5CFJA

Structural and functional attributes of malaria parasite ap4a hydrolase
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
140
Chain Sequence
NIIKAFGILLCRLKKYNPNKFEFLFLKASYADKHWTPPKGLHENNESGLETAVRETLEETGINKDKYKLLNYQKTLKYNVKDKPKETTYYLAMLLNNEENVILSDEHTDYKWIGSHESDTYNLPESLADLLKEAEEFLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIS(5'-nucleosyl)-tetraphosphatase (Diadenosine tetraphospha
publication title Structural and functional attributes of malaria parasite diadenosine tetraphosphate hydrolase
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
molecule tags Hydrolase
total genus 34
structure length 140
sequence length 146
ec nomenclature ec 3.6.1.17: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5cfjA00
1VK6A 3FK9A 4S2WA 5DD4A 5BS6A 2A6TA 3DKUA 1RYAA 1PPVA 4S2XA 5DDGA 3A6TA 2VNQA 3I7UA 4YPHA 1VRLA 1Q54A 1SJYA 3BAPA 3X0PA 2ICJA 5FSIA 5DPKA 1HX3A 3E57A 2KDVA 2QJTA 5DEQA 1MK1A 4ZG0A 1K2EA 2VNPA 5CFJA 3X0OA 3KVHA 1VIQA 1KTGA 4JZTA 4V14A 3A6VA 5C8LA 5ISYA 3U53A 3GWYA 3ZR1A 1V8MA 2I6KA 1Q27A 1PPWA 5CFIA 3P6YA 1V8VA 4N1UA 2AZWA 5ANVA 2CL3A 2I8UA 1VHGA 3HYQA 5BONA 5GHOA 3AC9A 3ID9A 3O61A 1MQWA 3GG6A 2QJOA 2PNYA 3H95A 1NQZA 1KT9A 4YOQA 5I8UA 3N77A 1TUMA 3X0JA 3F13A 1V8UA 3J7Ye 3R03A 1I9AA 1V8NA 2G74A 2JVBA 1JRKA 1V8LA 1NFSA 1V8TA 3Q1PA 1MP2A 5FSLA 3I9XA 3MDGA 3BHOA 1RRSA 2W4EA 5ANTA 3GZ6A 3X0QA 1VC9A 4ILQA 5ANSA 3ZR0A 1MQEA 4DYWA 1VC8A 1X51A 1XSCA 3X0KA 2G73A 2B0VA 1MUTA 3MCFA 5LPGA 3A6SA 1PUSA 2FMLA 3FJYA 3EXQA 4S2VA 1V8IA 5ANUA 3N9UA 1XSAA 2GB5A 4JZVA 2YVOA 1MR2A 2GT4A 2DSCA 3O69A 2DSDA 3OGAA 5GHJA 1OW2A 3QSJA 5GHQA 3DUPA 4KG3A 1G9QA 4KG4A 3X0MA 5C7QA 1XSBA 1PVFA 2FVVA 2FKBA 1PUQA 3BM4A 5FSMA 3HHJA 5GHIA 3FFUA 3EEUA 4HVYA 1X84A 3O6ZA 4JZUA 1X83A 2DHOA 2R5WA 3GRNA 4ICKA 4JZSA 2B2KA 2O5FA 5ANWA 2KDWA 2PQVA 3EF5A 5FSKA 1V8YA 2I8TA 2O1CA 3RH7A 1V8WA 3FCMA 3L85A 3O8SA 3Q93A 4N1TA 3X0SA 5FSOA 3WHWA 4NFWA 5HZXA 2ICKA 2YVNA 3MGMA 1VHZA 3GZ8A 2DUKA 2A8SA 2YVPA 2GT2A 1SZ3A 5C7TA 1Q33A 1RRQA 