5CFFE

Crystal structure of miranda/staufen dsrbd5 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
70
structure length
70
Chain Sequence
GSMKEQLLYLSKLLDFEVNFSDYPKGNHNEFLTIVTLSTHPPQICHGVGKSSEESQNDAASNALKILSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Miranda
publication title The structural basis of Miranda-mediated Staufen localization during Drosophila neuroblast asymmetric division
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/rna binding protein
total genus 21
structure length 70
sequence length 70
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5cffE00
4DUZE 1YYOA 5CFFE 4JI8E 1YYWA 1QU6A 2E5LE 4X66E 1XMQE 4LF9E 2HHHE 1UILA 2LTRA 4JI4E 4LF7E 4DR7E 4LFBE 2LJHA 2ZM6E 2CPNA 4AQYE 2KHXA 2IHR1 2LUPB 4DR4E 4B3ME 4JI1E 3ADGA 4JI5E 1HR0E 3C4TA 2L2NA 3ADLA 4DR3E 1FJGE 4KHPE 1RQ0A 3VYXA 4X8WA 4LF8E 4JV5E 2B7VA 2N3GA 5LMNE 4DV3E 2LBSB 2RTXA 4WFTA 3LLHA 2RSMA 3ADIA 2NUFA 3HTXA 4M30A 4YHHE 2JY9A 4NXNE 5BR8E 1O0WA 2L33A 1FKAE 2NUGA 4JI3E 2UXBE 3P1XA 1YZ9A 2JVAA 4GKJE 2L3CA 2DMYA 1X49A 2LTSA 2UU9E 2DIXA 4X65E 4JYAE 1X47A 1WHNA 2UUCE 1N33E 1PKPA 4OOGC 1WHQA 1IBME 1RC7A 2VQEE 4DUYE 1I94E 2UXCE 2F4VE 1HNXE 1UHZA 1T4NA 4OX9E 4LF5E 4LFCE 4LF4E 3C4BA 4X64E 1J5EE 4JI7E 2DB2A 1EKZA 4B3SE 4B3RE 1N36E 2UUAE 1XNQE 4NXME 2EZ6A 4M2ZA 3OTOE 4DV1E 1XMOE 1HNZE 1GQEA 2LRSA 1XNRE 1IBKE 1T4LB 4GKKE 4YY3E 2L2KB 1HNWE 4K0KE 2L3JA 2RS6A 4LFAE 4JI6E 4DKKA 4DR5E 3T1HE 4DR2E 1J26A 4DV5E 1ZBTA 2MDRA 2RS7A 1DI2A 2NUEA 3ADJA 4B3TE 2N3HA 3J7Yp 2UUBE 4LF6E 4DR1E 1N34E 1STUA 3VYYA 5IWAE 2L2MA 2VQFE 4DV0E 4DV6E 4JI0E 2B7TA 1IBLE 4WYQB 4DR6E 2LUQA 1N32E 2B3TB 4DV4E 3T1YE 4JI2E 4DV7E 1T4OA 2YT4A 1X48A 5LMUE 2NA2A 1YYKA 2UXDE 4DV2E 4X62E
chains in the Genus database with same CATH superfamily
3THNA 4DUZE 3FIGA 1A1KA 4X66E 1IQOA 3EPHA 1UILA 1IQSA 2LMZA 3BIDA 2CPNA 2KHXA 2IHR1 2HJJA 3BBGA 3HPZA 2EM4A 2YSPA 1HR0E 1YFHA 3ADLA 2EL4A 2V8QB 1MEYC 1FJGE 4KHPE 2L8TA 4LF8E 2EMYA 2EPCA 2V88A 2YTNA 4DV3E 2EPNA 1DGCA 2RTXA 4WFTA 3LLHA 3DJWA 2EP3A 3ADIA 2NUFA 3HTXA 3HQ1A 5DNYA 4TUIA 4BBYA 2E1MA 2JYAA 4TUGA 4R8OA 4Q28A 1TF3A 4WPYA 2EOIA 2EOZA 1AAYA 5A2QC 2EPRA 2L3CA 2DMYA 