5CFFE

Crystal structure of miranda/staufen dsrbd5 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
70
structure length
70
Chain Sequence
b'GSMKEQLLYLSKLLDFEVNFSDYPKGNHNEFLTIVTLSTHPPQICHGVGKSSEESQNDAASNALKILSKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Miranda
publication title The structural basis of Miranda-mediated Staufen localization during Drosophila neuroblast asymmetric division
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/rna binding protein
total genus 21
structure length 70
sequence length 70
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5cffE00
1O0WA 5BR8E 2UUCE 4GKKE 2L2MA 3ADGA 5LMNE 4JI6E 4B3TE 2MDRA 4DV1E 4LFAE 1QU6A 4X65E 2RS6A 4LFBE 2NUFA 4NXNE 2JY9A 4DUZE 3ADIA 2UXBE 4LFCE 2DMYA 2L2NA 2B3TB 4JI1E 4JV5E 3ADJA 4DKKA 4KHPE 4DV7E 4JI5E 4LF4E 2VQEE 4X62E 4DV4E 1DI2A 2HHHE 4DR6E 2KHXA 1HR0E 1J26A 4JI7E 1IBKE 4DV6E 4DR4E 2L2KB 3OTOE 2LRSA 3LLHA 1HNXE 2L3JA 3C4BA 1IBLE 5CFFE 2LTRA 3T1HE 2LTSA 5LMUE 4AQYE 4DV0E 2NUGA 2N3GA 1FKAE 2B7TA 1N34E 4K0KE 4X64E 2UUBE 2VQFE 1FJGE 1STUA 1UHZA 3T1YE 3C4TA 1T4NA 4NXME 4LF8E 2NA2A 1IBME 4JYAE 4DR7E 4DUYE 1XNRE 2JVAA 4JI4E 1ZBTA 4B3SE 1X47A 1T4OA 4DV3E 2RSMA 5IWAE 1XNQE 1XMQE 1YYOA 1WHQA 4WFTA 3ADLA 1RC7A 2RTXA 2LJHA 3VYXA 2UXCE 1N36E 4YHHE 1EKZA 4GKJE 2UUAE 2IHR1 4DR2E 2LUQA 1YYKA 2B7VA 4JI0E 2DIXA 4OOGC 3HTXA 1J5EE 2DB2A 4JI2E 1I94E 2NUEA 1WHNA 4M2ZA 1YZ9A 1X49A 4DR1E 2EZ6A 4JI3E 4OX9E 1N32E 2RS7A 4B3RE 4LF7E 2L3CA 2LBSB 1XMOE 2E5LE 4DV5E 3VYYA 4LF9E 1T4LB 1HNWE 4X66E 4DR5E 1HNZE 4B3ME 2UU9E 1RQ0A 1UILA 2CPNA 4WYQB 2N3HA 3J7Yp 4JI8E 4DV2E 2L33A 1GQEA 4LF6E 1X48A 2F4VE 2ZM6E 4M30A 1YYWA 2UXDE 1N33E 2YT4A 1PKPA 2LUPB 4X8WA 4LF5E 4DR3E 4YY3E 3P1XA
chains in the Genus database with same CATH superfamily
1EH7A 2EMYA 5BR8E 2VE7C 3THNA 3L00A 2MDRA 4R2AA 4BS9A 1MGTA 2V89A 2ADRA 1N3GA 4LFBE 5A69A 2UXBE 1ZR9A 1X3CA 2B3TB 2EMXA 2YTOA 4HEIA 1LLMC 1G2FC 3BBGA 3ADJA 2E72A 4DV7E 1DI2A 2EM7A 2V8QB 2WBTA 4BCAA 5AASA 2VQEE 2EN7A 1NEIA 2KHXA 5AE3A 1A1FA 1HR0E 1J26A 5A6JA 4DV6E 2JR1A 2EMLA 2EPZA 2LTRA 3T1HE 4P7DA 2LTSA 2LO3A 2LJUA 5LMUE 4BC7A 4IS1C 3KZZA 1FKAE 3F6GA 5F3WA 2DLQA 4K0KE 