5CFCA

Crystal structure of human cardiovirus safv-3
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
252
structure length
252
Chain Sequence
GVDNAEKGKVSDDNASTDFVAEPVKLPENQTRVSFFYDRSTLSSVLQSTSDVSSKFTPSTAKNLQNSILLTPLPSDIVNNSVLPEQERWISFASPTTQKPPYKTKQDWNFIMFSPFTYYKCDLEVTLSKNDRETISSVVRYVPCGAPSDLSDQTMPQTPSLADTRDPHMWVVGQGTTNQISFVIPYTSPLSVLPSVWFNGFSNFDNSSRFGVAPNADFGRLLLQGQGTFSVHYRYKKMRVFCPRPTVFIPWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structure and Genome Release Mechanism of the Human Cardiovirus Saffold Virus 3.
pubmed doi rcsb
molecule tags Virus
total genus 43
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cfcA00
1POV1 4FTSA 1ZBE1 1ND3A 1F8VA 2X5IB 1RUH2 2FZ2A 3JBG3 1H8TC 4GH4A 1ZBE2 4RR3B 4CDUB 5C4WA 4CEYC 1NCQB 4YVWB 5FMOL 1RUC1 1W39A 1B35C 1Z7S1 4RS5A 4JGYC 4AEDA 3VBRB 5D8AB 5A32A 1VBB1 1Z7S2 4GMP1 1COV1 1X33A 5DDJ1 4IV1C 4Q4W1 2R072 1RHI1 3VBFA 4CDWA 3JB4C 1VBB2 3ZFFA 1OOPC 2RS33 4N43B 1COV2 5DDJ2 4Q4W2 3ZFEA 4IV3C 1C8M1 1PO13 5ABJC 1R093 4FSJA 2IZWA 1R1A3 2ZTNA 1K5MB 5BNOC 1QQP1 2WZR1 1RUF3 4YVSA 1E57A 4RQPB 1QQP2 2WZR2 5JZGC 2RS13 2X5IA 4CEWB 1NA1B 1R083 4Q4V1 4GH4C 1ZBA1 4RR3A 4CDUA 4N53B 5C4WC 1NCQA 4YVWA 2MEV3 1RUI1 3FBMA 4WM7B 1EV13 4Q4V2 4RS5C 1QJU3 2WFF1 1ZBA2 4AEDC 3VBRA 4WM8B 1MEC3 5D8AA 3DPRB 4NWWA 2XPJA 2WFF2 1HRV2 3HAGA 4CDWC 3VBFC 1BEV3 1BBT3 3ZFFC 4N43A 2RM21 1AR73 1AYM1 2HWD1 1VRH3 1PIV2 4GB33 1AYM2 2PLV1 2HWD2 4Q4Y3 1K5MA 1RUH3 4Q4X1 2PLV2 1RUJ1 1VBD1 4YVSC 5K0UA 2RR13 2R041 5CFDB 4RQPA 4Q4X2 1RUJ2 1VBD2 2X5IC 1OHFA 2R042 4CEWA 1NA1A 1D4M3 3VBSB 4RR3C 5BNPB 4N53A 1NCQC 1Z7S3 4YVWC 5A33B 4WM7A 2R073 4WM8A 3VBRC 4Y5Z0 1AR83 2HWB1 2BBVA 2WS93 4JGZB 1CD3G 1COV3 5D8AC 3DPRA 2BFUL 1M06G 2R061 4Q4W3 3VBHB 5J96B 1C8NA 2HWB2 2XBO1 3ZFGB 3VBOB 2WLPA 1AL21 4RHV1 2R062 4N43C 1NCRA 5ACA3 1IHMA 1EAH1 1PO21 1AR93 2XBO2 3VBUB 4QPGB 3M8LA 4CDQB 1DDLA 1RMU1 1AL22 1RUC2 1QJY3 4PDWB 4RHV2 4CDXB 2GH8A 1VBC1 1V9U1 1EAH2 3CJIB 1PO22 4RFT0 1FMD3 1RMU2 1TMF1 1VBC2 2HWF1 1QQP3 1V9U2 2HWC1 2WZR3 1K5MC 1TME1 1MQTB 1ASJ1 1TMF2 1RHI2 2HWF2 5K0UC 2HWC2 5CFDA 4RQPC 1HRI3 5AC91 1TME2 3J8F1 1ASJ2 1AR63 1C8M2 1ZBA3 1NA1C 3TN91 5AC92 1VBA1 3JBG1 3J8F2 5BNPA 1RUE3 4N53C 3IDEA 1HRV3 3LOBA 1HQNA 3TN92 5A33A 4WM7C 1VBA2 5C8CB 4WM8C 1RUG3 1VB2A 1ND3C 4JGZA 1GFF2 3VDDB 2DF7A 3DPRC 4IV1B 3ZFGA 2BPA2 5LK7B 1PIV3 1OOPB 5BNNB 2HWE1 1FPN1 1NCRC 5L7OB 1AYM3 4EJRA 3VBUA 4QPGA 4CDQA 1WCDJ 1RUI2 4PDWA 2VQ0A 4CDXA 2HWE2 1FPN2 1VBE3 2QQPA 5ABJB 1PO11 1RB8G 2WWSA 1FOD3 2RS53 1PO12 5BNOB 1R1A1 4FTBA 1VBD3 2GSYA 3S6PA 1HXS3 3ZFEC 1VAKA 1RUF1 5CFDC 1R1A2 2RM22 1RUD3 4QPIB 5JZGB 5FOJB 1QJX1 1RUF2 4GH4B 4Z92B 3NAPB 5BNPC 1QJX2 2RMU1 1POV3 2MEV1 1ZBE3 5C8CA 1X36A 1BMV1 4JGZC 3JD71 3VDDA 2RMU2 2MEV2 1MEC1 2BUKA 2XBO3 2Y26A 4IV1A 1CJDA 1BMV2 1POV0 1AL23 1RUC3 2ZZQA 4CDUC 3ZFGC 3JD72 1PVC1 1MEC2 5BNNA 3JB8A 5L7OA 1BBT1 1AL0G 3VBUC 4QPGC 1RVF1 1VBB3 1PVC2 4CDQC 4GMP3 4CDXC 1AR71 5DDJ3 4BCUA 1BBT2 5ABJA 5C9AB 1RHI3 2HWF3 1RVF2 5CFCB 2ZAHA 4GB31 1AR72 5BNOA 4GMP0 4Q4Y1 1C8M3 4GB32 5AC93 2RR11 4Q4Y2 4QPIA 5JZGA 3TN93 1VBA3 2RR12 3NAPA 1D4M1 1AYN1 1ND2B 5J98B 5C8CC 1D4M2 1AYN2 2R071 3VDDC 4Q4V3 1AR81 2BFUS 2WS91 4CEWC 1H8TB 1RUI3 3VBSA 4CEYB 2HWE3 1FPN3 5FMOS 1AR82 2WFF3 2WS92 1B35B 5BNNC 5L7OC 4JGYB 3JBG2 5ACA1 1F2NA 1AR91 1QJY1 3VBHA 5C9AA 4SBVA 5ACA2 1SMVA 5CFCA 1AR92 1PGL1 3VBOA 1FMD1 1PGW1 2RM23 1QJY2 2RS31 1A6CA 4IV3B 2HWD3 1PGL2 5K0UB 1FMD2 1PGW2 2PLV3 1QJX3 4QPIC 2RS32 3CJIA 2TBVA 1HRI1 1R091 1AR61 4Q4X3 1RUJ3 3NAPC 1HRI2 2RMU3 1ND2A 1MQTA 2R043 1R092 1RUE1 1AR62 1HRV1 1AUYA 4NWVA 3JD73 1ND3B 1RUG1 1NG0A 1RUE2 4LLFA 1H8TA 2RS11 1PVC3 1R081 3VBSC 4CEYA 1RUG2 5C4WB 5GKAC 1B35A 1NCRB 4RS5B 2RS12 1PIV1 1RVF3 4JGYA 4Y4YA 2HWB3 4AEDB 1R082 1EV11 1QJU1 2R063 5A32B 2FZ1A 3VBHC 5C9AC 1VB4A 1EV12 1VBE1 1QJU2 4RHV3 5CFCC 1QJZA 3VBOC 4CDWB 3VBFB 1HX6A 3ZFFB 1FOD1 1EAH3 1OOPA 1PO23 1VBE2 1BEV1 1NY71 1RMU3 2RS51 3ZFEB 1OPOA 4IV3A 1VBC3 4FTEA 1V9U3 1FOD2 1HXS1 4PDWC 1BEV2 1NY72 2RS52 3CJIC 1TMF3 1VRH1 1RUD1 2HWC3 1HXS2 1AYN3 1TME3 1ASJ3 1VRH2 1ND2C 1RUD2 1MQTC 1NOVA 4YVSB 3ZXAC 1RUH1 3J8F3
chains in the Genus database with same CATH superfamily
4I0AA 3H50A 5DAPA 4N8MA 1CN1A 1O5UA 2NPIA 2A3XA 3EMRA 2X5IB 1W03A 4F8AA 1O3TA 1H0BA 1W04A 1L7RA 2PXJA 3M3QA 2TNFA 4AL9A 5IVBA 4LBQD 3C2UA 4H3WA 3V0AA 4RR3B 3MO4A 3FHIB 5DUVA 4YVWB 1YFXA 2DCJA 1RUC1 5T3NA 3VZKA 1GKBA 1RC6A 1MS5A 3NKGA 5FZ8A 4RD7A 4DY3A 2JG8C 4RS5A 3KQRA 1JYXA 4YGDA 1H2NA 2QCSB 4TWTA 1DGWX 5A32A 4B4RA 4ISRA 4PCRA 3UL2A 2BJSA 1UN1A 1COV1 1CIWA 5DDJ1 3IIAA 1Y9GA 2J42A 5FUPA 3I3EA 1O4ZA 1JMUB 4I0BA 2E7QA 3VBFA 1HKDA 2JG9B 3PMSA 1PVXA 1VBB2 3ETQA 3ZFFA 2BNMA 3THDA 2JIGA 5BY5A 3A22A 5EJZB 4QX1A 2DFCA 1U0AA 2VR4A 3B69A 1JOBA 2MPFA 1H2KA 2VH9A 4IV3C 4D6SA 1JYTA 1KJRA 4BPZA 5KHJA 2NZ9A 5FZ1A 5GALA 2V72A 3OEBA 3QH7A 1QXPA 2C9AA 4Y3OA 2PQSA 3VKLA 4DRVA 1UQXA 3O5SA 5CZKA 3U07A 4FSJA 2VY0A 2DCYA 2IZWA 4CP1A 1KJLA 2ZTNA 4XURA 4URTA 1XYPA 2TUNA 4NUBA 1JYWA 3M2MA 4Z07A 1K5MB 5H9SA 1W8NA 4QQOA 2UWBA 3TEXA 1ULEA 4JV4A 1JZ5A 4NVPA 4AFAA 1ZZ6A 4UAPA 