4NFXA 3Q4IA 1G0SA 3I7VA 3O52A 5GHPA 1VCDA 1JKNA 3X0IA 2A8PA 1V8RA 5GHMA 1SU2A 1K26A 1VIUA 2XSQA 1PPXA 1F3YA 3FSPA 2DSBA 2J8QA 3P5TA 1KHZA 3Q2TA 2YVMA 1QVJA 5IW5A 3MDIA 1IRYA 3X0NA 3SHDA 3F6AA 4K6EA 1HZTA 4KYXA 3SONA 4S2YA 3Q2SA 1GA7A 2O5WA 3A6UA 3SMDA 3GZ5A 1NQYA 2YYHA 3Q91A 4IJXA 3CNGA 2A8QA 1V8SA 3G0QA 5FSNA 5GHNA 4C9WA 3COUA 1R67A 3X0RA 2B06A 3ACAA 4KTBA 3EESA 1SOIA 3X0LA 4C9XA 1NFZA 4YPRA 1PUNA 4HFQA 2Q9PA 2A8RA 2A8TA 2QKMB 5IW4A 4MPOA 2RRKA 1U20A
chains in the Genus database with same CATH superfamily
1VK6A 3FK9A 4S2WA 5DD4A 5BS6A 2A6TA 3DKUA 1RYAA 1PPVA 4S2XA 5DDGA 3A6TA 2VNQA 3I7UA 4YPHA 1VRLA 1Q54A 1SJYA 3BAPA 3X0PA 2ICJA 5FSIA 5DPKA 1HX3A 3E57A 2KDVA 2QJTA 5DEQA 1MK1A 4ZG0A 1K2EA 2VNPA 5CFJA 3X0OA 3KVHA 1VIQA 1KTGA 4JZTA 4V14A 3A6VA 4J7GA 5C8LA 5ISYA 3U53A 3GWYA 3ZR1A 1V8MA 2I6KA 1Q27A 1PPWA 5CFIA 3P6YA 1V8VA 4N1UA 2AZWA 5ANVA 2CL3A 2I8UA 1VHGA 3HYQA 5BONA 5GHOA 3AC9A 3ID9A 3O61A 1MQWA 3GG6A 2QJOA 2PNYA 3H95A 1NQZA 1KT9A 4YOQA 5I8UA 3N77A 1TUMA 3X0JA 3F13A 1V8UA 3J7Ye 3R03A 1I9AA 1V8NA 2G74A 2JVBA 1JRKA 1V8LA 1NFSA 1V8TA 3Q1PA 1MP2A 5FSLA 3I9XA 3MDGA 3BHOA 1RRSA 2W4EA 5ANTA 3GZ6A 3X0QA 1VC9A 4ILQA 5ANSA 3ZR0A 1MQEA 4DYWA 1VC8A 1X51A 1XSCA 3X0KA 2G73A 2B0VA 1MUTA 3MCFA 5LPGA 3A6SA 1PUSA 2FMLA 3FJYA 3EXQA 4S2VA 1V8IA 5ANUA 3N9UA 1XSAA 2GB5A 4JZVA 2YVOA 1MR2A 2GT4A 2DSCA 3O69A 2DSDA 3OGAA 5GHJA 1OW2A 3QSJA 5GHQA 3DUPA 4KG3A 1G9QA 4KG4A 3X0MA 5C7QA 1XSBA 1PVFA 2FVVA 2FKBA 1PUQA 3BM4A 5FSMA 3HHJA 5GHIA 3FFUA 3EEUA 4HVYA 1X84A 3O6ZA 4JZUA 1X83A 2DHOA 2R5WA 3GRNA 4ICKA 4JZSA 2B2KA 2O5FA 5ANWA 2KDWA 2CZRA 2PQVA 3EF5A 5FSKA 1V8YA 2I8TA 2O1CA 3RH7A 1V8WA 3FCMA 3L85A 3O8SA 3Q93A 4N1TA 3X0SA 5FSOA 3WHWA 4NFWA 5HZXA 2ICKA 2YVNA 3MGMA 1VHZA 3GZ8A 2DUKA 2A8SA 2YVPA 2GT2A 1SZ3A 5C7TA 1Q33A 1RRQA 4NFXA 3Q4IA 1G0SA 3I7VA 3O52A 5GHPA 1VCDA 1JKNA 3X0IA 2A8PA 1V8RA 5GHMA 1SU2A 1K26A 1VIUA 2XSQA 1PPXA 1F3YA 4J7HA 3FSPA 2DSBA 2J8QA 3P5TA 1KHZA 3Q2TA 2YVMA 1QVJA 5IW5A 3MDIA 1IRYA 3X0NA 3SHDA 3F6AA 4K6EA 1HZTA 4KYXA 3SONA 4S2YA 3Q2SA 1GA7A 2O5WA 3A6UA 3SMDA 3GZ5A 1NQYA 2YYHA 3Q91A 4IJXA 3CNGA 2A8QA 1V8SA 3G0QA 5FSNA 5GHNA 4C9WA 3COUA 1R67A 3X0RA 2B06A 3ACAA 4KTBA 3EESA 1SOIA 3X0LA 4C9XA 1NFZA 4YPRA 1PUNA 4HFQA 2Q9PA 2A8RA 2A8TA 2QKMB 5IW4A 4MPOA 2RRKA 1U20A
