5CFJA

Structural and functional attributes of malaria parasite ap4a hydrolase
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
140
Chain Sequence
b'NIIKAFGILLCRLKKYNPNKFEFLFLKASYADKHWTPPKGLHENNESGLETAVRETLEETGINKDKYKLLNYQKTLKYNVKDKPKETTYYLAMLLNNEENVILSDEHTDYKWIGSHESDTYNLPESLADLLKEAEEFLNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIS(5'-nucleosyl)-tetraphosphatase (Diadenosine tetraphospha
publication title Structural and functional attributes of malaria parasite diadenosine tetraphosphate hydrolase
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
molecule tags Hydrolase
total genus 34
structure length 140
sequence length 146
ec nomenclature ec 3.6.1.17: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5cfjA00
3BAPA 4NFWA 3I9XA 2YYHA 2QKMB 5CFJA 4YPHA 2I8UA 2A8QA 3X0KA 2A8PA 4ILQA 5CFIA 2DUKA 3A6SA 5FSLA 5BONA 3O69A 3U53A 3GZ6A 1VK6A 1PPVA 5FSMA 2QJTA 3MDGA 1KHZA 3X0OA 1RYAA 4KG4A 1KTGA 1G9QA 3P5TA 4V14A 3X0RA 3FCMA 1PUQA 1SU2A 1V8NA 3HYQA 2ICKA 3Q2SA 2GB5A 3SONA 1V8SA 5DPKA 2ICJA 1V8UA 1VC8A 4JZTA 5DD4A 3CNGA 4C9WA 2DSBA 5DDGA 4KYXA 3X0QA 3FSPA 5GHNA 3SMDA 2RRKA 5DEQA 1V8RA 1VCDA 2FKBA 1NFSA 1Q54A 2YVNA 2O5WA 4JZSA 3GRNA 3I7UA 2XSQA 3MGMA 5ANUA 5C7TA 1K26A 1V8WA 3O8SA 3R03A 3G0QA 4YPRA 1R67A 2CL3A 1X83A 1IRYA 1JKNA 4HVYA 1G0SA 3J7Ye 1V8LA 1VHGA 2G74A 2O5FA 3O61A 3F13A 3X0LA 2J8QA 3GG6A 1QVJA 4NFXA 2W4EA 2R5WA 4HFQA 5ANSA 1F3YA 4ICKA 1RRQA 3MDIA 5FSNA 4DYWA 3ID9A 2DHOA 3X0MA 1VIUA 3ZR0A 3H95A 3A6TA 3KVHA 1GA7A 2QJOA 3F6AA 2VNPA 2A8TA 1MQEA 1SOIA 5GHPA 1PPWA 3RH7A 2GT4A 3AC9A 3E57A 2G73A 3FJYA 1VRLA 3Q91A 3COUA 2I8TA 2I6KA 3ZR1A 1HZTA 3A6VA 3GZ5A 5LPGA 4YOQA 3GWYA 5C7QA 1PUNA 5IW5A 3Q1PA 3EESA 5ANWA 1V8YA 1MK1A 1Q27A 1KT9A 1HX3A 2Q9PA 3I7VA 5BS6A 3X0JA 1NQYA 5GHQA 4S2WA 1MR2A 3GZ8A 1U20A 1V8TA 4ZG0A 4JZUA 1X51A 2YVOA 3EEUA 1JRKA 1XSAA 5FSOA 4S2YA 3BM4A 3Q93A 3QSJA 3A6UA 3N77A 2JVBA 1XSCA 3WHWA 3ACAA 1K2EA 3BHOA 2B0VA 3Q2TA 3P6YA 5ANTA 2FMLA 5ISYA 1XSBA 1TUMA 2A6TA 3O52A 5HZXA 