4DXRA 3E97A 3TOJA 4XFCA 5F5CA 2D93A 1A8DA 3LKJA 5FK7A 2GP3A 2HYKA 4I3PA 4DUXA 3H8RA 3LF7A 4TXWA 5C6CA 4O9GA 2FDKA 2A6ZA 1R083 4Y33A 2LRPA 4UOJA 1O7FA 4I2OA 2PHTA 4GH4C 4AVBA 4LULA 4HN1A 2RDNA 1S1AA 3AVSA 4N53B 4CU9A 1UMZA 2D3RA 3LDKA 1WUVA 4AFDA 3FBMA 4XTPA 5JI7A 4Q4V2 3ZPYA 1ZBA2 3AFKA 4FPHA 5HV0A 3T1MA 2XHKA 3B9CA 3J7LA 1XE0A 1B09A 1EY2A 3AP5A 5FO9B 4FP2A 4QHOA 4QMAA 1MEC3 2I74A 4TN7A 2JDHA 4XACA 3ZXLA 4CUAA 2DUQA 5G04L 4D8MA 3NNJA 1LECA 4M3CF 4XFHA 2XPJA 4DO0A 3EYPA 3POSA 2ZKNA 3HAGA 4JZRA 4IETA 1JW6A 4BM8A 1TNRA 4CDWC 3KVAA 3ZYGA 3MW3A 5BXXA 4XE9A 1ZVFA 4FT8A 4Y1VA 4BLJA 4HBNA 2DV9A 3CU7A 4HL0A 5LASA 3U11A 1W06A 2VPVA 4UFIA 2EAAA 1PIV2 4AQ2A 2RDRA 1VJ2A 2DVBA 1F4HA 3O1OA 3V56A 1T6BX 1S0FA 4XPVA 1DHKB 1UAIA 2BYVE 2VZUA 3FL7A 5L36A 3W5MA 4Y26A 1YI7A 2E53A 1Q56A 1RUH3 5CBLA 2IXKA 4HPKA 2YFUA 3RI8A 4KGGA 4DB5A 5A3NA 2IXJA 1ULFA 3SEPA 2WN3A 2EA7A 5FYUA 3IIIA 4LBLA 1LTEA 4XCAA 4EROA 5F5IA 2QE3A 2WC2A 1VBD2 1LKNA 2A5ZA 1OHFA 1V6KA 2R042 1BLZA 2WJSA 3E5QA 1NA1A 3TB0A 1OF4A 4AZZA 1D4M3 4W4ZA 1I3HA 1GWLA 1UY0A 1RJ8A 1NCQC 4FQ4A 4L0PA 5DZEA 5FPZA 1W2UA 1CONA 2WNVC 2ZX3A 4QX8A 5A7WB 2R6QA 4MVTA 2W91A 3U78A 4NHYA 4WM7A 3WNNA 1UZYA 5A33B 2WSVA 1DLCA 3I7DA 4Q29A 5DAWA 1BXHA 2YC4A 2GNDA 3MEPA 3Q8FA 1D0HA 2WS93 2HEYF 3KM5A 4XYXA 1COV3 1HN0A 5DZFA 3DPRA 3T08A 4ES9A 5JCTA 1HJGA 3ES1A 3O1MA 2WSUA 4AYUA 4HSLA 2WRAA 1C4RA 2HWB2 4IE0A 3GGLA 3H9AA 5A6YA 4XDOA 4RHV1 3CO2A 4N43C 4BQ3A 3J9SA 3HT2A 3UNPA 5KHGA 2XQXA 5CYYA 1PO21 1AR93 2C24A 3BB6A 3A0KA 5K4LA 1QXRA 2HLEA 3GBWA 4CDQB 4CU6A 4J1XA 2XJQA 1RUC2 5CVRA 1D2SA 1QJY3 1GP6A 1GSLA 2VZSA 2FDJA 2WO3A 3AYAA 3LCPA 4LR4A 4NOTA 4LT5A 3T2PA 4O61A 3N7KA 3OTFA 3R4SA 4UBHA 4AI8A 1QHDA 1FMD3 5FYVA 1DGRN 3FZ3A 1VBC2 3H3UA 4MUVA 5DPNA 5A7QA 3RJRA 2AENA 3S0MA 2ZS6B 1Q8PA 5DN2A 1GZCA 3LQCA 3D82A 1LHWA 2HWC2 2UYAA 1JZ7A 2ZX1A 2XMLA 5FQ0B 4RQPC 1SG3A 3WY6A 1WMXA 1RUNA 2LW8A 1O8PA 3CBNA 4FVVA 1S0IA 1AR63 4NIDA 5T52A 1LHNA 5LW9A 2KD7A 2BGOA 2XKPA 4GWNA 5A6XA 4XHBA 5AC92 4META 1ENSA 5BNPA 3TAYA 3CZJA 3PMEA 3INAA 4JX0A 4IGOA 4K9SA 1HRV3 1O59A 1UZ0A 5C8CB 2XLFA 1RUG3 2DVDA 2IXIA 2PA7A 3A0NA 3OB8A 4ORFA 4XDPA 5A6QA 4YYOA 1LGNA 3POIA 4JKKA 3SH5A 2EIBA 3ROUA 3VDDB 2DF7A 4QX2A 3RS6A 4UXAA 2C5DA 4P5YA 4GJZA 1V6NA 3GHMA 4E8DA 4YZ2A 3W5NA 1MVEA 3EBRA 2ZGKA 5FYMA 2K2SA 4ARYA 1OOPB 3RYRA 4EZ4A 1NCRC 5FFOC 2ENRA 3ZO0B 1UL9A 4F3JA 2CWSA 3K4AA 4QGNA 1AVBA 1XB9A 5E89A 3CKHA 4CDXA 3NV4A 1OA3A 4KWLA 2OYZA 2JDZA 3NRUA 1FPN2 3WNXA 5ABJB 1UNBA 2X29A 1UY4A 1S2BA 5IVYA 2LUWA 5AFEA 1OC1A 3O1VA 4DIQA 1FOD3 2QQWA 2GC2A 5AVPA 3UGFA 4R52A 2JDNA 1GMMA 5K8SA 2XWJB 5BNOB 4FTBA 2UWAA 4XETA 1MS4A 2HJIA 3LA3A 1LCLA 1YIFA 2W0XA 1RL3A 3I3DA 5FLJA 1RIRA 1D7PM 1UU5A 2H6CA 4LKDA 1YUDA 4X6QB 1R1A2 1Z0HA 4R9BA 3K51A 2EXHA 5I8TA 3MICA 3OBZA 4ONUA 1U12A 5FOJB 1DZTA 1FNYA 3HT1A 1HDKA 5JSPA 5FAXA 4CU7A 1GOHA 2DDUA 3RGBA 2AC1A 4IGQA 4CA9A 2ZKLA 3WX5A 4R9CA 4M4RA 4FOWA 4FP3A 4MOAA 1QJX2 4LO4B 2VAUA 2YU1A 2RMU1 3F2ZA 2VMEA 1US3A 1LOFC 1ZBE3 1NKGA 4N7UA 3L2HA 2KA3A 2YUEA 4XQDA 2JXAA 2OZ6A 1O3SA 3N9NA 4JGZC 4XF0A 5I93A 1O91A 2MEV2 3IPVA 1JOJA 2ZXQA 3MLLA 2Q8DA 4U36A 3N9PA 3ZM8A 1PVC1 5F39A 2VW0A 4HVRA 5FZIA 1BJQA 1D0GA 2CY6A 3MFAA 3ZIWA 3KD4A 2KM2A 3VBUC 1OQDA 3OOXA 1RVF1 2V5YA 3ZDVA 4GMP3 1SCRA 1VPHA 1UOGA 1AR71 1Q8VA 3GDBA 3THPA 1LNSA 2Q0AA 5DABA 4AXOA 4YZ5A 3UGGA 5M0TA 4UYBA 2VVEA 2WUHA 4BHPA 5C9AB 1W6QA 3LE0A 5DG1A 3BALA 2VNGA 5CFCB 1ALYA 2YU2A 3LEIA 2QQLA 5ANNA 4MXWB 1UOBA 4GB31 4ZS3A 2JG9C 1IPSA 2VMDA 5DG2A 1GNHA 1QU0A 2GC1A 2VW2A 1XNDA 1Y4WA 4Q4Y1 3UETA 4UFHA 4CXXA 4X8PA 1KDMA 5HBAA 4RL7A 3SH3A 4Y1ZA 1FV3A 5T5LA 4HN0A 2AEYA 3NVCA 3GNEA 1DQ5A 3GZTB 3IB3A 3ZVXA 5KHKA 4QQHA 1W8UA 2VUAA 1U5YA 4OQ8A 4P9IA 1F9KA 1RXFA 5SV8A 5FTTC 2CL2A 1ODNA 4OMDA 5FUIA 3NAPA 3KS7A 2WA4A 2QNKA 1PX3A 2DU1A 5FBJA 1LOAA 1QOTA 3ZYIB 2WLQA 2ZGNA 2A3WA 4KGQA 4Y5SA 3VDAA 1TVGA 5FO8B 2JDUA 5I0UA 4HK9A 1DGRA 2B9VA 1AYN2 3TNPB 4P5HA 5E88A 2R071 4ASLA 3KMHA 2ZHMA 2ID4A 3I2HA 1V00A 4AI9A 1REFA 3BPSA 1U5XA 3PTYA 4AR2A 1XSRA 3BI3A 3BUCA 3UJOA 1CX1A 4AEMA 2ORXA 2LALA 3LOIA 4TLFA 1XOYA 1YLLA 2JE7A 2JG8B 4FPCA 5L7OC 3S7IA 5IW0A 4CCDA 4LO8A 5BUVA 3Q9OA 4INDA 5D1IA 2GNMA 1JZ3A 3ASIA 4QD2A 3SKVA 1PM4A 2BP6A 2JDYA 3D6EA 2Z2SB 1MZFA 3IZOA 3HOBA 4UWDA 3AJYA 3KV6A 4MH0E 1SLTA 5KWRA 1PHMA 3UKVA 4J6GA 3FBYA 3BVCA 1H1AA 2QDNA 4NPRA 2ZZJA 2RM23 3ILRA 3UKTA 2NP0A 3C7GA 4DQAA 2XOMA 3DXUA 4QDSA 1H8VA 1QH6A 1S0JA 2RS31 4OYUA 4IV3B 1W6MA 5IJRA 3ABZA 2HBTA 1UCXA 2GAUA 4IERA 4CP2A 2PLV3 4QPIC 2GU9A 1DYKA 1GLHA 1OF3A 2V4VA 3K4ZA 4PI2A 4QX7A 4XFFA 3SNMA 4MV2A 4BOWA 4ITCA 3N35A 3GJAA 2XUEA 2NLRA 4D69A 3TRSB 1OA2A 4Q4X3 5IT6A 2RMU3 1ND2A 2EVXA 3T4VA 1MQTA 5J1XA 1R092 5FZ9A 4XTMA 4DUVA 2R0HA 3R6SA 4LBMA 4A6SA 2Q8OA 3BIEA 3MGUA 3NNFA 4EWAA 5F3GA 1P8JA 2VOVA 1CAVB 2VNRA 5FZ3A 1JUHA 1NG0A 1RUE2 2E63A 3UK9A 5DUUA 1O6UA 2VMCA 3O0WA 1BHGA 3O12A 4XFIA 1LJ7A 4N9HA 2BZDA 2RS11 1V6IA 1XNAA 2SBAA 5C33A 4A7ZA 1PVC3 3IAQA 1DU3D 2CGPA 4NMIA 1BCXA 2Q4SA 1LR5A 3B7MA 5C3OA 1ZRCA 2P4EA 5FR3A 1RVF3 3MUZ1 5A7NA 1APNA 1S0BA 3VHNA 1XC6A 1K45A 2YBKA 1S0CA 2F4PA 3FUOA 