chains in the Genus database with same CATH topology
1VK6A 3FK9A 4S2WA 5DD4A 5BS6A 2A6TA 3DKUA 1RYAA 1PPVA 4S2XA 5DDGA 3A6TA 2VNQA 3I7UA 4YPHA 1VRLA 1Q54A 1SJYA 3BAPA 3X0PA 2ICJA 5FSIA 5DPKA 1HX3A 3E57A 2KDVA 2QJTA 5DEQA 1MK1A 4ZG0A 1K2EA 2VNPA 5CFJA 3X0OA 3KVHA 1VIQA 1KTGA 4JZTA 4V14A 3A6VA 4J7GA 5C8LA 5ISYA 3U53A 3GWYA 3ZR1A 1V8MA 2I6KA 1Q27A 1PPWA 5CFIA 3P6YA 1V8VA 4N1UA 2AZWA 5ANVA 2CL3A 2I8UA 1VHGA 3HYQA 5BONA 5GHOA 3AC9A 3ID9A 3O61A 1MQWA 3GG6A 2QJOA 2PNYA 3H95A 1NQZA 1KT9A 4YOQA 5I8UA 3N77A 1TUMA 3X0JA 3F13A 1V8UA 3J7Ye 3R03A 1I9AA 1V8NA 2G74A 2JVBA 1JRKA 1V8LA 1NFSA 1V8TA 3Q1PA 1MP2A 5FSLA 3I9XA 3MDGA 3BHOA 1RRSA 2W4EA 5ANTA 3GZ6A 3X0QA 1VC9A 4ILQA 5ANSA 3ZR0A 1MQEA 4DYWA 1VC8A 1X51A 1XSCA 3X0KA 2G73A 2B0VA 1MUTA 3MCFA 5LPGA 3A6SA 1PUSA 2FMLA 3FJYA 3EXQA 4S2VA 1V8IA 5ANUA 3N9UA 1XSAA 2GB5A 4JZVA 2YVOA 1MR2A 2GT4A 2DSCA 3O69A 2DSDA 3OGAA 5GHJA 1OW2A 3QSJA 5GHQA 3DUPA 4KG3A 1G9QA 4KG4A 3X0MA 5C7QA 1XSBA 1PVFA 2FVVA 2FKBA 1PUQA 3BM4A 5FSMA 3HHJA 5GHIA 3FFUA 3EEUA 4HVYA 1X84A 3O6ZA 4JZUA 1X83A 2DHOA 2R5WA 3GRNA 4ICKA 4JZSA 2B2KA 2O5FA 5ANWA 2KDWA 2CZRA 2PQVA 3EF5A 5FSKA 1V8YA 2I8TA 2O1CA 3RH7A 1V8WA 3FCMA 3L85A 3O8SA 3Q93A 4N1TA 3X0SA 5FSOA 3WHWA 4NFWA 5HZXA 2ICKA 2YVNA 3MGMA 1VHZA 3GZ8A 2DUKA 2A8SA 2YVPA 2GT2A 1SZ3A 5C7TA 1Q33A 1RRQA 4NFXA 3Q4IA 1G0SA 3I7VA 3O52A 5GHPA 1VCDA 1JKNA 3X0IA 2A8PA 1V8RA 5GHMA 1SU2A 1K26A 1VIUA 2XSQA 1PPXA 1F3YA 4J7HA 3FSPA 2DSBA 2J8QA 3P5TA 1KHZA 3Q2TA 2YVMA 1QVJA 5IW5A 3MDIA 1IRYA 3X0NA 3SHDA 3F6AA 4K6EA 1HZTA 4KYXA 3SONA 4S2YA 3Q2SA 1GA7A 2O5WA 3A6UA 3SMDA 3GZ5A 1NQYA 2YYHA 3Q91A 4IJXA 3CNGA 2A8QA 1V8SA 3G0QA 5FSNA 5GHNA 4C9WA 3COUA 1R67A 3X0RA 2B06A 3ACAA 4KTBA 3EESA 1SOIA 3X0LA 4C9XA 1NFZA 4YPRA 1PUNA 4HFQA 2Q9PA 2A8RA 