2DLKA 2WZOA 3IWBA 4F6MA 2M9AA 4F9AB 3C4TA 5TSEA 5IXMB 2JWOA 2MC6A 3F6HA 2ELZA 2EM6A 4LF8E 1DQ3A 4F54A 4DUYE 2V85A 2YSPA 3KZYA 1DGCA 2RQLA 2EN4A 2MKDA 1ZBQA 5IWAE 2MC5A 2WBSA 2EOXA 1XNQE 4KWYA 2BB8A 3M99B 4R2PA 2M1SA 2H36X 2EMZA 1WRJA 3VYXA 2YRHA 2UXCE 1A1KA 2EPUA 4DR2E 1ZAAC 2EMHA 2DIXA 4BHBA 2DB2A 2EOHA 1ZU1A 3JTZA 4M2ZA 2RSIA 2DSYA 1IQOA 3J81C 3HPSA 2L8TA 4LF7E 2GPIA 1GTKA 4GZNC 2EPCA 2YRMA 3EPLA 5KL3A 2ELYA 4RHBB 2EM8A 4B3ME 2UU9E 1UILA 2CPNA 4WYQB 2N3HA 2LVHA 4BMJA 4JI8E 1GQEA 1F2IG 3DJWA 1AAYA 2F4VE 3EPKA 5T6JA 2EM2A 2EMAA 2LUPB 1BBOA 3P1XA 3ADGA 3BGHA 4JI6E 4O4KA 4DV1E 3KWRA 4LFAE 1X6FA 5A6AA 2YZTA 2EL4A 4X65E 2EOEA 1UBDC 1B69A 2EOIA 4DUZE 1IMUA 3J7AG 1TF6A 1NCSA 2L2NA 2EQ1A 4JI1E 4JV5E 1YPNA 1JK2A 2B9DA 4X62E 3TQMA 4DR6E 1IBKE 4DR4E 2L3JA 3C4BA 1IBLE 2Q8UA 4O5GA 2EOSA 4WX9A 2JOXA 4R2EA 1EH8A 4DV0E 2NUGA 5A2QC 2B7TA 1N34E 4X64E 2EMWA 2KONA 1FJGE 2VQFE 2EM3A 4ZYGA 1STUA 3AV0A 3JAMC 1T4NA 4NXME 3THOB 2EOMA 5LLQA 5DNYA 2NA2A 3EPJA 1IBME 2ENHA 5KL7A 1TF3A 1IQSA 3H09A 1XNRE 4JI4E 2EPNA 1PJQA 1SFEA 2WCC3 3VHTB 5IT9C 2R76A 1XMQE 2YTEA 1KYQA 2VF1A 3C6KA 1SR9A 3AUZA 4GKJE 2UUAE 2YRKA 1YYKA 2MDGA 5LL6R 2I13A 4JI0E 3IWDA 2FTXB 4OOGC 2YTJA 4KZSA 4JI2E 4R8OA 2NUEA 3QG5C 5A6KA 1X49A 2EZ6A 2F8BA 3FIGA 5AC4A 2YTIA 5AE1A 2JYAA 1XMOE 3J80C 2K7IA 4O43A 1WXRA 2EPLX 1RMDA 1X5WA 1RQ0A 2EM0A 1G2DC 4WPYA 2YSOA 4LF6E 2ZM6E 3EQ1A 4M30A 2EPPA 2UXDE 2L92A 2YT4A 1YUJA 2EOYA 1PJSA 2YTGA 4X8WA 3LMLA 4DV2E 4WSPA 2EMIA 2L2MA 2EMCA 5LMNE 2EOZA 2JOBA 2YU5A 4B3TE 2V86A 2EOOA 1QU6A 2VRDA 1A1GA 1QNTA 2RS6A 2BBGA 3VK6A 2NUFA 4NXNE 2HC5A 2WBUA 2HGHA 2K4VA 2A25A 2DRPA 2EQ0A 2LCEA 2JXPA 2YTQA 2KOUA 4DKKA 5A6BD 1A1JA 4DV4E 2HHHE 2JP9A 2MKNA 4JI7E 5ADZA 3K6QA 3HQ1A 4N4RB 4M0VA 1HNXE 2LRSA 3LLHA 1PJTA 2V88A 5CFFE 2FV4B 4F9BB 2EN2A 2N8XA 3RMPA 1BB8A 2N3GA 4TUIA 2LMZA 4WSGA 5FLXC 4R2QA 4BHCA 3T1YE 2HJJA 4X9JA 2DGCA 2YTFA 4DR7E 4HTGA 1BBGA 4M9VC 2EN1A 2JVAA 4B3SE 1X47A 4BBYA 4DV3E 5A6BA 3MHSC 4DMIA 1WHQA 3ADLA 5AE2A 1RC7A 2RTXA 2YTPA 2EPOA 4LTYA 2EMGA 1A1LA 1P47A 2EWLA 2IHR1 2EMKA 2EM5A 4Q28A 2EOFA 2ENCA 3BIDA 2EORA 3MHHC 1J5EE 2CT1A 2GHFA 3MSWA 1WHNA 3UK3C 3OMLA 4DR1E 2M4IA 4OX9E 