5A6AA 1X49A 2UU9E 2VE7C 4R2CA 4JYAE 2EN3A 2EPAA 2EMGA 3OMLA 2LE2A 2YTIA 3C6KA 2ODRC 2ELZA 2YTDA 2EL6A 4BHBA 4M0VA 4LF5E 4LF4E 1ZBQA 4B3SE 4B3RE 1N36E 1YSAC 2EE8A 2V89A 2EMXA 4M2ZA 3C6MA 2ODRD 2JXPA 1XMOE 4NHRA 2L3JA 3EPKA 4LFAE 2R76A 1MGTA 1WJPA 2DGCA 4RHBB 4DV5E 2EM9A 1ZAAC 2GLIA 1TN9A 3L00A 1BB8A 4B3TE 2DLKA 4R03A 5LLQA 5F3WA 5T6JA 4LF6E 5A6BA 1N34E 3VYYA 2L2MA 1IBLE 2JPAA 4NZVA 1SR9A 1G2DC 2EM6A 4DV2E 4ZYDA 1YYOA 2YPNA 2EOSA 2A25A 2YTFA 4JI8E 2FGGA 2L92A 2B9DA 2E5LE 1XMQE 4GZNC 4R2PA 4LF7E 4GEQB 2Q8UA 2R1FA 4WX9A 2DLQA 4DR4E 2V87A 2EOOA 3VHTB 3QG5C 4B3ME 4JI1E 2EPXA 5AC4A 2EQ3A 2NABA 5AC5A 2EM8A 1IMUA 2VRDA 4DR3E 1RQ0A 2EOEA 2ENAA 2K4VA 2KOUA 2DRPA 2EMKA 2B7VA 2EPPA 2JOXA 2WBSA 5LMNE 2LCEA 4R2AA 3K6QA 1T38A 1O0WA 2L33A 1FKAE 2YWQA 2NUGA 2M4IA 1EH7A 2EQ0A 1UBDC 4GKJE 3KZYA 2EWLA 4P78A 4DMIA 1A1IA 5KL7A 3IWCA 1WHNA 2EPLX 3BF2A 4OOGC 3J81C 4R2DA 2DMIA 4X9JA 2VQEE 3HPSA 4LTYA 3EPLA 3ZOQB 1T4NA 4F9BB 3C4BA 1J5EE 4BHCA 5AASA 4WXCA 2RPCA 5FLXC 4F6MA 2EN7A 3MHHC 3OTOE 1F2IG 5AE3A 2EPMX 1X6EA 2PRTA 2V86A 1ZU1A 1HNZE 1UN6B 2LJUA 2LRSA 4KZSA 1XNRE 1KYQA 1IBKE 1BBOA 4HEIA 2L2KB 2WBUA 1HNWE 2LO3A 1DQ3A 4F9AB 1GZ6A 4KWYA 2BBGA 4JI6E 4DKKA 4DR5E 2GHFA 2CT1A 3T1HE 4DR2E 1J26A 1TF6A 3J80C 2H36X 2RS7A 3ADJA 2EN2A 2EMCA 4L8NA 3J7Yp 2JR1A 2UUBE 1STUA 2EORA 3J7AG 4ZYGA 4ZYEA 4DV0E 2F8BA 1WXRA 1KJKA 4J8ZA 4WYQB 4F2JC 4R2QA 2B3TB 4DV4E 5TSEA 3T1YE 1PDAA 2HGHA 2EPZA 5IT9C 2J7JA 2M9AA 2YT4A 4DV7E 4LU9A 2NA2A 2EPUA 1ZR9A 1X6HA 2FV4B 2YTJA 2MC6A 4BC9A 3H09A 1EH6A 4LF9E 2EL5A 2HHHE 4JI4E 4WSPA 4DR7E 2GPIA 2ZM6E 2EOYA 4AQYE 2EN8A 2EJ4A 2LUPB 1RMDA 2YRKA 3EQ1A 3ADGA 1YUJA 4JI5E 4P7DA 3C4TA 5KL5A 2L2NA 3IWBA 1A1LA 1PJQA 2V85A 3VYXA 1A1HA 4X8WA 2EMHA 2N3GA 2RSMA 4F6NA 2CTDA 4M30A 2EMBA 2EOXA 2JY9A 4YHHE 2WCC3 3THOB 4NXNE 4JI3E 2UXBE 2EPKX 3HXLA 4O24A 3UK3C 1YZ9A 2JVAA 4WSGA 4R2EA 2LTSA 1GTKA 2KONA 1X47A 4WXDA 4X65E 1PKPA 1WHQA 1IBME 1RC7A 2EMLA 2EM5A 2YTQA 4DUYE 2M1SA 2LT7A 1A1JA 2UXCE 2F4VE 1HNXE 1P47A 1UHZA 4OX9E 1JK2A 2L6MA 1EKZA 2DB2A 1T39A 2G7HA 2YRMA 1X3CA 4NXME 2EZ6A 1Z1BA 5IXMB 4BC7A 3MHSC 2BB8A 2EN1A 2YU5A 4BCAA 1BBGA 4YY3E 2EOHA 3JU0A 4K0KE 2RS6A 2JWOA 2EPOA 