2A8TA 2QKMB 5IW4A 4MPOA 2RRKA 1U20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VK6 A;  3FK9 A;  4S2W A;  5DD4 A;  5BS6 A;  2A6T A;  3DKU A;  1RYA A;  1PPV A;  4S2X A;  5DDG A;  3A6T A;  2VNQ A;  3I7U A;  4YPH A;  1VRL A;  1Q54 A;  1SJY A;  3BAP A;  3X0P A;  2ICJ A;  5FSI A;  5DPK A;  1HX3 A;  3E57 A;  2KDV A;  2QJT A;  5DEQ A;  1MK1 A;  4ZG0 A;  1K2E A;  2VNP A;  5CFJ A;  3X0O A;  3KVH A;  1VIQ A;  1KTG A;  4JZT A;  4V14 A;  3A6V A;  5C8L A;  5ISY A;  3U53 A;  3GWY A;  3ZR1 A;  1V8M A;  2I6K A;  1Q27 A;  1PPW A;  5CFI A;  3P6Y A;  1V8V A;  4N1U A;  2AZW A;  5ANV A;  2CL3 A;  2I8U A;  1VHG A;  3HYQ A;  5BON A;  5GHO A;  3AC9 A;  3ID9 A;  3O61 A;  1MQW A;  3GG6 A;  2QJO A;  2PNY A;  3H95 A;  1NQZ A;  1KT9 A;  4YOQ A;  5I8U A;  3N77 A;  1TUM A;  3X0J A;  3F13 A;  1V8U A;  3J7Y e;  3R03 A;  1I9A A;  1V8N A;  2G74 A;  2JVB A;  1JRK A;  1V8L A;  1NFS A;  1V8T A;  3Q1P A;  1MP2 A;  5FSL A;  3I9X A;  3MDG A;  3BHO A;  1RRS A;  2W4E A;  5ANT A;  3GZ6 A;  3X0Q A;  1VC9 A;  4ILQ A;  5ANS A;  3ZR0 A;  1MQE A;  4DYW A;  1VC8 A;  1X51 A;  1XSC A;  3X0K A;  2G73 A;  2B0V A;  1MUT A;  3MCF A;  5LPG A;  3A6S A;  1PUS A;  2FML A;  3FJY A;  3EXQ A;  4S2V A;  1V8I A;  5ANU A;  3N9U A;  1XSA A;  2GB5 A;  4JZV A;  2YVO A;  1MR2 A;  2GT4 A;  2DSC A;  3O69 A;  2DSD A;  3OGA A;  5GHJ A;  1OW2 A;  3QSJ A;  5GHQ A;  3DUP A;  4KG3 A;  1G9Q A;  4KG4 A;  3X0M A;  5C7Q A;  1XSB A;  1PVF A;  2FVV A;  2FKB A;  1PUQ A;  3BM4 A;  5FSM A;  3HHJ A;  5GHI A;  3FFU A;  3EEU A;  4HVY A;  1X84 A;  3O6Z A;  4JZU A;  1X83 A;  2DHO A;  2R5W A;  3GRN A;  4ICK A;  4JZS A;  2B2K A;  2O5F A;  5ANW A;  2KDW A;  2PQV A;  3EF5 A;  5FSK A;  1V8Y A;  2I8T A;  2O1C A;  3RH7 A;  1V8W A;  3FCM A;  3L85 A;  3O8S A;  3Q93 A;  4N1T A;  3X0S A;  5FSO A;  3WHW A;  4NFW A;  5HZX A;  2ICK A;  2YVN A;  3MGM A;  1VHZ A;  3GZ8 A;  2DUK A;  2A8S A;  2YVP A;  2GT2 A;  1SZ3 A;  5C7T A;  1Q33 A;  1RRQ A;  4NFX A;  3Q4I A;  1G0S A;  3I7V A;  3O52 A;  5GHP A;  