4S2XA 4C9XA 2A8RA 1NFZA 4JZVA 3FK9A 1V8IA 1OW2A 5FSIA 5ANVA 3EXQA 1MP2A 3HHJA 1PUSA 2FVVA 3L85A 4KG3A 3X0IA 4MPOA 5I8UA 3X0SA 1VHZA 2GT2A 3N9UA 2YVPA 2VNQA 3O6ZA 1VIQA 2PQVA 3OGAA 4S2VA 3SHDA 4N1UA 5C8LA 3EF5A 1I9AA 2AZWA 2PNYA 3MCFA 2A8SA 3DKUA 5GHOA 3Q4IA 5GHMA 4KTBA 1RRSA 3DUPA 2O1CA 3X0NA 1MUTA 3X0PA 4N1TA 1PPXA 1VC9A 4IJXA 1V8MA 1X84A 2B2KA 2YVMA 2KDVA 2KDWA 3FFUA 5FSKA 5IW4A 1V8VA 1SJYA 2DSDA 4K6EA 5GHJA 1SZ3A 5GHIA 1Q33A 2DSCA 1PVFA 1MQWA 2B06A 1NQZA
chains in the Genus database with same CATH superfamily
3BAPA 4NFWA 3I9XA 2YYHA 2QKMB 5CFJA 4YPHA 2I8UA 2A8QA 3X0KA 2A8PA 4ILQA 5CFIA 2DUKA 3A6SA 5FSLA 5BONA 3O69A 3U53A 3GZ6A 1VK6A 1PPVA 5FSMA 2QJTA 3MDGA 1KHZA 3X0OA 1RYAA 4KG4A 1KTGA 1G9QA 3P5TA 4V14A 3X0RA 3FCMA 1PUQA 1SU2A 1V8NA 3HYQA 2ICKA 3Q2SA 2GB5A 3SONA 1V8SA 5DPKA 2ICJA 1V8UA 1VC8A 4JZTA 5DD4A 3CNGA 4C9WA 2DSBA 5DDGA 4KYXA 3X0QA 3FSPA 5GHNA 3SMDA 2RRKA 5DEQA 1V8RA 1VCDA 2FKBA 1NFSA 1Q54A 2YVNA 2O5WA 4JZSA 3GRNA 3I7UA 2XSQA 3MGMA 5ANUA 5C7TA 1K26A 1V8WA 3O8SA 3R03A 3G0QA 4YPRA 1R67A 2CL3A 1X83A 1IRYA 1JKNA 4HVYA 1G0SA 2CZRA 1V8LA 1VHGA 2G74A 2O5FA 3J7Ye 3O61A 3F13A 3X0LA 2J8QA 3GG6A 1QVJA 4NFXA 2W4EA 2R5WA 4HFQA 5ANSA 1F3YA 4ICKA 1RRQA 3MDIA 5FSNA 4DYWA 3ID9A 2DHOA 3X0MA 1VIUA 3ZR0A 3H95A 3A6TA 3KVHA 1GA7A 2QJOA 3F6AA 2VNPA 2A8TA 1MQEA 1SOIA 5GHPA 1PPWA 3RH7A 2GT4A 3AC9A 3E57A 2G73A 3FJYA 1VRLA 3Q91A 3COUA 2I8TA 2I6KA 3ZR1A 1HZTA 3A6VA 3GZ5A 5LPGA 4YOQA 3GWYA 5C7QA 1PUNA 5IW5A 3Q1PA 3EESA 5ANWA 1V8YA 1MK1A 1Q27A 1KT9A 1HX3A 2Q9PA 3I7VA 5BS6A 3X0JA 1NQYA 5GHQA 4S2WA 4J7HA 1MR2A 3GZ8A 1U20A 1V8TA 4ZG0A 4JZUA 1X51A 2YVOA 3EEUA 4J7GA 1JRKA 1XSAA 5FSOA 4S2YA 3BM4A 3Q93A 3QSJA 3A6UA 3N77A 2JVBA 1XSCA 3WHWA 3ACAA 1K2EA 3BHOA 2B0VA 3Q2TA 3P6YA 5ANTA 2FMLA 5ISYA 1XSBA 1TUMA 2A6TA 3O52A 5HZXA 4S2XA 4C9XA 2A8RA 1NFZA 4JZVA 3FK9A 1V8IA 1OW2A 5FSIA 5ANVA 3EXQA 1MP2A 3HHJA 1PUSA 2FVVA 3L85A 4KG3A 3X0IA 4MPOA 5I8UA 3X0SA 1VHZA 2GT2A 3N9UA 2YVPA 2VNQA 3O6ZA 1VIQA 2PQVA 3OGAA 4S2VA 3SHDA 4N1UA 5C8LA 3EF5A 1I9AA 2AZWA 2PNYA 3MCFA 2A8SA 3DKUA 5GHOA 3Q4IA 5GHMA 4KTBA 1RRSA 3DUPA 2O1CA 3X0NA 1MUTA 3X0PA 4N1TA 1PPXA 1VC9A 4IJXA 1V8MA 1X84A 2B2KA 2YVMA 2KDVA 2KDWA 3FFUA 5FSKA 5IW4A 1V8VA 1SJYA 2DSDA 4K6EA 5GHJA 1SZ3A 5GHIA 1Q33A 2DSCA 1PVFA 1MQWA 2B06A 1NQZA
