5CFLA

Crystal structure of anemone sting (nematostella vectensis) in complex with 3', 3' c-di-gmp, c[g(3', 5')pg(3', 5')p]
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
187
structure length
187
Chain Sequence
GSNVADGLAWSYYFGYLKFVLPELEKQIEKTSKFRSKEKFVKKMFILIPSNCFWDDKIPGSDYDPQNRITFEGNTEPLEKTRGGVFLRHYKHSVYEIKDGENEPWFCIMEYATPLLTLYDMSVAQPGELSREERDAQVVVFLRKLQDILEGDRACQGKYELVTFSPDRDLADVMLRKLKDSELEIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Stimulator of Interferon Genes
publication title Ancient Origin of cGAS-STING Reveals Mechanism of Universal 2',3' cGAMP Signaling.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Immune system
total genus 53
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cflA02
4F5WA 4LOJA 4EMUA 4F5EA 5CFNA 4LOLA 4LOIA 4EMTA 4F9EA 4YP1A 5CFOA 5CFRA 4JC5A 4KSYA 5CFQA 4QXRA 4QXQA 4QXPA 4F5DA 5CFMA 5CFPA 4F5YA 4LOHA 4KC0A 4EF4A 4KBYA 4F9GA 4LOKA 5BQXA 5CFLA 4QXOA 4EF5A
chains in the Genus database with same CATH superfamily
1QDLB 3RK4A 1VJCA 5B4TA 3IMKA 4D9MA 1MCZA 3C6QA 3CNOA 5HF5A 3W4JA 5MFZA 1A8SA 4B0OA 3NHUA 3NTUA 5BSGA 3K32A 2O3JA 3LHKA 4TL7A 4NMHA 4QNRA 2C99A 4F9EA 3OTHA 3Q7PA 5CDUA 3KEMA 4KVGA 4N3GA 2HRRA 5BNFA 3CR3C 1HA3A 1HBJA 1RC0A 3HS3A 2ZRDA 1O95C 4QHSA 4IV0A 1C9YA 4KVFA 2J7PA 1YS7A 1N1EA 1OLXB 1Z62A 5C80A 1SBHA 2AFIB 3BL8A 5AVWA 4W5QA 1ZK2A 3C3BA 1NXSA 1S1MA 2I99A 2ZRJA 1P6XA 2AG0A 2D1SA 9GPBA 4YRJA 3K1AB 1ACMA 1P6QA 1I7DA 4CM4B 3D7NA 1PSDA 1N5OX 4LJ8A 4WDRA 1JDBC 4S1TA 5K3CA 4MHTA 1TI7A 2O23A 4HPXB 1EXNA 2OENG 2UYGA 2MWMA 5CUQA 3K94A 4X1KB 3ZHBA 4B7CA 1LTQA 4X97A 2BP7B 1X0XA 5E3IA 3EY4A 4F12A 4MUMA 2CLCX 4ON9A 4Q4LA 1V35A 5F12A 1HE2A 2JAOA 3JWHA 2BDUA 4U9IS 4BMZA 1T36B 3T3NA 1QR6A 2W8BA 1KE1A 2QM7A 2UZAA 3LL7A 3SLRA 2XXAA 1TIKA 1SVNA 2Q3MA 1USUA 1K3FA 1JLLB 2BGMA 2IDKA 2YVLA 4J0KA 2P3QA 2E9SA 2HPAA 4HWOA 1Q7CA 1F7VA 2EHJA 2QW0X 3B6JA 3DQZA 2WKQA 3AUKA 3TRFA 3ZE2B 4F4HA 1W0CA 3ISJA 1E9RA 4FR0A 2GUWA 1MC4A 3IMFA 1Z37A 2HSDA 3HJTA 3JQAD 3L8YA 3KKZA 4UASA 4UU1A 1OHHD 3R75A 3E2IA 4X6XA 4XGKA 2WU3A 5KREA 1Q1AA 2BRUC 5JBNA 1MO4A 4IAOA 1JQKA 1S2DA 3ESZA 2DRIA 3UT0A 3OF2A 4C05A 4JKYA 4L0MA 3ZKWA 5IVDA 1ZU5A 5JEEA 3X43A 3OM9A 3BICA 2APJA 2CHUA 3E35A 4C76A 2RCYA 4ZAZA 5JV5A 6NULA 1JA1A 3H5RA 2VPWA 3D81A 2K7ZA 5B1EA 3UHFA 4E88A 4DV1B 1R3DA 4TXHA 1K98A 1CUYA 1DVRA 1W9HA 3G89A 1DC4A 2PSFA 3BULA 3NHZA 4MUHA 4A9AA 3PYMA 4XVRA 4QECA 3UB3A 1O8CA 1D2MA 3NRJA 9MHTA 2AI2A 1PL8A 3G9XA 3ZVLA 1VPEA 5J43A 2ID8A 1EFKA 2CXSA 1ZX1A 1ECLA 4DWVA 4EA6A 4JYAB 3B89A 3RC9A 1M1NB 3HH8A 4V0SA 3GGOA 2HZBA 1C7IA 2GVDC 1UJMA 1LY1A 1FL9A 4HQ0A 1TCUA 1NXWA 1NP7A 1E3WA 1WXHA 3CFYA 4BMXA 5LWQA 2HW8A 3ESDA 4IDQA 2CVZA 3I6QA 3K5WA 1H4SA 4UNIA 2R5NA 1X19A 3D3WB 3U7RA 3TLYA 1FU7A 4YASA 4EJ2A 4M83A 1M6YA 1JDBB 2P1DA 3PE4A 4O4IF 3RC7A 1T5BA 2QJOA 3M82A 3ZE9A 1PK7A 3ESYA 4ND7A 5B7QA 2HK9A 4G2NA 5JS7A 2A94A 2A9VA 2WT9A 3EISA 2AFRA 2FFBA 1A88A 3DT6A 4Z0HO 4HGZA 3FBTA 1P4HA 5GOZA 1CQZA 1R0ZA 4ZO9A 3EIEA 4R9NA 1XTBA 1OU4A 3WIOA 4UM9B 3NLLA 1O6ZA 5DM1A 3D6NB 5E8RA 1XALA 1ZVMA 3DDHA 3UGQA 4F72A 3A2MA 2ADOA 1VLMA 2Q2NA 3FMIA 4PZ0A 1JHRA 1RXYA 4AW9A 3FWNA 5UKDA 4RF5A 1BSVA 2Q6TA 1XPOA 3PCRB 3ZTTA 1CYEA 1ADFA 4DCVA 2FN7A 3FVTA 3GXBA 4FYIA 1R5NA 1PS0A 2GILA 4I5IA 1V45E 5GJVC 2ECPA 3QV2A 4FONA 2N1MA 3ZBPA 4PG8A 2PSEA 3OQJA 1SCUA 1KZ7B 4N0DA 5CLJA 1K5HA 1THGA 4UBNA 1N1DA 2VJAA 5EA2A 2H08A 3AU8A 3QLVA 2VBIA 4QARA 1LBEA 4I66A 2W0SA 3VUFA 3C3PA 1L7XA 2XADA 4HXEB 2FN3A 5CB0A 3RBZA 3ZCUA 1WBBA 4K03A 4HDMA 2PXXA 1H23A 1LF5A 1Y6JA 3L1VA 1T6ZA 4HH0A 5CMLA 4F2WA 2GZ1A 1JWLA 3BMXA 1F6DA 3SXUA 2Q3EA 1ESNA 2EWWA 3VYTB 4CIXA 1LRJA 1S3IA 1VJDA 2BGTA 3EVCA 2OBBA 3HBMA 3O8BA 4HMOA 4M21A 1LNQA 4EAQA 5SZKB 2NSDA 2GD2A 3DCJA 1E20A 4KVZA 2WM8A 3HXPA 2JJQA 2W6ZA 2FGKA 4EG8A 4UJ5A 3JD3A 3CR7A 4DLWA 3C45A 3DR5A 2PH5A 3GJ6A 5BOVA 3F90A 1LJUA 2VDOB 3HKCA 3Q9UA 1QHHA 1SC3A 4OAQA 1E64A 4I5EA 1T35A 3THOA 2PVSA 3KYJB 3K9NA 3JVEA 3VU0A 2HBRA 1U7XA 1C0IA 1IQPA 1M83A 4KPUA 1SN7A 4HGOA 3U1TA 1H0SA 1IHUA 4PBTA 1MJHA 1FJGB 1KR2A 1CX9B 1S5PA 1FS6A 2COKA 2GAIA 4C6HA 1UK7A 5A4DA 5BN5A 2EV9A 2X0FA 1XFAA 2Y6UA 3UN1A 2BKAA 5AI5A 2B3DA 4F6RB 1ZH2A 2O2EA 4KMOA 3R4VA 4TMZA 2AD1A 5EZQA 4FN4A 2RK4A 2AK3A 3N5KA 3A10A 3CKMA 3QVMA 5G1NA 1SCKA 3HCFA 4FSHA 3V2IA 2R9VA 3VHXB 2O19A 2P90A 2WBLC 2O2GA 5I5EA 1P75A 1Y9AA 2WM9B 5CX4A 4LX0A 3HJGA 3L01A 2BF7A 4RKWA 1HZZC 4V38A 3DUFA 3IR7A 2PGLA 1COZA 4PVDA 4ALLA 4DDUA 5PGMA 1WZIA 3WNDA 1SPBS 2OGUA 2Q5QA 2ZDGA 2NZJA 3CUVA 4TV8B 1NSFA 4NYJQ 4L8LA 1WB6A 5GM1A 1USVA 4RVCA 2IYSA 1G2IA 1FFAA 1T5HX 4LSZA 2JGRA 4LTNA 3P19A 3WDSA 5EZYA 4ZYZA 2O5VA 3DZFA 5TMPA 4X60A 5C31A 4OLAA 2PX6A 4K7JA 4EUEA 1W4RA 3X1YA 1C9JA 5CBKA 2OFXA 