3LPGA 2A6YA 4OMCA 3SCGA 1QDOA 2D6NA 2JECA 2OUHA 4R4ZA 5A3PA 3THCA 2FZ1A 1EV12 4AVAA 1QJU2 1WW4A 4GD4A 4TYSA 1QJZA 4LBOA 4CDWB 2BU9A 3J7NA 5IK5A 3IN9A 1EAH3 1W6OB 2OPWA 1ZYBA 1NX9A 1OH3A 3C7FA 4P02B 4TLGA 2G9ZA 1NAEA 1NY71 1RMU3 1KS4A 1OPOA 4XFGA 2OA2A 1D4VB 1V9U3 1HB1A 4Q26A 1HXS1 1UYPA 2JWPA 3BTYA 3S57A 4WV8A 1BEV2 1W9FA 2WBKA 2RS52 2JDAA 3AKRA 1TMF3 3LDRA 3ZXFA 3WT3A 4EWEA 4IGPA 1W2AX 3CQOA 3N36A 4AVTA 4KWUA 5A1FA 4N7IA 2IXHA 1TME3 5IYYA 1ASJ3 2XKOA 5T55A 1VRH2 3N9OA 1GANA 4D6QA 1RUD2 2DBNA 5IUQA 3MW2A 4W6YA 3USSA 4ES8A 3USUA 3RQ0A 1UOJA 1WBFA 2Y0IA 4ZONA 1OH4A 4JRLA 2UY9A 1POV1 5C5TA 1ND3A 1F8VA 4BK4A 3BTZA 4PJYA 2OS2A 4FPYA 2Q8EA 3WDUA 2QQKA 4E2SA 3HR9A 4XJ9A 5JPMB 3WUDA 1JYCA 3KWVA 1H8TC 1DFQA 3H8OA 1QGLA 3HD8B 4CDUB 4C90A 5C4WA 1NCQB 4HG6B 3DF0A 1WWYA 1B35C 3LDBA 2X10A 5BNOA 1CPMA 4L97A 2OUJA 1E5SA 3AP4A 4BJ0A 3O1UA 5C7GA 2BQPA 1UX7A 5FZ6A 1KITA 1QXJA 2Z5WA 2RE9A 4NN0A 1VBB1 2V09A 4ZXKA 5A3WA 3CEWA 1WCUA 1X33A 2XJVA 4XJUA 5JDBA 3N7LA 2R072 4GKYA 1GNYA 1XRUA 1RHI1 3PVEA 4GQ7A 5DAXA 1OOPC 2RS33 4N43B 2RVAA 4XXAA 3AX4A 3M4FA 4CTEA 4I3GA 4MGZE 4Q4W2 5JLVA 3ZFEA 1QY4A 1C8M1 1OLRA 2X53S 4AK3A 3ACIA 1PO13 2FBEA 4IE4A 4LKFA 3VGIA 3CDZB 4AAXA 4YW6A 4PI0A 1JYIA 5ABJC 4AQTA 2D98A 1XYNA 1AX0A 2PTMA 3FLPA 4PBPA 4OUMA 2P37A 3P3PA 2GDFA 4CCNA 4MGYE 4UW6A 2A3YA 4M0HA 4GJYA 5BNOC 5FP8A 2K0GA 4MGIE 3WHTA 1JYVA 3UYJA 1RUF3 4W8JA 2Z69A 4HZFA 4KU8A 3WF1A 3WD5A 5LCWL 2FCTA 4RQPB 4Q27A 1AF9A 4LK6A 3ZR5A 1QQP2 2V4AA 2WZR2 2A73B 2J1VA 4CUBA 2RS13 3TYJA 3KV9A 2ZCWA 1REDA 3RYKA 2P3YA 1XPWA 4Q4V1 1H6YA 3WDTA 1TE1B 1ZBA1 3OUIA 4QXBA 4XJAA 3ZN6B 1OPMA 2OX0A 2MNGA 3Q8CA 3T4HB 1AHSA 4BLIA 5DAVA 1YNAA 1GUIA 1UXZA 3ACHA 3N3HA 4ZZ5A 2RDSA 2A6WA 4RS5C 3DGTA 4X8NA 3HVDA 3VBRA 3Q8AA 4EZHA 2LS6A 2VZTA 1LHUA 4CP9B 5D8AA 4NWWA 2GMEA 2YG0A 2WL1A 3LA7A 1CZSA 1IS6A 2WFF2 3WLUA 4DXSA 4HSJA 1KFXL 3T1LA 4QQLA 3OF1A 3M3CA 4DOUA 4CCOA 3AMHA 2ARAA 2VZRA 4D3WA 2VTFA 1W8HA 3VBFC 1G9FA 3ZFFC 1BBT3 3ME2A 3ZSEA 5JXJA 2RV9A 4FOYA 4O65A 3I54A 3C3VA 3EHKA 2RJKA 4COVA 1LU1A 2D43A 4I09A 4XMIA 1W6NB 2P3IA 3T0BA 2W1UA 4NAMA 2JJ6A 4S2GA 4IUGA 2DCTA 2VD7A 3C8XA 3LGRA 3N7JA 2A1XA 4HKWA 1UWWA 1DQ0A 1PNFA 1YIPA 3LWCA 4ET7A 1OLME 3QCWA 3GF6A 2HWD2 2WO7A 1WKYA 3MPBA 1W9SA 2PFWA 3ZSLA 3NJYA 3ZR6A 2QQVA 4E4DX 1SBFA 1E5IA 3LPFA 3JUUA 2RHPA 2VBDA 1CQ9A 1Y9QA 2BEOA 1CAWB 1VBD1 4XZUG 1VR3A 2DCZA 2RR13 2VCCA 2R041 3O1TA 2ZMKA 1XYOA 3UESA 1YO8A 1DIWA 3NSTA 3OBTA 5FMCA 1RUJ2 2XVGA 2WA3A 3GBFA 3ACGA 4CEWA 4NRQA 4EE2A 2WNOA 3ENRA 2VE1A 4URAA 2GN3A 4P00B 2QVSB 3OPWA 5ISLA 3WG4A 4F83A 2WYFA 3POBA 2J1AA 2WNUA 4QDQA 2E51A 2VQAA 4AQ6A 3DKQA 1QIQA 4AWDA 3ITQA 1LOBA 1K42A 4WM8A 3ZXDA 5E8AA 5F32A 4H2AA 4YG6A 5GZFA 1AR83 2HWB1 2BBVA 4JGZB 2I2SA 5FP4A 4BQ4A 2Z4FA 1EUUA 2BFUL 3VLBB 2C6SA 5J96B 3KB5A 3IDBB 1UPIA 1YFYA 1DF0A 2EAKA 3VKOA 2AR6A 3WG2A 4EN8B 4CSWA 4QHBA 4LXLA 2J1RA 2VNVA 2ZGPA 3FFZA 2R062 2Y6KA 3BCWA 4IEWA 2XH6A 3J26N 2ZHNA 4YG3A 5ACA3 4CVUA 1WLTA 2ADEA 1POQA 2FCUA 2XBO2 4MGQA 3WQ0A 3VBUB 3POWA 3VHOA 3WDWA 2OZJA 5E16A 4PDWB 1VBC1 1N3PA 4M00A 3T30A 3N9MA 3P1IA 1CAUA 2VTXJ 1GZWA 1I1EA 1KFUL 3QBQA 4M3CB 5FZBA 4IDZA 4YM3A 1GV9A 4YM1A 2B45X 2HWC1 3KT7A 4BQXA 4EN9B 4IEZA 4CZSA 5FZ4A 4UBGA 1MQTB 4AVCA 2VOXA 4UF0B 3AJZA 2IXCA 1RHI2 2TEPA 4XJZA 5CFDA 3IBMA 2YDEA 2E31A 3WEZA 1HRI3 2YY1A 4DEQA 1M4WA 5AC91 5J7MA 3D4KA 4ZHNA 1WZXA 1LODA 1WCSA 3E5UA 1ODMA 1OD3A 1OQ1A 1C8M2 2MHFA 2WT2A 2ZX4A 2J1SA 3ZXKA 4C8DA 2VM9A 1ZBA3 4E8CA 1NA1C 5I0TA 2A6VA 5HPOA 4B1MA 3ZPOA 3VUOA 3JBG1 3BU0A 3J8F2 4OCTA 1W3XA 4CCJA 3UT0A 1NE6A 3POEA 2VVFA 3O1RA 3LOBA 1HQNA 1YQ5A 2Q1MA 4WM7C 3MIEA 5GJ6A 1RUOA 1VBA2 5F2WA 4LQRA 1US2A 4ZU5A 3MI8A 1N1YA 1GFF2 3B02A 5BYNA 3DPRC 3U75A 1CAXA 3HPNA 1MPXA 4L2NA 4M3CE 4IV1B 4YZ3A 2PAKA 1FX5A 2ATFA 3MUY1 3ZFGA 3RFRA 2FDHA 3BTXA 3OPZA 1X7NA 3PURA 1PIV3 2GN7A 4QB6A 4XUPA 1JZ2A 2HKXA 1XQNA 1FPN1 5L7OB 1YHFA 2W39A 3E1F1 1H1IA 2OIIA 4QPGA 5FREA 5FBZA 2W5FA 3K48A 3V65A 2B9UA 1CPNA 2QTWB 4AI0A 5A70A 1VBE3 4QB1A 5L9VA 1RB8G 1Y3TA 3AM2A 3PNAA 5BPXA 4Z8BA 1QNWA 3WINE 4KG8A 4PHZA 2YZ4A 1MS9A 5F1RA 4EN7B 4KQ7A 1R1A1 4UW3A 4LOSA 1VBD3 4O9EA 4QKDA 3S6PA 1S2KA 4JRAA 1IGOA 2VQUA 1VAKA 3BOPA 4Y22B 1G7YA 1QWRA 1WW7A 1ZRRA 2XVLA 4X6RB 5HI0A 2O8QA 4WVZA 5F8PA 2Y33A 3LSEA 4QPIB 3RG0A 5JZGB 4D7YA 2KXLA 1XNTA 1QJX1 5E1RA 1OVSA 1J83A 3OEAA 2D97A 2R1BA 2A71A 3OYWB 4NE9A 2FMYA 3JXSA 3SMHA 5A3UA 2WO1A 1OUSA 2NM1A 2RG4A 3OY8B 5BNPC 1NT0A 3WCSA 1F15A 3VN4A 1MS3A 3W59A 5FO7B 1YJKA 1JI6A 1LGBA 2MEV1 4W6WA 4IE5A 4QB2A 1X36A 4JTOA 3GZEA 4HFSA 4OUSA 3I2DA 1N1TA 3FMGA 3WV6A 4EN0A 3GJBA 2H0VA 2BUKA 4FPFA 1W8FA 2W1QA 3FHQA 1C1LA 1SCSA 1BMV2 4XUNA 1RUC3 5FJKA 4CDUC 4MYEA 1L7QA 4AGRA 1W6PB 4XBNA 3WNOA 1MEC2 1O3QA 1J1TA 1NZCA 5BNNA 3KHCA 2ZGRA 5FZOA 4NIIA 2I07B 2CGOA 4AHZA 5KHHA 5J3UA 1X9TA 1RGSA 3M3OA 5JSRA 2YMZA 4LBKA 3T2OA 2CU5A 1GQPA 5DDJ3 1BQPA 1XU1A 4CDXC 3AMMA 4BCUA 2W46A 5BNQA 3GZUC 5EYYA 3RZJA 4LJHA 3H1YA 3I59A 1IZ3A 3IDCB 2XL7A 3H3ZA 5FZDA 2IVJA 2PHRA 1OUXA 2GZWA 2ZEXA 3ST7A 4GMP0 4AFMA 1G86A 2OQ7A 2QDRA 1V6JA 2B42B 1H9PA 1ZA7A 2WR9A 4GALA 4D94A 4FFIA 5GZDA 