chains in the Genus database with same CATH topology
3BAPA 4NFWA 3I9XA 2YYHA 2QKMB 5CFJA 4YPHA 2I8UA 2A8QA 3X0KA 2A8PA 4ILQA 5CFIA 2DUKA 3A6SA 5FSLA 5BONA 3O69A 3U53A 3GZ6A 1VK6A 1PPVA 5FSMA 2QJTA 3MDGA 1KHZA 3X0OA 1RYAA 4KG4A 1KTGA 1G9QA 3P5TA 4V14A 3X0RA 3FCMA 1PUQA 1SU2A 1V8NA 3HYQA 2ICKA 3Q2SA 2GB5A 3SONA 1V8SA 5DPKA 2ICJA 1V8UA 1VC8A 4JZTA 5DD4A 3CNGA 4C9WA 2DSBA 5DDGA 4KYXA 3X0QA 3FSPA 5GHNA 3SMDA 2RRKA 5DEQA 1V8RA 1VCDA 2FKBA 1NFSA 1Q54A 2YVNA 2O5WA 4JZSA 3GRNA 3I7UA 2XSQA 3MGMA 5ANUA 5C7TA 1K26A 1V8WA 3O8SA 3R03A 3G0QA 4YPRA 1R67A 2CL3A 1X83A 1IRYA 1JKNA 4HVYA 1G0SA 2CZRA 1V8LA 1VHGA 2G74A 2O5FA 3J7Ye 3O61A 3F13A 3X0LA 2J8QA 3GG6A 1QVJA 4NFXA 2W4EA 2R5WA 4HFQA 5ANSA 1F3YA 4ICKA 1RRQA 3MDIA 5FSNA 4DYWA 3ID9A 2DHOA 3X0MA 1VIUA 3ZR0A 3H95A 3A6TA 3KVHA 1GA7A 2QJOA 3F6AA 2VNPA 2A8TA 1MQEA 1SOIA 5GHPA 1PPWA 3RH7A 2GT4A 3AC9A 3E57A 2G73A 3FJYA 1VRLA 3Q91A 3COUA 2I8TA 2I6KA 3ZR1A 1HZTA 3A6VA 3GZ5A 5LPGA 4YOQA 3GWYA 5C7QA 1PUNA 5IW5A 3Q1PA 3EESA 5ANWA 1V8YA 1MK1A 1Q27A 1KT9A 1HX3A 2Q9PA 3I7VA 5BS6A 3X0JA 1NQYA 5GHQA 4S2WA 4J7HA 1MR2A 3GZ8A 1U20A 1V8TA 4ZG0A 4JZUA 1X51A 2YVOA 3EEUA 4J7GA 1JRKA 1XSAA 5FSOA 4S2YA 3BM4A 3Q93A 3QSJA 3A6UA 3N77A 2JVBA 1XSCA 3WHWA 3ACAA 1K2EA 3BHOA 2B0VA 3Q2TA 3P6YA 5ANTA 2FMLA 5ISYA 1XSBA 1TUMA 2A6TA 3O52A 5HZXA 4S2XA 4C9XA 2A8RA 1NFZA 4JZVA 3FK9A 1V8IA 1OW2A 5FSIA 5ANVA 3EXQA 1MP2A 3HHJA 1PUSA 2FVVA 3L85A 4KG3A 3X0IA 4MPOA 5I8UA 3X0SA 1VHZA 2GT2A 3N9UA 2YVPA 2VNQA 3O6ZA 1VIQA 2PQVA 3OGAA 4S2VA 3SHDA 4N1UA 5C8LA 3EF5A 1I9AA 2AZWA 2PNYA 3MCFA 2A8SA 3DKUA 5GHOA 3Q4IA 5GHMA 4KTBA 1RRSA 3DUPA 2O1CA 3X0NA 1MUTA 3X0PA 4N1TA 1PPXA 1VC9A 4IJXA 1V8MA 1X84A 2B2KA 2YVMA 2KDVA 2KDWA 3FFUA 5FSKA 5IW4A 1V8VA 1SJYA 2DSDA 4K6EA 5GHJA 1SZ3A 