1VCD A;  1JKN A;  3X0I A;  2A8P A;  1V8R A;  5GHM A;  1SU2 A;  1K26 A;  1VIU A;  2XSQ A;  1PPX A;  1F3Y A;  3FSP A;  2DSB A;  2J8Q A;  3P5T A;  1KHZ A;  3Q2T A;  2YVM A;  1QVJ A;  5IW5 A;  3MDI A;  1IRY A;  3X0N A;  3SHD A;  3F6A A;  4K6E A;  1HZT A;  4KYX A;  3SON A;  4S2Y A;  3Q2S A;  1GA7 A;  2O5W A;  3A6U A;  3SMD A;  3GZ5 A;  1NQY A;  2YYH A;  3Q91 A;  4IJX A;  3CNG A;  2A8Q A;  1V8S A;  3G0Q A;  5FSN A;  5GHN A;  4C9W A;  3COU A;  1R67 A;  3X0R A;  2B06 A;  3ACA A;  4KTB A;  3EES A;  1SOI A;  3X0L A;  4C9X A;  1NFZ A;  4YPR A;  1PUN A;  4HFQ A;  2Q9P A;  2A8R A;  2A8T A;  2QKM B;  5IW4 A;  4MPO A;  2RRK A;  1U20 A; 
#chains in the Genus database with same CATH topology
 1VK6 A;  3FK9 A;  4S2W A;  5DD4 A;  5BS6 A;  2A6T A;  3DKU A;  1RYA A;  1PPV A;  4S2X A;  5DDG A;  3A6T A;  2VNQ A;  3I7U A;  4YPH A;  1VRL A;  1Q54 A;  1SJY A;  3BAP A;  3X0P A;  2ICJ A;  5FSI A;  5DPK A;  1HX3 A;  3E57 A;  2KDV A;  2QJT A;  5DEQ A;  1MK1 A;  4ZG0 A;  1K2E A;  2VNP A;  5CFJ A;  3X0O A;  3KVH A;  1VIQ A;  1KTG A;  4JZT A;  4V14 A;  3A6V A;  4J7G A;  5C8L A;  5ISY A;  3U53 A;  3GWY A;  3ZR1 A;  1V8M A;  2I6K A;  1Q27 A;  1PPW A;  5CFI A;  3P6Y A;  1V8V A;  4N1U A;  2AZW A;  5ANV A;  2CL3 A;  2I8U A;  1VHG A;  3HYQ A;  5BON A;  5GHO A;  3AC9 A;  3ID9 A;  3O61 A;  1MQW A;  3GG6 A;  2QJO A;  2PNY A;  3H95 A;  1NQZ A;  1KT9 A;  4YOQ A;  5I8U A;  3N77 A;  1TUM A;  3X0J A;  3F13 A;  1V8U A;  3J7Y e;  3R03 A;  1I9A A;  1V8N A;  2G74 A;  2JVB A;  1JRK A;  1V8L A;  1NFS A;  1V8T A;  3Q1P A;  1MP2 A;  5FSL A;  3I9X A;  3MDG A;  3BHO A;  1RRS A;  2W4E A;  5ANT A;  3GZ6 A;  3X0Q A;  1VC9 A;  4ILQ A;  5ANS A;  3ZR0 A;  1MQE A;  4DYW A;  1VC8 A;  1X51 A;  1XSC A;  3X0K A;  2G73 A;  2B0V A;  1MUT A;  3MCF A;  5LPG A;  3A6S A;  1PUS A;  2FML A;  3FJY A;  3EXQ A;  4S2V A;  1V8I A;  5ANU A;  3N9U A;  1XSA A;  2GB5 A;  4JZV A;  2YVO A;  1MR2 A;  2GT4 A;  2DSC A;  3O69 A;  2DSD A;  3OGA A;  5GHJ A;  1OW2 A;  3QSJ A;  5GHQ A;  3DUP