJGA 2I7QA 2RFNA 4EH3A 4BDEA 3WF6A 3SGCA 4UV0A 5M55A 5AR8A 3WILA 5KHWA 1ZYJA 3PE2A 3BU5A 4FIHA 2O65A 2Z7SA 3FQSA 2X4FA 3PXRA 1YDSE 4MBLA 5JZNA 5A4TA 3QHWA 5L6OA 1XJDA 2B53A 4FZDB 1JSUA 1CKPA 3PSCA 4OTDA 1KE6A 1A48A 4NK9A 4C62A 1VR2A 3ULIA 3CGFA 4IAIA 1OVEA 1WBWA 1W82A 4OTRA 4EK8A 4G3DA 4WSYA 5EQYA 2FSTX 2R3OA 3UIMA 4D4RA 1LEWA 1CMKE 4YC3A 2G9XA 5CU2A 5AAGA 1GNGA 3A2CA 3R02A 1IA8A 3MVJA 4BL1A 4HCTA 3LMIA 4DH3A 3SG9A 2W1HA 2YIQA 4ZY4A 3IDCA 3ODYX 3A62A 5CVGA 4AZTA 3RPVA 2OLCA 2PU8A 2B7AA 3SW4A 3LFEA 4FKRA 3L8VA 3QLGA 2OJJA 4RRVA 5KKRC 2CLXA 2HZ0A 1BMKA 4L42A 2WMQA 4AQCA 3IGGA 3CCNA 3QD3A 2GSFA 2P2HA 2XKDA 2YAAA 3RZBA 4RFZA 4DFYA 4C57A 3CPCA 4GT3A 3HA8A 2XIRA 2ITZA 3QKKA 4Z9LA 5LOHA 3F5GA 4GEOA 2F9GA 3FSKA 5HICA 3VS2A 4AW5A 4RIWB 3BCEA 5BVNA 3AC2A 4M12A 2CGUA 3ENHA 5EW9A 4BDAA 5IQCA 3MESA 4J99A 3E5AA 4ASEA 4DFLA 4RLLA 3KULB 4V0GB 3PVUA 4NYEA 2RF9A 4UXLA 3U6JA 3FI2A 1B6CB 3O7LB 3W8QA 1KE9A 4F09A 3B2WA 3PY1A 4BTKA 2W7XA 3MY1A 4NZWB 4K2RA 4OTHA 5IKWA 4USEA 1AD5A 2JDVA 2UZNA 1JKLA 3FMEA 3I5NA 4GCJA 4J53A 4PY1A 4RVMA 5FD2A 5CEKA 5CX9A 2R3JA 4XH6A 5CXHA 4XP2A 4IC7A 4AN9A 4RVLA 5F4NA 5AUXA 3R71A 3IS5A 3LHJA 3VS7A 2YIXA 3GC8A 4YTIA 4DGLC 4KUJA 5HNGA 5JN2A 1KE7A 3TDWA 4S32A 2ZAZA 4FIEA 1OUKA 5FBNC 5E8UA 5M09A 5K5XA 1VJYA 1JSTA 1YI3A 3R22A 3MW1A 3O0GA 4XG7A 2QCSA 4C4HA 2R3QA 4NFNA 3VJOA 4ITJA 4ZZMA 2GQGA 2CMWA 5HKMA 4P2KA 4CFNA 2QKWB 4S2ZA 4Z16A 3OXTA 3TUCA 1PMVA 4QRCA 4DHFA 3CPBA 4ASDA 2H8HA 3PWYA 5AP1A 3CY3A 5KHXA 3BEAA 4FSQA 3EQPA 3WF5A 4BYIA 1W0XC 3IW7A 4ACCA 4NH1A 5AMNA 2XS0A 2OI4X 4BCNA 3AC8A 3UOHA 4G1WA 4ALVA 3CD3A 4IHPA 5LCKA 3QYZA 2CN5A 4FKVA 5KMKA 3EOCA 2OBJA 3ZLXA 2WFYA 4BC6A 3P79A 5FEEA 2CJMA 5IUGA 2UW0A 1M7QA 1P4FA 5B2KA 5A4EA 2YAKA 3RM7A 4JBOA 3HP2A 2V7OA 4FIFA 2YM8A 5ANOA 1U4DA 5CY3A 3UNJA 5IQAA 3NAXA 2QO2A 2XNMA 3Q4CA 2Y9QA 4TYIA 1L8TA 3A8WA 4AF3A 4HVIA 3POZA 3HRFA 5AA8A 1JAMA 1IG1A 4DFBA 4IJPA 2WNTA 3ANQA 3REPA 4NM3A 2UZLA 5JRSA 1KUTA 3KK8A 3F2AA 4ZJIA 4AZEA 3DB8A 3JY9A 3KMMA 1OBDA 2WMXA 3I0OA 4I94A 3NR9A 4AACA 3UQGA 2C6KA 1WCCA 4BGHA 4ZAUA 4D9UA 3C4XA 4Y72A 2VTJA 4QPAA 4BBEA 4IB3A 3F61A 1J1BA 4F65A 3PLAE 3M11A 4DEDA 2HELA 3ET7A 4FOBA 5I9UA 4LUDA 3C0IA 3R28A 1XR1A 3R1QA 3RALA 3QHRA 2WMBA 3KN5A 1PXMA 2VWYA 4F08A 4CRLA 4A06A 3F66A 3R7VA 3F3ZA 2YISA 4JR7A 4UY9A 4H1JA 3GC7A 1JSVA 4QTAA 4D28A 4E26A 1G8SA 3MA3A 3UTOA 2FVDA 4RMZA 2UZVA 4FV7A 4G16A 2CNUA 3PY0A 5I9VA 2PVYA 3VF9A 2QOKA 3E64A 4X3JA 3H0ZA 1Q24A 3QQLA 3OT3A 2BR1A 3RVGA 1JOWB 4KBAA 3LFDA 4MWHA 4R3RA 5K4IA 3QRIA 1OL6A 2W96B 3FAAA 4CTBA 3C4FA 3Q9WA 2QC6A 3OMVA 3WI6A 2ZDUA 4U8ZA 2OFVA 1WBOA 1R0PA 1YOMA 2UW4A 2VTNA 3QUDA 5AR2A 4C61A 2GHLA 3NIZA 1SNXA 3Q4TA 3IDBA 4I22A 1UA2A 3R7YA 5A46A 5FDPA 5K4JA 5CEPA 3BGPA 4EHZA 4U41A 2OIDA 3UQCA 2I6LA 3FLYA 2GDOA 3FZ1A 3MDYA 4AP7A 4H36A 4TTHB 1Q3WA 4BCMA 3AC1A 4FVQA 2BILB 3DFCB 3NYXA 3QQUA 1B38A 3NSZA 3OW4A 4FEVA 3IW5A 5I9YA 4C59A 1OL7A 4EH9A 3KRRA 1S9IA 4W8EA 5DWRA 4FEXA 3DDPA 4MKCA 3SD0A 2CHLA 1P2AA 2W5HA 2JKMA 4RA4A 5AP5A 5AP4A 3RINA 5CI6A 5KMJA 4JOAA 1ZWSA 1MP8A 1SMHA 1X8BA 2JEDA 4L6QA 4FNXA 5EHLA 4OTIA 3O96A 3DKGA 4NIFA 2VO6A 2Q0BA 4KKEA 2VTLA 2XYNA 