5CFIA

Structural and functional attributes of malaria parasite ap4a hydrolase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
147
structure length
147
Chain Sequence
NIIKAFGILLCRLKKYNPVTTGDINKFEFLFLKASYADKHWTPPKGLHENNESGLETAVRETLEETGINKDKYKLLNYQKTLKYNVKDKPKETTYYLAMLLNNEENVILSDEHTDYKWIGSHESDTYNLPESLADLLKEAEEFLNKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIS(5'-nucleosyl)-tetraphosphatase (Diadenosine tetraphospha
publication title Structural and functional attributes of malaria parasite diadenosine tetraphosphate hydrolase
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
molecule tags Hydrolase
total genus 33
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.17: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5cfiA00
3SONA 3GZ6A 1VIUA 4YPRA 4K6EA 1V8VA 3ACAA 3FJYA 1V8TA 3O61A 1PPVA 4HVYA 2AZWA 3A6SA 3HHJA 3SMDA 3I7UA 1MQWA 2R5WA 1I9AA 1G0SA 1KTGA 4S2XA 5GHMA 5HZXA 3R03A 1RYAA 3Q93A 2FMLA 3N77A 3CNGA 1VIQA 4S2WA 1V8RA 4YOQA 5ANVA 2B2KA 2A8PA 2YVPA 2CL3A 3GZ5A 1JKNA 5CFJA 1NQZA 1HZTA 1SU2A 3G0QA 1XSAA 2XSQA 1MK1A 2YYHA 2QJOA 3F13A 3GZ8A 3EESA 3OGAA 5DDGA 1V8YA 3Q1PA 3X0MA 4S2YA 4MPOA 5CFIA 3FCMA 3FK9A 2A6TA 2KDVA 3O69A 1NFSA 1Q27A 3MCFA 3I7VA 1XSBA 2DSBA 2A8RA 3X0OA 2A8QA 1Q54A 5FSOA 3FSPA 2KDWA 3KVHA 3X0QA 5ANWA 3Q91A 1VC9A 3Q4IA 2GB5A 2PNYA 3I9XA 1V8IA 1KHZA 3EXQA 1V8UA 1VHZA 2A8TA 5ANUA 3QSJA 5FSKA 5FSMA 5GHIA 3X0PA 1SJYA 3RH7A 1X51A 5GHOA 2DUKA 3P5TA 4NFXA 5I8UA 1SOIA 2DSCA 4KTBA 5ANTA 5ISYA 2O5WA 4ILQA 2B06A 3X0RA 3HYQA 5DD4A 1JRKA 5DEQA 3MDIA 1PUNA 2DSDA 2G74A 3MDGA 1X83A 5GHJA 5C8LA 3X0IA 4C9XA 4KYXA 1MR2A 3ZR1A 2DHOA 4YPHA 5DPKA 3O8SA 1VK6A 1V8NA 2GT4A 3BM4A 1RRSA 5C7QA 1U20A 1V8WA 2ICKA 3FFUA 5GHNA 5ANSA 2YVNA 4JZUA 2B0VA 4IJXA 3X0KA 1IRYA 3BAPA 4ICKA 3DKUA 5LPGA 3GRNA 5FSIA 1PPXA 2W4EA 1QVJA 4S2VA 3X0NA 3ID9A 2YVMA 2YVOA 4JZSA 5GHPA 1NFZA 3F6AA 3A6UA 3ZR0A 2RRKA 2QJTA 1V8SA 3U53A 4C9WA 1Q33A 1V8LA 5C7TA 1VRLA 3N9UA 1VC8A 4JZVA 3EF5A 3GWYA 3MGMA 3O52A 1VCDA 5GHQA 3X0LA 