4O5GA 5A6BD 3EPJA 2N8XA 1X5WA 2MC5A 2EM0A 2EN4A 1ZBTA 5A6KA 2I13A 5KL2A 1NCSA 2ELYA 4I8OA 1G2FC 1WRJA 4MLQA 2EOJA 1PJSA 2N3HA 4N4RB 4Q35B 4DR1E 2MDGA 2YTPA 5KL3A 5IWAE 4JI0E 2B7TA 2EMZA 4DR6E 2EM2A 2EMFA 1LLMC 4ZYHA 1YYKA 2UXDE 5A69A 2EM7A 4M9VC 2MKNA 4F9CB 4X62E 2YTOA 5CFFE 1YYWA 3AUZA 2I9IA 1AH5A 1QU6A 3DF6A 4BS9A 2LTRA 5AE1A 4LFBE 1NEIA 2WZOA 1YUIA 2LJHA 4IS1C 1A1GA 2EOMA 1PJTA 2DSYA 1JK1A 2E72A 2EN6A 2RSIA 4HTGA 3TQMA 2RQLA 2YU8A 4O43A 4JV5E 2YSOA 3JTZA 3M99B 1B69A 2LBSB 1L4SA 2EOQA 2FTXB 2JOBA 5BR8E 4BMJA 3JAMC 2CSHA 3KZZA 1SFEA 3RMPA 3LMLA 4L5NC 2JP9A 2YTGA 3P1XA 3ECRA 2LV2A 4O4KA 2YTEA 3F6GA 4F54A 2DIXA 2UUCE 1N33E 2HC5A 1YPNA 4R2RA 3IWDA 2EM3A 1I94E 2ENHA 2ENCA 1QNTA 2ADRA 1X6FA 4LFCE 3MSWA 5IV8B 4X64E 3F6HA 4JI7E 5KL4A 2UUAE 5A6JA 1XNQE 2M7QA 2YZTA 4DV1E 2VF1A 1GQEA 2EQ1A 2EMAA 1T4LB 4GKKE 4R2SA 3BGHA 2MKDA 4FK5C 5LL6R 3AV0A 5AE2A 5ADZA 3KWRA 3VK6A 2WBTA 2MDRA 1DI2A 2EMIA 2NUEA 4IJDA 2K7IA 4RH8A 2VQFE 4DV6E 2YRHA 2LUQA 2LVHA 2D9HA 1N32E 1N3GA 4JI2E 2EMWA 2EOFA 1EH8A 1T4OA 1X48A 4MLVA 5LMUE 1A1FA 2V83A 5KL6A
chains in the Genus database with same CATH topology
4DUZE 1YYOA 5CFFE 4JI8E 3FIGA 2FGGA 3AUZA 2MC6A 4BC9A 1YYWA 3H09A 2L92A 2B9DA 1QU6A 2E5LE 4X66E 3DF6A 1XMQE 4LF9E 4BS9A 2HHHE 1UILA 2LTRA 5AE1A 4JI4E 4LF7E 2WZOA 2LMZA 4WSPA 2LJHA 4DR7E 2ZM6E 4GEQB 4LFBE 2CPNA 4AQYE 2DSYA 2KHXA 2IHR1 2LUPB 4DR4E 2V87A 4B3ME 3HPZA 4JI1E 3ADGA 4JI5E 1HR0E 4P7DA 3C4TA 2L2NA 3IWBA 2V85A 2V8QB 3ADLA 4DR3E 1FJGE 4KHPE 2L8TA 1RQ0A 3VYXA 4X8WA 2K4VA 2KOUA 2UU9E 4LF8E 4JV5E 2B7VA 2JOXA 2V88A 2N3GA 5LMNE 3JTZA 4DV3E 2LBSB 2RTXA 4WFTA 3LLHA 3DJWA 2RSMA 3K6QA 3ADIA 2FTXB 2NUFA 3HQ1A 4M30A 2JOBA 5DNYA 4YHHE 2JY9A 4NXNE 5BR8E 4BBYA 1O0WA 2E1MA 2L33A 4BMJA 3JAMC 4TUIA 1FKAE 2NUGA 4JI3E 3RMPA 4TUGA 2M4IA 3LMLA 4L5NC 4R8OA 4Q28A 2UXBE 3P1XA 3HXLA 4WPYA 1YZ9A 2JVAA 4GKJE 5A2QC 4DMIA 2EWLA 2DMYA 4P78A 2L3CA 1X49A 2LTSA 3F6GA 2DIXA 2VE7C 4F54A 2KONA 4X62E 1X47A 3IWCA 1WHNA 4X65E 2UUCE 4JYAE 1N33E 1PKPA 4OOGC 1WHQA 3OMLA 2LE2A 1IBME 3J81C 1RC7A 2VQEE 3HPSA 2ODRC 2M1SA 3IWDA 4DUYE 1I94E 4LTYA 2UXCE 2F4VE 3ZOQB 1HNXE 4M0VA 1UHZA 1T4NA 4F9BB 4LF5E 4OX9E 4LFCE 3MSWA 4LF4E 