4TW9A 2YABA 5L8KA 4B0GA 2QKRA 3V8SA 2XEYA 3OWJA 2OF2A 4PRJA 5IA4A 2PSQA 4AN2A 4UWYA 3GP0A 3DTCA 4EHEA 4Y95A 5DR2A 3W2PA 4L53A 4LRJA 4EHGA 4PX6A 1T45A 4FV6A 4BDDA 4G2FA 2PUUA 3MPMA 3OCTA 3ZC5A 3ENMA 3VNTA 4FGBA 1JWHA 4RX7A 5IQDA 3IW8A 4YMJA 2W17A 2V5QA 3Q32A 4FNZA 4BDCA 5DFPA 5AP3A 2PUPA 3EJ1A 3H9FA 4F63A 2GPHA 1R78A 2B52A 4U3YA 5F95A 2BRGA 4FZ6A 4IFCA 3VF8A 1XH8A 3VS6A 3NGAA 3Q5ZA 3E92A 2O63A 3CTJA 4Q9SA 4RWIA 3HUCA 4XG2A 5AV1A 3LIJA 3Q2MA 5FWKK 3OTUA 5AV2A 3RKBA 3UIUA 5KNJA 4JJRA 1FGIA 4TYGA 2P33A 2G15A 2UW6A 2VTRA 5F94A 3V51A 4BZOA 5HO6A 1OGUA 2C5VA 3HMMA 4E5BA 5M07A 3NUUA 5CSPA 4XUFA 2JDOA 1F5QA 2BRHA 2HAKA 2OXXA 2XNGA 3ALOA 4DGGA 5IA1A 3V5TA 4PTCA 3UC3A 5I5ZA 1KWPA 2BTSA 3NYVA 3SVVA 4JR3A 4W4YA 5TO8A 2GNIA 2RFDA 4ZTSA 3ZFYA 2YDKA 4F6SA 1ATPE 5CF8A 5A4CA 3WZJA 4TWOA 2B1PA 1YW2A 3QTZA 3VAPA 4E4MA 2XK9A 2BAKA 1VYZA 3RJCA 4R77A 4HOKA 4KRDA 2C69A 2BALA 5CAOA 4EJ7A 2PVJA 2WD1A 4KNBA 1MRUA 5FXSA 5HVYA 2C6DA 3NMUF 2XRWA 4F1MA 3CQWA 4R8QA 3PY3A 4C2VA 2JDSA 4HGEA 2R64A 5CXZA 2PUNA 4IMYA 2UVXA 4LMNA 2UZTA 2WIPA 2XNPA 4WRSA 5EDRA 3W55A 4AX8A 5EQPA 4BCQA 3S3IA 4NL0A 1JQHA 4ZMEA 4BGQA 2UZOA 4QNYA 3TNHA 4AUAA 4NKSA 4WG3A 3ZRMA 5DA3A 4J96A 3FHIA 4DEHA 5A4QA 1WVWA 2JAMA 2XBJA 4L7FA 2E9PA 2VWIA 4I3ZA 2QOBA 3GBZA 4UMUA 4OAUC 3BI6A 4I1ZA 4D1ZA 2BAQA 4TXCA 4RPVA 2A2AA 4WBOA 4A07A 1V0OA 4FKOA 5HG9A 4CCUA 4DLIA 5EM6A 3KF7A 3MN3A 2BIKB 4IAYA 5F1ZA 4I6FA 2GS7A 3FLSA 4JL9A 3F3WA 4FIJA 2WB8A 4BKZA 2W1GA 3EN4A 3BQRA 4AZFA 4MAOA 2QU6A 4YPSA 5HU3A 3DLSA 4TNDA 4WHZA 2WTDA 4O82A 5IQIA 4YLLA 4R5YA 4YC8A 4BWKA 3Q04A 3R9RA 3FYKX 4GRBA 4GU9A 4G6NA 5LARA 4I20A 3GCQA 3BE9A 4LOPA 1BX6A 3OOMA 5C1QB 4GFGA 4E5AX 3BIZA 4KKHA 4KRCA 5EOLA 3Q60A 1TQPA 5BVWA 3DNDA 4C7TA 4UB7A 5CASA 5EQEA 4ZTHA 3F5PA 3HX4A 4EQUA 4ZLZA 2P0CA 3DTWA 5HBJA 5TT7A 1OZ1A 4DEGA 4ACMA 3G9LX 4LV8A 3PE1A 4O84A 4IZ7A 1RDQE 2XNOA 4E20A 4L43A 1YDRE 3NUYA 4WOVA 5HORA 3CGOA 4AGUA 2YJRA 3F3TA 5CAPA 3MJ2A 4TKSA 1YHSA 3WYXA 1BKXA 3KGAA 3R9DA 3T3UA 4MF1A 1APME 4C3FA 3Q6WA 3MTLA 3GEQA 5AWMA 4YJOA 1KOAA 3CD8A 5CF5A 5DR6A 5EI2A 2X2MA 5DYJA 3A7IA 3NLBA 3ZONA 3GVUA 4I6HA 2OICA 1IRKA 2JBPA 4V0GA 1XKKA 3LLTA 4BTFA 3ATTA 3FPMA 2EXEA 4IW0A 2W1CA 4XLVA 3R8MA 3TNQB 2CKEA 5FEQA 2Z7RA 4QQTA 2QI8A 5J79A 2F7ZE 4GKIA 2QVSE 3UG2A 5LVPA 2CGXA 5CANA 4QTEA 4QMPA 2OJFE 4JBVA 3ZEPA 2BHEA 3R2YA 4KIOA 2JIIA 4F99A 3UODA 5IEYA 3P5KA 3HAVA 5HO7A 4R3CA 3R73A 4E7WA 4CKRA 4O2ZA 3O17A 4OTFA 5KX8A 4RSSA 4BCPA 3ZBFA 1NXKA 5HE1A 1KE5A 4NCTC 4J8MA 3ZCLA 4EQMA 3BU3A 3D5UA 3DKFA 3PIZA 3UVQA 3AG9A 1U46A 2I0HA 3C13A 4JG6A 5EFQA 3KF4A 3PPKA 4YJVA 3QUPA 5AM6A 4QMQA 3TTJA 3UZRA 5HI2A 1XH7A 3BHVA 5C4KA 3GGFA 1YWVA 2OFUA 5KKRB 3LJ1A 4YZMA 4FSYA 3ZSGA 2PZIA 1U54A 3MPAA 2HXLA 4MQ2A 3EZRA 2ZOQA 3EIDA 3UMWA 5CAVA 5JGAA 4CV9A 4HVSA 1FGKA 2J90A 3E8NA 4GU6A 5D12A 1TQIA 5D7VA 5IQBA 3L9PA 5EDPA 4O0RA 1PRYA 1PXJA 4QYEA 4IB1A 3O2MA 4ZP5A 1QPEA 2J51A 5CYIA 3G51A 3KKVA 3OCBA 5AX9A 5M57A 3GQLA 1L3RE 2AYPA 2IW6A 3GOKA 4YZBA 4DITA 2X7GA 3KRWA 4IB0A 1WBVA 3RPYA 3PRFA 4P90A 3E87A 3VUIA 1U5QA 3ATSA 4UEUA 5CS6A 4F0FA 3D15A 3H10A 4IE9A 5D11A 3GOPA 2PMIA 3EQIA 2ITYA 3ACKA 5ETCA 3VO3A 