3P6YA 1SZ3A 2GT2A 3Q2SA 2VNPA 3X0SA 1X84A 1GA7A 1HX3A 2ICJA 3X0JA 2I8TA 3DUPA 4NFWA 5BS6A 2QKMB 4N1UA 1G9QA 1PUSA 4JZTA 1TUMA 1RRQA 2VNQA 3O6ZA 1K26A 1MUTA 1VHGA 2Q9PA 3J7Ye 4KG4A 1PVFA 1K2EA 3EEUA 3WHWA 2FVVA 1MP2A 1NQYA 3AC9A 4HFQA 4KG3A 3Q2TA 1OW2A 4N1TA 5FSNA 2G73A 2O1CA 2PQVA 3COUA 3GG6A 1R67A 3E57A 3A6TA 4DYWA 2I6KA 2I8UA 5IW5A 1V8MA 2O5FA 3A6VA 5FSLA 2JVBA 1XSCA 5BONA 1PPWA 2A8SA 3H95A 4ZG0A 1MQEA 3L85A 3SHDA 1KT9A 1F3YA 1PUQA 2FKBA 3BHOA 5IW4A 4V14A 2J8QA
chains in the Genus database with same CATH superfamily
3SONA 3GZ6A 1VIUA 4YPRA 4K6EA 1V8VA 3ACAA 3FJYA 1V8TA 3O61A 1PPVA 4HVYA 2AZWA 3A6SA 3HHJA 3SMDA 3I7UA 1MQWA 2R5WA 1I9AA 1G0SA 1KTGA 4S2XA 5GHMA 5HZXA 3R03A 1RYAA 3Q93A 2FMLA 3N77A 3CNGA 4J7HA 1VIQA 4S2WA 1V8RA 4YOQA 5ANVA 2B2KA 2A8PA 2YVPA 2CL3A 3GZ5A 1JKNA 5CFJA 1NQZA 1HZTA 1SU2A 3G0QA 1XSAA 2XSQA 1MK1A 2YYHA 2QJOA 3F13A 3GZ8A 3EESA 3OGAA 5DDGA 1V8YA 3Q1PA 3X0MA 4S2YA 4MPOA 5CFIA 3FCMA 3FK9A 2A6TA 2KDVA 3O69A 1NFSA 1Q27A 3MCFA 3I7VA 1XSBA 2DSBA 2A8RA 3X0OA 2A8QA 1Q54A 5FSOA 3FSPA 2KDWA 3KVHA 3X0QA 5ANWA 3Q91A 1VC9A 3Q4IA 2GB5A 2PNYA 3I9XA 1V8IA 1KHZA 3EXQA 1V8UA 1VHZA 2A8TA 5ANUA 3QSJA 5FSKA 5FSMA 5GHIA 3X0PA 1SJYA 3RH7A 1X51A 5GHOA 2DUKA 3P5TA 4NFXA 5I8UA 1SOIA 2DSCA 4KTBA 5ANTA 5ISYA 2O5WA 4ILQA 2B06A 3X0RA 3HYQA 5DD4A 1JRKA 4J7GA 5DEQA 3MDIA 1PUNA 2DSDA 2G74A 3MDGA 1X83A 5GHJA 5C8LA 3X0IA 4C9XA 4KYXA 1MR2A 3ZR1A 2DHOA 4YPHA 5DPKA 3O8SA 1VK6A 1V8NA 2GT4A 3BM4A 1RRSA 5C7QA 1U20A 1V8WA 2ICKA 3FFUA 5GHNA 5ANSA 2YVNA 4JZUA 2B0VA 4IJXA 3X0KA 1IRYA 3BAPA 4ICKA 3DKUA 5LPGA 3GRNA 5FSIA 1PPXA 2W4EA 1QVJA 4S2VA 3X0NA 3ID9A 2YVMA 2YVOA 4JZSA 5GHPA 1NFZA 3F6AA 3A6UA 3ZR0A 2RRKA 2QJTA 1V8SA 3U53A 4C9WA 1Q33A 1V8LA 5C7TA 1VRLA 3N9UA 1VC8A 4JZVA 3EF5A 3GWYA 3MGMA 3O52A 2CZRA 1VCDA 5GHQA 3X0LA 3P6YA 1SZ3A 2GT2A 3Q2SA 2VNPA 3X0SA 1X84A 1GA7A 1HX3A 2ICJA 3X0JA 2I8TA 3DUPA 4NFWA 5BS6A 2QKMB 4N1UA 1G9QA 1PUSA 4JZTA 1TUMA 1RRQA 2VNQA 3O6ZA 1K26A 1MUTA 1VHGA 2Q9PA 3J7Ye 4KG4A 1PVFA 1K2EA 3EEUA 3WHWA 2FVVA 1MP2A 1NQYA 3AC9A 4HFQA 4KG3A 3Q2TA 1OW2A 4N1TA 5FSNA 2G73A 2O1CA 2PQVA 3COUA 3GG6A 1R67A 3E57A 3A6TA 4DYWA 2I6KA 2I8UA 5IW5A 1V8MA 2O5FA 3A6VA 5FSLA 2JVBA 1XSCA 5BONA 1PPWA 2A8SA 3H95A 4ZG0A 1MQEA 3L85A 3SHDA 1KT9A 1F3YA 1PUQA 2FKBA 3BHOA 5IW4A 4V14A 2J8QA