1YZGA 3F73A 3TM5A 1I3LA 1E7YA 2PO7A 2I6XA 4D3ZA 2NOAA 1QHSA 4AJ2A 3G7UA 2HL6A 3QVXA 4MW5A 3RYTC 3ZQ6A 2FW9A 3JWGA 5FUBA 3VSAA 2PYIA 1NUTA 3I83A 4MYRA 1P9NA 4TSKA 3VSCA 5JDIC 1ECJA 3TXAA 4OSEA 5KOJA 1JJ7A 5JS6A 3EX7C 2H3HA 2OG2A 3FZQA 4F85A 1D2RA 5KNLA 1GQSA 3NT5A 4G5XA 4BMVA 2NTJA 3GDWA 1F9AA 4ZK6A 3IUSA 3IR5A 2O2XA 3H2BA 1R8JA 1LBQA 2W9XA 4RK0A 4EA8A 1SRRA 3B5IA 2JEOA 1RWPA 3D3JA 3ECCA 3H9QA 2P9QA 3I34X 3UPTA 3GEHA 3D4NA 3A4YA 1H22A 4PC6A 1XKLA 5L3ZA 2OAGA 3SQOA 2AOUB 3E4CA 3ID6C 1QIJA 4W7SA 2P5YA 2XYPA 5BY2A 1NXOA 3FM9A 3QVOA 2GM5A 1GN8A 4DANA 2C7BA 1BJTA 5ICMA 4XIJA 4KE6A 3O2SB 4GKJB 4IFEA 4V3CA 1HT0A 1KK0A 1ZD3A 4KZKA 4V2UA 3UFXB 4R1LA 1JBQA 4ZICA 5JFGA 4X7MA 2BFFA 2Y67A 1J2TA 4RADA 4RSMA 4C22A 2JH9A 3NBXX 4F9GA 1V9SA 3HABA 3O6VA 3PQ5A 4MVXA 4C0QC 4DIEA 4EQ6B 4FOSA 4OY3A 4PRYA 3MAJA 4GT1A 2RBEA 4WNAB 4MWOA 1YIOA 3JATB 3PUVA 3VZQA 1D7AA 2AZDA 4FYWA 1F8GA 4HJXA 2K5UA 3COVA 1OBOA 1DRWA 1HF3A 1L1EA 3VNUA 4INAA 4ZEMA 3GVXA 3FB4A 3SEFA 4L15A 1RWOA 3HCWA 3NH6A 2P7HA 4K1XA 3QLEA 5JUWA 2H57A 4TZ0A 2P27A 5I9BA 2ZVJA 5KQGA 1M8KA 1QOPB 3D5TA 2FEKA 3I0MA 2P40A 2IOYA 4D4HA 2P79A 3U4QA 1PWYE 4KQHA 1A72A 1WCYA 2W71A 4JL8A 3FSEA 4R0MA 2QZJA 1JE1A 3BCSA 2OL4A 1WD5A 5KTPA 4F3CA 1I3CA 4OPMA 1S8FA 3QGMA 4WKNA 5TNXA 3H99A 3QYJA 3NXKA 1VLJA 2JFFA 1GXSA 3OFJA 2RJOA 5DGXA 1MEEA 1RSZA 4H59A 4AG5A 4K9OA 5IJ0A 4G5QA 2HFKA 1OTHA 3IUQA 4LS3A 4RA9A 1PR9A 3DO6A 1EXWA 2QNRA 1O5TA 3M81A 3WP1B 4C06A 3FKSD 1SVMA 4DC0A 3MB8A 1FBNA 1I6LA 3IPAA 5JYEA 4RD1A 5JRJA 5EEHA 4J1NA 4XVCA 2ZWAA 1DDGA 2CFRA 1BYIA 1YVEI 4W1SA 2R1UA 2YHUA 3DOUA 3QU9A 5AESA 2FETA 1EUYA 2JLAA 1EFLA 1KYYA 2Z04A 2ZJAA 3H05A 3L4EA 5KSZA 3KJQA 2PJDA 2WIGA 3OQ1A 4NV3A 4XWYA 5B1DA 5K6TA 1DX6A 1FA9A 2Q5CA 3REGA 3JXEA 4JDUA 3TDKA 1ULHA 1UDCA 4W9NA 1Y9JA 3S40A 1R27A 1ISIA 1IUKA 2C4KA 4EGFA 1Y5IA 1NG9A 4S1NA 4R51A 4NU0A 4ARZA 4LJAA 4OQFA 5CH8A 1D03A 2E4ZA 1SVKA 4FBLA 3MPUA 4YCNA 2GF9A 5G02A 4DV5B 1CNFA 4XB1A 1GNPA 1MT0A 3KWLA 3NC4A 5AKZA 4BO4A 2GDJA 3UJPA 3P9ZA 5DTMA 3I5YA 4MI9A 2XRFA 3TEFA 2HSWA 3DOIA 4JCOA 2WJIA 4B79A 2B2CA 2M9MA 1J2UA 2BGLA 1B74A 3FCAA 3Q6MA 3VPAA 1VL6A 4EKDA 2ZWPA 2IKQA 2P62A 3M1AA 5KQRA 5KYXB 1P18A 4OXYA 1UXGA 2ZYSA 4ODIA 4LE0A 1M34A 4I5GA 1VPWA 2VZEA 4GOJA 3T3PB 2E2WA 1W52X 3C5VA 3P0EA 5EWLA 1QHXA 5JNUA 3ODGA 1EKXA 1EG2A 3ZWBA 1WXFA 2PY6A 2RHOA 3HWX1 2CCJA 3O3NB 1NMEA 1X8LA 2VLIA 4UNRA 3T9AA 1VOTA 3INGA 3M4YA 3L40A 1VSTA 4R2MA 3RGGA 2O2CA 2PRKA 2WTMA 1EBBA 1VBFA 2AK2A 3PXAA 3U3ZA 1IAQA 2OPBA 4GD3Q 4MS4B 2CKMA 4EY3A 4FEEA 2OSVA 1P61B 1QPBA 2IA5A 3EE6A 1WUJS 1E7RA 1HKUA 1SG9A 2UYOA 5JMTA 4MXDA 4BATA 2XUIA 5U4QA 3UJDA 5B2FA 4B7UA 3AEUA 4D96A 1DDOA 4M9ZA 1WDMA 5DF1A 1LRKA 2AR9A 2GK7A 2XEDA 3TSYA 3MVEA 4X9XA 3X1ZA 1RWKA 4I4TB 1D1SA 1UF9A 2VT3A 1EB9A 4Q4AA 2DG2A 3CEAA 2CLOB 3PC8C 1H6BA 2WR8A 3MJSA 1E18A 2A0FA 3QYFA 4P54A 3VPBA 3P1JA 2EJCA 2GVNA 1SB8A 3W1VA 2OUKA 1BIFA 1BE1A 4EMTA 3EBLA 4GQIA 1VRCA 2HMUA 1EUZA 3G7SA 2ZZMA 3FNRA 4NJMB 2JIQA 3FWZA 2QKYA 2YYZA 4J3FA 5CBPA 5I3ZA 5CT6A 5HCUA 4DW8A 1HEUA 1U9ZA 4F5DA 4YV0A 4WK6A 1ZGZA 4YT8A 4A2CA 1N5JA 4WK0B 4E5UA 2HRBA 3CF4G 3NANA 1SUIA 2O2ZA 3S5JA 2Z2XA 3BTSA 4HTFB 1CZNA 2WTEA 4N3CA 4XIYA 2AV6A 2OWDA 4H7FA 3W1EA 1JWAB 3F5MA 5EUQB 4QM6A 4H4EA 3R3HA 2JIMA 2AQIA 2LTAA 2N1BA 1A4IA 1XXHA 4QNMA 5IJ9B 1YBHA 1HOTA 1V7QA 5E4JA 1IOVA 3A1NA 3QPWA 2V6JA 4FR5A 2YCBA 3WL6A 4MRNA 1M1YB 1V47A 2C3YA 2IQIA 2R47A 3QX7A 3HTXA 1VM6A 2CFIA 3IDZA 4QSMA 2GN0A 1H1TA 2I66A 3JU3A 2NNWB 3MGKA 3HV0A 3M1IA 4UXIA 5L45A 5F4ZA 5BR8B 1UKZA 1LDGA 2VSFA 3C8HA 4HXGA 2ZCVA 3PDCA 4YRIA 5IXSA 1FLDA 3E9CA 3BREA 3SF0A 5IDQA 2Z6QA 2FFHA 5EFOA 3S70A 1D6NA 2R8BA 2H65A 5KNCA 5L8VA 1VA5A 4D0NA 2GWRA 1IN4A 4AWXA 3VV2A 4QLBA 3S81A 1EZ1A 5KYYB 4C4YA 5FAKA 2H1IA 2XQFA 4ZTZB 2O7NA 3ZDBA 2X2PA 1ORHA 4HYTA 1PG0A 2QRZA 3LH5A 3OEWA 1YL5A 3OZVA 1RXEA 3K9BA 2ORED 3G68A 3Q8LA 4OGLA 1BGVA 2ZYUX 4RD0A 4C4PA 2GPBA 4YCJA 3S2UA 1PV2A 1UXIA 2VK4A 2Y4OA 1XPRA 2WV7A 2D2EA 4W4TA 5H8WA 2PX8A 1Z0KA 4UHEA 1XTKA 4EHHA 1DXQA 3P9NA 1ZW6A 2ZVDA 4RTRA 1UFRA 2A9OA 3P2JA 1WUKS 3ZJVA 2CLHB 3N76A 5LJIA 2F59A 2HA3A 2E7ZA 2QG4A 1YFLA 5HYVA 1EUQA 1ZRSA 1H66A 4IIYA 4IV8A 4AS2A 2B36A 3ITNA 3GMSA 3UKJA 1ZD4A 3ZHYA 5FUXA 3H3JA 5J4HA 4UXHA 4LZPA 4X94A 1NKVA 4R2LA 1AM4D 1KRHA 2BGUA 1V6SA 1ID1A 5FUVA 4I3GA 4A26A 4BNIA 4QEZA 2HM7A 3BXFA 4BNKA 3D31A 3K6SB 4KW7A 3SEZA 4J8PA 5H9WA 1JQLB 4I4NA 4LY3A 3U17A 2GYUA 2OAEA 2PHZA 2WYOA 1OYVA 1CRWG 3AV0B 3RU9A 1LDEA 4IY1A 4JEMA 3BEDA 4LGVA 2Y6VA 3CLTD 1DINA 2FMKA 3DHEA 3FNQA 2UYHA 1F2UA 4WESA 4RQUA 821PA 1QZ3A 3HCCA 4HDSB 2EJUA 3D4OA 3K0EA 1YC5A 2EL9A 4GMGA 2Y0BA 2WLSA 2CNOA 2GN8A 2PZFA 1E66A 3LTNC 3O92A 3EXG1 3HUDA 4KLNA 3PV0A 1TGYA 2W90A 2CB0A 4X5OA 4ZYXA 5T64A 2FPIA 