1ZOEA 4AE9A 5HOAA 4XG4A 5I4NA 5LMBA 4I93A 2XF0A 2I1MA 5CNOA 4E6CA 2GFSA 2QHMA 3AOXA 1ZOGA 2XJ1A 2ZM3A 4MD8E 2C6LA 2WMRA 3R7IA 1QPJA 1XBBA 2W1FA 1P5EA 2CDZA 2GNJA 4PDOA 4XOZA 5TE0A 3RAIA 3NUPA 1P4OA 2A1AB 3P9JA 4O1PA 4FL1A 3R8PA 4ACDA 2W1ZA 3MPTA 4DFZE 3LZBA 3H30A 3W33A 3EQFA 3JXWA 5HO8A 2X39A 2PVHA 1UVRA 1R39A 3MY0A 3RWQA 3LMHA 2XM8A 4FKQA 3CEKA 3RI1A 4FTKA 4M97A 4LG4A 4D2RA 4G3EA 2Y6MA 4XCUA 2XZSA 2W9ZB 5BPYA 3LXNA 2J0JA 5J1WA 4I23A 4DG2E 4TZRA 4BWXA 3N9XA 3KQ7A 2IPXA 3TNWA 3VS5A 3ITZA 4A9RA 3CJFA 5DE2A 2OF4A 1UNLA 3FZTA 4HYUA 4IJ9A 4KS8A 5E8ZA 3V8TA 5F20A 2FA2A 3U9NA 4IWDA 3LFFA 2GTNA 4QP3A 5BVKA 3I5ZA 1FVVA 2VTAA 3ODZX 4QMWA 3BBTB 5DLSA 5JGBA 3F5UA 2BDWA 4FZFB 3D4QA 3SHEA 5CVFA 4EH6A 1BYGA 3DK6A 2GS6A 2VTQA 3EQRA 3OOGA 4JVGA 2C3LA 5LVNA 4BCHA 4YTCA 3ZXTA 1H1RA 4QP4A 4FUYA 1YHVA 2F2CB 4FT3A 2F7XE 4A4LA 3F2RA 4PL5A 1SM2A 3V5WA 4EYMA 3B2TA 2PULA 3LQ3A 5AAFA 2W1DA 5IA0A 3NUXA 1URCA 5HX6A 3G6GA 4RVTA 3HDNA 3C0HA 2PE2A 5EYCA 4W4WA 5EYMA 5CVHA 4BTJA 3LFSA 2O0UA 2YCRA 2QR7A 1YI4A 5HBEA 1ND4A 4EC9A 3QUEA 3PA5A 4NUSA 4BKYA 4IM3A 5T6KA 4K6ZA 2V55A 1H1QA 3QGYA 3OWLA 3DT1A 4HGSA 4F9CA 5HX8A 3ZU7A 3R7UA 4FSZA 4G3FA 4L3PA 1NVRA 1J7LA 1WVYA 3TKHA 3LW0A 4RQKA 3ZLSA 3ZYAA 3PPJA 1QMZA 4XV1A 4AGWA 3W2OA 1UU9A 3MBLA 4RIXB 5CSXA 3UVPA 2XCHA 5T3QA 4U6RA 4I21A 3ZUVA 2BFYA 5FXQA 2RG6A 2ACXA 5B0XA 4ZJJA 3QRUA 3O8PA 2FSLX 3VUDA 1GIHA 4JG8A 2EB2A 5DT0A 2OJGA 2B54A 1MRYA 4Q5EA 2ZM1A 1SVEA 2GHMA 3DBQA 2QO9A 4U9AA 5HGIA 3A7FA 4CV8A 4ZLOA 3G0FA 4PP9A 4L52A 4AZWA 3VUTA 4C2WA 2PMLX 3UIXA 3BQCA 3RHXA 2VO0A 3CXWA 3DOGA 4UYAA 5EKNA 3DBEA 3WARA 1WBPA 2HY81 2YN8A 4CYJA 4UYNA 5CT7A 3PG3A 5L6WL 3BHUA 3RCDA 2VTSA 3MB6A 2BZIB 3TN8A 4D5KA 4BI0A 4ZTLA 3D14A 4ZTQA 3Q3BA 2WQNA 3V04A 3MIAA 4DH5A 4GT4A 4H1MA 3QKLA 3TWJA 4BDJA 2QQ7A 3LM0A 5C27A 5DEWA 4P4CA 5C4LA 1VEBA 3ZO1A 4PMSA 3E62A 3TZ8A 3VS4A 4KIKA 4FBXA 4IM2A 4DT8A 1MQ4A 2A19B 3LFNA 4BCGA 4O7LA 4S34A 5BVFA 4EH2A 1H1SA 5FXRA 4QMTA 5J7BA 3KXGA 5E8VA 3C50A 2J7TA 5FBOA 4GH2A 5CF6A 4YJSA 5E92A 3EHAA 1R1WA 5EW3A 1Q8UA 4DFXE 3R8VA 5GIOE 4ITHA 3C4WA 4CZUA 4X2KA 3PA3A 2KTYA 4L44A 4ANNA 3L9NA 3U87A 1REJA 4IADA 4O86A 3KMUA 3ZUUA 5FTOA 3U6IA 4WIHA 3COHA 1KV1A 5AEPA 4FV1A 3QYWA 3QGWA 2VX3A 4Q5HA 4D2VA 2JBOA 3MVLA 3NEWA 4Q2AA 3BV3A 4D9TA 5JEBA 2YCFA 3QF9A 3HKOA 1BI7A 2J6MA 1GZKA 3LXPA 2REIA 3OFMA 2OW3A 3GFWA 5JFVA 4RWJA 1ZLTA 2YIWA 4MXZA 4NM0A 2WPAA 1CSNA 4FL3A 2CKPA 2ZV9A 4DGNA 3E7OA 4X2JA 3BLHA 2W05A 3DLZA 4AU8A 3ZRLA 1XHAA 3LOKA 4FSWA 1SVHA 5FRIA 3WYYA 3EL7A 4RLKA 2AC3A 3BE2A 5H3QA 3II5A 4ONAA 3DPKA 3VN9A 4HYHA 4X21A 3NIEA 4FTNA 4MNEA 2OU7A 2VWUA 1LR4A 3COIA 1H27A 4DT9A 5M4UA 4FV8A 1YRPA 3W2CA 1JKSA 2BRBA 4XYFA 5BVEA 5BQ0A 3GU5A 2IVUA 3MVHA 1S9JA 3FZPA 4RZVA 4BWPA 3V01A 3W1FA 4C8BA 4JX7A 2BKZA 3HA6A 4YO6A 3UNZA 5LQFA 4G9CA 2C30A 2PZRA 4CKIA 3ACJA 2UW8A 3I7CA 2PE1A 3PWDA 4I4FA 4RJ4A 4AOTA 4ZSJA 3HRCA 2UW9A 2JDRA 4FYOA 4QP9A 4LGHA 4XRJA 4FTCA 1ZZLA 4ENYA 1E1VA 5IEXA 4CFVA 3A7HA 2VGPA 3S0OA 2OZAB 4O91A 3HV7A 4C33A 2VV9A 4U5JA 3EH9A 4F7NA 3RCJA 5ANJA 4F7JA 2H34A 3TCPA 3HGKA 3TIYA 3UVRA 4RIOA 3LLAA 2QOLA 5ANGA 4DEAA 4EZ7A 4YC6A 2GMXA 3DCVA 4DEIA 