1UKGA 4BQ1A 1SPPA 1ZZ7A 5AC93 5L73A 3MPPG 2VCBA 3SISA 4QX3A 1BK1A 3TEZA 3O0VA 1GQGA 1OBNA 2VVDA 1MS0A 2VNOA 1YFUA 3KT1A 1PNGA 1Q8QA 3W21A 4C1XA 5L19A 5FZKA 3KV5A 5CNAA 1IPJA 1YQ8A 3VHPA 3ZIXA 2X09A 4QQ2A 1AYN1 3I2JA 1SBDA 1REEA 1LAJA 3KZ4C 3ZYRA 1EPWA 3ETPA 2QQJA 4AGGA 3EXUA 4ISQA 5B4NA 1YYNA 2AH2A 1I9RA 1D4M2 2IVIB 4O7XA 2J1TA 3NV3A 1QOSA 5LZ6A 2ZEWA 5F7UA 1HLCA 4LBQB 1W05A 4B4QA 5A7PA 4ZS2A 3WF0A 1H8TB 2P5BA 3KCYA 2QJVA 5B4XA 5FPUA 2VECA 1GNZA 1NYWA 1FPN3 5FMOS 4XF1A 2WS92 5F5QA 5FLHA 1B35B 3V0BA 1PZ9A 2P6HA 4R9AA 3AZZA 1J3RA 4S2FA 5A6ZA 1W2TA 3JBG2 5IK8A 4CCLA 5C3PA 1URXA 1RJ7A 2IUWA 3IDAA 1W8WA 2DUOA 2QKDA 1SLAA 1CIYA 2I45A 1GWKA 3AKTA 3KLSA 3VL8A 5HCHA 1SMVA 3RZZA 3AZYA 3KV4A 5D2AA 1AR92 3JQXA 3VBOA 3VDBA 3K46A 1G9AA 1SFPA 2WAOA 1QJY2 2XVKA 3U14A 4YW2A 3SLIA 5FRAA 4R8HA 3HQRA 3LEKA 4NAOA 1AZDA 1DYPA 1PGL2 1YRZA 2JEMA 1FMD2 1PGW2 3WP4A 5DZGA 3QH6A 4D0QA 3U0ZA 1YQCA 1VAMA 2R30A 4LHNA 1QJX3 2OW4A 1NQJA 3P5BA 1Y9MA 1S55A 2VL4A 3RMXA 3PIJA 3PUSA 1K5JA 2VUDA 4KWJA 1R091 4YGEA 3BU7A 5FZ7A 1KS5A 2O0OA 3VD7A 3KF5A 4LIUA 4A3ZA 3D0JA 3NAPC 1UYXA 4DXTA 2BVVA 1I6XA 5F5AA 2XJSA 1RUE1 3EO6A 4BK5A 1JOPA 1AR62 5C71A 4NHLA 2ADDA 2IC1A 4RN5A 2GP5A 3NMBA 3FX3A 4QT6A 3ILFA 4YWAA 4CCEA 2EXIA 3RDIA 3S5QA 3ZKUA 5CADA 4KMQA 3I8TA 3EJKA 1SFNA 2JDMA 4QU1A 1ZA4A 5FLIA 3V0AB 1ZRDA 5KBFA 5FMDA 1RUG2 2G1MA 2P17A 3LD8A 4CEYA 1KDKA 3AB0A 4UFJA 1O5LA 3POYA 1QEXA 4LHLA 5FYHA 1GICA 1UIKA 4RS5B 3THTA 5FOBB 4JGYA 2PYTA 4Y4YA 4YW5A 4Q0SA 1W99A 4NO4A 4OLLA 1EV11 1JXNA 3M7AA 1EPZA 1QJU1 3OGSA 2P1BA 5KXDA 3MV11 4WVWA 4XAAA 5A32B 2ZHKA 4NIGA 4LITA 3LEGA 4CCKA 1VRBA 5JXGA 2VG9A 1UY3A 2GNBA 1J59A 1VB4A 4S2HA 4RHV3 5FY9A 5LRSA 5DXDA 1T6GC 3ZDSA 3AZXA 3VBFB 5KC5A 2QFEA 2ZAAA 4UFMA 3ZFFB 1PO23 4RYDA 4Y4RA 2GH2A 3KHBA 4KH9A 1BEV1 2XJPA 2RS51 3ACLA 2JKXA 3B5LB 4LBJA 5EFUA 5IWFA 2WQ8A 3DYMA 5IVEA 1FOD2 1GQHA 2ET7A 4PDWC 3UJQA 5J09A 3R4UA 5C5UA 1CESA 5LK5A 3WF3A 5F9TA 5IK4A 1I5ZA 2WIIB 4LUMA 1VRH1 2YGMA 3G7DA 1JUIA 1RUD1 2BGPA 3CMGA 4D7SA 2CAUA 1HB3A 2L9LA 4ASMB 2ZGUA 1W8ZA 4BA6A 1AYN3 4XEZA 4LMFA 1ONAA 4NR1A 5JOXA 2JDKA 5T50A 1ND2C 1W8OA 3VD4A 1MQTC 1NOVA 1W28A 2PELA 3I2GA 3DEMA 5EIYB 4OI0A 4U2AA 4AI1A 1IKQA 3DCQA 3HNMA 2JD9A 4OHZA 1YQ6A 5A3OA 2YROA 2VZOA 1HB4A 1KD7A 3BODA 3AMPA 3CL1A 3NNLA 3WCRA 5FYIA 1FV2A 1ZBE2 2W3JA 2XONA 5FMOL 1QOOA 3MYXA 5T5JA 4HMZA 2Y6FA 2W87A 1IQAA 4AEDA 2WO2A 2CAVA 2XB6C 3MF9A 4KWKA 1NQDA 2W1SA 1KEXA 1OFSA 4GZ9A 4QWNA 1WGPA 5IVVA 4HETA 4QM9A 1Z7S2 4FOQA 2Y64A 4IV1C 2CNAA 4Q4W1 3ATGA 2D40A 2BTVC 3JB4C 3NJXA 3VD3A 4LBNA 2R1DA 5LBFA 2OKXA 4QPYA 3ZMOA 4PLMA 5FP7A 3WOGA 2FCVA 2P2KA 4NROA 2G19A 1TG7A 2WZEA 1KGYA 4XFBA 3MIFA 1RXGA 2VCMA 4K21A 4CP0A 4COZA 1V6MA 5LWBA 1R093 3ORJA 4KG0A 3ZSJA 2F4LA 4AE2A 1AXZA 1XXNA 4XAEA 5CG8A 3POJA 1SDWA 2BW8A 4LKEA 4Y1YA 2ZOEB 4Y1UA 4OI2A 4IQPA 1UPSA 1Y43B 1UU4A 4CRQA 1QQP1 2WZR1 5IFPA 2WWUA 3AVRA 3SQOA 3CIHA 4HPKB 5FYZA 1WCQA 4YVSA 3H0OA 3O0XA 1JZ8A 5FYTA 1ZREA 4XW3A 1JHJA 1W90A 2VZVA 3FHAA 3GALA 3LZZA 1VAVA 4G3YC 4J1WA 3PU8A 4H7MA 4NHKA 5JZGC 2D6KA 5IATA 2X5IA 3LFIA 3NNMA 1NA1B 4XQWA 1W9YA 1DCSA 4FPGA 4LIVA 2JX9A 4Y20A 3WDVA 4RR3A 4LA3A 5C4WC 2ZGQA 4YVWA 4BMEA 5C3RA 1O4YA 1RUI1 4P9XA 5I8SA 4PT6A 4WM7B 1BKZA 1EV13 1IPKA 3MLKA 1QJU3 2WFF1 3PLQA 4BISA 5CB7A 1FI2A 3N9QA 3VZOA 4BQYA 1A8MA 2A6XA 1VE0A 3DPRB 5JI9A 2V73A 1OT5A 2JENA 1LULA 1MS8A 5FZHA 3VZMA 4ZKTB 4YW7A 2B5HA 4BIFA 1WBLA 1IG3A 2YB7A 2R32A 4MO3M 3Q8EA 1J1LA 4LO6B 1XJAA 4AFBA 2JG9A 1BEV3 1X8EA 4BQWA 2GC0A 3ZX7A 2Y60A 1IS3A 3HMYA 1ZX5A 3PJQA 4YW4A 3B94A 4MHUA 1AR73 1BVVA 4BB3A 4COYA 3VD9A 1STMA 1GZ9A 4QXHA 5FPAA 2HWD1 1JODA 2ZACA 1VRH3 1NUKA 2ET1A 2O14A 4GB33 3AKQA 2D6MA 2F17A 1AYM2 3T0DA 1H4HA 2WWJA 3NWKA 4Q4Y3 5F6LB 1H2MA 2BNOA 1K5MA 1Z78A 2AZ5A 2HEWF 2DVAA 3AK0A 1XSQA 3Q8BA 1GP4A 2PLV2 4FFHA 1KXGA 1RUJ1 3TWIA 3SITA 5JUVA 3WP6A 4Z2AA 5K0UA 4V2VA 3PVOA 5IVJA 2NYYA 4XJWA 4HANA 4E4HA 4UW4A 5IK7A 4EN6B 4Q4X2 4Y5TA 4HVQA 5LA1A 1GWMA 3F95A 1LENA 4DNYA 4Q8KA 2N7GA 4QU2A 3D8CA 3UKNA 5BNPB 2XJRA 2PHLA 3C7HA 4N53A 1H9WA 2WQZC 2D44A 3ON7A 1HJFA 4YGCA 4AHYA 4QKNA 2JIJA 4MADA 3MFCA 1UZZA 5KC6A 3ZOIA 1SBEA 2R073 3VBRC 1Q43A 4DFSA 4YFZA 4JDMA 4Y5Z0 1SACA 3AYEA 1CD3G 5D8AC 3MLJA 4BXSV 5AFBA 1JTZX 2ZPXA 2R061 4Q4W3 1VMHA 5LB6A 2GNTA 5KR7A 4IXLA 4M01A 2XJUA 4JDNA 2XBO1 1PZ8A 3VL9A 4AQSA 3VBOB 3MIHA 1W9TA 2WLPA 4C0BA 3WW4A 3GCXA 3ZN5A 1JN2P 3A21A 4YNIA 1IHMA 1MR5A 1ZZ8A 4XABA 3RWNA 3ZXJA 3HN1A 1DZQA 3C7EA 2XDVA 1QMJA 1AL22 3IAPA 4CDXB 3RZLA 2GH8A 4K1ZA 4Q5OA 1EAH2 5TSWA 3KGZA 3SXWA 3S30A 5JOZA 5I0SA 4KNCA 4RFT0 3WZ1A 1RMU2 3K3OA 3ZKYA 4KU7A 4AAPA 4HXCA 4E4ZA 1QQP3 1V9U2 1ZZCA 2WZR3 3FN9A 5FY7A 5IFTA 4P14A 3VV1A 1W9WA 4RA0A 4BQ5A 1PZ7A 1TMF2 2G4IA 2VOWA 2HWF2 4COUA 2WN2A 5F2SA 1LGCA 1TME2 3DKWA 5EP9A 1UW8A 3J8F1 1ASJ2 4LHSA 4ZXEA 3WW3A 2P34A 2BGCA 1SDDB 2D6PA 1DGLA 1H1MA 4B29A 1VBA1 4LKSA 4D7TA 3LIGA 4JVAA 3IDEA 4FPKA 4IEOA 4YFWA 2JKBA 4OQ9A 5A7WA 3RYPA 3ZLIA 3TN92 2WNUC 4OHVA 5A33A 1IS4A 3OUJA 5EV7A 4GKXA 1WMEA 3WVJA 4WM8C 3MW4A 1VB2A 1PK6A 5C3SA 4MGSA 2WQ4A 3ILNA 1VMJA 3WNMA 5A3TA 3RZGA 3IPVB 3HN3A 2ZGMA 