chains in the Genus database with same CATH topology
3SONA 3GZ6A 1VIUA 4YPRA 4K6EA 1V8VA 3ACAA 3FJYA 1V8TA 3O61A 1PPVA 4HVYA 2AZWA 3A6SA 3HHJA 3SMDA 3I7UA 1MQWA 2R5WA 1I9AA 1G0SA 1KTGA 4S2XA 5GHMA 5HZXA 3R03A 1RYAA 3Q93A 2FMLA 3N77A 3CNGA 4J7HA 1VIQA 4S2WA 1V8RA 4YOQA 5ANVA 2B2KA 2A8PA 2YVPA 2CL3A 3GZ5A 1JKNA 5CFJA 1NQZA 1HZTA 1SU2A 3G0QA 1XSAA 2XSQA 1MK1A 2YYHA 2QJOA 3F13A 3GZ8A 3EESA 3OGAA 5DDGA 1V8YA 3Q1PA 3X0MA 4S2YA 4MPOA 5CFIA 3FCMA 3FK9A 2A6TA 2KDVA 3O69A 1NFSA 1Q27A 3MCFA 3I7VA 1XSBA 2DSBA 2A8RA 3X0OA 2A8QA 1Q54A 5FSOA 3FSPA 2KDWA 3KVHA 3X0QA 5ANWA 3Q91A 1VC9A 3Q4IA 2GB5A 2PNYA 3I9XA 1V8IA 1KHZA 3EXQA 1V8UA 1VHZA 2A8TA 5ANUA 3QSJA 5FSKA 5FSMA 5GHIA 3X0PA 1SJYA 3RH7A 1X51A 5GHOA 2DUKA 3P5TA 4NFXA 5I8UA 1SOIA 2DSCA 4KTBA 5ANTA 5ISYA 2O5WA 4ILQA 2B06A 3X0RA 3HYQA 5DD4A 1JRKA 4J7GA 5DEQA 3MDIA 1PUNA 2DSDA 2G74A 3MDGA 1X83A 5GHJA 5C8LA 3X0IA 4C9XA 4KYXA 1MR2A 3ZR1A 2DHOA 4YPHA 5DPKA 3O8SA 1VK6A 1V8NA 2GT4A 3BM4A 1RRSA 5C7QA 1U20A 1V8WA 2ICKA 3FFUA 5GHNA 5ANSA 2YVNA 4JZUA 2B0VA 4IJXA 3X0KA 1IRYA 3BAPA 4ICKA 3DKUA 5LPGA 3GRNA 5FSIA 1PPXA 2W4EA 1QVJA 4S2VA 3X0NA 3ID9A 2YVMA 2YVOA 4JZSA 5GHPA 1NFZA 3F6AA 3A6UA 3ZR0A 2RRKA 2QJTA 1V8SA 3U53A 4C9WA 1Q33A 1V8LA 5C7TA 1VRLA 3N9UA 1VC8A 4JZVA 3EF5A 3GWYA 3MGMA 3O52A 2CZRA 1VCDA 5GHQA 3X0LA 3P6YA 1SZ3A 2GT2A 3Q2SA 2VNPA 3X0SA 1X84A 1GA7A 1HX3A 2ICJA 3X0JA 2I8TA 3DUPA 4NFWA 5BS6A 2QKMB 4N1UA 1G9QA 1PUSA 4JZTA 1TUMA 1RRQA 2VNQA 3O6ZA 1K26A 1MUTA 1VHGA 2Q9PA 3J7Ye 4KG4A 1PVFA 1K2EA 3EEUA 3WHWA 2FVVA 1MP2A 1NQYA 3AC9A 4HFQA 4KG3A 3Q2TA 1OW2A 4N1TA 5FSNA 2G73A 2O1CA 2PQVA 3COUA 3GG6A 1R67A 3E57A 3A6TA 4DYWA 2I6KA 2I8UA 5IW5A 1V8MA 2O5FA 3A6VA 5FSLA 2JVBA 1XSCA 5BONA 1PPWA 2A8SA 3H95A 4ZG0A 1MQEA 3L85A 3SHDA 