4F1TA 4K8AA 5BX0A 3E88A 2RIOA 1OL2A 4M0YA 4R1YA 2O8YA 2W06A 5HQ0A 5I9XA 3RGFA 3QD4A 3FLZA 4FZ7A 4X3FA 3BKBA 4PNKA 3FLQA 2BCJA 3NW7A 5DHJA 3CQUA 4ZSEA 4D55A 3ID6C 3ZBXA 3LPBA 5AFVA 3TI1A 4FT9A 3OZ6A 4D4SA 3RTPA 3HL7A 1YQJA 5E1SA 4EONA 2QONA 3MYGA 1CTPE 2XIZA 2PE0A 5HG7A 4XV9A 4JNWA 2H96A 3R63A 4XHKB 1YI6A 4YHFA 2WTIA 3VWAA 1YHWA 5CWZA 1O6KA 3KVXA 4KD1A 2VNWA 4WSQA 5IMEA 4BDBA 3VBWA 5BYLA 2IZRA 4DTAA 3QQHA 4Y85A 4BKJA 5JFSA 5HIEA 4WT6A 4BCJA 1IAHA 2YERA 1HCKA 4EJNA 4OBQA 1U5RA 4JDJA 3HEGA 3FE3A 3WE4A 3ROYA 3CC6A 3FBVA 1OKZA 3OHTA 4FV5A 4HPTE 4ID7A 2JFMA 4UN0C 4TYHB 4N6ZA 5B7VA 4U80A 5JSMA 4EH5A 1GIJA 3N4UA 4LMUA 1YVJA 3VVHA 3MIYA 4OTQA 3OD6X 3NCZA 3DFAA 3DXNA 3LCSA 2B55A 2PZYA 4XV2A 4M0ZA 2X9EA 5DNRA 3TZMA 3TT0A 3OG7A 5CQUA 4IIRA 5EM5A 3RP9A 4CFXA 2VTTA 3COMA 3L8SA 4UZDA 4GT5A 4MNFA 1CDKA 2ESMA 5J8IA 3UOJA 3CQEA 2JKKA 2R3HA 2G2HA 4ZS0A 2UUEA 4F1OA 5EOBA 1ZYDA 3RK7A 4FMQA 3CP9A 2ZB1A 3FI4A 1UWJA 3QTRA 4XP0A 5L2SA 4IACA 1F3MC 2PZPA 4UALA 1NVSA 3BYVA 2XB7A 4CQEA 3KB7A 5E8SA 1UU7A 5IZFA 3BGZA 4TYEA 3TV4A 3PXZA 3JR1A 5JGDA 3KEXA 3EKNA 3ZLYA 1WMKA 1PXLA 1ZYCA 4DN5A 2DWBA 1FQ1B 5CEIA 5FUTA 3H3CA 5A14A 4BRXA 4BBMA 1YKRA 3VUMA 2VWWA 1H24A 1Q61A 3PJ1A 4I5CA 2R3FA 2ZM4A 4PUZA 2Y4IC 3A7GA 5EM7A 3CKWA 3AQVA 4MD9E 3DJ6A 3HP5A 3QFVA 4FODA 4DBXA 3QWKA 1AGWA 1IA9A 4L7SA 4I24A 2V62A 1FOTA 3SG8A 3HMPA 5CU0A 4GJ2A 1R0EA 2AUHA 4XBUA 5HCXA 5AV4A 3QXOA 4D1SA 4LL0A 2H6DA 1RJBA 3PFQA 2WTCA 1Q8ZA 3C9WA 3G0EA 3EB0A 1Z57A 3R21A 1W8CA 4HCVA 4LRMA 4J52A 3FXZA 3IONA 3QU0A 4CKJA 2XIKA 2XKEA 3E7VA 4O0XA 5AP2A 4XG6A 2X8DA 4JQEA 5J95A 4BZNA 1QCFA 5L4QA 3D5VA 1TKIA 2JITA 3QD0A 4F70A 3F7ZA 4QYGA 2RL5A 2OKRA 5JMSA 3PZHA 2Z8CA 3MY5A 5ACBC 4WNMA 4K77A 3G9NA 2QOOA 1OB3A 1OL1A 3HLLA 3O50A 4CMUA 2C1BA 4ZSGA 1OBGA 5A6NA 3IK3A 5H8EA 2YZLA 2G1TA 3QTQA 5M4IA 4BY9E 4HYIA 4CFFA 3S95A 3RAKA 2VWBA 5LMAA 4KWPA 5DMZA 3PP1A 2YLEA 4FKUA 4QMSA 1PXPA 2P3GX 4AGDA 3RPSA 2C1AA 3UOLA 4XOYA 4NM5A 3MI9A 4L3JA 2WTKB 4KB8A 2C0TA 4BHZA 3A60A
chains in the Genus database with same CATH superfamily
4HZRA 5KBQA 2C5YA 4QPMA 4AE6A 5CEQA 1NW1A 4YJRA 4H05A 3SXFA 3W32A 2OG8A 3SAYA 3H9OA 2IN6A 2ZYBA 3LJ2A 4FC0A 5FM2A 3U55A 1YOLA 5B2LA 4HJOA 3JUHA 4WG5A 4DCEA 2X1NA 1V0BA 2XM9A 4G6OA 4O0SA 5CI7A 5CALA 2BRNA 4ACHA 5IH6A 4QMLA 2ZVAA 4AGCA 4R3PA 4O0VA 2YACA 3BWJA 3DDQA 4RX9A 3KCFA 3OF0A 2W4JA 3P4KA 4JX3A 4E73A 2PVLA 5AADA 5IUHA 2YLFA 4QYHA 4IC8A 5ANEA 3O51A 3QTUA 4L46A 4JAIA 4PV0A 3GCUA 4WNPA 2FYSA 4H39A 1G8KA 4AFEA 2J5EA 4LV5A 1OPJA 3UGCA 4FNWA 4IAKA 5AR7A 4XV3A 4M3QA 3VQHA 3LE6A 4JXFA 3FC1X 3MB7A 3BLQA 3PZEA 5HG8A 3RHKA 4RJ7A 3SRVA 1Q99A 2UZBA 3QZGA 1EH4A 3TNIA 4Z7GA 3UE4A 3AC5A 2QLQA 3E63A 4WO5A 2J0MB 3PSDA 4K18A 4BTMA 3MH2A 1Q41A 4CMOA 2WQBA 4CQGA 4ZJVA 2YIYA 4EOSA 4FKLA 3HRBA 4JI9A 4V01A 4NKAA 5JKGA 2Y7JA 4ZS4A 2BTRA 2UZWE 3FV8A 3AT3A 2OXYA 4QEBA 2W0JA 1J7UA 3ZM9A 3GCPA 3PG1A 4J97A 2O5KA 4BHNA 3FL4A 2BVAA 5CNNA 4WUAA 2X9FA 3QQGA 3O7LD 2J0KA 1FVRA 4ZSAA 4K33A 4ZZOA 4APCA 2C47A 4O6LA 3RMFA 5K5NA 4IFGA 2OWBA 1M52A 2RKUA 4AW2A 3QCQA 3W2RA 5DIAA 5KMLA 4QMMA 2W99B 3ZLWA 3PXQA 2QURA 3DBCA 3QAME 4G3CA 3ORXA 3PJCA 4KA3A 4FZAB 