2J9YB 1FIUA 1P19A 3STUA 1I5OA 2YJTD 1Y7HA 2RFLA 5A4IS 4KBGA 3DE7X 2IGBA 2WRZA 1P45A 3R23A 1H8EA 3ONWA 3PT9A 4BMPB 1LRLA 5ARDA 4RD6A 4CL3A 2OV4A 2BM1A 3NNDA 1VI6A 3WK4A 4CIAA 1GTL1 2RHGB 5D3MA 3IP6A 4MX8A 2GJ4A 3AP2A 2HU2A 3ZLUA 1Q0TA 2CXQA 4HLUA 2C8JA 2O50A 3HNOA 3QFTA 1XMVA 1CUGA 3G8YA 4ZODA 2ADMA 3N28A 5CB6A 4EX6A 4TOIA 3SXJA 2GERA 3JAMA 4RE5A 1KRWA 2D7JA 2H2WA 4FPXA 4BXOB 5JATA 5KSYA 1VIAA 2R6CA 1ACJA 1LQ2A 1IY8A 5EY5B 2WIFA 1WP9A 4IXMA 4YUZA 4O2BF 4QOFA 1HGXA 3WX0A 4EG5A 4P4GA 1E60A 2HJ9A 4MROA 4N9WA 3UMSA 1ZJYA 1KBQA 5EUMA 1RVDA 1KI4A 1GEEA 3I2FA 1ZD5A 3OETA 1G1MA 2X4IA 3AF2A 3L18A 4HX5A 4COOA 5CB4A 2MINB 1SUAA 3C41J 1N1GA 2ZSBA 3QF4A 3A37A 1AKMA 1LH0A 1AHPA 3B7PA 3Q7RA 1W581 1D09A 4PQEA 3HO8A 1UBUS 2BFDA 2DWPA 1X86B 4HYYA 4X1IB 4MR8B 3WGIA 1HH4A 4AI6A 1YRWA 1PYOA 3H9GA 2JBHA 5BVGA 1T34A 2A1UB 4BLOA 1DAHA 1JR3A 3GJ4A 3E82A 3DGFC 5BMVF 4RK4A 4EWLA 1OC4A 1JLRA 5G40A 3PD1A 4RC9A 1CFZA 4GI2A 3NJ4A 1OSNA 3A3YA 1PUJA 1Z68A 1BEEA 4UUMA 2EIHA 5JH7F 5MHTA 1I3MA 1M2HA 4K9MA 1NT2A 3M3PA 4GAEA 5JWHA 3TM4A 5K8LA 1FTSA 1T4BA 5G0WA 3PWTA 4Q18A 4DGQA 4GVXA 1IOZA 3E9QA 2NSLA 5IX8A 1MUUA 3OCYA 5EPEA 5LD2B 3EDQA 4Y2HA 2J48A 3WGLA 3ROKA 1MGPA 4O4JB 1ENZA 1W1IA 3S68A 3U4DA 1JFFB 1F2TB 1G7SA 4GG1A 2C9OA 4R16A 1WTAA 4OQDA 1F8XA 1WVMA 4YROA 5HE8A 3VHRA 4JXKA 3C6XA 1Z6AA 5DYNA 1V8DA 3O2NA 2FWMX 4WD3A 4DG9A 5A4KA 1ZR2A 2CSXA 5KNCH 2D62A 2QK4A 3UC5A 3IDQA 4ZI2A 2V7WA 1POXA 4OFXA 1DQRA 1JEEA 1OWOA 5SICE 1YQGA 4Q4DA 4G37A 3SICE 2FW1A 5DKFA 4QXMA 3BGVA 3UOWA 3DCIA 3NDBB 1Y81A 2G88A 4NYIR 4MLDA 3R8CA 5HJEA 4PS1A 3ZWOA 1G2QA 3K30A 2H5LA 3DBLB 2P69A 4KDFA 3BSWA 4WCDA 4KYTA 3IP1A 1DU4A 1WZ2A 4DR6B 3BUSA 1Y1LA 3AM5A 4C08A 5JADA 2C9ZA 2GI4A 1E9EA 3A6LA 4JBIA 4RY0A 1MD9A 3ZXUB 5ADVA 2G1PA 2PFGA 1UMCA 1YCFA 2HF9A 3L1JA 1CUEA 3EWNA 1QHYA 5DU2A 3ZUGA 1BJRE 1TTHA 4ITUA 4AO6A 1DEOA 3UVEA 2OFWA 3MTEA 5IPFA 2X0RA 1TC2A 1KEWA 2RDMA 3CPSA 3A1CA 1XN4A 3HG7A 4XB6B 4D82A 1QDUA 5GZ1A 1BDHA 1F14A 2AVNA 4Y9UA 3S99A 2BFEB 5IS2A 4R83A 4A8HA 2V1XA 4RSGA 3I8SA 3E1GA 3EAFA 3D7LA 3L6BA 2ZBEA 1Z8NA 3GLUA 1GNQA 3LAWA 5AOVA 3WLPA 4X20B 5C81A 1J8MF 1OA1A 3AIMA 3MWYW 5D87A 3ORHA 2H4HA 4L1KA 4BVHA 4CM8B 3IEMA 3RTGA 3SC2B 4UTNA 2NU7A 3E1SA 1A96A 3AESB 1DELA 2FSIA 2YZNA 4AZ0A 5K0ZA 1WW2A 2I91A 3GLKA 4LIPD 3ZCSA 1OY1A 3KG2A 4JJGA 2GDZA 4DR2B 5KTTA 4FFVA 4ZZ3A 4NMLA 5KPJA 1GKKA 4WNYA 4EY5A 4P84A 2I4NA 2A9JA 2SNIE 3RKRA 5DHQA 1QRDA 3WNZA 4JOBA 3JVVA 1U6JA 4OKIA 5C8YF 3PI7A 5GV7A 4HQRA 3NWPA 4KSYA 4FOLA 1CG6A 2ZDHA 2PH1A 3PKJA 1QTNA 3B9PA 4HP8A 3IRUA 1OLXA 1SIOA 2BFMA 3CBQA 4TWZA 4PIPA 2AFIA 4M6WA 1CIPA 4DCJA 2AUNA 1C9EA 4F2GA 2VHEA 1AOXA 1IZ8A 1QPGA 3C4VA 4C89A 3RJ9A 5D84A 3WRXC 3W3AD 2AQ8A 2V4ZA 4B76A 1N3YA 2ZI5A 2A14A 3F4KA 1RXUA 3K1AA 4QTUB 4BQOA 1F17A 1SUDA 2PZJA 2D2XA 1PL0A 2HNBA 3RS9A 2NZUG 3VNVA 1FDIA 2CVPA 4TYMA 1RHQA 2VPZA 2I3GA 2Z2IA 3KAKA 4MARA 4X1KA 5FBHA 3VR3A 1O3YA 1P0CA 2J08A 4NYIQ 3OTWA 5FTNA 3UB2A 4UEJA 4GBMA 1U7HA 2EKBA 1QG2A 4O2AB 2HIHA 5THKA 1L6IA 1T1RA 4XFJA 3X1XA 1M76A 2XUJA 2ECQA 1LQUA 2WSMA 4GX5A 4YGXB 2BEWB 1LDMA 1T36A 3KAPA 1QM5A 3PDWA 3JZAA 2QG9A 4G8CA 4MA0A 3THXB 1NMQA 1BE6A 2O7VA 2WA1A 3UICA 1VCOA 1F12A 3WYAA 1LPNA 3IBCA 1JLLA 3NJ8A 4N0MA 4AJEA 1UMDB 1G4UR 5TMEA 2EFCB 1W4LA 3FNHA 4G24A 4MGZR 4TM8A 4MQEB 4CM6A 1T15A 1JQEA 1L4KA 2G7MC 3R3UA 3TTYA 3VH3A 3ZCRA 2PEYA 2P2DA 1M7GA 2Y93A 3GRUA 3NB0A 3FOAA 4MWBA 3RSHA 1C9NA 5AVQA 1TNDA 3TLEA 1NATA 1EVJA 1I1HA 2CDRA 1L8QA 1K06A 2AVDA 2AOTA 3FIJA 3IGFA 2H1WA 3KZKA 1NIPA 2RGUA 3DKVA 3IAUA 2ZIAA 5H82A 1AKEA 2AQHA 3L7BA 4UOZA 1M2JA 1UWLA 1A5SB 3IHLA 5HGJA 2QS9A 2ZXFA 2HQBA 2JFPA 2XUAA 4QWWA 3AFNA 3BJIC 3DZJA 3VJMA 1D04A 3WVNA 4L51A 2I29A 2OK7A 4MCIA 2JW5A 1X1SA 4JI5B 4AY5A 5FD8A 1U98A 2PCJA 1OA0A 2NTEA 3GAAA 4NOJA 3W5AA 4H3KB 2GO1A 2XJ4A 3M33A 3U9SA 1T2NA 3WWCA 4DZRA 3ZNOA 4JSRA 1R88A 4RY8A 4B34A 1N78A 3CPHA 1W87A 2YYAA 1N2ZA 2DFKB 4F04A 5FV7A 2I2XB 2QZSA 3D8HA 4R9RA 1M1NA 4NESA 4RMJA 4LDRA 4X63A 3CJRA 1JAYA 1TO1E 2JGFA 4B3JA 3HJUA 1YK0A 1A0OA 4B4OA 1NTRA 2HCJB 3A1FA 4ZRMA 5HKKD 3O9MA 1I1NA 4GGPA 3A1SA 3RVMA 4MRAA 3R8XA 3ZI0A 1QZUA 4YMSA 4YO8A 1FFSA 2EU8A 1OI7A 1W0KA 1WCIB 2BCEA 3QFCA 4HD8A 2FMXA 3LE8A 3T9DA 3CF6R 1SM4A 4OB8A 4G97A 5C3MA 4HS4A 3D9QX 1V6AA 1KO1A 3UKOA 3V8RA 4CTNA 2AEJA 3QSGA 5C4MA 4ARCA 4JP2A 1XU9A 4HYEA 1GAWA 2QJWA 1RWQA 4DV7B 3EBOA 1JDSA 1TKAA 2E1PA 3G8AA 2VBCA 3WWOA 1V1MB 1YZTA 2GYYA 2PGIA 3S27A 3WK6A 4B2PA 2WSSD 2PQ0A 3O93A 1T2UA 1JKMA 2WKWA 2D2IA 3EJ6A 1AZWA 2FPPB 3DPUA 3MRXA 3NONA 4FQ7A 4FT4A 4GM4A 4K86A 4Q7KA 3ZDDA 4XX1A 3ANXA 4CV0A 3FGPA 1G1AA 1W19A 4RLQA 1BXGB 1O9BA 4I99A 4L3OA 3U7FB 5ENDA 1VG1A 1YA6A 1DTEA 3RNOA 3E53A 1CXZA 1MX9A 5LQKA 3G0CA 3ESCA 1HFKA 5DLQC 4C0HA 4ZYVA 