A;  4KG3 A;  1G9Q A;  4KG4 A;  3X0M A;  5C7Q A;  1XSB A;  1PVF A;  2FVV A;  2FKB A;  1PUQ A;  3BM4 A;  5FSM A;  3HHJ A;  5GHI A;  3FFU A;  3EEU A;  4HVY A;  1X84 A;  3O6Z A;  4JZU A;  1X83 A;  2DHO A;  2R5W A;  3GRN A;  4ICK A;  4JZS A;  2B2K A;  2O5F A;  5ANW A;  2KDW A;  2CZR A;  2PQV A;  3EF5 A;  5FSK A;  1V8Y A;  2I8T A;  2O1C A;  3RH7 A;  1V8W A;  3FCM A;  3L85 A;  3O8S A;  3Q93 A;  4N1T A;  3X0S A;  5FSO A;  3WHW A;  4NFW A;  5HZX A;  2ICK A;  2YVN A;  3MGM A;  1VHZ A;  3GZ8 A;  2DUK A;  2A8S A;  2YVP A;  2GT2 A;  1SZ3 A;  5C7T A;  1Q33 A;  1RRQ A;  4NFX A;  3Q4I A;  1G0S A;  3I7V A;  3O52 A;  5GHP A;  1VCD A;  1JKN A;  3X0I A;  2A8P A;  1V8R A;  5GHM A;  1SU2 A;  1K26 A;  1VIU A;  2XSQ A;  1PPX A;  1F3Y A;  4J7H A;  3FSP A;  2DSB A;  2J8Q A;  3P5T A;  1KHZ A;  3Q2T A;  2YVM A;  1QVJ A;  5IW5 A;  3MDI A;  1IRY A;  3X0N A;  3SHD A;  3F6A A;  4K6E A;  1HZT A;  4KYX A;  3SON A;  4S2Y A;  3Q2S A;  1GA7 A;  2O5W A;  3A6U A;  3SMD A;  3GZ5 A;  1NQY A;  2YYH A;  3Q91 A;  4IJX A;  3CNG A;  2A8Q A;  1V8S A;  3G0Q A;  5FSN A;  5GHN A;  4C9W A;  3COU A;  1R67 A;  3X0R A;  2B06 A;  3ACA A;  4KTB A;  3EES A;  1SOI A;  3X0L A;  4C9X A;  1NFZ A;  4YPR A;  1PUN A;  4HFQ A;  2Q9P A;  2A8R A;  2A8T A;  2QKM B;  5IW4 A;  4MPO A;  2RRK A;  1U20 A; 
#chains in the Genus database with same CATH homology
 1VK6 A;  3FK9 A;  4S2W A;  5DD4 A;  5BS6 A;  2A6T A;  3DKU A;  1RYA A;  1PPV A;  4S2X A;  5DDG A;  3A6T A;  2VNQ A;  3I7U A;  4YPH A;  1VRL A;  1Q54 A;  1SJY A;  3BAP A;  3X0P A;  2ICJ A;  5FSI A;  5DPK A;  1HX3 A;  3E57 A;  2KDV A;  2QJT A;  5DEQ A;  1MK1 A;  4ZG0 A;  1K2E A;  2VNP A;  5CFJ A;  3X0O A;  3KVH A;  1VIQ A;  1KTG A;  4JZT A;  4V14 A;  3A6V A;  4J7G A;  5C8L A;  5ISY A;  3U53 A;  3GWY A;  3ZR1 A;  1V8M A;  2I6K A;  1Q27 A;  1PPW A;  5CFI A;  3P6Y A;  1V8V A;  4N1U A;  2AZW A;  5ANV A;  2CL3 A;  2I8U A;  1VHG A;  3HYQ A;  5BON A;  5GHO A;  3AC9 A;  3ID9 A;  3O61 A;  1MQW A;  3GG6 A;  2QJO A;  2PNY A;  