2HZ4A 3MFRA 3BL9A 1UU3A 5HBHA 2IW8A 3WF9A 2JIVA 4FTQA 4IQ6A 4JT3A 3LAUA 2F2UA 3R2BA 3UO5A 4FUXA 1YOJA 1PYXA 5CEOA 2WMTA 4BR3A 1J1CA 1OIRA 4YZCA 5EW8A 1WVXA 3O71A 4UMTA 3FI8A 4AOJA 3NW6A 2WU6A 4M13A 3HMIA 5CENA 3JVSA 3FMLA 1QL6A 5HD4A 3NX8A 2WZJA 1OKVA 1XH9A 3D2KA 3QA8A 4Z3VA 1O6YA 1PXIA 4YTFA 3U9CA 4X0MA 1XQZA 5LMKA 3NRMA 4CZYB 4LRKA 1ZYSA 4G31A 3HDMA 5M51A 2Q0NA 5M44A 2XP2A 3NUSA 3QL8A 4FKIA 2FSMX 4YLKA 1Q8TA 3G2FA 4JRVA 4N0SA 4FKTA 5M4FA 4ENXA 2WEVA 4F9BA 2XJ0A 4FYNA 2YFXA 2C0OA 1M7NA 2WHBA 3FJQE 3VRZA 3GU7A 3R1NA 4XS2A 4TY1A 5DVRA 4FKSA 3W2SA 4KABA 4O7YA 3FLWA 3AKLA 3ZFXA 3K2LA 4NW5A 4UXQA 2XJ2A 4NFMA 3K54A 3TM0A 2JGZA 3QX4A 2R5TA 2E9VA 4PL3A 1PY5A 3SXRA 3W0MA 1LPUA 2R9SA 3DV3A 3EQDA 4TT7A 3ZRKA 4MBIA 5CLPA 4A7CA 4CFWA 2IF8A 3CKXA 4EKLA 1IASA 3AD5A 4DINA 4ZTMA 3FEGA 4DHJA 2P2IA 3SQQA 3UBDA 4ERWA 3F88A 4C3RA 2HW7A 2JLDA 4NT4A 4GVAA 2YZAA 1WBTA 4MQ1A 3AC4A 2Q83A 4IBMA 4FSMA 2OH0E 3R9OA 4CCBA 3QTSA 3RAWA 1OUYA 4FT0A 4Y83A 4I5PA 3TV7A 3V6RA 3WZUA 4AS0A 2VRXA 5FQDC 4O7VA 5IQHA 2BRMA 4GK3A 4RIYB 2GS2A 3BELA 3MV5A 2J5FA 5JRQA 1OIUA 4IX3A 3OEZA 4I5HA 5BUEA 2XNEA 3MH3A 3OS3A 1GZNA 3FXXA 2YM5A 2CNVA 3NYOA 3QZHA 4LUEA 4LM5A 4U3ZA 4AXFA 4JDIA 2PUIA 3F3VA 4YJPA 3CTQA 4NTSA 2OIQA 5LVLA 3SOCA 4IANA 2BIYA 3AT2A 1YXSA 2C3KA 4NM7A 3C4EA 5DOSA 4FF8A 2B9HA 3P5JC 4WD5A 3W0PA 4HGTA 3R7EA 5ITAA 2NRUA 4TN6A 3ZUTA 4QTDA 5IMXA 4XG3A 3FLNC 4RQVA 4PDYA 4EH8A 3OUNB 4CT1A 1RW8A 3QZIA 4ZOGA 3OC1A 4Q9ZA 3PTGA 4MBJA 2IVTA 4BYJA 2HWPA 2R0IA 3H0YA 3B8QA 2HW6A 4G3GA 4ACGA 4AZVA 4D4VA 2X7FA 5IEVA 4RIWA 2RSVA 3P7CA 3SA0A 3IGOA 1CKJA 3KCKA 2B0QA 2A27A 3COKA 5L6PA 4BCKA 4JQ8A 4C37A 1OPKA 3MFUA 3P7BA 5FG8A 3FUPA 2ZV2A 4F9YA 5IH4A 4DYMA 5GJFA 5KUPA 5IG1A 3JY0A 4I0SA 1DAWA 5BMMA 2HCKA 3KULA 4U97A 5EHYA 4O7TA 3MFTA 1NY3A 2R4BA 4TYHA 3PRIA 4IAZA 4PWNA 4H3QA 3ZM4A 3LCTA 4G17A 3KREA 2BDJA 1O6LA 4ZXTA 2O64A 3H9RA 3HAMA 3EFWA 4FKJA 2ITNA 4C34A 3I79A 2BAJA 2DYLA 2YWPA 1FMKA 1W84A 4II5A 4J1RA 3KA0A 3R8LA 2YWVA 1GIIA 4KSPA 3ZO3A 4P5ZA 3TXOA 1M17A 3ZMMA 5B2MA 4QQ5A 5J1VA 2YM4A 1OIYA 5E9EA 4YTHA 4KINA 4M69B 4MD7E 3I1AA 3G33A 2B4SB 4B8LA 4O0WA 4FSTA 4IDTA 4QMZA 4YGAA 5A4LA 4FG8A 5CSVA 3TV6A 3OCGA 4FX3A 3POOA 4LL5A 5AUUA 2OH4A 4KAOA 4B6LA 3FMNA 5DR9A 3W18A 3T8OA 1BL7A 4F9WA 2NPQA 4MVFA 4YHJA 4OT6A 2CNQA 4JS8A 5AUZA 2ITTA 3UPXA 2RG5A 3PYYA 3Q96A 4FT7A 1OI9A 3D9VA 3EFJA 4PDPA 4WRGA 2R7IA 3DU8A 4EOKA 3O5AA 4I6BA 4YPDA 2UVYA 1JVPP 3ORMA 3P78A 3O23A 2E9UA 3DBDA 4C4GA 2XK8A 5I9ZA 3P0MA 4IM0A 4TL0A 1JKTA 3D5WA 1CKIA 1UKHA 2QOQA 3QZFA 1DI8A 2VD5A 2BKKA 3FZRA 3LVPA 3DAKA 2XH5A 3GXLA 4IVBA 3TTIA 3UJGA 3G6HA 3OW3A 4UWCA 4IZAA 2VAGA 1GY3A 2HIWA 5FM3A 3EQCA 5BUJA 2I0YA 3HECA 4IVAA 2J50A 2XNBA 4LDTA 2VTOA 2BMCA 5EI8A 2PVMA 4DG0E 4AT3A 5ETFA 4DH7A 4D2TA 2IG7A 2I0VA 3M1SA 2GTMA 2WTWA 4M68A 1UWHA 3V5JA 3TACA 2Y4PA 2GNGA 3UYTA 2ITWA 5K3YA 5L8JA 4DTBA 5AR4A 1H1WA 2WO6A 1YXVA 2VTPA 3V6SA 5C8NA 3DAJA 3E3BX 3E8EA 3OP5A 3U51A 4U81A 5J9ZA 4GFOA 4I5MA 5DG5A 5GZ9A 1OPLA 2VTHA 3VBVA 4L68A 2EXMA 4USFA 1KOBA 4OGRA 2X0QA 1YXXA 4FTIA 4RFMA 4GG5A 4DEEA 2HY0A 4QP8A 4D58A 1H4LA 3ZXZA 3DJ5A 3VHKA 3GB2A 4BZDA 5HLWA 2NP8A 4U44A 