1KT9A 1F3YA 1PUQA 2FKBA 3BHOA 5IW4A 4V14A 2J8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SON A;  3GZ6 A;  1VIU A;  4YPR A;  4K6E A;  1V8V A;  3ACA A;  3FJY A;  1V8T A;  3O61 A;  1PPV A;  4HVY A;  2AZW A;  3A6S A;  3HHJ A;  3SMD A;  3I7U A;  1MQW A;  2R5W A;  1I9A A;  1G0S A;  1KTG A;  4S2X A;  5GHM A;  5HZX A;  3R03 A;  1RYA A;  3Q93 A;  2FML A;  3N77 A;  3CNG A;  1VIQ A;  4S2W A;  1V8R A;  4YOQ A;  5ANV A;  2B2K A;  2A8P A;  2YVP A;  2CL3 A;  3GZ5 A;  1JKN A;  5CFJ A;  1NQZ A;  1HZT A;  1SU2 A;  3G0Q A;  1XSA A;  2XSQ A;  1MK1 A;  2YYH A;  2QJO A;  3F13 A;  3GZ8 A;  3EES A;  3OGA A;  5DDG A;  1V8Y A;  3Q1P A;  3X0M A;  4S2Y A;  4MPO A;  5CFI A;  3FCM A;  3FK9 A;  2A6T A;  2KDV A;  3O69 A;  1NFS A;  1Q27 A;  3MCF A;  3I7V A;  1XSB A;  2DSB A;  2A8R A;  3X0O A;  2A8Q A;  1Q54 A;  5FSO A;  3FSP A;  2KDW A;  3KVH A;  3X0Q A;  5ANW A;  3Q91 A;  1VC9 A;  3Q4I A;  2GB5 A;  2PNY A;  3I9X A;  1V8I A;  1KHZ A;  3EXQ A;  1V8U A;  1VHZ A;  2A8T A;  5ANU A;  3QSJ A;  5FSK A;  5FSM A;  5GHI A;  3X0P A;  1SJY A;  3RH7 A;  1X51 A;  5GHO A;  2DUK A;  3P5T A;  4NFX A;  5I8U A;  1SOI A;  2DSC A;  4KTB A;  5ANT A;  5ISY A;  2O5W A;  4ILQ A;  2B06 A;  3X0R A;  3HYQ A;  5DD4 A;  1JRK A;  5DEQ A;  3MDI A;  1PUN A;  2DSD A;  2G74 A;  3MDG A;  1X83 A;  5GHJ A;  5C8L A;  3X0I A;  4C9X A;  4KYX A;  1MR2 A;  3ZR1 A;  2DHO A;  4YPH A;  5DPK A;  3O8S A;  1VK6 A;  1V8N A;  2GT4 A;  3BM4 A;  1RRS A;  5C7Q A;  1U20 A;  1V8W A;  2ICK A;  3FFU A;  5GHN A;  5ANS A;  2YVN A;  4JZU A;  2B0V A;  4IJX A;  3X0K A;  1IRY A;  3BAP A;  4ICK A;  3DKU A;  5LPG A;  3GRN A;  5FSI A;  1PPX A;  2W4E A;  1QVJ A;  4S2V A;  3X0N A;  3ID9 A;  2YVM A;  2YVO A;  4JZS A;  5GHP A;  1NFZ A;  3F6A A;  3A6U A;  3ZR0 A;  2RRK A;  2QJT A;  1V8S A;  3U53 A;  4C9W A;  1Q33 A;  1V8L A;  5C7T A;  1VRL A;  3N9U A;  1VC8 A;  4JZV A;  3EF5 A;  3GWY A;  3MGM A;  3O52 A;  1VCD A;  5GHQ A;  3X0L A;  3P6Y A;  1SZ3 A;  2GT2 A;  3Q2S A;  2VNP A;  3X0S A;  1X84 A;  