2EM4A 1N32E 4O24A 2RS7A 4B3RE 4F2JC 3HXLA 1T39A 2L3CA 2LBSB 4GEQB 2E5LE 4WXDA 4R2RA 4DV5E 2EPMX 3VYYA 2R1FA 1X6EA 1T38A 1HNWE 4R03A 2E1MA 5KL4A 4ZYDA 1HNZE 1A1IA 3J7Yp 1YUIA 5KL5A 4ZYHA 1AH5A 4IJDA 1MEYC 2J7JA 2CSHA 4TUGA 3C6MA 1N33E 4WXCA 2LV2A 5KL6A 4R2CA 4LF5E 4DR3E 1TN9A 4YY3E 1GZ6A 2M7QA 2LE2A 2DMIA 1O0WA 4GKKE 2UUCE 2EJ4A 1Z1BA 2ODRC 3DF6A 3JU0A 2JPAA 2YWQA 4R2DA 2JY9A 3ADIA 2EOJA 2EN8A 4LFCE 3HPZA 2DMYA 4KHPE 4JI5E 4LF4E 2YU8A 2EQ3A 4NHRA 2EM9A 2EMBA 2G7HA 2EE8A 2L2KB 3OTOE 1PDAA 2ENAA 2FGGA 2LT7A 4AQYE 3EPHA 4BC9A 1X6HA 2D9HA 1JK1A 2UUBE 5KL2A 1UHZA 2YTNA 2V87A 2NABA 4JYAE 4F9CB 1ZBTA 1T4OA 4RH8A 2RSMA 2EPAA 4LU9A 2GLIA 1KJKA 3ECRA 3IWCA 4MLVA 4FK5C 1YYOA 4L8NA 4WFTA 2ODRD 4J8ZA 2LJHA 1YFHA 2EPXA 1N36E 4I8OA 4YHHE 1EKZA 2EMFA 2YPNA 2EP3A 1YSAC 2EL5A 3BF2A 2LUQA 2B7VA 2RPCA 2EN3A 3HTXA 1L4SA 2EN6A 1I94E 4Q35B 1YZ9A 2EL6A 4L5NC 2EOQA 1WJPA 5AC5A 4JI3E 2L6MA 4R2SA 4P78A 2I9IA 4MLQA 1T4LB 2YTDA 4X66E 4DR5E 4NZVA 1EH6A 2CTDA 5IV8B 2PRTA 3ZOQB 4ZYEA 2L33A 1X48A 2V83A 1YYWA 1PKPA 4F6NA 1UN6B 2EPKX 2EPRA 1A1HA 4LF9E
chains in the Genus database with same CATH topology
1O0WA 5BR8E 2UUCE 4GKKE 2L2MA 2VE7C 3ADGA 5LMNE 2JOBA 4JI6E 2ODRC 2MDRA 4DV1E 3DF6A 3KWRA 4BS9A 2V86A 4DR3E 4B3TE 4LFAE 1QU6A 3JU0A 2YZTA 4X65E 2V89A 2RS6A 3VK6A 4LFBE 2NUFA 4NXNE 2JY9A 4DUZE 3ADIA 2K4VA 3J7AG 2UXBE 4LFCE 3HPZA 2DMYA 2L2NA 2B3TB 4JI1E 4JV5E 2KOUA 3ADJA 4DKKA 4KHPE 2B9DA 4DV7E 4JI5E 2V8QB 4BCAA 5AASA 4X62E 2VQEE 4DV4E 2HHHE 4LF4E 5AE3A 2KHXA 1HR0E 4DR6E 1J26A 4JI7E 5ADZA 3K6QA 3HQ1A 4DV6E 2G7HA 4M0VA 2JR1A 2LRSA 2L2KB 3LLHA 3OTOE 2L3JA 1HNXE 4DR4E 1DI2A 3C4BA 1IBLE 2V88A 5CFFE 2LTRA 2FV4B 2JOXA 3T1HE 2FGGA 4P7DA 2LTSA 4WSPA 4F9BB 5LMUE 4AQYE 4BC7A 4BC9A 1IBKE 3RMPA 4DV0E 2NUGA 2N3GA 5A2QC 2LMZA 2B7TA 3F6GA 5FLXC 4X64E 4TUIA 5F3WA 1N34E 1FKAE 4K0KE 2WZOA 2KONA 3IWBA 2VQFE 2UUBE 1FJGE 1STUA 1UHZA 3T1YE 4F9AB 3AV0A 3JAMC 3C4TA 1T4NA 4NXME 2JWOA 2MC6A 3F6HA 2V87A 5DNYA 2NA2A 4LF8E 1IBME 4JYAE 1DQ3A 4F54A 4DUYE 4DR7E 3H09A 1XNRE 2V85A 4F9CB 2JVAA 4JI4E 1ZBTA 4B3SE 1X47A 1T4OA 4BBYA 4DV3E 2RSMA 4LU9A 1ZBQA 3IWCA 2MC5A 4DMIA 5IWAE 5IT9C 1XMQE 1XNQE 1YYOA 1WHQA 4L8NA 