4OHKA 2W2PA 5B58C 1JIIA 2BVNA 3FFBA 3IAFA 4HBGA 4QD3A 5IK2A 3RC3A 2YHAA 3IRVA 3TIXB 3WKBA 2F8SA 1IBRA 2I87A 3ZG6A 3B13B 3TINA 1CY0A 3EOZA 2OO7A 3HE3A 3T3HA 4N54A 1L5WA 1T8TA 1DGQA 3C3XA 4LY9A 3PQ7A 5F52A 2A58A 1U7ZA 3KYBA 1TJPB 4PBRA 5A0FA 5LB2A 3ZZTA 4NDNE 5IEJA 1UMKA 2JGKA 4OJQA 1KP9A 3DP9A 3GI1A 4R1OA 5H02A 3D64A 1XTQA 2VG8A 4WLNA 2XQIA 1PG5A 2LCFA 3HSSA 2VHWA 4RH1A 4X8LA 4IFBA 4CGZA 4UATA 4FSDA 4P7KA 1OREA 2EW2A 3MCAA 3NHKA 4YRQA 5BRAA 2GN9A 2QPTA 3SQXA 1LK7A 3E61A 2IDZA 1CUAA 1UPUA 2W2XA 3C7TA 5CLGA 3PQDA 1JKJB 1SK9A 2QOEA 4RY2A 3KZ1E 2CNDA 2E21A 3LKDA 3OPYA 3H4MA 4FQ5A 4AZWA 4Q7LA 2WMDA 4Q03A 2IPMA 4WPGA 4CM9D 1XV5A 4DA9A 4MRPA 3CM0A 3RRJA 5EESA 3FNFA 3GUVA 4P93A 4D9GA 4DR4B 1WE2A 1W75A 5FA6A 1E3MA 3CY6A 3KJFA 4NOKA 2LKCA 3WLTA 3IOMA 2PIAA 3QOXA 4JLVA 3ZJTA 2NUAB 4DR1B 5FTKA 4YC7A 1CF2O 1SBQA 1U2DC 4WERA 1C8BA 3CLRD 1A9SA 4EKGA 2W0MA 4NMWA 5IANA 5JY6A 4Z4QA 1ZJWA 3TGPA 3LWDA 2D1FA 1NQXA 3ZWKA 1UBCA 1MFPA 3GLFA 5BO5A 1KY5A 3GLVA 4CFSA 4PZCA 1OXVA 2AKEA 1FUKA 2Y9MB 4S1VA 1NUHA 1W34A 3KXLA 2ZUFA 1TJ3A 2QX8A 2IWHA 1M75A 1LI4A 1UJ4A 4BQQA 1PWHA 3FRIA 1WMDA 2H4WA 2H51A 2WF9A 4QZVA 4PTZA 4JQYA 4R6XA 1EBFA 1EUDA 2C1ZA 3IJEB 3O8NA 5IW8A 4DV6B 4ABTA 2V58A 5C8ZA 3I04A 3VNAA 4GRIA 5LP6A 1IMOA 2X5JO 3E5MA 2ECKA 1JEJA 1TIPA 3BCUA 5E9QA 2HF2A 4MLCA 3BILA 2P11A 1O0BA 3H4IA 3NALA 1MT3A 3OZCA 4QJBA 4EFMA 3Q8KA 1F51E 3ZGZA 2XDQB 1C1HA 3DE0X 4RHTA 4PYJA 5BV0A 1SU6A 2A88A 4TV8A 3LPNA 4GMXA 4OP2A 3T5MA 3GF4A 3OZTA 1BS2A 1PP4A 4ND3A 2HXSA 5ALGA 1XTSA 2QRJA 2I1WA 3PQ2A 3QKSB 4EGCB 2FU5C 3FX2A 1QU3A 1GCAA 1B3RA 3I30X 5LYJA 4BTLA 1NVWQ 3SKXA 1J7KA 4EBBA 2XUKA 3FPLA 5KWSA 4UC0A 3U4HA 3BPSA 4AC9A 3H87A 4TWAA 4FKMA 4LHXA 4X44A 4BC0A 4CRWB 5BNTA 2HGSA 1W8IA 2FSGA 1E1DA 1GAJA 4G8BA 1BCSA 4BCCA 3NG1A 3V4VB 3K2EA 3NBKA 3V7FA 4YRLA 1QX3A 2RGEA 3COYA 1MZVA 4HYQA 1AGRA 4J07A 5FEMA 1A8PA 1NN1A 2Z2KA 4CM7A 1D0SA 3PDHA 5FOXA 4DLVA 3DDSA 4HPWA 2P78A 2EERA 2XF8A 4RGQA 1ST2A 3ASZA 4PTLA 4KXYA 3QW2A 5JOQA 3H9UA 2P9HA 4RXUA 4KQIA 5CT4A 5K05A 3R09A 3UV6A 3NI2A 5LU8A 1M6VA 3M0EA 1NRJB 1L4UA 3QKWA 1W25A 4IRMA 3LP6A 2WF5A 1Y63A 3MT0A 1KH2A 3H1AA 4IIBA 2J9FB 3U7GA 1RYBA 4A91A 1PFKA 2AOUA 1O6GA 1PEYA 1U1CA 3OD5A 2LCQA 4XI9A 1XD9A 2I5PO 1H65A 4HI0E 2RGCA 3AKDA 1WDWB 3UFXA 5B7PA 2VRCD 2PS1A 4IIGA 4M9RA 4TV9B 3LNCA 4WADA 3OO0A 1QO7A 2OCKA 4MVWA 1JXAA 2GBLC 2Q3JA 3U80A 5JXHA 5TE9A 1KSFX 4ER5A 1JMKC 4EQ6A 4OYRA 2O4UX 1NR7A 2BFBA 3QXHA 4WNAA 3NCHA 1AURA 3JATA 2RH5A 3JQ8B 1BC5A 3F46A 1MF7A 4IIJB 4X91A 1YB4A 2ARKA 1M6WA 2X4LA 4X7PA 8ABPA 3EXHC 4Y1RB 1O94C 1HZZA 4V24A 4OJYA 2OOKA 2NIPA 2PL3A 3KWFA 4MB0A 2PFSA 4PNPA 4UDYX 3ZGVA 2H54A 4XVUA 5JD5A 1DIGA 3BJZA 4BASA 5AJYA 4NFSA 2IP4A 4UZSA 2P7IA 2Z2ZA 4PBSA 3BDAA 4AMZA 1DRVA 2Q62A 3GZJA 1M72A 4GLLA 3HA7A 3PF8A 4AF7A 1G19A 4DLXA 4XLTA 5JG7A 2MSCB 2P9TA 3FPJA 3P96A 4OI4A 1I6WA 4UAUA 3X1JA 4EDHA 2BFNA 3EEOA 4JMLA 1O58A 2JIPA 4TTAA 5DNCA 5F23A 5ALEA 1T0HB 2H63A 2L19A 3O9ZA 4RK1A 3O1LA 4US0R 4FMBB 2K7FA 1JNXX 3N58A 2LV8A 5IDYA 3ETDA 1SVOA 3GFRA 2SKCA 3BHJA 4ZQBA 3UK2A 5K0JA 1OH5A 4M8LA 1HG1A 1Q0HA 2GBIA 5JDIA 3NH9A 2HDWA 2WUEA 2J3QA 1B1AA 3SBDA 4EMSA 3KV1A 1XNRB 1IG0A 2ZIZA 3FPAA 3I37X 3IUBA 5HWSA 4UU0A 1YB1A 3HZHA 4DUZB 3ZC3A 2VP5A 4XVQA 3CT6A 3GFGA 5J2UB 2QN7A 3EUAA 3ZCXA 5DNDA 3DEAA 3JV7A 2AOWA 3HVHA 1AGPA 2ANBA 4EW6A 3LHIA 3VJKA 3M9LA 3FA2A 1K8QA 1TW2A 3AB7A 3W5SA 3OLXA 3OP4A 4YAEA 3ZHQA 4UUPA 1PS8A 1CVIA 2NGRA 4EATA 2VHCA 3H5IA 5D1NA 1MDFA 4B6PA 2AJBA 4KU4A 1NFQA 1M54A 5GPBA 3NUGA 2NZ2A 1UQRA 1YGYA 1POWA 5TDHA 3TF5A 4GSKA 3QH4A 4EHJA 1Q3HA 4CMJA 4HADA 4OU4A 4L2IA 3ZCQA 3P9YA 4IVRA 3VC1A 3QXSA 5KYXA 1Y6FA 1E6CA 3ITKA 3BKXA 3S2SA 2Q4DA 2R11A 1D4FA 3DONA 3V7UA 1JHAA 3UENA 4HUTA 2OBMA 1VZ2A 2FSUA 4DVJA 1DQZA 5HM6A 5C7YA 2WYHA 3AM3A 5CCEA 1AUOA 2WQ7A 3VPFA 1NP3A 1YZKA 2VP3A 3ZHXA 3BMCB 3EXHB 4NZZA 3PQ3A 3BK2A 3DWGA 3L8DA 4K88A 5A5VA 1O0CA 2P9GA 2HCRA 2WU8A 1KPHA 1ODSA 1TCCA 1U1GA 1X7WB 3DTVD 3ESXA 3FFAA 4H0CA 1VB5A 3MJCA 3T0GA 1TVMA 2ZR8A 3ZQKA 4EW3A 4G0UA 1BVHA 1Z0DA 4Y6PA 4MS4A 3SPXA 4U5XA 1Z74A 2V6MA 4WAUA 9LDBA 4ZQCB 2HA5A 3WIEA 3EPRA 2ACKA 4KACA 4I55B 2JDIA 4TTJA 1PZMA 5JDCC 3AERA 3QHQA 3LXUX 4BO0A 2X7HA 1SQFA 4NK4A 4KBFA 3V97A 2CJYA 1GT91 1PZGA 4JQSA 2PRIA 5EI5A 1UKYA 2YVQA 3G1TA 3PVZA 4RPIA 4EF5A 2C4UA 3E2MA 4I4TA 4N41A 3DE5X 4Q3DA 4MVJG 1KO5A 2C7PA 3LF1A 2CNBA 4FHEA 4G4SP 2Q9UA 2QGZA 4GM0A 3HFJA 3V1LA 4CG1A 4DSUA 3PJGA 4L5YA 5FWDA 3OZXA 3K0CC 1SOWA 2NV0A 3H2KA 4ZAVA 3IOBA 3MHPA 4PFJA 4HRYA 4NJMA 3OEED 2Q1WA 3RSSA 2BFOA 2PR7A 8ATCA 1E2QA 1UBFA 2BGIA 2Q1SA 5EIEA 4REQA 1FP4B 2ZJOA 4DLAA 3AJAA 2XWQA 4G8DA 4WV3A 3ZD7A 2Z1DA 1PLKA 1MJGM 3CS3A 4HTFA 2O3RA 1V48A 3H7AA 5AJTA 2XXJA 2XVZA 1GPDG 2BUBA 3BSSA 3V8MA 