3C4BA 2L6MA 1ZBQA 4X64E 1J5EE 5AASA 3F6HA 2DB2A 4JI7E 1EKZA 4B3SE 4B3RE 1N36E 5FLXC 2G7HA 2UUAE 1XNQE 4NXME 2V89A 2M7QA 2EZ6A 4M2ZA 2ODRD 4BC7A 2YZTA 3OTOE 4DV1E 5AE3A 1XMOE 2V86A 1HNZE 2VF1A 1GQEA 2LRSA 4KZSA 1XNRE 4BCAA 1T4LB 1IBKE 4GKKE 4YY3E 2L2KB 1HNWE 4K0KE 3JU0A 1DQ3A 2L3JA 2RS6A 4F9AB 5LL6R 2JWOA 1GZ6A 4LFAE 4JI6E 3AV0A 4DKKA 5AE2A 4DR5E 5ADZA 3T1HE 4DR2E 1J26A 3KWRA 4DV5E 2MC5A 3VK6A 3J80C 1ZBTA 2H36X 2MDRA 2RS7A 1DI2A 2NUEA 3ADJA 4B3TE 4I8OA 4R03A 4L8NA 2N3HA 3J7Yp 2JR1A 5T6JA 5F3WA 4DR1E 2UUBE 4LF6E 1N34E 1STUA 3VYYA 5IWAE 2L2MA 2VQFE 4DV0E 2F8BA 1WXRA 4DV6E 3J7AG 4JI0E 2B7TA 4J8ZA 4WYQB 1IBLE 2LUQA 4DR6E 1N32E 2B3TB 4DV4E 3T1YE 4JI2E 1SR9A 5IT9C 3HTXA 4DV7E 1T4OA 2YT4A 1X48A 4LU9A 5LMUE 2NA2A 1YYKA 2UXDE 4DV2E 2FV4B 4F9CB 2V83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ E;  1YYO A;  5CFF E;  4JI8 E;  1YYW A;  1QU6 A;  2E5L E;  4X66 E;  1XMQ E;  4LF9 E;  2HHH E;  1UIL A;  2LTR A;  4JI4 E;  4LF7 E;  4DR7 E;  4LFB E;  2LJH A;  2ZM6 E;  2CPN A;  4AQY E;  2KHX A;  2IHR 1;  2LUP B;  4DR4 E;  4B3M E;  4JI1 E;  3ADG A;  4JI5 E;  1HR0 E;  3C4T A;  2L2N A;  3ADL A;  4DR3 E;  1FJG E;  4KHP E;  1RQ0 A;  3VYX A;  4X8W A;  4LF8 E;  4JV5 E;  2B7V A;  2N3G A;  5LMN E;  4DV3 E;  2LBS B;  2RTX A;  4WFT A;  3LLH A;  2RSM A;  3ADI A;  2NUF A;  3HTX A;  4M30 A;  4YHH E;  2JY9 A;  4NXN E;  5BR8 E;  1O0W A;  2L33 A;  1FKA E;  2NUG A;  4JI3 E;  2UXB E;  3P1X A;  1YZ9 A;  2JVA A;  4GKJ E;  2L3C A;  2DMY A;  1X49 A;  2LTS A;  2UU9 E;  2DIX A;  4X65 E;  4JYA E;  1X47 A;  1WHN A;  2UUC E;  1N33 E;  1PKP A;  4OOG C;  1WHQ A;  1IBM E;  1RC7 A;  2VQE E;  4DUY E;  1I94 E;  2UXC E;  2F4V E;  1HNX E;  1UHZ A;  1T4N A;  4OX9 E;  4LF5 E;  4LFC E;  4LF4 E;  3C4B A;  4X64 E;  1J5E E;  4JI7 E;  2DB2 A;  1EKZ A;  4B3S E;  4B3R E;  1N36 E;  2UUA E;  1XNQ E;  4NXM E;  2EZ6 A;  4M2Z A;  3OTO E;  4DV1 E;  1XMO E;  1HNZ E;  1GQE A;  2LRS A;  1XNR E;  1IBK E;  1T4L B;  4GKK E;  4YY3 E;  2L2K B;  1HNW E;  4K0K E;  2L3J A;  2RS6 A;  4LFA E;  4JI6 E;  4DKK A;  4DR5 E;  3T1H E;  4DR2 E;  1J26 A;  4DV5 E;  1ZBT A;  2MDR A;  2RS7 A;  1DI2 A;  2NUE A;  3ADJ A;  4B3T E;  2N3H A;  3J7Y p;  2UUB E;  4LF6 E;  4DR1 E;  1N34 E;  1STU A;  3VYY A;  5IWA E;  2L2M A;  2VQF E;  4DV0 E;  4DV6 E;  4JI0 E;  2B7T A;  1IBL E;  4WYQ B;  4DR6 E;  2LUQ A;  1N32 E;  2B3T B;  4DV4 E;  3T1Y E;  4JI2 E;  4DV7 E;  1T4O A;  2YT4 A;  1X48 A;  5LMU E;  2NA2 A;  1YYK A;  2UXD E;  4DV2 E;  4X62 E; 