4WFTA 3ADLA 2M1SA 5AE2A 1RC7A 2H36X 2RTXA 2ODRD 2VF1A 4J8ZA 4LTYA 2LJHA 1SR9A 3VYXA 3AUZA 2UXCE 1N36E 4I8OA 4YHHE 1EKZA 2EWLA 4GKJE 2UUAE 2IHR1 4DR2E 4Q28A 2LUQA 1YYKA 5LL6R 2B7VA 4JI0E 2DIXA 3IWDA 2FTXB 4OOGC 1J5EE 3HTXA 4KZSA 2DB2A 4JI2E 4R8OA 2M7QA 1I94E 2NUEA 3MSWA 1WHNA 3JTZA 4M2ZA 1YZ9A 3OMLA 2DSYA 1X49A 4L5NC 4DR1E 2M4IA 2F8BA 3FIGA 4JI3E 4OX9E 1N32E 2EZ6A 2RS7A 3J81C 4B3RE 5AE1A 3HPSA 2L8TA 3HXLA 4LF7E 2L3CA 2LBSB 1XMOE 2L6MA 4GEQB 3J80C 2E5LE 4DV5E 4P78A 3VYYA 4LF9E 1WXRA 1T4LB 1HNWE 4R03A 2E1MA 4X66E 4DR5E 1HNZE 4B3ME 2UU9E 1RQ0A 1UILA 2CPNA 4WYQB 2N3HA 4BMJA 3J7Yp 4JI8E 3ZOQB 4DV2E 2L33A 1GQEA 4WPYA 3DJWA 4LF6E 1X48A 2V83A 2F4VE 2ZM6E 4M30A 1YYWA 2UXDE 4TUGA 2L92A 2YT4A 1N33E 1PKPA 5T6JA 2LUPB 4X8WA 4LF5E 3LMLA 4YY3E 1GZ6A 3P1XA 2LE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O0W A;  5BR8 E;  2UUC E;  4GKK E;  2L2M A;  3ADG A;  5LMN E;  4JI6 E;  4B3T E;  2MDR A;  4DV1 E;  4LFA E;  1QU6 A;  4X65 E;  2RS6 A;  4LFB E;  2NUF A;  4NXN E;  2JY9 A;  4DUZ E;  3ADI A;  2UXB E;  4LFC E;  2DMY A;  2L2N A;  2B3T B;  4JI1 E;  4JV5 E;  3ADJ A;  4DKK A;  4KHP E;  4DV7 E;  4JI5 E;  4LF4 E;  2VQE E;  4X62 E;  4DV4 E;  1DI2 A;  2HHH E;  4DR6 E;  2KHX A;  1HR0 E;  1J26 A;  4JI7 E;  1IBK E;  4DV6 E;  4DR4 E;  2L2K B;  3OTO E;  2LRS A;  3LLH A;  1HNX E;  2L3J A;  3C4B A;  1IBL E;  5CFF E;  2LTR A;  3T1H E;  2LTS A;  5LMU E;  4AQY E;  4DV0 E;  2NUG A;  2N3G A;  1FKA E;  2B7T A;  1N34 E;  4K0K E;  4X64 E;  2UUB E;  2VQF E;  1FJG E;  1STU A;  1UHZ A;  3T1Y E;  3C4T A;  1T4N A;  4NXM E;  4LF8 E;  2NA2 A;  1IBM E;  4JYA E;  4DR7 E;  4DUY E;  1XNR E;  2JVA A;  4JI4 E;  1ZBT A;  4B3S E;  1X47 A;  1T4O A;  4DV3 E;  2RSM A;  5IWA E;  1XNQ E;  1XMQ E;  1YYO A;  1WHQ A;  4WFT A;  3ADL A;  1RC7 A;  2RTX A;  2LJH A;  3VYX A;  2UXC E;  1N36 E;  4YHH E;  1EKZ A;  4GKJ E;  2UUA E;  2IHR 1;  4DR2 E;  2LUQ A;  1YYK A;  2B7V A;  4JI0 E;  2DIX A;  4OOG C;  3HTX A;  1J5E E;  2DB2 A;  4JI2 E;  1I94 E;  2NUE A;  1WHN A;  4M2Z A;  1YZ9 A;  1X49 A;  4DR1 E;  2EZ6 A;  4JI3 E;  4OX9 E;  1N32 E;  2RS7 A;  4B3R E;  4LF7 E;  2L3C A;  2LBS B;  1XMO E;  2E5L E;  4DV5 E;  3VYY A;  4LF9 E;  1T4L B;  1HNW E;  4X66 E;  4DR5 E;  1HNZ E;  4B3M E;  2UU9 E;  1RQ0 A;  1UIL A;  2CPN A;  4WYQ B;  2N3H A;  3J7Y p;  4JI8 E;  4DV2 E;  2L33 A;  1GQE A;  4LF6 E;  1X48 A;  2F4V E;  2ZM6 E;  4M30 A;  1YYW A;  2UXD E;  1N33 E;  2YT4 A;  1PKP A;  2LUP B;  4X8W A;  4LF5 E;  4DR3 E;  4YY3 E;  3P1X A; 