1PSWA 1WHTB 2JNWA 4US1R 2IHUA 4YJGB 4D97A 5IJ9A 3LL4A 1QH1B 1ZZGA 2D2VA 3OFNA 1W6RA 3ZW9A 3JYLA 1Q0ZA 2ZWVA 2FJPA 2VYQA 4AP5A 3FCCA 3KWMA 5EAIA 3HV2A 4CKWB 4K9PA 1OBVA 1DPGA 2O1EA 1M1YA 1G8PA 5I4IA 4C6RA 4MS3B 5IM5A 1DARA 3KELA 5EMNA 1TT5B 3I09A 4H35A 5LMCA 5KNBA 3IQHX 1JLMA 2HMWA 2FCRA 2QM8A 4RKFA 5J5CA 1KSGA 5BV8A 3NWEA 1L7NA 1QF9A 4GE0A 4MB2A 4RVHA 2H8KA 4DQVA 1O95D 4UTZA 4H18A 4GF5A 5BQ5A 3IBFA 4ZV7A 5JYBA 5HIAA 3AEKB 1PNOA 3KALA 2PSDA 4KDCA 3ROZA 1B8OA 3FRHA 2JJ2D 1E69A 1TVKA 2VDWA 7ADHA 1LD3A 1BRMA 2CJFA 4KR2A 1WNFA 3AKYA 3G2JA 1J2RA 2OY0A 3ANYB 3AUFA 1NJSA 2C5EA 2RI6A 4X6LA 3IDOA 4Q02A 4DQKA 2B0CA 2PXHA 5LM3A 1ISMA 3FFXA 4ENPA 3RYIB 3PTAA 4G5YA 2EGGA 2OQRA 2ZRLA 4L6IA 1V71A 4PXYA 2G9VA 1T4GA 5B64A 1LGYA 4AT1A 2OXEA 1AMNA 4UM9D 3WZ2A 1KI9A 1N3LA 3BXHA 2A7XA 1ILWA 4GLFA 1FUEA 5F5LA 3UWMA 2FMIA 3H0KA 1GM5A 1F0PA 4RJ2A 2HC9A 2WTBA 3U3DA 2ZUVA 2PV0A 4YTEA 2AJ8A 5A7FA 5FWNA 1KVUA 3D0QA 1JSZA 3P4UA 3V8EA 5DW3A 5JAOA 2ZZNA 3OQPA 1Y4UA 2E5LB 1L4FA 1ZU4A 3EQ6A 3FDIA 4NU5A 3M83A 3K6SA 4UDXX 3I8OA 4MINA 2PPVA 2YX1A 2ASVA 2W2NA 3RASA 2YHIA 2C7RA 4U7PB 2RHBA 3L79A 4G63A 4F84A 1ZN8A 3ROGA 3AOEC 5JSQA 3GJ8A 4KHZA 1EJBA 4QXQA 1USWA 3QX3A 4HDSA 4P5PA 1EP2B 2VZ9A 4S1OA 1QFJA 3HFGA 2Z98A 3JCZA 3K1JA 4GYKA 4UVDA 1OFGA 3T1QA 3CW9A 2PZAA 3QTTA 1OLUB 1QRTA 3BRSA 4E07A 2WQZA 3KT8A 4AJ1A 3ZGLA 2ZSUA 1GFIA 1UXJA 2GPAA 2H3EA 2JFVA 4NNOA 4A0SA 2LRHA 3PXEA 2OHOA 3DR3A 1CU1A 1SKUA 1Y3AA 4R05A 1YVRA 1I32A 2R7AA 2X0IA 3TIIA 3T06B 3PITA 4FHFA 1Z5WA 2CV1A 2COEA 4DV0B 1PW7A 1CQPA 2C04A 1MG5A 1PUXA 2ZAMA 4DABA 2CZCA 1FF9A 2FOLA 3IELA 4UMEA 2E4UA 1KARA 2I7XA 5J9FA 4JD5A 1TW3A 1DHRA 3LSTA 1A04A 1XSEA 1BX0A 1DJQA 4JUIA 3SBOA 4ER3A 2G6TA 6REQB 3O91A 1SCDA 2J32A 2WIAA 4QSHA 4MWEA 4AX8A 5LNK1 4BXOA 3GMIA 5JSZB 5JQGB 4AN4A 1T3SA 3U0BA 1F3OA 4JUBA 4WFJA 1QVZA 1WR8A 2VTVA 4R5HA 2Q6LA 1EXMA 1II8B 4ILEA 4KIWA 1WPRA 4R8VA 2Q46A 3CLUD 3I9NA 3NBMA 3Q88A 4UAJA 3K0FA 5DSZA 2R97A 1RWWA 2VHUA 4DNOA 4C2UA 1VE6A 3PXXA 3DOCA 3NNSA 2IZ6A 3OOWA 3JVIA 1KOLA 2ZSKA 3WMFA 5E3HA 2GHIA 2MINA 1LFDB 1OGJA 2WICA 4IOLA 4JJ4A 4MK4A 1J2YA 1HV8A 1KEVA 3AY3A 5IF3A 3BWVA 4JX9A 5CXUA 3ZQJA 1OJLA 1TPZA 5AI6A 4FFMA 4RIGA 1YDMA 1YVDA 2ZQZA 3A0UA 3LCJA 4MR8A 4Y1FA 1H05A 1FFHA 3D43A 1NI5A 2DPGA 2A1UA 4P53A 4EFDA 2VH5R 1U3TA 2CK3A 2JK0A 2C59A 2XVMA 4BEBA 3VC7A 2CFOA 1E7QA 1RYZA 3ZJ5A 4KXLA 3ZWYA 4L72A 4V1CI 3INNA 5GV8A 1ESZA 1A9XB 1P1RA 4KR0A 5CB4F 4GKKB 2AHOA 3GCDA 4WEOA 2W48A 1L4MA 3B9RA 4KIGA 4U9UA 2EYUA 3TQHA 5KPDA 1HOXA 1KYTA 3CUUA 3QVGB 1N0UA 1JDJA 2B35A 4UMFA 2WD8A 4G3XA 1H9BA 4JLBA 1QB8A 4XWTA 2IBTA 4B6FA 3B8HA 5K3BA 4F56A 1JQAA 5BVHB 2D7CA 2RD2A 4Q3EA 1G3UA 1JFFA 1F2TA 1OYYA 1R9GA 1WW8A 2ERXA 3BORA 5THXA 3VTZA 3ZXSA 4MP6A 5KNBH 3RS3A 3EOBI 4UU7A 1M1YE 1U9JA 2F9MA 2VZLA 3CSSA 3JVDA 3JYOA 3M6UA 4B2LA 3U1BA 2B8WA 2FUCA 1VGRA 2IC5A 2C0PA 3TAXA 1P7WA 4OHCA 5JEDA 4JI8B 5ENZA 3C8MA 4YPVA 1TL7C 1FDRA 3O03A 3WGMA 4QUDA 2YMMA 3TR6A 1L5KA 3VR6A 1YNSA 3ER9A 3RC8A 1ZNXA 3OJFA 4QXAA 2H9AA 1LF0A 3OEHD 4JC5A 3RVBA 2DB3A 3NAQA 1VE3A 3NXSA 5BWMA 3MMNA 4ZI5A 4CI9A 4M9XA 1U7OA 1CSEE 1AUQA 1E0JA 1GGHA 2YXPX 3OX2A 4J9UE 4ZFNA 5KS2A 3LI2A 1JSCA 2IUUA 1NE2A 1HWYA 1Y8RA 2FSHA 5FFFA 5ES4B 1DX9A 3MRSA 3F9RA 1G16A 1UK6A 3G02A 4KQMA 4BAGA 4U6QA 5JO0A 1ZSVA 2ZBGA 5TR9A 3ICCA 2IW1A 2XTJA 3RVJA 2IOFK 2ZSDA 2VRNA 3NP9A 4P0PB 2IHKA 4EVRA 2FEPA 4QYMA 2BSXA 4UREA 3K92A 4I1SA 4OMDA 5DLPA 1DMSA 1Y5NA 2X23A 4BP1A 3RF7A 2Q3DA 3SZ3A 4DMGA 1M2OB 2BFEA 2F00A 4L75A 2CLLB 4M3NA 4DNFA 5ESDA 1WXDA 4AZVA 5AVZA 5A4AA 1CFJA 4Q9HA 2VTEA 4I6GA 3N7AA 3E8SA 2FK7A 4MVJP 3NHJA 3U4CA 3PEUA 4ENWA 7AT1A 1MN6A 3O2QB 4X20A 4CM8A 4NCBA 1M66A 1PGOA 2WOJA 4XPIB 3T94A 4D44A 4PSAA 3GLGB 2Y9PB 3SC2A 1HTWA 2ZCUA 2WP8J 4L27A 2J1LA 3AESA 3F96A 4G1EB 3T7IA 4EO9A 1NNSA 4TTQA 4I0WB 4G4JA 5L3SB 2EF1A 5LN1A 3RAFC 1E8MA 1OZAA 2H29A 2PQ2A 3O4FA 4PYIA 5CFNA 2CHFA 2VXOA 1S4QA 4MUEA 1P4AA 2CUNA 3HL0A 4W63A 4HNQA 4PYKA 2RGDA 3EPPA 2B8JA 3PS9A 4NYMQ 3LIIA 3WFJA 4FYHA 1TZJA 2VHXA 5HTKA 1SULA 1L4LA 4LF7B 2D59A 2Y3IA 2XSZD 4J2TA 2QR2A 4JKOA 2VDJA 3CRMA 5F3WB 2WDPA 2O7SA 4LKOA 3WSWA 5KSPA 3OT4A 1U1IA 3UXMA 5G4KB 4D7AA 4GI1A 5LQJA 1S2LA 2YJ5A 3L43A 4IXTA 2PKQP 1DQYA 3E3LA 3I1JA 3NUZA 4GZ6A 1TOAA 1EVYA 1CZHA 5EPUA 2ZG6A 1C2TA 1JLKA 1I10A 1XE3A 2IK8A 2J85A 3OSUA 1E6UA 3SN6A 4ZYTA 3EVTA 1IBLB 1OI3A 3VPXA 2WHYA 3OHSX 3QQPA 1L2TA 2OBXA 2QMYA 3C85A 3OFKA 4IMIB 4KFRA 5JAQA 4AMUA 1HDXA 4YAWA 2HRCA 4Z9XA 1DCMA 2B6NA 2OHGA 2VSNA 3TSAA 1JG6A 1ZISA 1UZUA 2PZEA 2ZYIA 3I92A 3PU6A 4P2GA 1E2HA 2UVQA 3HFRA 2ZR9A 3W5DA 3THXA 2HCFA 1VLHA 4EHAA 1N2XA 3KZCA 4H0FA 4ZVSA 5DWVA 3KDAA 1UMDA 4CZ2A 3NHRA 4M7RA 2AG1A 4BVEA 1W88A 4OAPA 1ZL2A 4RHCA 4MQEA 4B4KA 2FXVA 3TRIA 2IXBA 