1DZRA 2ZGSA 3ZYJB 4B1LA 2G9GA 4AF9A 3I3QA 4B7KA 1W0NA 1VP6A 4YZ1A 4UI9L 5FZMA 4E2QA 2QQIA 3PTRB 2GMMA 2WZ8A 4ATEA 3HNYM 3WDXA 1MVQA 4I02A 3PUQA 1OMIA 4EJRA 3WQ7A 4LHKA 1TQ5A 4CDQA 2EF6A 4OHYA 3NV2A 1RUI2 3QACA 2VQ0A 4MXVA 4P9JA 2HWE2 3FJSA 3X29B 4AVVA 3N4MA 4W6XA 2W68A 1W6QB 3ALQA 3GM8A 5LA2A 4L9BA 4AEJA 1MZEA 3AC0A 4COWA 4W50A 5JVVA 1ZZBA 2NMNA 1PO12 2DBIA 2W47A 4WBBA 4ASKA 1G6NA 3LEMA 2GSYA 5FMBA 4OI1A 4K3UA 1HXS3 2CGNA 4XILA 1KRIA 2CTVA 1QJEA 4B8EA 5CFDC 5FQ0A 1HQLA 3MZHA 5LA9A 1IQDC 2XL9A 4FCAA 3PVNA 2AACA 4YLZA 2JDPA 3CHXA 1N3OA 5CKQA 1J3PA 1UY1A 4WZFA 3EB7A 3FC0A 1RUF2 4DPNA 1DQ4A 3HWJA 3MF6A 2YBSA 4XBLA 5CIRA 3NAPB 4XDQA 4ZU7A 5D21A 3NJZA 2ZGTA 2IFWA 5LBBA 1POV3 3VKNA 3WNLA 4K6BA 4OVEA 1V70A 5C8CA 3VZLA 2W94A 4UW5A 1BMV1 4OFGA 4YRDA 3RRDA 3VDDA 4DINB 2PN5A 3CNAA 4XJ8A 1MEC1 2XBO3 2VULA 2Y26A 3DYOA 1CJDA 2ZGLA 3POGA 4QKFA 4HVOA 3ZFGC 4AG4A 4JDOA 3JD72 4UT5A 4XQ4A 2ERFA 3H7JA 4PF1A 1ZRIA 2ZJCA 3JB8A 4MLOA 1JU4A 4QQPA 1W0PA 4YZ4A 1AL0G 1L7LA 2B8MA 4QPGC 2YC2A 1VBB3 2GMPA 2SLIA 2ORZA 4Q0UA 4FFFA 1ULDA 4Q2FA 4R4XA 1F4AA 1XNBA 1BBT2 3RJ2X 5ABJA 1OURA 1RHI3 2VOTA 2VZ1A 3WP3A 3A23A 4C0HA 5FWJA 2ZAHA 1OLQA 1ULCA 1UYZA 3FWEA 2H6BA 1KQRA 5FXZA 2XG3A 3QOPA 3AFGA 4HKOA 4LOTA 1C8M3 4YM0A 5FZGA 5IHRA 2ZX0A 4YM2A 5FPVA 2YHJA 3BN6A 5KXCA 1W6MB 2DU0A 3HQXA 2FHRA 2OVUA 3H42B 3KCXA 1HIXA 4QX5A 1GOGA 3H1WA 4FPOB 4TSVA 5JIAA 4XXPA 1LOGA 2X8KA 3D0SA 1VBA3 4MX3A 4E4SA 3B3QE 1NXD1 2RR12 2D6OX 1C3HA 4I0WB 4NRMA 1FNZA 4QM8A 1D4M1 5FZFA 4RSUA 5A7SA 1IOAA 1ND2B 4GA9A 5GLTA 5J98B 5LBEA 4JHZA 3WG3A 1AXYA 3PUIA 4E27A 4W65A 3MIGA 4XZPA 2CV6A 2K9ZA 1A78A 1UD1A 3KF3A 3GBGA 3I2FA 5JAXA 2PMWB 5LEKA 4LLOA 4IEVA 1DG6A 2J1UA 4L8QA 2W52A 3W9AA 1JBCA 4Q4V3 2WS91 5SV5A 2C0ZA 2R7EB 4Z82A 3IT8A 4QXCA 1DQ2A 4M4PA 3VBSA 4WVVA 4FPEA 3VZNA 3WDYA 1JS9A 1K12A 3C7OA 1AR82 3AKSA 3DUIA 3GZAA 4AI2A 1OSGA 2WAAA 4HT1T 5BNNC 4XVHA 4G4FA 1SEFA 1UX6A 5FZLA 2VGDA 3KQ4B 4DEVA 5E6HA 1AR91 5EWSA 3BYWA 3ACFA 3AP9A 2AEZA 4QAWA 4DMIA 3I49A 3BIWE 1QJY1 3S7EA 3J7HA 2WZPP 3VBHA 5C9AA 5ACA2 4FAGA 5CFCA 5DMYA 1PGL1 4MXWA 4K7JA 4MSVA 3HIFA 1FMD1 1PGW1 4L11A 3OGVA 2JB4A 2VMIA 1DQ1A 1GP5A 3HQUA 3U37A 3AZWA 2ZBJA 1HN1A 4XIOA 1T2XA 5A1AA 3AMQA 5FJHA 1A6CA 3NNGA 3QLQA 2VXJA 2QQOA 5K0UB 1G9BA 2EIEA 2AREA 2HBUA 2WT1A 1C1FA 2P6CA 3CJIA 3M3EA 1NLSA 2P3JA 4XCBA 2E7TA 5DAQA 5FZAA 1BVP1 2Y8KA 3ZSKA 3JQWA 1AR61 1JU3A 3WHUA 2AYHA 5LEJA 1OXCA 3R0RA 1HRI2 4RFRB 4CPBA 2BNNA 4MHRA 2R043 4C91A 4YPJA 4GIQA 3USUB 5FPBA 3KGLA 5T5OA 4UFKA 1HRV1 2ZX2A 4OZXA 3U1XA 4FQZA 4WZCA 2XQRA 2XWBB 1ND3B 2ILMA 2W08A 4FXGB 4V2WA 4WVMA 4AEKA 1RUG1 4PQQA 4N9IA 4CXWA 3WQ1A 1LHOA 4LLFA 5FKBA 4JQRA 2QQUA 1N1SA 5FUNA 2O8OA 5C4WB 3OCPA 5LY2A 4AVSA 5CEHA 4FAHA 1EP0A 3WXPA 4Z2WA 4PIXA 1YWKA 1SLLA 2JG8A 4EWDA 2UYBA 4Q0PA 2HWB3 1R082 1S0EA 2EXJA 5L9BA 1ST8A 4MGKE 4BE3A 5JR7B 3DXTA 5IVFA 5HXMA 1Q5OA 2AGSA 3MBWA 2FD8A 4CCCA 4Q8LA 2BVBA 3H8UA 2Y6GA 4LUKA 3D3AA 1N3QA 1WD4A 3FLTA 3VBOC 1HX6A 1XNCA 2NMOA 4AHWA 1FOD1 3WR0A 1SFYA 4BWOA 1C57A 1VBE2 2EICA 3I2KA 2BV4A 3ZFEB 4PBOA 4IV3A 1VBC3 1H6XA 4FTEA 4Y24A 2B39A 1TEIA 2Q1ZB 5DUWA 2IWGB 4JHTA 3OGGA 4NPMA 2WNEA 1FAYA 4DZGA 3O1SA 5F6KA 5EJ3A 2R16A 4FBFA 1LRHA 2VO5A 5CAZA 2HWC3 4GWIA 4BXFA 1WA4A 4TZDA 4L92A 3KT4A 3WF2A 2NQYA 4OI4A 4EQVA 3RZMA 2VUCA 2ZA9A 3WUCA 1VLNA 2X05A 2ES3A 4GWMA 3ZXAC 2W2IA 2WABA 4HLTA 4QXKA 1WW5A 4CPBD 4CU8A 5LBCA 1OKQA 4IEXA 1ACCA 4FTSA 3PU3A 5CA6A 1PK6B 1ZBE1 2VUJA 2VMHA 3BPZA 3DECA 4IEPA 1CAVA 1SLIA 1AJKA 3RI9A 4AGVA 1S4CA 1UF2C 2UU8A 1RUH2 2ARXA 2DUPA 2FZ2A 1JYNA 1ZM1A 2JE8A 3JBG3 3KCCA 1HW5A 3PL0A 2VBBA 3S5AA 4GH4A 4XIKA 4BQ2A 3BTAA 3SEEA 1FXZA 3WF4A 4CEYC 1OFNA 5A7OA 3OGJA 4MGTA 1W39A 2GC3A 4FFGA 4HOOA 4OUEA 1Z7S1 3KSCA 4JGYC 3VBRB 3EQEA 5J36A 3WNKA 4BH9A 3B01A 3WP5A 1F5JA 2BWCA 5FXXA 4DXZA 2RJ2A 2QQNA 4GULA 5D8AB 1R1ZA 3AL6A 3FLRA 1CR7A 2VZ3A 3FFQA 1CVNA 4GMP1 5C70A 2XGXA 5GLUA 4EV0A 2JB8A 3E6DA 5KXBA 1FT9A 1XE7A 2EXKA 3ZXEA 3DL3A 4CDWA 1X8MA 3WNPA 1W6OA 5HCBA 1COV2 1DGWA 4K20A 5DDJ2 5A80A 1WLWA 1V0AA 2W95A 2D6LX 3BGAA 2XLGA 4XBQA 4IEQA 4BDVB 1SZBA 4IL7A 2QBXA 3OGRA 5LRRA 3I3BA 3P6BA 4DS0A 4EYUA 2EALA 5EHDA 1SLBA 3T09A 5FY8A 4KL1A 3LA2A 3M70A 4DRRA 4YSFA 3UGHA 1OQEA 1R1A3 1XNKA 1J84A 1W2OA 3JZVA 1YEWA 2C9KA 3G6JB 5FDBA 4LEJA 5JOYA 2VW1A 4FO9A 3FE5A 3O1PA 4LNVA 1MZ5A 4LORA 3PUAA 2ZMLA 1E57A 1QH7A 2DTYA 2QZ3A 1QDCA 5G05L 5FYYA 5JSOA 2XHNA 4BIOA 1PMIA 2A75A 5FCCA 2FMDA 2O1QA 3OSDA 4CEWB 2WINB 1XBFA 3CZUA 4I30A 3GCWA 1UMIA 3NKTA 4CDUA 2A70A 3J7MA 3I4IA 4A7KA 1NCQA 5FK8A 5T5PA 1UKRA 2JD4A 2MEV3 1UMHA 2WNVA 2J7MA 5LY1A 1MACA 2WKKA 2WNUB 2P3KA 1RTVA 2Q30A 4AEDC 4WM8B 2ZEZA 5JPNB 1GR3A 4DY5A 1C5HA 3VHRA 4LTAA 2RDQA 2DVFA 3E6CC 5IAVA 1Q3EA 1HRV2 1S0DA 1DBNA 1MS1A 3UV9A 1YI9A 4OHXA 3DYPA 3ZSMA 4Y20B 4N43A 2RM21 1AX2A 4M0NA 1AYM1 4FOVA 3I2IA 1PMHX 1WCKA 3R4DB 3RPQA 5JIUA 1O3RA 4Q0VA 1GYKA 1UY2A 1CAUB 1GZWB 1ENRA 2PLV1 5JR2A 2KR2A 5ERLA 4AFCA 4XOGA 5F3CA 5T54A 1AJOA 2Z42A 2QZ2A 5GLWA 4Q4X1 1NE4A 2E32A 3PUHA 2XLAA 4QX0A 5GZCA 4YVSC 1TNFA 5CFDB 1G8WA 3ZYBA 4RQPA 4LK7A 4JAAA 4R9DA 4XMAA 1A34A 1J3QA 3PJYA 5KHIA 