#chains in the Genus database with same CATH topology
 1EH7 A;  2EMY A;  5BR8 E;  2VE7 C;  3THN A;  3L00 A;  2MDR A;  4R2A A;  4BS9 A;  1MGT A;  2V89 A;  2ADR A;  1N3G A;  4LFB E;  5A69 A;  2UXB E;  1ZR9 A;  1X3C A;  2B3T B;  2EMX A;  2YTO A;  4HEI A;  1LLM C;  1G2F C;  3BBG A;  3ADJ A;  2E72 A;  4DV7 E;  1DI2 A;  2EM7 A;  2V8Q B;  2WBT A;  4BCA A;  5AAS A;  2VQE E;  2EN7 A;  1NEI A;  2KHX A;  5AE3 A;  1A1F A;  1HR0 E;  1J26 A;  5A6J A;  4DV6 E;  2JR1 A;  2EML A;  2EPZ A;  2LTR A;  3T1H E;  4P7D A;  2LTS A;  2LO3 A;  2LJU A;  5LMU E;  4BC7 A;  4IS1 C;  3KZZ A;  1FKA E;  3F6G A;  5F3W A;  2DLQ A;  4K0K E;  2DLK A;  2WZO A;  3IWB A;  4F6M A;  2M9A A;  4F9A B;  3C4T A;  5TSE A;  5IXM B;  2JWO A;  2MC6 A;  3F6H A;  2ELZ A;  2EM6 A;  4LF8 E;  1DQ3 A;  4F54 A;  4DUY E;  2V85 A;  2YSP A;  3KZY A;  1DGC A;  2RQL A;  2EN4 A;  2MKD A;  1ZBQ A;  5IWA E;  2MC5 A;  2WBS A;  2EOX A;  1XNQ E;  4KWY A;  2BB8 A;  3M99 B;  4R2P A;  2M1S A;  2H36 X;  2EMZ A;  1WRJ A;  3VYX A;  2YRH A;  2UXC E;  1A1K A;  2EPU A;  4DR2 E;  1ZAA C;  2EMH A;  2DIX A;  4BHB A;  2DB2 A;  2EOH A;  1ZU1 A;  3JTZ A;  4M2Z A;  2RSI A;  2DSY A;  1IQO A;  3J81 C;  3HPS A;  2L8T A;  4LF7 E;  2GPI A;  1GTK A;  4GZN C;  2EPC A;  2YRM A;  3EPL A;  5KL3 A;  2ELY A;  4RHB B;  2EM8 A;  4B3M E;  2UU9 E;  1UIL A;  2CPN A;  4WYQ B;  2N3H A;  2LVH A;  4BMJ A;  4JI8 E;  1GQE A;  1F2I G;  3DJW A;  1AAY A;  2F4V E;  3EPK A;  5T6J A;  2EM2 A;  2EMA A;  2LUP B;  1BBO A;  3P1X A;  3ADG A;  3BGH A;  4JI6 E;  4O4K A;  4DV1 E;  3KWR A;  4LFA E;  1X6F A;  5A6A A;  2YZT A;  2EL4 A;  4X65 E;  2EOE A;  1UBD C;  1B69 A;  2EOI A;  4DUZ E;  1IMU A;  3J7A G;  1TF6 A;  1NCS A;  2L2N A;  2EQ1 A;  4JI1 E;  4JV5 E;  1YPN A;  1JK2 A;  2B9D A;  4X62 E;  3TQM A;  4DR6 E;  1IBK E;  4DR4 E;  2L3J A;  3C4B A;  1IBL E;  2Q8U