1JNKA 3D7TB 2R3IA 1FVTA 5TF9A 4AN3A 3DAEA 5HG5A 4IZ5A 4Y5QA 2GNFA 3Q4UA 4MXOA 5D10A 3ZDIA 2Y4IB 1P14A 2X2LA 5F9EA 3Q9ZA 5HTCA 2PPQA 5GINE 2BHHA 4V05A 1M14A 3L8XA 4WNKA 4EK4A 2ITQA 3BLRA 4GMYA 2YCSA 3CY2A 4J8NA 3NW5A 2C6TA 2QR8A 4FTLA 4L3LA 3W10A 2CCHA 2JKOA 3HVCA 4S33A 5EH0A 5CZIA 4CZTA 3K5VA 5AV3A 2HXQA 2QG5A 3ORLA 3W2QA 5I3RA 5GJDA 4UMPA 3NFGB 2CGWA 5D1JA 5AIKA 5LVMA 2C3IB 2VX1A 4U7ZA 1ZXEA 3IO7A 2XKFA 1ZMWA 5CU3A 3PXFA 4FOCA 4EYJA 3EKKA 3DBFA 3SDJA 1JPAA 3EFKA 4E4XA 2XIYA 5DT3A 2X8EA 1TVOA 3WF7A 1UNHA 2WU7A 4ZTNA 2YJSA 4GV1A 2PVNA 3ZO4A 4DAWA 3FDNA 1FINA 4MEDA 5HCZA 3JYAA 2XRUA 1PKGA 3I60A 1DM2A 3I81A 5FTQA 3Q53A 2OZOA 2QLUA 1XBCA 3BHYA 2HYYA 5KMMA 3QCYA 1PHKA 3KXMA 3TJDA 4DTKA 1B39A 4NWMA 4RZWA 4RT7A 3N4VA 4CMTA 4M66A 4QDEA 1Y6BA 1J91A 4CTCA 4TWNA 5AP6A 3QC4A 5E8TA 3BYMA 4OR5A 1ZY4A 3OVVA 4O7ZA 3F82A 3L9LA 3EQHA 4E3CA 3ZEWA 2WXVA 5CZHA 5IH5A 1XO2B 3AGMA 5H8BA 3VS1A 1XBAA 2YA9A 3MH0A 3UZPA 4CG9A 2F4JA 3AMYA 4QMVA 1PMEA 3ORIA 5E7RA 4ANMA 2J4ZA 3MTFA 5JQ5A 4X2FA 1WFCA 3E93A 3KC3A 3G15A 1UNGA 3ROCA 5DT4A 3BBWA 3DNEA 1M2RA 4QQCA 3EYGA 4KIPA 3S2PA 2VZ6A 3Q52A 4CVAA 2IZTA 5C01A 4R1VA 3RAHA 1FMOE 1Y8YA 3QX2A 3U6HA 3TNPC 1SYKA 2HZNA 2LGCA 3HUBA 4FKPA 4FK3A 4F78A 4QD6A 2EWAA 3VIDA 4ALUA 4FVRA 4MK0A 5AUWA 5BV3A 3RPRA 4PP7A 3KXHA 4LV7A 2ZMCA 3EQGA 3WF8A 1WBNA 3VS3A 3K5UA 1YXUA 4O4BB 2UW3A 5CTPA 3EL8A 4MWIA 3R7OA 4O81A 2C6EA 4FT5A 4RA5A 5L3AA 3F6XA 3WIKA 1JLUE 4GS6A 1I44A 2VWXA 2WTVA 3NZ0A 3FMKA 4FV9A 4G5JA 3DXQA 4FGRA 3OY1A 5HIDA 5J87A 2ZFYA 2IWIA 4JBQA 1Y6AA 1V0PA 3UNKA 5IDPA 3KK9A 1SZMA 3QKMA 3R1YA 4O21A 4BDFA 4MHAA 3RNYA 4E6AA 4FKGA 3OBJA 2ITUA 4FI1A 4EOMA 2BPMA 3OY3A 2ONLA 4YBJA 2W4OA 4NEUA 2C4GA 4A9UA 3AXWA 4DLJA 2ITOA 2IVVA 4FV3A 4CGAA 1HOWA 4DBNA 4I0RA 3U8WA 4D1XA 3TKUA 1VYWA 2Z02A 5JT2A 5IQGA 4IX4A 3QALE 5HE2A 4O38A 2IZUA 2PTKA 4AT4A 5CF4A 3ORTA 4PF4A 4ANBA 3FY2A 4GIIA 5EKOA 1PKDA 5K9IA 1H01A 4NTTA 3HZTA 3FYJX 3GUBA 4EC8A 2A4LA 4D2SA 4YO4A 3KRJA 5BMSA 3OXIA 3SC1A 5HTBA 3QLFA 3LCOA 4IX5A 2GNHA 2FGIA 3R8UA 1M2QA 3ZTXA 4OAVB 2XKCA 3VBTA 3I6WA 4G6LA 4C35A 2PHKA 4BDKA 4C0TA 4C36A 4IAAA 4ZMFA 3FL5A 4X3FC 3LM5A 3ORZA 4BFMA 3LJ0A 3OWPA 3EN5A 4GYGA 4ARKA 4MUQA 2JFLA 3AMAA 4IWQA 1H08A 4OW8A 3WZEA 1PXNA 3QTWA 5DGZA 5FP6A 4BBFA 1BLXA 2WQOA 5HHWA 2Z7QA 4LFIA 1OM1A 4QP2A 3RM6A 5FEDA 3V8WA 2CLQA 2XMYA 5KZ0A 4UMQA 4UWBA 1ZAOA 4BIBA 4R78A 3FKOA 1DS5A 2FB8A 2QD9A 3LMGA 1OKYA 4PPAA 3IECA 4GL9A 2EUFB 4O6EA 2C68A 3UO6A 1VZOA 3UIBA 2IZSA 4MXXA 3D83A 3JPVA 4FTJA 5L2WA 3TG1A 4IZYA 3C0GA 4R7BA 4QP6A 4EH4A 3F3UA 4K1BA 5BYZA 3CLYA 3ZOSA 4GUEA 2XK6A 1ZY5A 2XANA 3NNXA 4B7TA 1W2CA 3IW6A 3FMDA 2FSOX 4DH8A 2JAVA 3EN7A 4L45A 4DH1A 4QMNA 3E3PA 3IDPA 3Q4ZA 5TOZA 4BDIA 2VGOA 4E6DA 2CKOA 2PMOX 1E1XA 1H0VA 2V22A 2W4KA 3ORPA 4EEVA 5GHVA 2GFCA 5CQWA 3ELJA 5HLPA 3NYNA 3CTHA 3R01A 3LFAA 2Z2WA 4FA2A 5D7AA 2A98A 2HZIA 4CD0A 5J9LA 3ERKA 4KSQA 5EI6A 4M7IA 2NRYA 3IOPA 2IJMA 3QWJA 3TMOA 3CBLA 3DXPA 2WQEA 2X0OA 5FP5A 4LOQA 2ERZE 4M84A 2WMSA 2WELA 2DQ7X 2ZMDA 4LGGA 3VC4A 4YUQA 5K0XA 4FEWA 1TQMA 4AQKA 4XG9A 3LQ8A 4O22A 4YR8A 3P7AA 3LFBA 3IQ7A 2WOUA 5D41A 4OBPA 2OIBA 3DZQA 3QTXA 3P86A 2V0DA 