3H95 A;  1NQZ A;  1KT9 A;  4YOQ A;  5I8U A;  3N77 A;  1TUM A;  3X0J A;  3F13 A;  1V8U A;  3J7Y e;  3R03 A;  1I9A A;  1V8N A;  2G74 A;  2JVB A;  1JRK A;  1V8L A;  1NFS A;  1V8T A;  3Q1P A;  1MP2 A;  5FSL A;  3I9X A;  3MDG A;  3BHO A;  1RRS A;  2W4E A;  5ANT A;  3GZ6 A;  3X0Q A;  1VC9 A;  4ILQ A;  5ANS A;  3ZR0 A;  1MQE A;  4DYW A;  1VC8 A;  1X51 A;  1XSC A;  3X0K A;  2G73 A;  2B0V A;  1MUT A;  3MCF A;  5LPG A;  3A6S A;  1PUS A;  2FML A;  3FJY A;  3EXQ A;  4S2V A;  1V8I A;  5ANU A;  3N9U A;  1XSA A;  2GB5 A;  4JZV A;  2YVO A;  1MR2 A;  2GT4 A;  2DSC A;  3O69 A;  2DSD A;  3OGA A;  5GHJ A;  1OW2 A;  3QSJ A;  5GHQ A;  3DUP A;  4KG3 A;  1G9Q A;  4KG4 A;  3X0M A;  5C7Q A;  1XSB A;  1PVF A;  2FVV A;  2FKB A;  1PUQ A;  3BM4 A;  5FSM A;  3HHJ A;  5GHI A;  3FFU A;  3EEU A;  4HVY A;  1X84 A;  3O6Z A;  4JZU A;  1X83 A;  2DHO A;  2R5W A;  3GRN A;  4ICK A;  4JZS A;  2B2K A;  2O5F A;  5ANW A;  2KDW A;  2CZR A;  2PQV A;  3EF5 A;  5FSK A;  1V8Y A;  2I8T A;  2O1C A;  3RH7 A;  1V8W A;  3FCM A;  3L85 A;  3O8S A;  3Q93 A;  4N1T A;  3X0S A;  5FSO A;  3WHW A;  4NFW A;  5HZX A;  2ICK A;  2YVN A;  3MGM A;  1VHZ A;  3GZ8 A;  2DUK A;  2A8S A;  2YVP A;  2GT2 A;  1SZ3 A;  5C7T A;  1Q33 A;  1RRQ A;  4NFX A;  3Q4I A;  1G0S A;  3I7V A;  3O52 A;  5GHP A;  1VCD A;  1JKN A;  3X0I A;  2A8P A;  1V8R A;  5GHM A;  1SU2 A;  1K26 A;  1VIU A;  2XSQ A;  1PPX A;  1F3Y A;  4J7H A;  3FSP A;  2DSB A;  2J8Q A;  3P5T A;  1KHZ A;  3Q2T A;  2YVM A;  1QVJ A;  5IW5 A;  3MDI A;  1IRY A;  3X0N A;  3SHD A;  3F6A A;  4K6E A;  1HZT A;  4KYX A;  3SON A;  4S2Y A;  3Q2S A;  1GA7 A;  2O5W A;  3A6U A;  3SMD A;  3GZ5 A;  1NQY A;  2YYH A;  3Q91 A;  4IJX A;  3CNG A;  2A8Q A;  1V8S A;  3G0Q A;  5FSN A;  5GHN A;  4C9W A;  3COU A;  1R67 A;  3X0R A;  2B06 A;  3ACA A;  4KTB A;  3EES A;  1SOI A;  3X0L A;  4C9X A;  1NFZ A;  4YPR A;  1PUN A;  4HFQ A;  2Q9P A;  2A8R A;  2A8T A;  2QKM B;  5IW4 A;  4MPO A;  2RRK A;  1U20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...