5GHIA 1Q33A 2DSCA 1PVFA 1MQWA 2B06A 1NQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BAP A;  4NFW A;  3I9X A;  2YYH A;  2QKM B;  5CFJ A;  4YPH A;  2I8U A;  2A8Q A;  3X0K A;  2A8P A;  4ILQ A;  5CFI A;  2DUK A;  3A6S A;  5FSL A;  5BON A;  3O69 A;  3U53 A;  3GZ6 A;  1VK6 A;  1PPV A;  5FSM A;  2QJT A;  3MDG A;  1KHZ A;  3X0O A;  1RYA A;  4KG4 A;  1KTG A;  1G9Q A;  3P5T A;  4V14 A;  3X0R A;  3FCM A;  1PUQ A;  1SU2 A;  1V8N A;  3HYQ A;  2ICK A;  3Q2S A;  2GB5 A;  3SON A;  1V8S A;  5DPK A;  2ICJ A;  1V8U A;  1VC8 A;  4JZT A;  5DD4 A;  3CNG A;  4C9W A;  2DSB A;  5DDG A;  4KYX A;  3X0Q A;  3FSP A;  5GHN A;  3SMD A;  2RRK A;  5DEQ A;  1V8R A;  1VCD A;  2FKB A;  1NFS A;  1Q54 A;  2YVN A;  2O5W A;  4JZS A;  3GRN A;  3I7U A;  2XSQ A;  3MGM A;  5ANU A;  5C7T A;  1K26 A;  1V8W A;  3O8S A;  3R03 A;  3G0Q A;  4YPR A;  1R67 A;  2CL3 A;  1X83 A;  1IRY A;  1JKN A;  4HVY A;  1G0S A;  3J7Y e;  1V8L A;  1VHG A;  2G74 A;  2O5F A;  3O61 A;  3F13 A;  3X0L A;  2J8Q A;  3GG6 A;  1QVJ A;  4NFX A;  2W4E A;  2R5W A;  4HFQ A;  5ANS A;  1F3Y A;  4ICK A;  1RRQ A;  3MDI A;  5FSN A;  4DYW A;  3ID9 A;  2DHO A;  3X0M A;  1VIU A;  3ZR0 A;  3H95 A;  3A6T A;  3KVH A;  1GA7 A;  2QJO A;  3F6A A;  2VNP A;  2A8T A;  1MQE A;  1SOI A;  5GHP A;  1PPW A;  3RH7 A;  2GT4 A;  3AC9 A;  3E57 A;  2G73 A;  3FJY A;  1VRL A;  3Q91 A;  3COU A;  2I8T A;  2I6K A;  3ZR1 A;  1HZT A;  3A6V A;  3GZ5 A;  5LPG A;  4YOQ A;  3GWY A;  5C7Q A;  1PUN A;  5IW5 A;  3Q1P A;  3EES A;  5ANW A;  1V8Y A;  1MK1 A;  1Q27 A;  1KT9 A;  1HX3 A;  2Q9P A;  3I7V A;  5BS6 A;  3X0J A;  1NQY A;  5GHQ A;  4S2W A;  1MR2 A;  3GZ8 A;  1U20 A;  1V8T A;  4ZG0 A;  4JZU A;  1X51 A;  2YVO A;  3EEU A;  1JRK A;  1XSA A;  5FSO A;  4S2Y A;  3BM4 A;  3Q93 A;  3QSJ A;  3A6U A;  3N77 A;  2JVB A;  1XSC A;  3WHW A;  3ACA A;  1K2E A;  3BHO A;  2B0V A;  3Q2T A;  3P6Y A;  5ANT A;  2FML A;  5ISY A;  1XSB A;  1TUM A;  2A6T A;  3O52 A;  5HZX A;  4S2X A;  4C9X A;  2A8R A;  1NFZ A;  4JZV A;  3FK9 A;  1V8I