1VALA 2BRTA 1PGSA 1LB2A 2X5IC 2RJLA 4Y1XA 4XUQA 3OG2A 2B7YA 1NXMA 4PIYA 1OLMA 5FXVA 3ZN6A 4KBZA 4RR3C 3VBSB 5FZEA 3RZHA 3BOWA 1Z7S3 4YVWC 3SCHA 1JZ6A 5FY1A 2W1WA 2FDFA 5HCFA 1WLCA 5FY4A 1NLQA 4RGAA 5ANQA 3VB9A 1CX4A 2VJXA 2UWCA 4YGBA 2HEVF 3HBKA 3JU9A 4CP9A 5APAA 5HXVA 1CAXB 4GXLA 1M06G 3VBHB 1N47A 2FQPA 1E5RA 1C8NA 5JMCA 5I0DA 3APBA 1GOFA 1S2EA 3K75B 1I5PA 3ZFGB 3MIDA 5J37A 1AL21 3W58A 4B4PA 1OA4A 1EYBA 1NCRA 3T3YA 4A4AA 2ZEYA 3PHMA 1EAH1 2YC0A 1G9CA 1QNYA 4QPGB 1IS5A 3M8LA 4OHWA 1R64A 1DDLA 1RMU1 4RHV2 1W6NA 4JQTA 2VCAA 3ECQA 1V9U1 3B00A 4KI5M 2XUMA 4CUCA 3CJIB 3ELNA 1PO22 3SHRA 5EJ1B 2E7AA 2OT7A 4K8FA 1TMF1 5DUXA 3OJBA 1AX1A 2EIGA 2HWF1 5FV3A 1G9DA 3VZJA 1UIJA 1K5MC 1TZOA 4D6RA 1TME1 5I91A 5EPAA 2K46A 1ASJ1 4CYDA 5A3LA 5BV6A 1CAWA 2FDGA 5K0UC 4Z1VA 1HQWA 1YFWA 2VU9A 4N90A 2YFZA 1H4GA 1YJLA 4WVMB 5CG9A 2UY8A 1NZIA 1F35A 4LO7A 2YV8A 3AL5A 3TN91 5FKCA 2IXLA 4PLOA 4YW3A 5FXWA 1ENQA 5JXHA 1WLDA 1WW6A 5CKMA 4JKMA 2Q8CA 1AXKA 1XE8A 4QGLA 3AP7A 3VDCA 4K8RB 1RUE3 4N53C 3ZMNA 3IMNA 4XF4A 1Y7BA 1UYYA 1E5HA 5FPXA 3NL1A 4XUTA 2ARBA 3IM0A 3U4SA 1LOFA 4QHZA 2OPKA 2W9XA 4LPLA 1GBGA 5EQUA 2E26A 1EUTA 2BBAA 1ND3C 4JGZA 3J4UH 4FPLA 3URFA 1V6OA 2VMGA 4BYYA 3WW1A 3WQBA 2DURA 3MHZA 2LM3A 1CGPA 4YARA 3PIGA 4OZOA 3T2QA 2BPA2 1DLLA 1ULPA 5LA0A 3DV8A 5LK7B 1FYUA 5FIXA 3L2YA 4A6OA 5BNNB 2HWE1 2XJTA 3AP6A 2IFRA 2VZQA 4ZPIA 2C1FA 5FZOB 1AYM3 4NIHA 2LTNA 4C1WA 5I0RA 1V6LA 2W92A 4Q1RA 2DYCA 3VBUA 3TEWA 3VKFC 1WCDJ 4P9YA 1O8SA 2ARCA 4PDWA 3NJVA 2QQPA 1L3JA 1PO11 3OD4A 3U4XA 5AVAA 2WWSA 4P9GA 2HH9A 3I59B 2HYXA 4M3CA 2AUYA 2Q1FA 3FUQA 3HEIA 4PIZA 4NHMA 3L9JT 3LAGA 4K40A 4YW1A 2RS53 3T2TA 3K77A 1FATA 2C26A 4SLIA 5F3EA 2DCKA 4UF0A 5GLZA 3ZFEC 4NIAA 2PHXA 4XC9A 1DP0A 2G9FA 1UZVA 4H7LA 1SPPB 1RUF1 2VMFA 4CXYA 3HJRA 4IE7A 2ETEA 4NRPA 2RM22 4H55A 1RUD3 1U5ZA 4QPWA 1OVPA 1GZTA 4JCKA 1ULOA 5FY5A 3RZKA 2CYFA 3W20A 4CE8A 1XU2A 2J22A 4XFAA 4GH4B 1LOEA 4AHXA 4Z92B 2A7AA 3NW4A 4PQ9A 2PHDA 1PMJX 2D7FA 1U5IA 1WMDA 2Y6JA 5H9PA 3AXDA 2VXRA 3BKZA 5GLVA 1UOFA 3DN7A 1HB2A 2UURA 4LO5B 1NLRA 1H2LA 5CKNA 4P9WA 4IE6A 1W2NA 3MIBA 5HV4A 2WYSA 5F3IA 2E9QA 1PK6C 3TEYA 3JD71 2OXBA 3IMMA 1PX4A 2RMU2 1QKQA 2LROA 4JTNA 3I2OA 2YXSA 3RMYA 4IV1A 4E2GA 4A45A 5JMOA 4H14A 2D5HA 4A41A 4S2DA 1POV0 1AL23 2ZZQA 4HKLA 2BWAA 3A4UA 3RWKX 3AKPA 3SKJE 5GM0A 4XUOA 3V0BB 4FXKB 5L7OA 1OKOA 1GU3A 1BBT1 3GYDA 1W8TA 4FI9A 4Q1PA 4ATFA 1JHNA 2R49A 1DQ6A 4TTGA 1J58A 3QD6A 4BZ4A 1PVC2 4IESA 4CDQC 1SHWB 2Y38A 2VC9A 4BU2A 5J48A 3AYDA 5GZEA 1C5IA 1D2QA 5F37A 3OUHA 3TBDA 1N1VA 3VKMA 1Q8OA 5H9QA 1MZ6A 1RVF2 2HWF3 4IEUA 4AI3A 4F7ZA 1AR72 4PF5A 1YXWA 4OULA 3H3LA 4CUGA 3V64A 4MZUA 4QKBA 4LA2A 2JICA 2GALA 2B46X 3MDPA 1C28A 3TNQA 1YCIA 3K4DA 3MV01 4GB32 4Y22A 4HONA 4XF3A 4ZU4A 2Y6HA 2RR11 3M1HA 4Q4Y2 3JCIA 4P08A 4QPIA 5JZGA 3N9LA 3GXUA 1F31A 1LESA 3TN93 1JZ4A 3HBZA 4AOCA 2Y6LA 1IKPA 2CWMA 3OYWA 3PDQA 1QF3A 4RGGA 3CJXA 4KBBA 4E9KA 3OY8A 3POFA 5FYBA 5H9RA 3LSDA 4HK8A 3SCFA 2WNVB 3WG1A 2VZPA 3ZYHA 4A3XA 3M3IA 1VIWB 1S0GA 2VTXA 1A3KA 4GAZA 2C4XA 1QJFA 1YQ2A 3R05A 5FP9A 5C8CC 5IAXA 2PAMA 2CDPA 1BYHA 4FPJA 4GWJA 5JWPA 2CSGA 3SC7X 3VDDC 1CJPA 2BOIA 1AR81 2YPDA 2BFUS 3NV1A 4CEWC 1SLCA 3VD5A 2F6BA 3I3MA 2WDBA 4B7EA 3E6BA 1RUI3 1RINA 2XXZA 3O7OA 4UFLA 4CEYB 2HWE3 1W6PA 3IWZA 1WA6X 4LE4A 5LATA 2WFF3 3O14A 4Q0QA 2VOKA 5FPLA 5FZ0A 4JGYB 2PQQA 1IG0A 5ACA1 2B4KA 4XHXA 4K1YA 4NJ4A 4ZZ8A 1F2NA 3OD0A 1YC61 3A7QA 1W0OA 4ZY9A 4PLNA 1H30A 3GHNA 4A2UA 1SQ4A 3LB9A 4NPLA 1W3VA 3OBAA 4SBVA 5EXOA 4A44A 1X9PA 2ZHLA 2VQTA 2YGLA 4JKLA 1CWPA 3CF6E 3RVHA 1OI6A 5HCAA 2PHUA 4J25A 4CCMA 1UU6A 1JH5A 2QUOA 2XR4A 1ZRFA 2V5DA 4YG0A 1RITA 2HWD3 5L9RA 2QQMA 4A7YA 1O4TA 3WW2A 4G9SB 2DWRA 2RS32 2TBVA 5CU1A 1HRI1 1ENXA 2Z79A 2BDRA 5FZCA 4QDRA 1VMFA 2Q5TA 3LIHA 5EZWA 5FWEA 5B2GB 5K7PA 3ES4A 1ZNPA 5FP3A 1RUJ3 3B9IA 2YPJA 4I01A 5FYCA 1Q8SA 3AYCA 2EIDA 4RGKA 2E6VA 4V1PA 2ZGOA 1AUYA 4LE3A 2E33A 4NWVA 3JD73 2FDIA 1CZTA 1X82A 2CDOA 2DVGA 3PVBB 4LBQA 1LEMA 1UXXX 2DTWA 3K2OA 1H8TA 4BMBA 1X50A 4XF9A 5C3QA 3RSJA 1LHVA 1R081 3IKWA 3ZN4A 3VBSC 2BERA 1F5FA 5DQ0A 3H8XA 2D5FA 5GKAC 1B35A 1K3IA 1NCRB 1OD5A 2PAEA 2RS12 3H7YA 1PIV1 4JC1A 2H0BA 5FY0A 4AEDB 1WD3A 5GZGA 4QGMA 1HV1A 1BK0A 2JE9A 2WFPA 3E5XA 5CISA 1RYYA 2R063 1CZVA 4L99A 5K9YA 5JXIA 1HV0A 3NO8A 4B3NA 5A3MA 2BOJA 3B93A 2D3SA 3H1MA 2J1EA 2VBPA 1LU2A 2PHFA 1VBE1 3VBHC 1DYOA 3CLPA 5C9AC 3KVBA 5CFCC 4NHXA 5EYXA 3T0AA 3U10A 3ZYFA 4MG2A 3OPTA 1LOCA 5A1LA 3AZVA 1OOPA 2YYOA 3I97A 3AXEA 3ZXGA 2ZMNA 2Y34A 1LEDA 2D3PA 2DFBA 2YBPA 3K3NA 4IW3A 5JOWA 4A42A 5C8WA 3LFMA 1ULGA 1ZZ9A 2ZABA 1NY72 3P3NA 1PM7A 3CJIC 4AW7A 3ZYPA 5KXEA 1UO9A 2R0FA 5IVCA 1WMFA 4ARXA 4DUWA 2OQ6A 2PHWA 1HXS2 3N7MA 1BZWA 3AMNA 4P9LA 3WSOA 3RNSA 5I8YA 2NN8A 3SH4A 1UZWA 2Y0OA 3NQHA 3D5OA 3OBRA 4YVSB 2CHHA 2WT0A 4IEYA 1RUH1 3HNBM 5FYSA 3J8F3
chains in the Genus database with same CATH topology