#chains in the Genus database with same CATH topology
 3THN A;  4DUZ E;  3FIG A;  1A1K A;  4X66 E;  1IQO A;  3EPH A;  1UIL A;  1IQS A;  2LMZ A;  3BID A;  2CPN A;  2KHX A;  2IHR 1;  2HJJ A;  3BBG A;  3HPZ A;  2EM4 A;  2YSP A;  1HR0 E;  1YFH A;  3ADL A;  2EL4 A;  2V8Q B;  1MEY C;  1FJG E;  4KHP E;  2L8T A;  4LF8 E;  2EMY A;  2EPC A;  2V88 A;  2YTN A;  4DV3 E;  2EPN A;  1DGC A;  2RTX A;  4WFT A;  3LLH A;  3DJW A;  2EP3 A;  3ADI A;  2NUF A;  3HTX A;  3HQ1 A;  5DNY A;  4TUI A;  4BBY A;  2E1M A;  2JYA A;  4TUG A;  4R8O A;  4Q28 A;  1TF3 A;  4WPY A;  2EOI A;  2EOZ A;  1AAY A;  5A2Q C;  2EPR A;  2L3C A;  2DMY A;  5A6A A;  1X49 A;  2UU9 E;  2VE7 C;  4R2C A;  4JYA E;  2EN3 A;  2EPA A;  2EMG A;  3OML A;  2LE2 A;  2YTI A;  3C6K A;  2ODR C;  2ELZ A;  2YTD A;  2EL6 A;  4BHB A;  4M0V A;  4LF5 E;  4LF4 E;  1ZBQ A;  4B3S E;  4B3R E;  1N36 E;  1YSA C;  2EE8 A;  2V89 A;  2EMX A;  4M2Z A;  3C6M A;  2ODR D;  2JXP A;  1XMO E;  4NHR A;  2L3J A;  3EPK A;  4LFA E;  2R76 A;  1MGT A;  1WJP A;  2DGC A;  4RHB B;  4DV5 E;  2EM9 A;  1ZAA C;  2GLI A;  1TN9 A;  3L00 A;  1BB8 A;  4B3T E;  2DLK A;  4R03 A;  5LLQ A;  5F3W A;  5T6J A;  4LF6 E;  5A6B A;  1N34 E;  3VYY A;  2L2M A;  1IBL E;  2JPA A;  4NZV A;  1SR9 A;  1G2D C;  2EM6 A;  4DV2 E;  4ZYD A;  1YYO A;  2YPN A;  2EOS A;  2A25 A;  2YTF A;  4JI8 E;  2FGG A;  2L92 A;  2B9D A;  2E5L E;  1XMQ E;  4GZN C;  4R2P A;  4LF7 E;  4GEQ B;  2Q8U A;  2R1F A;  4WX9 A;  2DLQ A;  4DR4 E;  2V87 A;  2EOO A;  3VHT B;  3QG5 C;  4B3M E;  4JI1 E;  2EPX A;  5AC4 A;  2EQ3 A;  2NAB A;  5AC5 A;  2EM8 A;  1IMU A;  2VRD A;  4DR3 E;  1RQ0 A;  2EOE A;  2ENA A;  2K4V A;  2KOU A;  2DRP A;  2EMK A;  2B7V A;  2EPP A;  2JOX A;  2WBS A;  5LMN E;  2LCE A;  4R2A A;  3K6Q A;  1T38 A;  1O0W A;  2L33 A;  1FKA E;  2YWQ A;  2NUG A;  2M4I A;  1EH7 A;  2EQ0 A;  1UBD