1GA7 A;  1HX3 A;  2ICJ A;  3X0J A;  2I8T A;  3DUP A;  4NFW A;  5BS6 A;  2QKM B;  4N1U A;  1G9Q A;  1PUS A;  4JZT A;  1TUM A;  1RRQ A;  2VNQ A;  3O6Z A;  1K26 A;  1MUT A;  1VHG A;  2Q9P A;  3J7Y e;  4KG4 A;  1PVF A;  1K2E A;  3EEU A;  3WHW A;  2FVV A;  1MP2 A;  1NQY A;  3AC9 A;  4HFQ A;  4KG3 A;  3Q2T A;  1OW2 A;  4N1T A;  5FSN A;  2G73 A;  2O1C A;  2PQV A;  3COU A;  3GG6 A;  1R67 A;  3E57 A;  3A6T A;  4DYW A;  2I6K A;  2I8U A;  5IW5 A;  1V8M A;  2O5F A;  3A6V A;  5FSL A;  2JVB A;  1XSC A;  5BON A;  1PPW A;  2A8S A;  3H95 A;  4ZG0 A;  1MQE A;  3L85 A;  3SHD A;  1KT9 A;  1F3Y A;  1PUQ A;  2FKB A;  3BHO A;  5IW4 A;  4V14 A;  2J8Q A; 
#chains in the Genus database with same CATH topology
 3SON A;  3GZ6 A;  1VIU A;  4YPR A;  4K6E A;  1V8V A;  3ACA A;  3FJY A;  1V8T A;  3O61 A;  1PPV A;  4HVY A;  2AZW A;  3A6S A;  3HHJ A;  3SMD A;  3I7U A;  1MQW A;  2R5W A;  1I9A A;  1G0S A;  1KTG A;  4S2X A;  5GHM A;  5HZX A;  3R03 A;  1RYA A;  3Q93 A;  2FML A;  3N77 A;  3CNG A;  4J7H A;  1VIQ A;  4S2W A;  1V8R A;  4YOQ A;  5ANV A;  2B2K A;  2A8P A;  2YVP A;  2CL3 A;  3GZ5 A;  1JKN A;  5CFJ A;  1NQZ A;  1HZT A;  1SU2 A;  3G0Q A;  1XSA A;  2XSQ A;  1MK1 A;  2YYH A;  2QJO A;  3F13 A;  3GZ8 A;  3EES A;  3OGA A;  5DDG A;  1V8Y A;  3Q1P A;  3X0M A;  4S2Y A;  4MPO A;  5CFI A;  3FCM A;  3FK9 A;  2A6T A;  2KDV A;  3O69 A;  1NFS A;  1Q27 A;  3MCF A;  3I7V A;  1XSB A;  2DSB A;  2A8R A;  3X0O A;  2A8Q A;  1Q54 A;  5FSO A;  3FSP A;  2KDW A;  3KVH A;  3X0Q A;  5ANW A;  3Q91 A;  1VC9 A;  3Q4I A;  2GB5 A;  2PNY A;  3I9X A;  1V8I A;  1KHZ A;  3EXQ A;  1V8U A;  1VHZ A;  2A8T A;  5ANU A;  3QSJ A;  5FSK A;  5FSM A;  5GHI A;  3X0P A;  1SJY A;  3RH7 A;  1X51 A;  5GHO A;  2DUK A;  3P5T A;  4NFX A;  5I8U A;  1SOI A;  2DSC A;  4KTB A;  5ANT A;  5ISY A;  2O5W A;  4ILQ A;  2B06 A;  3X0R A;  3HYQ A;  5DD4 A;  1JRK A;  4J7G A;  5DEQ A;  3MDI A;  1PUN A;  2DSD A;  2G74 A;  3MDG A;  1X83 A;  5GHJ A;  5C8L A;  3X0I A;  4C9X A;  4KYX A;  1MR2 A;  3ZR1 A;  