A;  4O5G A;  2EOS A;  4WX9 A;  2JOX A;  4R2E A;  1EH8 A;  4DV0 E;  2NUG A;  5A2Q C;  2B7T A;  1N34 E;  4X64 E;  2EMW A;  2KON A;  1FJG E;  2VQF E;  2EM3 A;  4ZYG A;  1STU A;  3AV0 A;  3JAM C;  1T4N A;  4NXM E;  3THO B;  2EOM A;  5LLQ A;  5DNY A;  2NA2 A;  3EPJ A;  1IBM E;  2ENH A;  5KL7 A;  1TF3 A;  1IQS A;  3H09 A;  1XNR E;  4JI4 E;  2EPN A;  1PJQ A;  1SFE A;  2WCC 3;  3VHT B;  5IT9 C;  2R76 A;  1XMQ E;  2YTE A;  1KYQ A;  2VF1 A;  3C6K A;  1SR9 A;  3AUZ A;  4GKJ E;  2UUA E;  2YRK A;  1YYK A;  2MDG A;  5LL6 R;  2I13 A;  4JI0 E;  3IWD A;  2FTX B;  4OOG C;  2YTJ A;  4KZS A;  4JI2 E;  4R8O A;  2NUE A;  3QG5 C;  5A6K A;  1X49 A;  2EZ6 A;  2F8B A;  3FIG A;  5AC4 A;  2YTI A;  5AE1 A;  2JYA A;  1XMO E;  3J80 C;  2K7I A;  4O43 A;  1WXR A;  2EPL X;  1RMD A;  1X5W A;  1RQ0 A;  2EM0 A;  1G2D C;  4WPY A;  2YSO A;  4LF6 E;  2ZM6 E;  3EQ1 A;  4M30 A;  2EPP A;  2UXD E;  2L92 A;  2YT4 A;  1YUJ A;  2EOY A;  1PJS A;  2YTG A;  4X8W A;  3LML A;  4DV2 E;  4WSP A;  2EMI A;  2L2M A;  2EMC A;  5LMN E;  2EOZ A;  2JOB A;  2YU5 A;  4B3T E;  2V86 A;  2EOO A;  1QU6 A;  2VRD A;  1A1G A;  1QNT A;  2RS6 A;  2BBG A;  3VK6 A;  2NUF A;  4NXN E;  2HC5 A;  2WBU A;  2HGH A;  2K4V A;  2A25 A;  2DRP A;  2EQ0 A;  2LCE A;  2JXP A;  2YTQ A;  2KOU A;  4DKK A;  5A6B D;  1A1J A;  4DV4 E;  2HHH E;  2JP9 A;  2MKN A;  4JI7 E;  5ADZ A;  3K6Q A;  3HQ1 A;  4N4R B;  4M0V A;  1HNX E;  2LRS A;  3LLH A;  1PJT A;  2V88 A;  5CFF E;  2FV4 B;  4F9B B;  2EN2 A;  2N8X A;  3RMP A;  1BB8 A;  2N3G A;  4TUI A;  2LMZ A;  4WSG A;  5FLX C;  4R2Q A;  4BHC A;  3T1Y E;  2HJJ A;  4X9J A;  2DGC A;  2YTF A;  4DR7 E;  4HTG A;  1BBG A;  4M9V C;  2EN1 A;  2JVA A;  4B3S E;  1X47 A;  4BBY A;  4DV3 E;  5A6B A;  3MHS C;  4DMI A;  1WHQ A;  3ADL A;  5AE2 A;  1RC7 A;  2RTX A;  2YTP A;  2EPO A;  4LTY A;  2EMG A;  1A1L A;  1P47 A;  2EWL A;  2IHR 1;  2EMK A;  2EM5 A;  4Q28 A;  2EOF A;  2ENC A;  3BID A;  2EOR A;  3MHH C;  1J5E E;  2CT1 A;  2GHF A;  3MSW A;  1WHN A;  3UK3 C;  3OML A;  4DR1 E;  2M4I A;  4OX9 E;  2EM4 A;  1N32 E;  4O24 A;  2RS7 A;  4B3R E;  4F2J C;  3HXL A;  1T39 A;  2L3C A;  2LBS B;  4GEQ B;  2E5L E;  4WXD A;  