4I0AA 3H50A 1CN1A 1O5UA 2NPIA 2A3XA 2X5IB 4F8AA 1O3TA 1H0BA 3M3QA 2TNFA 4LBQD 3C2UA 4H3WA 3V0AA 4RR3B 3FHIB 5DUVA 4YVWB 1YFXA 2DCJA 1RUC1 5T3NA 3VZKA 1GKBA 1RC6A 1MS5A 3NKGA 4RD7A 4DY3A 2JG8C 4RS5A 3KQRA 4YGDA 1H2NA 2QCSB 4TWTA 1DGWX 5A32A 4B4RA 4ISRA 4PCRA 3UL2A 1UN1A 1COV1 1CIWA 5DDJ1 3IIAA 1O4ZA 4I0BA 2E7QA 3VBFA 1HKDA 2JG9B 3PMSA 1PVXA 1VBB2 3ETQA 3ZFFA 2BNMA 5BY5A 2DFCA 1U0AA 3B69A 2VH9A 2MPFA 1H2KA 4IV3C 1KJRA 4BPZA 5KHJA 2NZ9A 5GALA 3QH7A 1QXPA 2C9AA 4DRVA 3VKLA 3O5SA 3U07A 4FSJA 2VY0A 2DCYA 2IZWA 4CP1A 1KJLA 2ZTNA 4URTA 1XYPA 2TUNA 3M2MA 4Z07A 1K5MB 5H9SA 4QQOA 2UWBA 1ULEA 4JV4A 4NVPA 4AFAA 1ZZ6A 3E97A 3TOJA 4XFCA 2D93A 1A8DA 3LKJA 2HYKA 4I3PA 5C6CA 4O9GA 2A6ZA 1R083 1O7FA 4I2OA 2PHTA 4GH4C 4AVBA 4LULA 4HN1A 1S1AA 4N53B 1UMZA 2D3RA 1WUVA 4AFDA 3FBMA 4XTPA 5JI7A 4Q4V2 3ZPYA 1ZBA2 3AFKA 4FPHA 3T1MA 2XHKA 3B9CA 5FO9B 1B09A 1EY2A 3AP5A 4FP2A 4QMAA 1MEC3 2I74A 3ZXLA 2DUQA 1LECA 4M3CF 4XFHA 2XPJA 3POSA 2ZKNA 3HAGA 4IETA 1JW6A 4BM8A 1TNRA 4CDWC 3ZYGA 3MW3A 5BXXA 4XE9A 1ZVFA 4FT8A 4Y1VA 4BLJA 4HBNA 2DV9A 3CU7A 4HL0A 3U11A 2VPVA 2EAAA 1PIV2 4AQ2A 1VJ2A 2DVBA 3V56A 1S0FA 4XPVA 1DHKB 1UAIA 2BYVE 5L36A 4Y26A 1YI7A 2E53A 1Q56A 1RUH3 5CBLA 2IXKA 4HPKA 3RI8A 4KGGA 4DB5A 2IXJA 1ULFA 2EA7A 4LBLA 1LTEA 4EROA 2QE3A 2WC2A 1VBD2 1LKNA 2A5ZA 1OHFA 1V6KA 2R042 3E5QA 2WJSA 3TB0A 1NA1A 1D4M3 1I3HA 1RJ8A 1NCQC 4FQ4A 5DZEA 5FPZA 1W2UA 1CONA 2WNVC 2ZX3A 2R6QA 4MVTA 5A33B 4WM7A 1UZYA 2WSVA 3I7DA 4Q29A 1BXHA 2GNDA 3MEPA 1D0HA 2WS93 2HEYF 3KM5A 4XYXA 1COV3 4ES9A 5DZFA 3DPRA 5JCTA 3ES1A 2WSUA 4AYUA 4HSLA 1C4RA 2HWB2 3H9AA 4RHV1 3CO2A 4N43C 3J9SA 3HT2A 5KHGA 1PO21 1AR93 3BB6A 3A0KA 1QXRA 5FPXA 3GBWA 4CDQB 4J1XA 2XJQA 1RUC2 5CVRA 1D2SA 1QJY3 3AYAA 1GSLA 3LCPA 4LR4A 4NOTA 4LT5A 3N7KA 3OTFA 3R4SA 4UBHA 4AI8A 1QHDA 1FMD3 1DGRN 3FZ3A 1VBC2 3H3UA 4MUVA 3RJRA 2AENA 3S0MA 2ZS6B 1Q8PA 1GZCA 3D82A 1LHWA 2HWC2 2UYAA 2ZX1A 5FQ0B 4RQPC 3WY6A 1RUNA 4FVVA 1S0IA 1AR63 5T52A 1LHNA 2XKPA 4GWNA 4XHBA 5AC92 4META 1ENSA 5BNPA 3TAYA 3PMEA 3INAA 4K9SA 1HRV3 5C8CB 2XLFA 1RUG3 2DVDA 2IXIA 2PA7A 3A0NA 4ORFA 4YYOA 1LGNA 3SH5A 3ROUA 3VDDB 2DF7A 3RS6A 4UXAA 2C5DA 1V6NA 3GHMA 4YZ2A 1MVEA 3EBRA 2ZGKA 2K2SA 1OOPB 3RYRA 1NCRC 5FFOC 2ENRA 3ZO0B 1UL9A 4F3JA 2CWSA 4QGNA 1AVBA 5E89A 4CDXA 3NV4A 1OA3A 4KWLA 2OYZA 2JDZA 3WNXA 1FPN2 5ABJB 2X29A 1S2BA 2LUWA 5AFEA 1FOD3 2GC2A 5AVPA 4R52A 5K8SA 2XWJB 5BNOB 4FTBA 2UWAA 4XETA 1MS4A 2HJIA 3LA3A 1LCLA 1YIFA 2W0XA 1RL3A 5FLJA 1RIRA 1UU5A 2H6CA 1YUDA 4X6QB 1R1A2 1Z0HA 4R9BA 3K51A 2EXHA 5I8TA 3MICA 4ONUA 1U12A 5FOJB 1DZTA 1FNYA 3HT1A 1HDKA 5JSPA 5FAXA 2ZKLA 3WX5A 4R9CA 4FOWA 4FP3A 1QJX2 4LO4B 2RMU1 1LOFC 1ZBE3 4N7UA 3L2HA 2KA3A 2YUEA 4XQDA 2JXAA 2OZ6A 1O3SA 4JGZC 4XF0A 5I93A 1O91A 2MEV2 3IPVA 1JOJA 3MLLA 4U36A 1PVC1 2VW0A 4HVRA 1BJQA 1D0GA 2CY6A 3MFAA 3ZIWA 3KD4A 2KM2A 3VBUC 1OQDA 1RVF1 2V5YA 4GMP3 1SCRA 1AR71 1Q8VA 3THPA 4YZ5A 2Q0AA 4AXOA 4BHPA 2VVEA 5C9AB 1W6QA 5DG1A 3BALA 2VNGA 5CFCB 1ALYA 4MXWB 4GB31 2JG9C 5DG2A 1GNHA 1QU0A 2GC1A 2VW2A 1XNDA 4Q4Y1 4X8PA 1KDMA 5HBAA 4RL7A 3SH3A 4Y1ZA 1FV3A 5T5LA 4HN0A 3NVCA 3GNEA 1DQ5A 3GZTB 3ZVXA 5KHKA 4QQHA 2VUAA 1U5YA 4P9IA 1F9KA 5SV8A 5FTTC 2CL2A 3NAPA 3KS7A 2WA4A 2QNKA 2DU1A 1LOAA 1QOTA 3ZYIB 2WLQA 2ZGNA 2A3WA 4KGQA 5FO8B 5I0UA 4HK9A 1DGRA 1AYN2 3TNPB 4P5HA 5E88A 2R071 4ASLA 3KMHA 2ZHMA 1V00A 1REFA 1U5XA 3PTYA 3UJOA 4AEMA 2LALA 3LOIA 4TLFA 1YLLA 2JE7A 2JG8B 4FPCA 5L7OC 3S7IA 4LO8A 5BUVA 3Q9OA 4INDA 5D1IA 2GNMA 3ASIA 4QD2A 3D6EA 2Z2SB 1MZFA 3AJYA 4MH0E 1SLTA 5KWRA 1PHMA 3UKVA 4J6GA 3FBYA 1H1AA 2QDNA 4NPRA 2ZZJA 2RM23 3ILRA 3UKTA 2NP0A 4DQAA 1H8VA 1QH6A 1S0JA 2RS31 4IV3B 1W6MA 1UCXA 2GAUA 4IERA 4CP2A 2PLV3 4QPIC 2GU9A 1DYKA 1GLHA 4XFFA 3SNMA 4MV2A 4BOWA 4ITCA 3N35A 2NLRA 4D69A 3TRSB 1OA2A 4Q4X3 5IT6A 2RMU3 1ND2A 2EVXA 1MQTA 1R092 4XTMA 2R0HA 3R6SA 4LBMA 2Q8OA 3MGUA 4EWAA 2VOVA 1CAVB 2VNRA 1JUHA 1NG0A 1RUE2 2E63A 3UK9A 5DUUA 3O0WA 3O12A 4XFIA 1LJ7A 4N9HA 2RS11 1V6IA 2SBAA 2CGPA 5C33A 4A7ZA 1PVC3 1DU3D 1BCXA 2Q4SA 1LR5A 3B7MA 1ZRCA 1RVF3 1APNA 1S0BA 3VHNA 1S0CA 2F4PA 3FUOA 3SCGA 2A6YA 1QDOA 2D6NA 2JECA 2OUHA 4R4ZA 2FZ1A 1EV12 4AVAA 1QJU2 1WW4A 4TYSA 1QJZA 4LBOA 4CDWB 5IK5A 3IN9A 1EAH3 1W6OB 1ZYBA 1NY71 1RMU3 1KS4A 1OPOA 4XFGA 2OA2A 1D4VB 1V9U3 4Q26A 1HXS1 4WV8A 1BEV2 3ZXFA 2RS52 3AKRA 1TMF3 3WT3A 4EWEA 3N36A 4AVTA 4N7IA 2IXHA 1TME3 1ASJ3 2XKOA 5T55A 1VRH2 1GANA 4ES8A 1RUD2 5IUQA 3MW2A 4W6YA 3USSA 3USUA 3RQ0A 1WBFA 2Y0IA 4JRLA 2UY9A 1POV1 1ND3A 1F8VA 4PJYA 4FPYA 3WDUA 4E2SA 3HR9A 4XJ9A 5JPMB 3WUDA 1JYCA 1H8TC 1DFQA 1QGLA 3HD8B 4CDUB 4C90A 5C4WA 1NCQB 3DF0A 1B35C 1CPMA 4L97A 2OUJA 3AP4A 2BQPA 1KITA 1QXJA 2Z5WA 2RE9A 4NN0A 1VBB1 2V09A 4ZXKA 3CEWA 1X33A 2XJVA 4XJUA 5JDBA 3N7LA 2R072 4GKYA 3PVEA 1XRUA 1RHI1 4GQ7A 1OOPC 2RS33 4N43B 4XXAA 3AX4A 3M4FA 4CTEA 4I3GA 4MGZE 4Q4W2 5JLVA 3ZFEA 1QY4A 1C8M1 1OLRA 2X53S 4AK3A 1PO13 2FBEA 3VGIA 1JYIA 5ABJC 4AQTA 2D98A 1XYNA 1AX0A 2PTMA 3FLPA 4PBPA 4OUMA 2P37A 3P3PA 2GDFA 4MGYE 4UW6A 2A3YA 4M0HA 5BNOC 3WHTA 2K0GA 4MGIE 1RUF3 2Z69A 4HZFA 4KU8A 3WD5A 4RQPB 4Q27A 1AF9A 1QQP2 2WZR2 2A73B 2RS13 3TYJA 2ZCWA 1REDA 3RYKA 4Q4V1 3WDTA 1TE1B 1ZBA1 3ZN6B 4XJAA 1OPMA 2MNGA 1AHSA 4BLIA 1YNAA 3N3HA 4RS5C 2A6WA 3DGTA 4X8NA 3VBRA 1LHUA 5D8AA 4NWWA 2GMEA 3LA7A 2WL1A 3WLUA 1IS6A 2WFF2 4HSJA 1KFXL 3T1LA 4QQLA 3OF1A 3M3CA 4DOUA 3AMHA 