2DHO A;  4YPH A;  5DPK A;  3O8S A;  1VK6 A;  1V8N A;  2GT4 A;  3BM4 A;  1RRS A;  5C7Q A;  1U20 A;  1V8W A;  2ICK A;  3FFU A;  5GHN A;  5ANS A;  2YVN A;  4JZU A;  2B0V A;  4IJX A;  3X0K A;  1IRY A;  3BAP A;  4ICK A;  3DKU A;  5LPG A;  3GRN A;  5FSI A;  1PPX A;  2W4E A;  1QVJ A;  4S2V A;  3X0N A;  3ID9 A;  2YVM A;  2YVO A;  4JZS A;  5GHP A;  1NFZ A;  3F6A A;  3A6U A;  3ZR0 A;  2RRK A;  2QJT A;  1V8S A;  3U53 A;  4C9W A;  1Q33 A;  1V8L A;  5C7T A;  1VRL A;  3N9U A;  1VC8 A;  4JZV A;  3EF5 A;  3GWY A;  3MGM A;  3O52 A;  2CZR A;  1VCD A;  5GHQ A;  3X0L A;  3P6Y A;  1SZ3 A;  2GT2 A;  3Q2S A;  2VNP A;  3X0S A;  1X84 A;  1GA7 A;  1HX3 A;  2ICJ A;  3X0J A;  2I8T A;  3DUP A;  4NFW A;  5BS6 A;  2QKM B;  4N1U A;  1G9Q A;  1PUS A;  4JZT A;  1TUM A;  1RRQ A;  2VNQ A;  3O6Z A;  1K26 A;  1MUT A;  1VHG A;  2Q9P A;  3J7Y e;  4KG4 A;  1PVF A;  1K2E A;  3EEU A;  3WHW A;  2FVV A;  1MP2 A;  1NQY A;  3AC9 A;  4HFQ A;  4KG3 A;  3Q2T A;  1OW2 A;  4N1T A;  5FSN A;  2G73 A;  2O1C A;  2PQV A;  3COU A;  3GG6 A;  1R67 A;  3E57 A;  3A6T A;  4DYW A;  2I6K A;  2I8U A;  5IW5 A;  1V8M A;  2O5F A;  3A6V A;  5FSL A;  2JVB A;  1XSC A;  5BON A;  1PPW A;  2A8S A;  3H95 A;  4ZG0 A;  1MQE A;  3L85 A;  3SHD A;  1KT9 A;  1F3Y A;  1PUQ A;  2FKB A;  3BHO A;  5IW4 A;  4V14 A;  2J8Q A; 
#chains in the Genus database with same CATH homology
 3SON A;  3GZ6 A;  1VIU A;  4YPR A;  4K6E A;  1V8V A;  3ACA A;  3FJY A;  1V8T A;  3O61 A;  1PPV A;  4HVY A;  2AZW A;  3A6S A;  3HHJ A;  3SMD A;  3I7U A;  1MQW A;  2R5W A;  1I9A A;  1G0S A;  1KTG A;  4S2X A;  5GHM A;  5HZX A;  3R03 A;  1RYA A;  3Q93 A;  2FML A;  3N77 A;  3CNG A;  4J7H A;  1VIQ A;  4S2W A;  1V8R A;  4YOQ A;  5ANV A;  2B2K A;  2A8P A;  2YVP A;  2CL3 A;  3GZ5 A;  1JKN A;  5CFJ A;  1NQZ A;  1HZT A;  1SU2 A;  3G0Q A;  1XSA A;  2XSQ A;  1MK1 A;  2YYH A;  2QJO A;  3F13 A;  3GZ8 A;  3EES A;  3OGA A;  5DDG A;  1V8Y A;  3Q1P A;  3X0M A;  4S2Y A;  4MPO A;  5CFI A;  3FCM A;  3FK9 A;  2A6T A;  2KDV A;  3O69 