3IUJA 3BXZA 2P75A 5K03A 2Z08A 1H1DA 1GZVA 2CXNA 4P31A 2J0UB 4W9RA 4ECAA 1DIHA 2I1QA 2FRDC 2XPCA 4HDRB 4ZDWA 4UNQA 3BHNA 3ANSA 4YQFA 4ETMA 4LXHA 4QOHA 1WPXA 4MP3A 1C8VB 1MC1A 1NOKA 1R6VA 2JHFA 2ZJ5A 4RIEA 2JB9A 1Q57A 1K5DA 4ND1A 4WZZA 3LTEA 2OM6A 3P26A 4NU6A 1XYYA 1IJBA 1EGVB 3CLHA 1HT3A 5F76A 2A5FA 4CT0A 3ADBA 3BRCA 1I24A 1EI9A 4CLEA 1HMPA 3JQPA 2P67A 4BYMA 3LY5A 3H9JA 3KXKA 3TIFA 1ORIA 2HO4A 1YMQA 4B09A 1DXYA 2W58A 3BGDA 1FP2A 4I6EA 1PFUA 1RWVA 1ORTA 1C7RA 4FEAA 4OGKA 4UMDA 3L84A 2QLLA 3JWEA 3LXXA 5SZJA 3SR4A 1P2FA 5T6MA 1RYNA 3ZWNA 2Y66A 4ME6A 4RMGA 4WCFC 3LT0A 4X90A 5C1IA 1G6HA 1O96B 2E55A 2XECA 3KFVA 1ZCBA 3PA6A 4BIMA 2A3NA 1XROA 3H11A 1XDWA 3L6DA 3K1YA 3R0ZA 1GCIA 1LPAB 4BTEA 4C5CA 1CTQA 3WRXA 1YONA 1ESEA 1Y37A 4BX0A 3SJ7A 5H70A 2BHTA 3P9RA 2I54A 1WCIA 4FNMA 2CEAA 3D2BA 4EA9A 4U6NA 5K6AC 1G20B 2G63A 2JI8A 4LOKA 1JKIA 4U7TB 1UPTA 4PAQA 3AHEA 2HLDA 4D9FA 4XUDA 1OBHA 5B5SA 4JFAA 3OTIA 1PJQA 4RM3A 5KC9A 7MHTA 1Y6GA 2AN4A 3C1UA 2V6IA 4I3HA 2FPPA 4YYEA 1YQTA 4A4DA 4EK9A 2IELA 1JS1X 1FFCA 1PCXA 4Z4GA 1BXGA 1QCDA 1MDBA 2A5LA 2FI1A 4B43A 1U2TA 2CE7A 3CF4A 3W2FA 3HVRA 1H2HA 1YASA 1KQ3A 1FC0A 1IG3A 2V6BA 2ERYA 2I4OA 4IHAA 1NHGA 1R0BA 1N8TA 1U0GA 2EARA 4A8JA 4EB6A 3S8MA 3CMCO 1DG1G 4NEQA 5A5DA 2OV1A 1QIKA 1ZK1A 4QGFA 3FOWA 2VJBA 4P3YA 3EVAA 4UVGA 1TUIA 4W1RA 4ZEOA 6PFKA 4YCCA 5EZSA 4W8OA 5DIZA 4V02A 1DFIA 2ILTA 3IV6A 5SZIA 3H8SA 1HFWA 1D2GA 4M1EA 3O8CA 1XNQB 2PNFA 5LQMA 1NBME 1ZXLA 4OCZA 2QRKA 1ZICA 2ABWA 4RDCA 1KVTA 3Q10A 4K6GA 3RFFA 2OE2A 1Z33A 4OKSA 1UFQA 4PCUA 1M0WA 3E7XA 2E49A 3GPBA 4N9QA 1IXRC 1P0MA 2IEBA 1Z26A 4RDXA 2A9KA 4AP6A 2FQWA 4C0WA 3H84A 3MUFA 1Z4QA 1SIUA 3UBMA 3L6EA 2GCIA 3TTSA 2Z3WA 3UQYS 2G3YA 3OKCA 5JXWA 1BZYA 2O0LA 1X14A 2A9PA 2PRSA 3M49A 1J5PA 4WRRA 3SY8A 2BBSA 3Q98A 1LC3A 1SG0A 1AZSC 1MHPA 1P1JA 1WQ3A 4PLFA 4WCFB 5ITVA 2NUAA 2QE7D 4PXSA 1T5TA 4R69A 2I2BA 4YBRA 3RVPA 4TQUS 5GZ3A 1QGOA 4FFSA 2C96A 3IUPA 3LDGA 4YAJA 5A3JA 3AJ9A 3K1TA 4EB0A 2PS0A 3U09A 1YGPA 2P65A 1YNOA 2JZCA 2JATA 3G0IA 1IONA 4M9UA 4JL6A 4XARA 1M1ZA 1T13A 1X92A 3C6ZA 2PKCA 4Y6SA 4RGVA 1KI6A 2YXBA 4DNXA 3FGZA 2EEZA 3GNQA 5ARBA 2SBTA 2I55A 4DG5A 1ETUA 2OGZA 3DG9A 5COQA 3HHPA 2QN3A 2NO1A 5IWCA 1YBVA 3OIWA 3UJ8A 1ECFA 1NLMA 3L0PA 1YKGA 4I81A 3A9SA 4YRCA 3WKEA 4O29A 4AJHA 3I5XA 5JWRA 5F98A 3M4XA 1PVVA 2XZDA 3I2GA 1T9GR 1LV8A 3OE1A 1RXIA 4NRDA 3RUHA 1MLDA 1PHPA 3EQZA 3K8ZA 1PFQA 1FU4A 4MYHA 5HXAA 1GGEA 4WZ6A 4WT7A 4YALA 3HWWA 1Z4KA 10MHA 2XTAA 2Q5EA 3KX2A 1Q21A 2BF4A 2HUPA 2XDQA 1R66A 3W3AA 4R1PA 3RT1A 1YR6A 2HSJA 4B7ZA 3MWKA 4AKEA 4MW2A 2FLVA 5DULA 1Q6YA 3GP8A 5M7EA 4JBXA 3BFXA 3VNBA 2FZEA 1ORRA 1B43A 3N2KB 4TUYB 5J40A 2P2GA 5GINE 1XDZA 4IMJB 3B85A 2PEZA 1MPXA 3DZHA 4PYOA 3KQPA 3SFTA 3WQQA 5JBQA 4NJEA 1E92A 2WD9A 1QVWA 3JQ9C 4NL4H 4ZP1A 3DMFA 3LWBA 1GR0A 5MF6A 1DCFA 5TQ0B 1JFRA 4BJHB 4DCTA 1WKBA 1WF6A 2NPIA 2QQEA 1QSGA 1DKQA 3QRWA 4IHQA 1HNZB 1D2AA 5FPQA 1HLGA 1V8ZA 2PPLA 5KWIA 1PR6A 3DEFA 3QM1A 4TV8F 1HQYE 3UMBA 1E2EA 3LNTA 2GEBA 4Q82A 1N4AA 3DKKA 3H86A 4I1RA 1Y1QA 2J9XB 3L4BC 4K46A 3BT7A 3KTOA 3TPFA 2WU1A 1U8UA 1EDBA 1Z8HA 4HFNA 3CWCA 3GX1A 4JHLA 1HDGO 4DLZA 2QGNA 2Y1KA 1TVCA 2ATVA 5F21A 2QDXA 3NEAA 1O2DA 1YOBA 4FBMA 3I1IA 4R7ZA 1QRAA 3NDJA 4TMWA 4AYXA 1TLTA 1DO0A 5FBLB 2JCYA 1PO7A 2EJBA 1XZMA 4L5BA 4XD7D 5TF0A 4JI1B 3TSOA 4X8HA 3ILHA 1DBSA 2OD2A 2Q9AA 4RORA 1UBEA 1T5OA 4YT2A 3QBJA 5SY6A 1U8XX 1ZGAA 3DWEX 5JJ5A 2X7XA 3K8YA 3GJ7A 4BGDA 5CD1A 3PNMA 3PIDA 4MEBA 1MZPA 1QQ5A 1Y80A 2JGDB 2V7VA 3ER6A 4IMRA 1LWNA 2NUTA 2WNSA 1FJHA 2X13A 4BLWA 4PLYA 4ZYYA 3A9UA 5JIBA 3PRJA 4QGHA 2JGLA 3CKKA 2IY8A 3WFZA 2B34A 3VV3A 1X9HA 3EXG2 2H00A 1DIBA 4Q21A 3JASB 4Q9IA 1AMOA 1QU2A 3CVVA 2B1RA 3JQ8A 3LRTA 4IIJA 1KU0A 5L6MB 1ZKDA 4Y1RA 2CNWD 4WZAB 3M5DA 3AEYA 3KJIA 2H18A 4B47A 1EIWA 2XX3A 4DLTA 5DM4A 2CDNA 3AIKA 2VAXA 1GPH1 3PUZA 4IX1A 3MXTA 2P8SA 5ALJA 4XGIA 2DLCX 4JYZA 3SLGA 4JP3A 4XASA 2QX9A 2QQ5A 2VHTA 1KZ1A 1SUWA 3CH7A 4DEVA 1Q3KA 3L6UA 5KINB 1SFRA 1C1DA 1OC2A 5GMOA 1C0LA 1B76A 1MX5A 4H7PA 2WKSA 3UMGA 3GGCA 1UKEA 1BRTA 1P4RA 2YOHA 1GCGA 2NQ2C 5HE9A 1YD7A 5C1PA 3NX4A 2EFYA 1Y6RA 4MYCA 3NC0C 4LYEA 3U81A 2R3SA 4WH0A 2C03A 3UKDA 4N03A 2EKQA 3PKIA 3WFIA 2YVAA 2JFWA 3TFOA 4YAUA 3IPYA 3ONEA 5CVDA 3KJGA 4ZVVA 3W04A 2PJRA 4ESOA 1ZGHA 1VDMA 2A0YA 3A7EA 3DV0B 2UZ4A 1X38A 1G9TA 3KVRA 2ON6A 5CH3A 4G85A 1RQLA 1GUAA 4XWWA 5AJVB 3PLRA 2B5WA 4UBOA 3QEOA 3V5NA 9LDTA 3HJFA 5EWMA 2BDEA 1IJKA 2DUUA 3HYLA 1PT8A 4FFDA 4YJ2A 5J2UA 2Q1XA 1DBRA 3PP8A 3ECAA 2ASEA 3H8VA 2WWRA 4FD2A 1YZUA 3SYKA 3BD9A 4EG3A 3IHWA 5LSAA 4C0XA 4CEJB 1ISJA 5B3LA 3U7JA 3G2KA 1LS6A 1FNNA 1NBMD 2XYRA 3A27A 4F1JA 4ITVA 4Z0PA 521PA 621PA 4LPKA 3RVQA 5L3QB 4V0MA 3AI7A 2O7RA 1T9ZA 3GAZA 3KEOA 3WHIA 