4R2R A;  4DV5 E;  2EPM X;  3VYY A;  2R1F A;  1X6E A;  1T38 A;  1HNW E;  4R03 A;  2E1M A;  5KL4 A;  4ZYD A;  1HNZ E;  1A1I A;  3J7Y p;  1YUI A;  5KL5 A;  4ZYH A;  1AH5 A;  4IJD A;  1MEY C;  2J7J A;  2CSH A;  4TUG A;  3C6M A;  1N33 E;  4WXC A;  2LV2 A;  5KL6 A;  4R2C A;  4LF5 E;  4DR3 E;  1TN9 A;  4YY3 E;  1GZ6 A;  2M7Q A;  2LE2 A;  2DMI A;  1O0W A;  4GKK E;  2UUC E;  2EJ4 A;  1Z1B A;  2ODR C;  3DF6 A;  3JU0 A;  2JPA A;  2YWQ A;  4R2D A;  2JY9 A;  3ADI A;  2EOJ A;  2EN8 A;  4LFC E;  3HPZ A;  2DMY A;  4KHP E;  4JI5 E;  4LF4 E;  2YU8 A;  2EQ3 A;  4NHR A;  2EM9 A;  2EMB A;  2G7H A;  2EE8 A;  2L2K B;  3OTO E;  1PDA A;  2ENA A;  2FGG A;  2LT7 A;  4AQY E;  3EPH A;  4BC9 A;  1X6H A;  2D9H A;  1JK1 A;  2UUB E;  5KL2 A;  1UHZ A;  2YTN A;  2V87 A;  2NAB A;  4JYA E;  4F9C B;  1ZBT A;  1T4O A;  4RH8 A;  2RSM A;  2EPA A;  4LU9 A;  2GLI A;  1KJK A;  3ECR A;  3IWC A;  4MLV A;  4FK5 C;  1YYO A;  4L8N A;  4WFT A;  2ODR D;  4J8Z A;  2LJH A;  1YFH A;  2EPX A;  1N36 E;  4I8O A;  4YHH E;  1EKZ A;  2EMF A;  2YPN A;  2EP3 A;  1YSA C;  2EL5 A;  3BF2 A;  2LUQ A;  2B7V A;  2RPC A;  2EN3 A;  3HTX A;  1L4S A;  2EN6 A;  1I94 E;  4Q35 B;  1YZ9 A;  2EL6 A;  4L5N C;  2EOQ A;  1WJP A;  5AC5 A;  4JI3 E;  2L6M A;  4R2S A;  4P78 A;  2I9I A;  4MLQ A;  1T4L B;  2YTD A;  4X66 E;  4DR5 E;  4NZV A;  1EH6 A;  2CTD A;  5IV8 B;  2PRT A;  3ZOQ B;  4ZYE A;  2L33 A;  1X48 A;  2V83 A;  1YYW A;  1PKP A;  4F6N A;  1UN6 B;  2EPK X;  2EPR A;  1A1H A;  4LF9 E; 
#chains in the Genus database with same CATH homology
 1O0W A;  5BR8 E;  2UUC E;  4GKK E;  2L2M A;  2VE7 C;  3ADG A;  5LMN E;  2JOB A;  4JI6 E;  2ODR C;  2MDR A;  4DV1 E;  3DF6 A;  3KWR A;  4BS9 A;  2V86 A;  4DR3 E;  4B3T E;  4LFA E;  1QU6 A;  3JU0 A;  2YZT A;  4X65 E;  2V89 A;  2RS6 A;  3VK6 A;  4LFB E;  2NUF A;  4NXN E;  2JY9 A;  4DUZ E;  3ADI A;  2K4V A;  3J7A G;  2UXB E;  4LFC E;  3HPZ A;  2DMY A;  2L2N A;  2B3T B;  4JI1 E;  4JV5 E;  2KOU A;  3ADJ A;  4DKK A;  4KHP E;  2B9D A;  4DV7 E;  4JI5 E;  2V8Q B;  4BCA A;  5AAS A;  4X62 E;  2VQE E;  4DV4 E;  2HHH E;  4LF4 E;  5AE3 A;  2KHX A;  1HR0 E;  4DR6 E;  1J26 A;  4JI7 E;  5ADZ A;  3K6Q