C;  4GKJ E;  3KZY A;  2EWL A;  4P78 A;  4DMI A;  1A1I A;  5KL7 A;  3IWC A;  1WHN A;  2EPL X;  3BF2 A;  4OOG C;  3J81 C;  4R2D A;  2DMI A;  4X9J A;  2VQE E;  3HPS A;  4LTY A;  3EPL A;  3ZOQ B;  1T4N A;  4F9B B;  3C4B A;  1J5E E;  4BHC A;  5AAS A;  4WXC A;  2RPC A;  5FLX C;  4F6M A;  2EN7 A;  3MHH C;  3OTO E;  1F2I G;  5AE3 A;  2EPM X;  1X6E A;  2PRT A;  2V86 A;  1ZU1 A;  1HNZ E;  1UN6 B;  2LJU A;  2LRS A;  4KZS A;  1XNR E;  1KYQ A;  1IBK E;  1BBO A;  4HEI A;  2L2K B;  2WBU A;  1HNW E;  2LO3 A;  1DQ3 A;  4F9A B;  1GZ6 A;  4KWY A;  2BBG A;  4JI6 E;  4DKK A;  4DR5 E;  2GHF A;  2CT1 A;  3T1H E;  4DR2 E;  1J26 A;  1TF6 A;  3J80 C;  2H36 X;  2RS7 A;  3ADJ A;  2EN2 A;  2EMC A;  4L8N A;  3J7Y p;  2JR1 A;  2UUB E;  1STU A;  2EOR A;  3J7A G;  4ZYG A;  4ZYE A;  4DV0 E;  2F8B A;  1WXR A;  1KJK A;  4J8Z A;  4WYQ B;  4F2J C;  4R2Q A;  2B3T B;  4DV4 E;  5TSE A;  3T1Y E;  1PDA A;  2HGH A;  2EPZ A;  5IT9 C;  2J7J A;  2M9A A;  2YT4 A;  4DV7 E;  4LU9 A;  2NA2 A;  2EPU A;  1ZR9 A;  1X6H A;  2FV4 B;  2YTJ A;  2MC6 A;  4BC9 A;  3H09 A;  1EH6 A;  4LF9 E;  2EL5 A;  2HHH E;  4JI4 E;  4WSP A;  4DR7 E;  2GPI A;  2ZM6 E;  2EOY A;  4AQY E;  2EN8 A;  2EJ4 A;  2LUP B;  1RMD A;  2YRK A;  3EQ1 A;  3ADG A;  1YUJ A;  4JI5 E;  4P7D A;  3C4T A;  5KL5 A;  2L2N A;  3IWB A;  1A1L A;  1PJQ A;  2V85 A;  3VYX A;  1A1H A;  4X8W A;  2EMH A;  2N3G A;  2RSM A;  4F6N A;  2CTD A;  4M30 A;  2EMB A;  2EOX A;  2JY9 A;  4YHH E;  2WCC 3;  3THO B;  4NXN E;  4JI3 E;  2UXB E;  2EPK X;  3HXL A;  4O24 A;  3UK3 C;  1YZ9 A;  2JVA A;  4WSG A;  4R2E A;  2LTS A;  1GTK A;  2KON A;  1X47 A;  4WXD A;  4X65 E;  1PKP A;  1WHQ A;  1IBM E;  1RC7 A;  2EML A;  2EM5 A;  2YTQ A;  4DUY E;  2M1S A;  2LT7 A;  1A1J A;  2UXC E;  2F4V E;  1HNX E;  1P47 A;  1UHZ A;  4OX9 E;  1JK2 A;  2L6M A;  1EKZ A;  2DB2 A;  1T39 A;  2G7H A;  2YRM A;  1X3C A;  4NXM E;  2EZ6 A;  1Z1B A;  5IXM B;  4BC7 A;  3MHS C;  2BB8 A;  2EN1 A;  2YU5 A;  4BCA A;  1BBG A;  4YY3 E;  2EOH A;  3JU0 A;  4K0K E;  2RS6 A;  2JWO A;  2EPO A;  4O5G A;  5A6B D;  3EPJ A;  2N8X A;  1X5W A;  2MC5 A;  2EM0 A;  2EN4 A;  1ZBT A;  5A6K A;  2I13 A;  5KL2 A;  1NCS A;  2ELY