3UA4A 2QJTA 1SC9A 5CRIA 1VJ5A 4NBSA 4P1ZA 3I0NA 4LRUA 4U7GA 4OHZA 1ML3A 3TQCA 1FMLA 4YP0A 2SKDA 1E3QA 1V11A 1XDBA 1UM9A 3H16A 3TFQA 1E3IA 1E5LA 4Q39A 4D56A 4G36A 2XKBA 4RJJA 5DB4A 2WFMA 5FDFA 2PBRA 1IULA 4KDRA 3TBFA 1H93A 4BC1A 4JXXA 1I1QB 5JU6A 2XNKA 3C3AA 2YWRA 2KI5A 3R0JA 1QTIA 2BSAA 2IOHA 2IHTA 4MWZA 3TVYA 2YBDA 2Q1TA 5B2EA 1A27A 4IUCS 4GLBA 4GRAA 4EPYA 1G5PA 2ZUUA 3W3AH 1SQSA 1A9YA 1LPMA 3EXHA 3LPDA 1G4HA 3W2EA 1E1KA 1O94A 3F6EX 3DZ8A 4CR8A 1YS9A 1HEYA 1QFSA 3LBFA 2PX3A 2GM4A 1SCIA 3FPFA 3OT1B 1JR4A 4HOYA 3QPDA 1RFLA 1ZOLA 3TR0A 1ESMA 2BR5A 2GZAA 4DCOA 1H3FA 3C43A 4ID9A 5A9SB 3LKVA 5F33A 5LQUA 1P9LA 4E1BA 2TRSB 1AS2A 2BKEA 4YUAA 4UBMA 2IYOA 1QO0D 3DMYA 5AK3A 3AEZA 4D99A 4H7IA 4I55A 3HKBB 4IGKA 2M32A 2QUJA 3P2OA 3WBJA 3KYDB 5K0CA 3MIZA 3S1LA 2ZI7A 4BKQA 2ZWMA 5JS1A 4I5DA 3CX8A 4D8YA 3GH3A 1D0VA 1ZEMA 4JI2B 4MV5A 4LJYA 3K9QO 4G84A 2DHRA 1DQNA 3P0RA 3T38A 1MIOB 5C32A 1HDOA 3MCTA 4RTQA 1Z7WA 3QA3E 1W2HA 4OP1A 1SKBA 5AUPB 1UANA 4O3FA 1CJBA 1EB8A 1SBNE 1QZXA 3N74A 3PDIA 1UBOS 1EHYA 1RXSA 3LECA 4RA6A 2HT1A 2AKAB 3NHAA 1QR2A 4N48A 3LDUA 1YVPA 1VPTA 3CEJA 5IZ4A 1FP4A 4O6VA 4W6ZA 1O5IA 1A9PA 1PJZA 3IAHA 3D4LA 1SKQA 3MNFA 2FX5A 4FCVA 4MUYA 2QTZA 4N8DA 4UVIA 1UEIA 1D2NA 1VKRA 4I4TF 2O0JA 3R7BA 3LHFA 3DBIA 2Y4NA 1KXZA 2Y77A 3WGNA 1W76A 1NURA 5C5IA 1WHTA 3PXBA 4YJGA 1FXWA 2ORVA 4ZMRA 3NUQA 1SUSA 4G0VA 1JEYB 2HZ7A 3SIRA 5ALDA 4ZDKA 2GRJA 4DSOA 4DB4A 2RHLA 3A1TA 3FD8A 4URYR 2I2WA 3V1YA 4QUKA 3RIXA 1O6CA 4WXYB 3BC1A 2UUOA 1RCTE 1ZWKA 2JVIA 2B20A 3DZDA 4MS3A 2H4YA 2HSZA 2IV2X 3V4ZA 4YMUA 2W2VA 2NUPB 3TZHA 4RCVA 4XQGA 3WNBA 4WLEA 1Z0IA 3HB1A 1BD3A 1SQ6A 4NCKA 1M10A 2OEPA 5CK4A 2WG2A 1FB5A 2WUFA 2ZI9A 2IZOA 4R7TA 3UTCA 1XTRA 1YR8A 2ID4A 3PJFA 4RPKA 3KR0A 4NBTA 4ONEA 3HZZA 1EWKA 1IHYA 1VMKA 2W6IA 5KEIA 1M67A 4I9HA 3PGVA 2O0KA 2YXNA 4O4LA 4PR3A 1E4EB 1Z5OA 1EA5A 3HM2A 4MRMA 3T7KA 3T7EA 2NSYA 3HCEA 3PUJA 3X1DA 3DNPA 1X3SA 1KXJA 5ALKA 1EMDA 1DBWA 2P9YA 4XR9A 1U2GC 4DSNA 3OZ7A 1DADA 2NW6A 3LFHA 4NFHA 4D9HA 2EKZA 3DCNA 2I1LA 2GFIA 3BHIA 3FCYA 3B2NA 1GQYA 1U2QA 3ADKA 3GY0A 5JDCA 1LA2A 2ZSIA 1IBSA 2KMLA 4FEGA 4PR0A 3EZFA 3Q6IA 4NNJA 2Z9CA 4GC5A 4C20A 1IHPA 1B0ZA 1VIMA 2BMEA 2FNAA 2Q2OA 3R5XA 4RF3A 4HT3B 1O89A 3R3VA 4QTTB 2JLVA 3UK1A 1B26A 1CEQA 2UZIR 2PMCA 1D9ZA 4YRSA 3SF8B 1KH1A 1M7HA 4QTXA 3PB3A 1XVUA 3QXJA 4H7HA 1KOFA 2WZBA 3LQ4A 2P6NA 4RBNA 2IL1A 2PX0A 4I2VA 1LU9A 2E82A 4MYTA 5DYIA 2QTNA 3SHWA 2YYYA 2PZGA 2VUUA 3LHSA 1JPNA 4OX9Y 4QYTA 4L73A 2WHEA 4OOFA 4C0LA 3OZGA 4XW2A 1SIBE 4J2OA 1DKMA 5TRTA 3VVBA 4EL0A 3X2FA 4NP6A 2R8OA 3DA8A 1B8UA 1GGKA 4KQKA 1C4KA 1WZEA 2EWMA 3SCZA 4OM8A 3MQFA 2QPLA 4JYPA 4JXZA 3JAWB 1NW7A 1V8FA 4TTRA 4EENA 1ZW1A 1PTJC 5MGBA 3K15A 1P1CA 1Y3CE 1ZOOA 3LUPA 5DDIP 1Z8FA 1ZH6A 3JQGB 3OZAA 5K8IA 3S2EA 2HK7A 1QO9A 4QRDA 3T7RA 5JC1A 3UWDA 1U5AA 2CLIB 2HRDA 4KQWA 3D0OA 1AHIA 3MPOA 5FHQA 2D0IA 3EAGA 4AWBA 3DF7A 1WZCA 1VMAA 1IEWA 5IULC 3A6DA 2HQRA 2B4YA 1KS2A 2CMDA 2H31A 3KPYA 4D3FA 4OQQA 1PJSA 1R9MA 1U99A 1QIHA 2NXJA 4MLZA 3RIYA 3TD9A 1KZYC 4FCTA 1PJLA 6REQA 3BGWA 3CPEA 1AQNA 1QHIA 4MQBA 2H2FA 3K9CA 2VUTA 1PYGA 5AHWA 4TSFD 4U00A 4YCLA 5JSZA 5JZVA 3ET5A 4WKGA 2JGMA 2RE8A 1ZHOA 2CL0X 1YA4A 4OL9A 4N0QA 4PG4A 5ALMA 1JFTA 4TVSA 2D13A 1II8A 2RHJA 4HVAA 4ZCTA 5JPDA 5AMXA 4WI1A 2GA9A 3MT8A 3NWBA 2IUEA 2QTLA 1EPUA 2RHCA 3ZK8A 1W1WA 4JITA 3I9LA 2Z5VA 3PJDA 4K6MA 3PCXA 1TAHA 4DIKA 5HSGA 2EQBA 3OX1A 3L1HA 1D5WA 4Q3BA 2X8BA 5K0NA 4YX9A 3E8XA 3IEIA 3SJCA 4QHTA 1GG2A 2ZT7A 3ZU3A 3W7AA 1L5QA 5FNVB 3FWYA 5C51B 2XE8A 4GSLA 2O0MA 3ZXYA 3UZUA 5JCOC 4Q3LA 4QO8A 2NVUB 1IBKB 1BW9B 1FS4A 1U0LA 4JJKA 3H2IA 2VNAA 3G0BA 1AKVA 3GA5A 2QN6A 3GELA 2PNJA 2X1LA 3W4KA 3ZQUA 2Z4SA 3TI9A 3QMMA 1VSBA 2V7QD 1RI5A 1P31A 2O8NA 1LSSA 2HU7A 4KQXA 4PN3A 5CJ2A 3AY6A 5B36A 4HQKA 3AHIA 3NHSA 1KFEB 4DGSA 1A9XA 4AMYA 4M55A 4JENA 1BN7A 1ZDMA 3FUVA 3GD5A 4DM3A 1QQAA 2B61A 4NFYA 5EJ9A 5HX7A 1VHWA 2GR9A 2QL9A 2DULA 2FPWA 4FDMA 3TNLA 4ZK2A 2VVTA 3FHLA 5EIBC 1GUBA 1BA3A 1RE0A 4AULA 4BFZA 3OE7D 4OQYA 4BNDA 2NSJA 2IH4A 1U7WA 3MFQA 2WLTA 4JB2A 1Q1NA 1UJ2A 3MD9A 5CFLA 3L41A 4X8OA 5HUHA 2G1JA 3AY7A 5JYCA 3SBEA 3PXDA 4MDYA 2QTCA 1SXGA 3KLPX 1L3IA 5AM4A 2IOQA 5KKCA 3DLCA 3NJRA 3QNMA 1Q77A 1EDOA 3K9WA 3KKMA 4G2TA 3UF0A 4E5NA 3TJRA 3FSRA 3I2JA 3L06A 5AVYA 3QY9A 1ENPA 5IZCC 4ZZ1A 1G3RA 1N75A 4Q5IA 4KN8A 4Z4EA 2DHDA 5A4FS 1N2EA 2IXAA 1MOQA 3NC1C 4WXPA 4D5EA 5BSVA 4O4JF 3GW8A 1C30A 1G63A 4UPVA 3L0CA 1AQ6A 4X92A 5FL3A 2W2MA 3WNQA 3RJTA 5JCXA 1FUUA 5DISB 3IAAA 4MMXB 1YS1X 1G0NA 3FMGA 4ZV9A 2PK3A 3UNXA 3WLHA 4YR7A 4ZI7F 2OA0A 4WOBA 3AR8A 4IIFA 4MEAA 1GRVA 1DTWB 4KRYA 2CCGA 1MTZA 1RPTA 1UP4A 2IYFA 2RGYA 4Q1FA 3CNLA 4YRDA 3O4RA 5JAZA 3PNPA 3P9SA 3DL2A 2Z5FA 4ENRA 5KJ6A 1Y89A 