A;  1NFS A;  1Q27 A;  3MCF A;  3I7V A;  1XSB A;  2DSB A;  2A8R A;  3X0O A;  2A8Q A;  1Q54 A;  5FSO A;  3FSP A;  2KDW A;  3KVH A;  3X0Q A;  5ANW A;  3Q91 A;  1VC9 A;  3Q4I A;  2GB5 A;  2PNY A;  3I9X A;  1V8I A;  1KHZ A;  3EXQ A;  1V8U A;  1VHZ A;  2A8T A;  5ANU A;  3QSJ A;  5FSK A;  5FSM A;  5GHI A;  3X0P A;  1SJY A;  3RH7 A;  1X51 A;  5GHO A;  2DUK A;  3P5T A;  4NFX A;  5I8U A;  1SOI A;  2DSC A;  4KTB A;  5ANT A;  5ISY A;  2O5W A;  4ILQ A;  2B06 A;  3X0R A;  3HYQ A;  5DD4 A;  1JRK A;  4J7G A;  5DEQ A;  3MDI A;  1PUN A;  2DSD A;  2G74 A;  3MDG A;  1X83 A;  5GHJ A;  5C8L A;  3X0I A;  4C9X A;  4KYX A;  1MR2 A;  3ZR1 A;  2DHO A;  4YPH A;  5DPK A;  3O8S A;  1VK6 A;  1V8N A;  2GT4 A;  3BM4 A;  1RRS A;  5C7Q A;  1U20 A;  1V8W A;  2ICK A;  3FFU A;  5GHN A;  5ANS A;  2YVN A;  4JZU A;  2B0V A;  4IJX A;  3X0K A;  1IRY A;  3BAP A;  4ICK A;  3DKU A;  5LPG A;  3GRN A;  5FSI A;  1PPX A;  2W4E A;  1QVJ A;  4S2V A;  3X0N A;  3ID9 A;  2YVM A;  2YVO A;  4JZS A;  5GHP A;  1NFZ A;  3F6A A;  3A6U A;  3ZR0 A;  2RRK A;  2QJT A;  1V8S A;  3U53 A;  4C9W A;  1Q33 A;  1V8L A;  5C7T A;  1VRL A;  3N9U A;  1VC8 A;  4JZV A;  3EF5 A;  3GWY A;  3MGM A;  3O52 A;  2CZR A;  1VCD A;  5GHQ A;  3X0L A;  3P6Y A;  1SZ3 A;  2GT2 A;  3Q2S A;  2VNP A;  3X0S A;  1X84 A;  1GA7 A;  1HX3 A;  2ICJ A;  3X0J A;  2I8T A;  3DUP A;  4NFW A;  5BS6 A;  2QKM B;  4N1U A;  1G9Q A;  1PUS A;  4JZT A;  1TUM A;  1RRQ A;  2VNQ A;  3O6Z A;  1K26 A;  1MUT A;  1VHG A;  2Q9P A;  3J7Y e;  4KG4 A;  1PVF A;  1K2E A;  3EEU A;  3WHW A;  2FVV A;  1MP2 A;  1NQY A;  3AC9 A;  4HFQ A;  4KG3 A;  3Q2T A;  1OW2 A;  4N1T A;  5FSN A;  2G73 A;  2O1C A;  2PQV A;  3COU A;  3GG6 A;  1R67 A;  3E57 A;  3A6T A;  4DYW A;  2I6K A;  2I8U A;  5IW5 A;  1V8M A;  2O5F A;  3A6V A;  5FSL A;  2JVB A;  1XSC A;  5BON A;  1PPW A;  2A8S A;  3H95 A;  4ZG0 A;  1MQE A;  3L85 A;  3SHD A;  1KT9 A;  1F3Y A;  1PUQ A;  2FKB A;  3BHO A;  5IW4 A;  4V14 A;  2J8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...