A;  3HQ1 A;  4DV6 E;  2G7H A;  4M0V A;  2JR1 A;  2LRS A;  2L2K B;  3LLH A;  3OTO E;  2L3J A;  1HNX E;  4DR4 E;  1DI2 A;  3C4B A;  1IBL E;  2V88 A;  5CFF E;  2LTR A;  2FV4 B;  2JOX A;  3T1H E;  2FGG A;  4P7D A;  2LTS A;  4WSP A;  4F9B B;  5LMU E;  4AQY E;  4BC7 A;  4BC9 A;  1IBK E;  3RMP A;  4DV0 E;  2NUG A;  2N3G A;  5A2Q C;  2LMZ A;  2B7T A;  3F6G A;  5FLX C;  4X64 E;  4TUI A;  5F3W A;  1N34 E;  1FKA E;  4K0K E;  2WZO A;  2KON A;  3IWB A;  2VQF E;  2UUB E;  1FJG E;  1STU A;  1UHZ A;  3T1Y E;  4F9A B;  3AV0 A;  3JAM C;  3C4T A;  1T4N A;  4NXM E;  2JWO A;  2MC6 A;  3F6H A;  2V87 A;  5DNY A;  2NA2 A;  4LF8 E;  1IBM E;  4JYA E;  1DQ3 A;  4F54 A;  4DUY E;  4DR7 E;  3H09 A;  1XNR E;  2V85 A;  4F9C B;  2JVA A;  4JI4 E;  1ZBT A;  4B3S E;  1X47 A;  1T4O A;  4BBY A;  4DV3 E;  2RSM A;  4LU9 A;  1ZBQ A;  3IWC A;  2MC5 A;  4DMI A;  5IWA E;  5IT9 C;  1XMQ E;  1XNQ E;  1YYO A;  1WHQ A;  4L8N A;  4WFT A;  3ADL A;  2M1S A;  5AE2 A;  1RC7 A;  2H36 X;  2RTX A;  2ODR D;  2VF1 A;  4J8Z A;  4LTY A;  2LJH A;  1SR9 A;  3VYX A;  3AUZ A;  2UXC E;  1N36 E;  4I8O A;  4YHH E;  1EKZ A;  2EWL A;  4GKJ E;  2UUA E;  2IHR 1;  4DR2 E;  4Q28 A;  2LUQ A;  1YYK A;  5LL6 R;  2B7V A;  4JI0 E;  2DIX A;  3IWD A;  2FTX B;  4OOG C;  1J5E E;  3HTX A;  4KZS A;  2DB2 A;  4JI2 E;  4R8O A;  2M7Q A;  1I94 E;  2NUE A;  3MSW A;  1WHN A;  3JTZ A;  4M2Z A;  1YZ9 A;  3OML A;  2DSY A;  1X49 A;  4L5N C;  4DR1 E;  2M4I A;  2F8B A;  3FIG A;  4JI3 E;  4OX9 E;  1N32 E;  2EZ6 A;  2RS7 A;  3J81 C;  4B3R E;  5AE1 A;  3HPS A;  2L8T A;  3HXL A;  4LF7 E;  2L3C A;  2LBS B;  1XMO E;  2L6M A;  4GEQ B;  3J80 C;  2E5L E;  4DV5 E;  4P78 A;  3VYY A;  4LF9 E;  1WXR A;  1T4L B;  1HNW E;  4R03 A;  2E1M A;  4X66 E;  4DR5 E;  1HNZ E;  4B3M E;  2UU9 E;  1RQ0 A;  1UIL A;  2CPN A;  4WYQ B;  2N3H A;  4BMJ A;  3J7Y p;  4JI8 E;  3ZOQ B;  4DV2 E;  2L33 A;  1GQE A;  4WPY A;  3DJW A;  4LF6 E;  1X48 A;  2V83 A;  2F4V E;  2ZM6 E;  4M30 A;  1YYW A;  2UXD E;  4TUG A;  2L92 A;  2YT4 A;  1N33 E;  1PKP A;  5T6J A;  2LUP B;  4X8W A;  4LF5 E;  3LML A;  4YY3 E;  1GZ6 A;  3P1X A;  2LE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...