A;  1OW2 A;  5FSI A;  5ANV A;  3EXQ A;  1MP2 A;  3HHJ A;  1PUS A;  2FVV A;  3L85 A;  4KG3 A;  3X0I A;  4MPO A;  5I8U A;  3X0S A;  1VHZ A;  2GT2 A;  3N9U A;  2YVP A;  2VNQ A;  3O6Z A;  1VIQ A;  2PQV A;  3OGA A;  4S2V A;  3SHD A;  4N1U A;  5C8L A;  3EF5 A;  1I9A A;  2AZW A;  2PNY A;  3MCF A;  2A8S A;  3DKU A;  5GHO A;  3Q4I A;  5GHM A;  4KTB A;  1RRS A;  3DUP A;  2O1C A;  3X0N A;  1MUT A;  3X0P A;  4N1T A;  1PPX A;  1VC9 A;  4IJX A;  1V8M A;  1X84 A;  2B2K A;  2YVM A;  2KDV A;  2KDW A;  3FFU A;  5FSK A;  5IW4 A;  1V8V A;  1SJY A;  2DSD A;  4K6E A;  5GHJ A;  1SZ3 A;  5GHI A;  1Q33 A;  2DSC A;  1PVF A;  1MQW A;  2B06 A;  1NQZ A; 
#chains in the Genus database with same CATH topology
 3BAP A;  4NFW A;  3I9X A;  2YYH A;  2QKM B;  5CFJ A;  4YPH A;  2I8U A;  2A8Q A;  3X0K A;  2A8P A;  4ILQ A;  5CFI A;  2DUK A;  3A6S A;  5FSL A;  5BON A;  3O69 A;  3U53 A;  3GZ6 A;  1VK6 A;  1PPV A;  5FSM A;  2QJT A;  3MDG A;  1KHZ A;  3X0O A;  1RYA A;  4KG4 A;  1KTG A;  1G9Q A;  3P5T A;  4V14 A;  3X0R A;  3FCM A;  1PUQ A;  1SU2 A;  1V8N A;  3HYQ A;  2ICK A;  3Q2S A;  2GB5 A;  3SON A;  1V8S A;  5DPK A;  2ICJ A;  1V8U A;  1VC8 A;  4JZT A;  5DD4 A;  3CNG A;  4C9W A;  2DSB A;  5DDG A;  4KYX A;  3X0Q A;  3FSP A;  5GHN A;  3SMD A;  2RRK A;  5DEQ A;  1V8R A;  1VCD A;  2FKB A;  1NFS A;  1Q54 A;  2YVN A;  2O5W A;  4JZS A;  3GRN A;  3I7U A;  2XSQ A;  3MGM A;  5ANU A;  5C7T A;  1K26 A;  1V8W A;  3O8S A;  3R03 A;  3G0Q A;  4YPR A;  1R67 A;  2CL3 A;  1X83 A;  1IRY A;  1JKN A;  4HVY A;  1G0S A;  2CZR A;  1V8L A;  1VHG A;  2G74 A;  2O5F A;  3J7Y e;  3O61 A;  3F13 A;  3X0L A;  2J8Q A;  3GG6 A;  1QVJ A;  4NFX A;  2W4E A;  2R5W A;  4HFQ A;  5ANS A;  1F3Y A;  4ICK A;  1RRQ A;  3MDI A;  5FSN A;  4DYW A;  3ID9 A;  2DHO A;  3X0M A;  1VIU A;  3ZR0 A;  3H95 A;  3A6T A;  3KVH A;  1GA7 A;  2QJO A;  3F6A A;  2VNP A;  2A8T A;  1MQE A;  1SOI A;  5GHP A;  1PPW A;  3RH7 A;  2GT4 A;  3AC9 A;  3E57 A;  2G73 A;  3FJY A;  1VRL A;  3Q91 A;  3COU A;  2I8T A;  2I6K