4D3WA 3VBFC 1G9FA 3ZFFC 1BBT3 3ME2A 3ZSEA 4FOYA 3I54A 3C3VA 3EHKA 2RJKA 4COVA 1LU1A 2D43A 4I09A 4XMIA 1W6NB 2P3IA 2JJ6A 4S2GA 2DCTA 3LGRA 3N7JA 4HKWA 1DQ0A 1PNFA 1YIPA 3LWCA 3QCWA 3GF6A 2HWD2 3MPBA 2PFWA 3ZSLA 4E4DX 1SBFA 3JUUA 2RHPA 1CQ9A 1Y9QA 2BEOA 1CAWB 1VBD1 1VR3A 2DCZA 2RR13 2R041 2ZMKA 1XYOA 1YO8A 1DIWA 3NSTA 3OBTA 1RUJ2 2XVGA 2WA3A 3GBFA 4CEWA 3ENRA 2GN3A 2QVSB 3WG4A 4F83A 2WNUA 2E51A 2VQAA 4AQ6A 4AWDA 1LOBA 4WM8A 3ZXDA 5E8AA 4YG6A 5GZFA 1AR83 2HWB1 2BBVA 4JGZB 2I2SA 2BFUL 3VLBB 5J96B 3KB5A 3IDBB 1UPIA 1YFYA 1DF0A 2EAKA 3VKOA 2AR6A 3WG2A 4EN8B 4QHBA 2ZGPA 3FFZA 4IEWA 4Y20A 2R062 3BCWA 4YG3A 2XH6A 3J26N 2ZHNA 5ACA3 1WLTA 3WQ0A 2XBO2 3VBUB 3POWA 3VHOA 3WDWA 2OZJA 5E16A 4PDWB 1VBC1 1N3PA 4M00A 1CAUA 1GZWA 1I1EA 1KFUL 3QBQA 4M3CB 4YM3A 1GV9A 4YM1A 2B45X 2HWC1 3KT7A 4EN9B 4IEZA 4CZSA 4UBGA 1MQTB 4AVCA 2VOXA 3AJZA 2IXCA 1RHI2 2TEPA 4XJZA 5CFDA 3IBMA 2YDEA 1HRI3 2YY1A 5AC91 1M4WA 5J7MA 3D4KA 1LODA 1WCSA 3E5UA 2MHFA 1OQ1A 1C8M2 2WT2A 2ZX4A 3ZXKA 1ZBA3 1NA1C 5I0TA 2A6VA 3VUOA 3JBG1 3J8F2 1NE6A 2VVFA 3LOBA 1HQNA 2Q1MA 4WM7C 3MIEA 5GJ6A 1RUOA 1VBA2 4ZU5A 3MI8A 1N1YA 1GFF2 3B02A 5BYNA 3DPRC 1CAXA 4L2NA 4M3CE 4IV1B 4YZ3A 2PAKA 1FX5A 2ATFA 3ZFGA 3OPZA 1X7NA 1PIV3 2GN7A 2HKXA 1XQNA 1FPN1 5L7OB 1YHFA 2W39A 1H1IA 2OIIA 4QPGA 5FREA 5FBZA 3K48A 3V65A 2B9UA 1CPNA 4AI0A 1VBE3 1RB8G 1Y3TA 3AM2A 3PNAA 5BPXA 4Z8BA 1QNWA 3WINE 4KG8A 2YZ4A 1MS9A 4EN7B 4KQ7A 1R1A1 4UW3A 1VBD3 4O9EA 3S6PA 1S2KA 4JRAA 1IGOA 1VAKA 3BOPA 4Y22B 1G7YA 1QWRA 1WW7A 1ZRRA 2XVLA 4X6RB 5HI0A 2O8QA 4WVZA 3RG0A 3LSEA 4QPIB 5JZGB 4D7YA 2KXLA 1QJX1 5E1RA 2D97A 2R1BA 2A71A 3OYWB 3SMHA 2FMYA 2NM1A 3OY8B 5BNPC 3WCSA 3VN4A 1MS3A 3W59A 5FO7B 1YJKA 2MEV1 1LGBA 4W6WA 1X36A 4JTOA 4HFSA 4OUSA 3I2DA 1N1TA 3FMGA 3WV6A 4EN0A 2H0VA 2BUKA 4FPFA 1C1LA 1SCSA 1BMV2 1RUC3 4CDUC 4MYEA 4AGRA 1W6PB 4XBNA 1MEC2 1O3QA 1J1TA 1NZCA 5BNNA 2ZGRA 2I07B 2CGOA 4AHZA 5KHHA 5J3UA 1RGSA 3M3OA 5JSRA 2YMZA 4LBKA 4CDXC 5DDJ3 1BQPA 1XU1A 3AMMA 4BCUA 5BNQA 3GZUC 5EYYA 3H1YA 3I59A 1IZ3A 3IDCB 2XL7A 3H3ZA 2PHRA 2GZWA 4AFMA 3ST7A 4GMP0 1G86A 2QDRA 1V6JA 2B42B 1H9PA 4GALA 4D94A 5GZDA 4BQ1A 1UKGA 5AC93 1ZZ7A 5L73A 3MPPG 3SISA 1BK1A 3O0VA 1GQGA 2VVDA 1MS0A 2VNOA 1YFUA 3KT1A 1PNGA 1Q8QA 4C1XA 5L19A 5CNAA 1IPJA 3VHPA 3ZIXA 4QQ2A 1AYN1 1SBDA 1REEA 3KZ4C 3ZYRA 1EPWA 4AGGA 3EXUA 4ISQA 1YYNA 2AH2A 1I9RA 1D4M2 3NV3A 1QOSA 1HLCA 4LBQB 4B4QA 1H8TB 3KCYA 2QJVA 2VECA 1GNZA 1NYWA 1FPN3 5FMOS 4XF1A 2WS92 5F5QA 5FLHA 1B35B 3V0BA 1PZ9A 4R9AA 3AZZA 1J3RA 4S2FA 3JBG2 5IK8A 1URXA 1RJ7A 2DUOA 2QKDA 1SLAA 3AKTA 2I45A 3KLSA 3VL8A 1SMVA 3RZZA 3AZYA 1AR92 3JQXA 3VBOA 1G9AA 1QJY2 2XVKA 4YW2A 3SLIA 5FRAA 4R8HA 1AZDA 1DYPA 1PGL2 1YRZA 2JEMA 1FMD2 1PGW2 3WP4A 5DZGA 3QH6A 3U0ZA 2R30A 1VAMA 4LHNA 2OW4A 1QJX3 1NQJA 3RMXA 1S55A 4KWJA 1R091 4YGEA 3BU7A 1KS5A 2O0OA 3D0JA 3NAPC 2BVVA 1I6XA 2XJSA 1RUE1 3EO6A 1AR62 4NHLA 2IC1A 4QT6A 3FX3A 3ILFA 2EXIA 3RDIA 3I8TA 3EJKA 1SFNA 5FLIA 1ZA4A 3V0AB 1ZRDA 5KBFA 4CEYA 1RUG2 2P17A 1KDKA 3AB0A 1O5LA 3POYA 4LHLA 1GICA 1UIKA 4RS5B 3THTA 5FOBB 4JGYA 2PYTA 4Y4YA 4YW5A 4Q0SA 4NO4A 4OLLA 1EV11 1JXNA 3M7AA 1EPZA 1QJU1 5KXDA 4WVWA 5A32B 2ZHKA 2VG9A 2GNBA 1J59A 1VB4A 4S2HA 4RHV3 5LRSA 5DXDA 1T6GC 3ZDSA 3AZXA 3VBFB 5KC5A 2QFEA 2ZAAA 3ZFFB 1PO23 2GH2A 4KH9A 1BEV1 2XJPA 2RS51 3ACLA 3B5LB 4LBJA 5EFUA 5J09A 1FOD2 1GQHA 2ET7A 4PDWC 3UJQA 3R4UA 1CESA 5LK5A 5IK4A 5F9TA 1I5ZA 2WIIB 4LUMA 1VRH1 2YGMA 3G7DA 1JUIA 1RUD1 4D7SA 2CAUA 4ASMB 2ZGUA 4BA6A 1AYN3 4XEZA 1ONAA 4NR1A 5JOXA 5T50A 1ND2C 1MQTC 1NOVA 2PELA 4OI0A 4U2AA 4AI1A 1IKQA 4OHZA 2YROA 1KD7A 3BODA 3AMPA 3CL1A 3WCRA 1FV2A 1ZBE2 5FMOL 1QOOA 3MYXA 5T5JA 4HMZA 1IQAA 4AEDA 2CAVA 2XB6C 3MF9A 4KWKA 1NQDA 1OFSA 1WGPA 4HETA 4QM9A 1Z7S2 4FOQA 4IV1C 2CNAA 4Q4W1 3ATGA 2D40A 2BTVC 3JB4C 4LBNA 2R1DA 4QPYA 3ZMOA 4PLMA 3WOGA 2P2KA 4XFBA 3MIFA 4CP0A 4K21A 4COZA 1V6MA 1R093 4KG0A 3ZSJA 4AE2A 1AXZA 1XXNA 5CG8A 1SDWA 2BW8A 4Y1YA 2ZOEB 4Y1UA 4OI2A 4IQPA 1UPSA 1Y43B 1UU4A 4CRQA 1QQP1 2WZR1 4HPKB 4YVSA 3H0OA 3O0XA 1ZREA 4XW3A 3GALA 4J1WA 4NHKA 5JZGC 3LZZA 1VAVA 4G3YC 4H7MA 2D6KA 2X5IA 1NA1B 4XQWA 4FPGA 2JX9A 3WDVA 4RR3A 4LA3A 5C4WC 2ZGQA 4YVWA 4BMEA 1O4YA 1RUI1 4P9XA 5I8SA 4WM7B 1BKZA 1EV13 1IPKA 3MLKA 1QJU3 2WFF1 3PLQA 5CB7A 1FI2A 3VZOA 1A8MA 2A6XA 3DPRB 5JI9A 2V73A 2JENA 1LULA 1MS8A 3VZMA 4ZKTB 2B5HA 4BIFA 1WBLA 2R32A 1J1LA 4LO6B 4AFBA 2JG9A 1BEV3 1X8EA 2GC0A 3ZX7A 3PJQA 1IS3A 3HMYA 1ZX5A 4YW4A 3B94A 4COYA 1AR73 1BVVA 1GZ9A 2HWD1 2ZACA 1VRH3 2ET1A 4GB33 3AKQA 2D6MA 1AYM2 1H4HA 3NWKA 4Q4Y3 5F6LB 1H2MA 2BNOA 1K5MA 1Z78A 2AZ5A 2HEWF 2DVAA 3AK0A 2PLV2 1KXGA 1RUJ1 3TWIA 3SITA 3WP6A 5K0UA 3PVOA 2NYYA 4XJWA 4HANA 5IK7A 4UW4A 4EN6B 4Q4X2 4HVQA 1LENA 4DNYA 4Q8KA 2N7GA 4QU2A 3D8CA 3UKNA 5BNPB 2XJRA 2PHLA 4N53A 1H9WA 2WQZC 2D44A 4YGCA 4AHYA 3MFCA 1UZZA 5KC6A 1SBEA 2R073 3VBRC 1Q43A 4DFSA 4YFZA 4JDMA 4Y5Z0 1SACA 3AYEA 1CD3G 5D8AC 3MLJA 5AFBA 1JTZX 2ZPXA 2R061 4Q4W3 2GNTA 4IXLA 4M01A 2XJUA 4JDNA 2XBO1 1PZ8A 3VL9A 4AQSA 3VBOB 3MIHA 2WLPA 4C0BA 3WW4A 3ZN5A 1JN2P 4YNIA 1IHMA 1MR5A 1ZZ8A 3RWNA 3ZXJA 3HN1A 1DZQA 1QMJA 1AL22 4CDXB 2GH8A 4K1ZA