A;  4I8O A;  1G2F C;  1WRJ A;  4MLQ A;  2EOJ A;  1PJS A;  2N3H A;  4N4R B;  4Q35 B;  4DR1 E;  2MDG A;  2YTP A;  5KL3 A;  5IWA E;  4JI0 E;  2B7T A;  2EMZ A;  4DR6 E;  2EM2 A;  2EMF A;  1LLM C;  4ZYH A;  1YYK A;  2UXD E;  5A69 A;  2EM7 A;  4M9V C;  2MKN A;  4F9C B;  4X62 E;  2YTO A;  5CFF E;  1YYW A;  3AUZ A;  2I9I A;  1AH5 A;  1QU6 A;  3DF6 A;  4BS9 A;  2LTR A;  5AE1 A;  4LFB E;  1NEI A;  2WZO A;  1YUI A;  2LJH A;  4IS1 C;  1A1G A;  2EOM A;  1PJT A;  2DSY A;  1JK1 A;  2E72 A;  2EN6 A;  2RSI A;  4HTG A;  3TQM A;  2RQL A;  2YU8 A;  4O43 A;  4JV5 E;  2YSO A;  3JTZ A;  3M99 B;  1B69 A;  2LBS B;  1L4S A;  2EOQ A;  2FTX B;  2JOB A;  5BR8 E;  4BMJ A;  3JAM C;  2CSH A;  3KZZ A;  1SFE A;  3RMP A;  3LML A;  4L5N C;  2JP9 A;  2YTG A;  3P1X A;  3ECR A;  2LV2 A;  4O4K A;  2YTE A;  3F6G A;  4F54 A;  2DIX A;  2UUC E;  1N33 E;  2HC5 A;  1YPN A;  4R2R A;  3IWD A;  2EM3 A;  1I94 E;  2ENH A;  2ENC A;  1QNT A;  2ADR A;  1X6F A;  4LFC E;  3MSW A;  5IV8 B;  4X64 E;  3F6H A;  4JI7 E;  5KL4 A;  2UUA E;  5A6J A;  1XNQ E;  2M7Q A;  2YZT A;  4DV1 E;  2VF1 A;  1GQE A;  2EQ1 A;  2EMA A;  1T4L B;  4GKK E;  4R2S A;  3BGH A;  2MKD A;  4FK5 C;  5LL6 R;  3AV0 A;  5AE2 A;  5ADZ A;  3KWR A;  3VK6 A;  2WBT A;  2MDR A;  1DI2 A;  2EMI A;  2NUE A;  4IJD A;  2K7I A;  4RH8 A;  2VQF E;  4DV6 E;  2YRH A;  2LUQ A;  2LVH A;  2D9H A;  1N32 E;  1N3G A;  4JI2 E;  2EMW A;  2EOF A;  1EH8 A;  1T4O A;  1X48 A;  4MLV A;  5LMU E;  1A1F A;  2V83 A;  5KL6 A; 
#chains in the Genus database with same CATH homology
 4DUZ E;  1YYO A;  5CFF E;  4JI8 E;  3FIG A;  2FGG A;  3AUZ A;  2MC6 A;  4BC9 A;  1YYW A;  3H09 A;  2L92 A;  2B9D A;  1QU6 A;  2E5L E;  4X66 E;  3DF6 A;  1XMQ E;  4LF9 E;  4BS9 A;  2HHH E;  1UIL A;  2LTR A;  5AE1 A;  4JI4 E;  4LF7 E;  2WZO A;  2LMZ A;  4WSP A;  2LJH A;  4DR7 E;  2ZM6 E;  4GEQ B;  4LFB E;  2CPN A;  4AQY E;  2DSY A;  2KHX A;  2IHR 1;  2LUP B;  4DR4 E;  2V87 A;  4B3M E;  3HPZ A;  4JI1 E;  3ADG A;  4JI5 E;  1HR0 E;  4P7D A;  3C4T A;  2L2N A;  3IWB A;  2V85 A;  2V8Q B;  3ADL A;  4DR3 E;  1FJG E;  4KHP E;  2L8T A;  1RQ0 A;  3VYX A;  4X8W A;  2K4V A;  2KOU A;  2UU9 E;  4LF8 E;  