3LXLA 2QOIA 3FI3A 2Y0AA 4N70A 4BGGA 2RGPA 4M14A 3RK9A 3BYUA 2JKQA 5CT0A 4EZ3A 4IVDA 2WIHA 2C6MA 3ALNA 4M69A 3ZHPC 3CE3A 4EK5A 2W9FB 3B8RA 3GU8A 4YURA 3GC9A 4KBKA 4UBAA 2XBAA 4RFYA 4E5WA 3LFCA 4DFUA 5AUVA 4XRLA 4Y5HA 1KE8A 3IW4A 5HTIA 4GFMA 5JFXA 3OEFX 3QRKA 1OECA 2J0IA 4FK6A 4GG7A 3WE8A 5KMNA 3S00A 5CSWA 4QTBA 1QPDA 4F0IA 2C6IA 4E4LA 5AAEA 5J5TA 5CU4A 3NUNA 2XIXA 4AOIA 5J5SA 3I6UA 4DGOA 4TRLA 3UDTA 4UZHA 3NAYA 5C03A 4PMPA 2XUUA 3FKNA 5FGKA 4PQNA 1GZOA 3D0EA 3PXYA 4DG3E 4F7LA 2X81A 2VUWA 4F4PA 1Q8WA 1Z9XA 3VQUA 1U54B 3C4CA 3FZOA 4B99A 4QQJA 5G6VA 5EYKA 2VWVA 3C51A 3ETAA 2HOGA 4U79A 4QOXA 3DKCA 3HV4A 3QQJA 1PW2A 4EORA 4FE2A 1KV2A 1LEZA 5AUTA 3DB6A 4QT1A 2FUMA 3EFLA 4C02A 4O0UA 4EL9A 3SV0A 4USDA 2ZJWA 4FV0A 3DGKA 4XX9A 1PYEA 3W16A 3Q6UA 5IUIA 2PVRA 3JVRA 4OTPA 4CSVA 1YXTA 4DEBA 1REKA 1K2PA 3IG7A 3R7GA 4ZEGA 3G5DA 4ZSLA 1H00A 5AIRA 4C58A 4F64A 4GSBA 3SKCA 1CM8A 3LFQA 3QXPA 5AJQA 1A06A 4QTCA 5DN3A 2ITXA 4DGMA 5HNIX 3T3VA 3VJNA 2I40A 3KVWA 3BHTA 4EUUA 4Y8DA 4RWKA 3IOKA 3D7TA 4NW6A 3DQXA 4L01A 2WMWA 2WMUA 5GZ8A 5CU6A 1GAGA 2R3MA 4AZSA 4QNAA 4V04A 1K9AA 3UZTA 4R7HA 3BWFA 5IISA 3TZ7A 5LXMA 3VUKA 4C4JA 5K0KA 4N6YA 2EVAA 4H58A 4XMOA 3H4JA 4R7IA 3CR0A 2FO0A 2W1EA 1WBSA 2H9VA 4YLJA 1SVGA 3F9NA 1W7HA 2R3GA 4O83A 3OWKA 4KIQA 5DRBA 4YP8A 3GQIA 1G3NA 3HYHA 3K3JA 3NPCA 4Z55A 2CPKE 4FSUA 4BIEA 4U45A 4G5PA 4RWLA 3CS9A 4YHTA 3DK3A 3AD4A 4QMOA 3TDVA 1XMMA 3DK7A 3I0QA 3UYSA 2QO7A 3FQEA 2PL0A 4BDGA 4JRNA 1Y91A 3HMOA 3NDMA 4C4IA 4EOIA 1DI9A 1Q4LA 4QYYA 3BEGA 3GU4A 3FZSA 5ANIA 2F49A 3UQFA 1I09A 3SOAA 5IQFA 4JDKA 3QD2B 5GIPE 3OBGA 3KMWA 4ZTRA 4MH7A 4G9RA 3P23A 1E9HA 3VUHA 5AM7A 3A4PA 5T68A 4Y73A 3GNIB 5ICPA 3D7ZA 4JQ7A 4RIXA 3Q2JA 2Y6OA 2UW5A 2HK5A 5E1EA 1A9UA 3VBQA 1ZOHA 3IKAA 5H8GA 3SX9A 3FXWA 2YHVA 3C1XA 4A4OA 5J9YA 2P4IA 5E4HA 4RX8A 5GNKA 2VU3A 3ZZEA 1SNUA 4N57A 4FTOA 3R30A 1V1KA 2ITPA 2X7OA 4FV2A 3RWPA 4GUBA 4OT5A 1T46A 4KBCA 5ANKA 3D94A 4GIHA 3BPRA 5EDQA 5HESA 5KCVA 3PP0A 4DE4A 4HPUE 4X6QC 3R9HA 4X2GA 4I41A 4PL4A 4E1ZA 3E8CA 1H1PA 4O2PA 5L2QA 4FL2A 3TIZA 3DKOA 4UMRA 4O4FA 3VW8A 3R00A 4ASXA 3HNGA 3RK5A 4JIAA 3HV3A 4TYJA 4ZZNA 4A4XA 1FBNA 3C4ZA 4GVJA 3SXSA 2CKQA 4W8DA 4F9AA 2Z60A 4EOJA 5LMKC 1NT2A 3ZH8A 3NNUA 1H8FA 3PA4A 3VS0A 1GOLA 3KL8A 3FMHA 4KS7A 3WIGA 4EBWA 4AXEA 1Q62A 4JLCA 3KRXA 4XP3A 5AX3A 1OMWA 2PVFA 3FSFA 4ASZA 1Q3DA 3UO4A 2BZJA 3ZFMA 4M67A 5H2UA 4QMUA 4HCUA 3Q9XA 3LXKA 3OXZA 2Y8OA 1H26A 4XG8A 4EH7A 5JQ8A 3FC2A 4K9YA 4WG4A 3UDBA 3NVKI 4XJ0A 3NFFB 3C5IA 2J9MA 4FVPA 4EOLA 2BROA 4GJ3A 3L8PA 2WOTA 3EN9A 3W8LA 4L67A 4S31A 1G8AA 2X8IA 3QTIA 3NCGA 4FTAA 3UPZA 3K3IA 4BCFA 4YU2A 4GK4A 3GCVA 1OGYA 3AMBA 3TJCA 4XLIA 3TEIA 4IEBA 4E8AA 2P55A 4KIKB 3FPQA 2KULA 4LI5A 5AR5A 4O7WA 4HVGA 1W98A 3ZSHA 5IA3A 4IXPA 5A54A 1BI8A 2QNJA 3O8UA 4CG8A 4APPA 3QQKA 5E90A 4MXCA 2GHGA 5A9UA 5BUIA 2X6EA 4QMXA 2VN9A 4W4VA 4JG7A 5AUYA 2WQMA 4XBRA 1WAKA 4ORKA 3QC9A 4A9YA 5IPJA 2QOHA 4O0YA 3VW6A 4G34A 3ANRA 2XK3A 4LYNA 4YZDA 4FSRA 5AP7A 3KY2A 5FLFA 4K11A 1ZZ2A 2C5OA 2PZ5A 1LP4A 4ALWA 3DY7A 3HMNA 1IR3A 4O27B 3MVMA 3NNWA 5LWMA 2ZDTA 5C8MA 3I7BA 1NVQA 4YZ9A 1YWNA 3FMMA 2AQXA 3ZS5A 2VWZA 2Z7LA 3AD6A 