A;  3ZR1 A;  1HZT A;  3A6V A;  3GZ5 A;  5LPG A;  4YOQ A;  3GWY A;  5C7Q A;  1PUN A;  5IW5 A;  3Q1P A;  3EES A;  5ANW A;  1V8Y A;  1MK1 A;  1Q27 A;  1KT9 A;  1HX3 A;  2Q9P A;  3I7V A;  5BS6 A;  3X0J A;  1NQY A;  5GHQ A;  4S2W A;  4J7H A;  1MR2 A;  3GZ8 A;  1U20 A;  1V8T A;  4ZG0 A;  4JZU A;  1X51 A;  2YVO A;  3EEU A;  4J7G A;  1JRK A;  1XSA A;  5FSO A;  4S2Y A;  3BM4 A;  3Q93 A;  3QSJ A;  3A6U A;  3N77 A;  2JVB A;  1XSC A;  3WHW A;  3ACA A;  1K2E A;  3BHO A;  2B0V A;  3Q2T A;  3P6Y A;  5ANT A;  2FML A;  5ISY A;  1XSB A;  1TUM A;  2A6T A;  3O52 A;  5HZX A;  4S2X A;  4C9X A;  2A8R A;  1NFZ A;  4JZV A;  3FK9 A;  1V8I A;  1OW2 A;  5FSI A;  5ANV A;  3EXQ A;  1MP2 A;  3HHJ A;  1PUS A;  2FVV A;  3L85 A;  4KG3 A;  3X0I A;  4MPO A;  5I8U A;  3X0S A;  1VHZ A;  2GT2 A;  3N9U A;  2YVP A;  2VNQ A;  3O6Z A;  1VIQ A;  2PQV A;  3OGA A;  4S2V A;  3SHD A;  4N1U A;  5C8L A;  3EF5 A;  1I9A A;  2AZW A;  2PNY A;  3MCF A;  2A8S A;  3DKU A;  5GHO A;  3Q4I A;  5GHM A;  4KTB A;  1RRS A;  3DUP A;  2O1C A;  3X0N A;  1MUT A;  3X0P A;  4N1T A;  1PPX A;  1VC9 A;  4IJX A;  1V8M A;  1X84 A;  2B2K A;  2YVM A;  2KDV A;  2KDW A;  3FFU A;  5FSK A;  5IW4 A;  1V8V A;  1SJY A;  2DSD A;  4K6E A;  5GHJ A;  1SZ3 A;  5GHI A;  1Q33 A;  2DSC A;  1PVF A;  1MQW A;  2B06 A;  1NQZ A; 
#chains in the Genus database with same CATH homology
 3BAP A;  4NFW A;  3I9X A;  2YYH A;  2QKM B;  5CFJ A;  4YPH A;  2I8U A;  2A8Q A;  3X0K A;  2A8P A;  4ILQ A;  5CFI A;  2DUK A;  3A6S A;  5FSL A;  5BON A;  3O69 A;  3U53 A;  3GZ6 A;  1VK6 A;  1PPV A;  5FSM A;  2QJT A;  3MDG A;  1KHZ A;  3X0O A;  1RYA A;  4KG4 A;  1KTG A;  1G9Q A;  3P5T A;  4V14 A;  3X0R A;  3FCM A;  1PUQ A;  1SU2 A;  1V8N A;  3HYQ A;  2ICK A;  3Q2S A;  2GB5 A;  3SON A;  1V8S A;  5DPK A;  2ICJ A;  1V8U A;  1VC8 A;  4JZT A;  5DD4 A;  3CNG A;  4C9W A;  2DSB A;  5DDG A;  4KYX A;  3X0Q A;  3FSP A;  5GHN A;  3SMD A;  2RRK A;  5DEQ A;  1V8R A;  1VCD A;  2FKB A;  1NFS A;  1Q54 A;  2YVN A;  2O5W A;  4JZS A;  