4JV5 E;  2B7V A;  2JOX A;  2V88 A;  2N3G A;  5LMN E;  3JTZ A;  4DV3 E;  2LBS B;  2RTX A;  4WFT A;  3LLH A;  3DJW A;  2RSM A;  3K6Q A;  3ADI A;  2FTX B;  2NUF A;  3HQ1 A;  4M30 A;  2JOB A;  5DNY A;  4YHH E;  2JY9 A;  4NXN E;  5BR8 E;  4BBY A;  1O0W A;  2E1M A;  2L33 A;  4BMJ A;  3JAM C;  4TUI A;  1FKA E;  2NUG A;  4JI3 E;  3RMP A;  4TUG A;  2M4I A;  3LML A;  4L5N C;  4R8O A;  4Q28 A;  2UXB E;  3P1X A;  3HXL A;  4WPY A;  1YZ9 A;  2JVA A;  4GKJ E;  5A2Q C;  4DMI A;  2EWL A;  2DMY A;  4P78 A;  2L3C A;  1X49 A;  2LTS A;  3F6G A;  2DIX A;  2VE7 C;  4F54 A;  2KON A;  4X62 E;  1X47 A;  3IWC A;  1WHN A;  4X65 E;  2UUC E;  4JYA E;  1N33 E;  1PKP A;  4OOG C;  1WHQ A;  3OML A;  2LE2 A;  1IBM E;  3J81 C;  1RC7 A;  2VQE E;  3HPS A;  2ODR C;  2M1S A;  3IWD A;  4DUY E;  1I94 E;  4LTY A;  2UXC E;  2F4V E;  3ZOQ B;  1HNX E;  4M0V A;  1UHZ A;  1T4N A;  4F9B B;  4LF5 E;  4OX9 E;  4LFC E;  3MSW A;  4LF4 E;  3C4B A;  2L6M A;  1ZBQ A;  4X64 E;  1J5E E;  5AAS A;  3F6H A;  2DB2 A;  4JI7 E;  1EKZ A;  4B3S E;  4B3R E;  1N36 E;  5FLX C;  2G7H A;  2UUA E;  1XNQ E;  4NXM E;  2V89 A;  2M7Q A;  2EZ6 A;  4M2Z A;  2ODR D;  4BC7 A;  2YZT A;  3OTO E;  4DV1 E;  5AE3 A;  1XMO E;  2V86 A;  1HNZ E;  2VF1 A;  1GQE A;  2LRS A;  4KZS A;  1XNR E;  4BCA A;  1T4L B;  1IBK E;  4GKK E;  4YY3 E;  2L2K B;  1HNW E;  4K0K E;  3JU0 A;  1DQ3 A;  2L3J A;  2RS6 A;  4F9A B;  5LL6 R;  2JWO A;  1GZ6 A;  4LFA E;  4JI6 E;  3AV0 A;  4DKK A;  5AE2 A;  4DR5 E;  5ADZ A;  3T1H E;  4DR2 E;  1J26 A;  3KWR A;  4DV5 E;  2MC5 A;  3VK6 A;  3J80 C;  1ZBT A;  2H36 X;  2MDR A;  2RS7 A;  1DI2 A;  2NUE A;  3ADJ A;  4B3T E;  4I8O A;  4R03 A;  4L8N A;  2N3H A;  3J7Y p;  2JR1 A;  5T6J A;  5F3W A;  4DR1 E;  2UUB E;  4LF6 E;  1N34 E;  1STU A;  3VYY A;  5IWA E;  2L2M A;  2VQF E;  4DV0 E;  2F8B A;  1WXR A;  4DV6 E;  3J7A G;  4JI0 E;  2B7T A;  4J8Z A;  4WYQ B;  1IBL E;  2LUQ A;  4DR6 E;  1N32 E;  2B3T B;  4DV4 E;  3T1Y E;  4JI2 E;  1SR9 A;  5IT9 C;  3HTX A;  4DV7 E;  1T4O A;  2YT4 A;  1X48 A;  4LU9 A;  5LMU E;  2NA2 A;  1YYK A;  2UXD E;  4DV2 E;  2FV4 B;  4F9C B;  2V83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...