2OXDA 3QCSA 4OLIA 4A9SA 2GQRA 3KFAA 2XCKA 3VBXA 1K3AA 3PJ8A 4P7EA 1PF8A 4RC4A 2R3RA 3TUDA 1W2DA 2YEXA 5IA2A 4CXAA 3R1SA 4CFUA 5C8KA 4AA5A 5H9BA 3KRLA 4BICA 2WEIA 3BU6A 2VTIA 3NNVA 3UG1A 2ETMA 2OZAA 2WAJA 2XEZA 4FKWA 4JAJA 4MNEB 3DS6A 2OK1A 5KE0A 4BI1A 5DI1A 2JD5A 5E91A 2RFSA 5KZIA 4LGDA 3VBYA 3RBWA 5FDXA 3P08A 4E6QA 4YBKA 2YM3A 4PTEA 5DRDA 5CSHA 4JMQA 3PJ3A 5HU9A 4U40A 2YITA 3Q9YA 2BDFA 4EUTA 2WTJA 3PPZA 3W0OA 1PMUA 1RE8A 3HV6A 4R6VA 2PY3A 2XAOA 4K0YA 2O3PA 3EYHA 4RC2A 2UZUE 4J7BA 4IDVA 3ULZA 3S1HA 1PMNA 2VTMA 2ZB0A 4FICA 5IA5A 5ACKA 3U54A 2F7EE 3F2NA 4AA4A 3MFSA 2YM7A 3ORKA 4B9DA 4EK3A 5BNJA 1NA7A 4DDIA 1HCLA 4KKGA 5AP0A 3KXNA 1O9UA 3OT8A 5EG3A 3NUAA 5M06A 2X2KA 1ZRZA 4GYIA 4WNOA 4D4YA 4FJVA 2JDTA 1F0QA 1J3HA 4HW7A 2JIUA 4H3BA 2WKMA 3MSSA 4HVHA 2DUVA 4NJ3A 1W83A 4QMYA 5ETAA 3GC0A 4FG7A 3MJ1A 1IEPA 2OJIA 2XNNA 3PUPA 1PJKA 4W9XA 4X3FB 3KXXA 4J71A 4OTGA 4U0IA 3UOKA 4AW0A 4ZLYA 4AAAA 4RVKA 3ZSIA 2JC6A 4X6RA 3F69A 5TR6A 2E9NA 3NWWA 1H0WA 2QHNA 3CIKA 4MXAA 4RX5A 2UW7A 5J7HA 5AA9A 1QPCA 1Z5MA 3A61A 3A7JA 2C6OA 2ETKA 3LKMA 1R3CA 3ZC6A 4A9TA 3QBNA 1H25A 4TWPA 4RG0A 2IVSA 4CEGA 4HGLA 4QPSA 4QYFA 4HYSA 4HNIA 3GU6A 3HV5A 4IAFA 3KU2A 2R3NA 5HE3A 3VUGA 4CFMA 4MCVA 3P1AA 3C5UA 4R5SA 3LCKA 2C3JA 2R3PA 5HVJA 4ANSA 1YDTE 3MGYA 2XA4A 4NSTA 2E2BA 1Q5KA 2OSCA 2X4ZA 4M15A 4TNBA 2VO7A 3VRYA 3PVBA 2QOCA 2QOFA 3AGLA 3KXZA 5LWNA 4RJ8A 3ZDUA 4C4EA 3MS9A 3SW7A 3R04A 2QODA 4ITIA 2UZEA 4EOQA 1OIQA 2EU9A 5EHOA 4AA0A 4LOOA 1PXOA 2OGVA 1DAYA 4WUNA 4D0XA 5IQEA 4I0TA 2R2PA 3BZ3A 4D0WA 5IDNA 4CT2A 1YWRA 3R83A 1GZ8A 3EMGA 5JFWA 4W9WA 1URWA 3GI3A 4BDHA 2PWLA 4CLJA 1BL6A 1MUOA 3FWQA 3R6XA 1LUFA 2DS1A 3TUBA 3DJ7A 2X0PA 4FV4A 4F7SA 2VNYA 3FKLA 4YJUA 4D2WA 5M56A 2XARA 4OBOA 4OTWA 2R7BA 2F57A 4P5QA 4BN1A 3PIXA 3THBA 1Q8YA 3EN6A 4C4FA 5JK3A 5KMIA 5HVKA 4QO9A 2BFXA 4NCTA 1GJOA 3PJ2A 2G2FA 2I0EA 4YSMA 4RGJA 3NS9A 4ERKA 1JBPE 3WZKA 1BUHA 2C5NA 2WTKC 3FQHA 1UKIA 4DHZA 4MXYA 1ST4A 3A8XA 2W5BA 5M53A 4RJ5A 2QG7A 3QCXA 4L00A 5TKDA 4E4NA 1STCE 3NVMB 4S30A 4DF3A 2GQSA 4YJTA 1ZMUA 2CN8A 2GNLA 3OCSA 4EK6A 2E9OA 4IX6A 2GU8A 4HNFA 4CNHA 5C9CA 3OTVA 4IVCA 4WBBB 4FIGA 2VO3A 3V5PA 5E8XA 3PLSA 3FMJA 4FEQA 3L1SA 4PMTA 5IU2A 3QQFA 2CGVA 2UV2A 2YDJA 3PVGA 5D9HA 5HNBA 4ZK5A 3UP2A 4AT5A 2EXCX 2YCQA 1IAJA 1ERKA 3ZZWA 3EQBA 4QP7A 3M2WA 2J2IB 3UMXA 3EWHA 4AG8A 3CSVA 3N4TA 5CEMA 4IH8A 2UVZA 3PDTA 5FTGA 3GT8A 3TL8A 2W5AA 4PDSA 5HD7A 2B9JA 3M42A 4I6QA 3G90X 5HLNA 3VHEA 1JKKA 3AC3A 2B9FA 2G2IA 3QRJA 4F0GA 4FTUA 4C38A 4L9IA 4FTTA 4CYIA 3PXKA 3OROA 1XWSA 3SLSA 1G5SA 2XVDA 5I3OA 4BB4A 2PMNX 3BYSA 4EWQA 4ZIMA 4J98A 3R8ZA 2IO6A 4ANQA 2J0LA 4X2NA 4CLIA 4JBPA 4NJDA 3T9IA 4D2PA 4YSJA 4GKHA 3D2IA 2YIRA 2OJ9A 5EK7A 1M2PA 4JDHA 4HZSA 5AV0A 1OKWA 3BRBA 4YNEA 2C5XA 2HWOA 4MTAA 3OUKA 4O0TA 3VULA 4EHVA 4F6UA 3BL7A 5A6OA 1KSWA 2X0GA 4EOPA 4FTMA 3A4OX 4HVDA 5LJJA 3N51A 5AR3A 4N4SA 4OUCA 5CAQA 4B8MA 4GK2A 5HE0A 1OL5A 4BI2A 5BVOA 3DA6A 3R0TA 5EM8A 3F7WA 3RNIA 3UP7A 4EQCA 4Y46A 1Y57A 4GW8A 5C26A 5HZNA 4PTGA 4FG9A 1MRVA 5A3XA 4C3PA 3EZVA 3V3VA 1TZDA 4DA5A 2W1IA 2O2UA 1FPUA 4ZY5A 3FHRA 3PIYA 3S4QA 2ERKA 4RBLA 4DDGA 2WMAA 4FR4A 4B4LA