3GRN A;  3I7U A;  2XSQ A;  3MGM A;  5ANU A;  5C7T A;  1K26 A;  1V8W A;  3O8S A;  3R03 A;  3G0Q A;  4YPR A;  1R67 A;  2CL3 A;  1X83 A;  1IRY A;  1JKN A;  4HVY A;  1G0S A;  2CZR A;  1V8L A;  1VHG A;  2G74 A;  2O5F A;  3J7Y e;  3O61 A;  3F13 A;  3X0L A;  2J8Q A;  3GG6 A;  1QVJ A;  4NFX A;  2W4E A;  2R5W A;  4HFQ A;  5ANS A;  1F3Y A;  4ICK A;  1RRQ A;  3MDI A;  5FSN A;  4DYW A;  3ID9 A;  2DHO A;  3X0M A;  1VIU A;  3ZR0 A;  3H95 A;  3A6T A;  3KVH A;  1GA7 A;  2QJO A;  3F6A A;  2VNP A;  2A8T A;  1MQE A;  1SOI A;  5GHP A;  1PPW A;  3RH7 A;  2GT4 A;  3AC9 A;  3E57 A;  2G73 A;  3FJY A;  1VRL A;  3Q91 A;  3COU A;  2I8T A;  2I6K A;  3ZR1 A;  1HZT A;  3A6V A;  3GZ5 A;  5LPG A;  4YOQ A;  3GWY A;  5C7Q A;  1PUN A;  5IW5 A;  3Q1P A;  3EES A;  5ANW A;  1V8Y A;  1MK1 A;  1Q27 A;  1KT9 A;  1HX3 A;  2Q9P A;  3I7V A;  5BS6 A;  3X0J A;  1NQY A;  5GHQ A;  4S2W A;  4J7H A;  1MR2 A;  3GZ8 A;  1U20 A;  1V8T A;  4ZG0 A;  4JZU A;  1X51 A;  2YVO A;  3EEU A;  4J7G A;  1JRK A;  1XSA A;  5FSO A;  4S2Y A;  3BM4 A;  3Q93 A;  3QSJ A;  3A6U A;  3N77 A;  2JVB A;  1XSC A;  3WHW A;  3ACA A;  1K2E A;  3BHO A;  2B0V A;  3Q2T A;  3P6Y A;  5ANT A;  2FML A;  5ISY A;  1XSB A;  1TUM A;  2A6T A;  3O52 A;  5HZX A;  4S2X A;  4C9X A;  2A8R A;  1NFZ A;  4JZV A;  3FK9 A;  1V8I A;  1OW2 A;  5FSI A;  5ANV A;  3EXQ A;  1MP2 A;  3HHJ A;  1PUS A;  2FVV A;  3L85 A;  4KG3 A;  3X0I A;  4MPO A;  5I8U A;  3X0S A;  1VHZ A;  2GT2 A;  3N9U A;  2YVP A;  2VNQ A;  3O6Z A;  1VIQ A;  2PQV A;  3OGA A;  4S2V A;  3SHD A;  4N1U A;  5C8L A;  3EF5 A;  1I9A A;  2AZW A;  2PNY A;  3MCF A;  2A8S A;  3DKU A;  5GHO A;  3Q4I A;  5GHM A;  4KTB A;  1RRS A;  3DUP A;  2O1C A;  3X0N A;  1MUT A;  3X0P A;  4N1T A;  1PPX A;  1VC9 A;  4IJX A;  1V8M A;  1X84 A;  2B2K A;  2YVM A;  2KDV A;  2KDW A;  3FFU A;  5FSK A;  5IW4 A;  1V8V A;  1SJY A;  2DSD A;  4K6E A;  5GHJ A;  1SZ3 A;  5GHI A;  1Q33 A;  2DSC A;  1PVF A;  1MQW A;  2B06 A;  1NQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...