1KAEA 2WPDD 3GFTA 2AYZA 3MK31 4LFAB 3EWSA 4MKGA 4L7QA 1M5UA 4OJNA 5J5VA 2JLXA 2NWQA 5IJWA 3WIDA 2D7DA 3OY2A 2FSVC 1QGUB 1OH7A 4A6DA 4XUCA 2C57A 4DQDA 5LZ4A 1DO2A 3UEOA 4RZXA 1SOUA 4JELA 1P7ZA 3R5HA 3BD8A 5EJ4A 4HLNA 1E9DA 2II6A 3MJDA 1OAOA 4RELA 1Z75A 5ERGB 2RGWA 4W5RA 3ZXIA 1QWSA 5I7FA 3GLGA 4AN0A 1C4WA 3ZJ4A 1HLFA 4GKAA 4AJJA 3G8DA 1ZUNB 3GVHA 3SR3A 2B6HA 3CLKA 5J3JA 4R2HA 1F9EA 2BSQA 4B2YA 1MNAA 1BJKA 1TYZA 2YWFA 3ZWAA 2I2FA 2ZBPA 2QSZA 3EPKA 4GDFA 2OG1A 2G0NA 3IHTA 3O1JC 1YRAA 1I6KA 5A3SA 3VSBA 2IY9A 1AV7A 2FZ4A 1ZSNA 1EQUA 1Z9BA 4PYMA 3TOVA 4NBLA 4NH4A 1PEKE 4RMHA 4PU0A 4OBXA 3VO1A 3HP1A 4M1SA 1AK1A 2GXSA 4JR1A 3P0FA 3S3TA 4J0DA 1TYAE 4ZT6A 1UEXC 2MIIA 1YCDA 3R3YA 4KAXA 3QKUA 3VR4D 1ZJZA 2NVBA 2JKYA 4L76A 5G4KA 3SVTA 1GNVA 1RM4A 1Y1RA 4LV8B 2EX0A 4CT5A 4E13A 4UUAA 5HS4A 1Q74A 2FPKA 4GM1A 1JPVA 4MKXA 5HCNA 4AJ4A 5LZ7A 1L7QA 3UQZA 3L6CA 3OAAA 2GJ8A 1XQXA 5EGSA 4BRWA 3ND7A 4QEKA 2E87A 1L3CA 1QH0A 2QTGA 3NM6B 2DLNA 4KFCA 1H4VB 4OLHA 4LMBA 3I6IA 4J0EA 4Z49A 2C7GA 4NV1A 4LHVA 1A1SA 1QBKC 5D5PA 2ZXUA 4OH7A 4Y2JA 1M74A 4PAOA 3TZBA 4ZCSA 4II3A 1VQ1A 5ER9A 1JEAA 4ZT5A 4EG4A 5JSHA 1VYTA 5IUJC 1KOJA 5T57A 1GHTA 3SYMA 1IUNA 3G0HA 3LT1A 4HDQB 3ED1A 4BV2A 2Q49A 4TVBA 2PAAA 2EP8A 1J2EA 2QRNA 2VDPB 3GRAA 3PHGA 4LYDA 3V48A 1NM5A 3QWIA 4B3FX 3CMMA 2ZWIA 3LUHA 3T5DA 2Z6AA 2RHWA 3PRKE 1EM8B 2OMEA 4RTPA 3CXUA 1DKNA 2BBWA 3N1UA 3UMFA 5K1ZA 7YASA 4PCVA 4O2AF 1P73A 2JHGA 4HDRA 3D3NA 1OWPA 2QN2A 2O7QA 3IPXA 4FTWA 1UPXA 5F78A 4YRGA 5D8DA 3DOHA 1E9BA 2FP4B 1FSSA 3GB9A 3I04M 3RUFA 2IEYA 4JLUA 3U37A 1W5BA 1ADGA 2YZKA 1RKQA 1U7TA 1RDFA 2ISQA 2L18A 2X2EA 3GIWA 1T24A 3OUUA 5LQAA 1W4CA 2PMFA 2IE8A 2NO0A 4X3CA 1NUAA 1L5FA 1NLFA 1QXSA 1BE0A 4CLHA 1Z7BA 3ROMA 3PGA1 4PHHA 1OLSA 2PUGA 1Z6PA 4ANFA 3MWDB 4ZI3A 3AKZA 4L02A 1TM4E 4NOLA 4Z7NB 2I4TA 3C6KA 1FLNA 2ZRAA 3UXYA 2R44A 2V0CA 3IH5A 3LOUA 3A6JA 4XQEA 3VR5D 1PR2A 4RX1A 4BB6A 3DE6X 4ZQGA 3A4LA 4WZBB 1U94A 3EQ8A 1DJOA 2OAQ1 1CJTC 5IJXA 1O96A 1IHXA 1JEQB 4X00A 4Y2VA 5ERXA 1BAPA 4UD2A 1OH8A 3V4SA 5JVDF 2J33A 2AKYA 3AUTA 3EDMA 3ICVA 2V6FA 3R1IA 4IUBS 4HTAA 3DSRA 4QULA 1TM7E 2WNHA 1ZESA 1EU1A 5DOVA 2WG1A 3P2EA 3DAHA 3P0IA 2W43A 1RQXA 2ZSAA 2B69A 4IEFB 3GGGA 1G20A 1FSFA 1OTYA 1XAIA 1YFZA 5D51S 4Y1GA 5EQDA 5DTEA 4A1OA 2ZXEA 3MS4A 4M0DA 3P9KA 4G1MB 4MVJA 4KSCA 3W90A 2A9RA 5CPFA 3L1UA 4CLDA 1XL1A 3KFXA 1GZ3A 4FE3A 1VE9A 4YGYA 5DWQA 5AVKA 4BMCA 2P4UA 1MG0A 4EM6A 2VTBB 3DP7A 1BS1A 4GFDA 3VVLA 1ZP6A 3RBVA 2PTGA 4NE2A 2O8CA 1E6EA 4QUEA 2HHHB 3AG6A 3WHPA 1JBKA 4YI3A 4ZVPA 3RFCA 1N6PA 1ADBA 3AF5A 1EFDN 4IIXA 4LY6A 2R0QC 3AJRA 3DL4A 1BWSA 4WY2A 3Q15C 2AF3C 3BIFA 2X0NA 2QMOA 1W6UA 3FCUB 4NULA 4PO3X 5G4LA 2EF0A 3VI4B 3DV9A 1Z6YA 3LUFA 4Z4IA 3SHOA 2YUIA 1QANA 3AG5A 3GROA 5DSXA 3VFDA 3WGOA 4G0PA 1E3LA 1FFGA 1QH8B 4U8HA 5FB3A 1GGVA 3RTDA 2O2DA 3FPGA 3W5CA 2YJNA 1T0UA 2BCJQ 4URFA 2LUOA 5CXXA 5NLLA 1H6DA 2FRDA 1U8EA 3FYDA 1WBJB 5J4YA 5G0TA 5KYWB 1U7DA 4UHHA 1UINA 2DM6A 5I6DA 4RHYA 2C94A 1R4NA 3NHPA 3C5HA 4J75A 2FFJA 1PEAA 3GOQA 1NMSA 2KSQA 4NHEA 1K4YA 3GDOA 5A1TA 1MBZA 3EFHA 1HPLA 1N6IA 4WUTA 5BURA 2CF6A 3RIMA 4RVSA 3BTVA 4CL8A 1DLJA 1P81A 1FLVA 5KSOA 1SU7A 1MABB 3DFKA 5IYZA 4BN5A 3K70C 3FI9A 5EJGA 1N92A 4RZHA 2DFNA 3NO4A 3HXMA 3EDRA 1H2AS 1Z0SA 3IVXA 4IQ0A 4BWYA 3AF1A 2QVXX 3T5GA 1V96A 4ZYWA 3ETNA 3AHCA 3A36A 5T67A 2PGJA 1DNPA 5I45A 1O08A 1OYOA 2X14A 1IMJA 1TUGA 4GR9A 3F6YA 2CXUA 4JKIA 1O8BA 2D0DA 1XMIA 1I13A 1N57A 2GX6A 4UFNA 3A9TA 4X66B 2PUDA 2C4HA 3DEKA 3RR2A 2GPSA 1DI0A 2JJ1D 1Y34E 1JA0A 4FBGA 3EH1A 5JISA 1U7UA 4JT9A 3KEGA 2DPLA 3FBWA 5FTLA 2EHDA 2C2GA 4XWGA 1II9A 2HFJA 4F4CA 3V3KA 1YR9A 2Z09A 4KQEA 1N25A 4Q47A 5K6AA 1BKDR 2DUNA 2Q29A 3QA9A 3W1WA 4CF4A 1U3GA 3M2TA 1H5QA 1PE0A 2AN3A 2GSWA 1MOZA 3DXZA 2NXNA 1FUIA 4HX9A 1Q91A 4BX8A 4E5KA 5B12A 1NAHA 1WRBA 2FMFA 4BVBA 4CQMD 3V55A 3G5UA 3GWGA 4PG5A 3IBYA 1J23A 1U3DA 1IDN1 1ULSA 1JR2A 4M86A 4EG7A 2E5WA 2QUZA 1X7YA 3GEDA 2B1JA 4KFTA 1RM3A 1WLYA 2AZ4A 4MRSA 5L4LA 2DQ4A 3EG5A 4WN3A 2VPXA 2JS7A 2E6UX 1ZUD1 1SMKA 3ANTA 3SS8A 1KY2A 2KB0A 3DFFA 1RYMA 4JJIA 4CMEC 2BV3A 2O06A 4ZGGA 4BNNA 5DCWA 3RCBA 1B8NA 2C29D 3ZGYA 4AD8A 4IKEA 2QRLA 1A3CA 1WP4A 2WPNA 4OAOA 2MOKA 4QOIA 4F1WA 1DV1A 4K6CA 3OTQA 3INRA 4BS9A 5JCJD 1ZVKA 2EW1A 5B57C 1Q44A 3N2KA 3EIFA 3QVJA 1QJCA 4TUYA 1XD8A 1X74A 1WDKA 3RTEA 4EW1A 2O59A 1XZGA 1OGYA 4BJ3A 1ZGBA 1WXQA 1H42A 1NVUQ 1YE8A 3DLAA 3M5PA 5K01A 1ULBA 1Q84A 4PPGA 2UXDB 4RZSA 3E0XA 4O2LA 5TQ0A 3E22B 4G86A 4CDMA 3PUXA 2CMKA 4CKYA 4PAMA 4EG1A 1VIYA 2DC1A 2F3UA 4M7OA 4K0RA 1YU6A 3R44A 2FN9A 5FBQB 1SQ5A 3OESA 2Z43A 3TBKA 4F7WA 2LCIA 4DEYA 1RTTA 4HVCA 1PNRA 5B1YA 2X7JA 4H27A 1XU7A 3FW1A 3IVCA 8OHMA 4EGQA 2DPXA 5ABPA 1NT4A 1ZITA 2JK1A 3QW4B 1FTWA 1U8FO 4P81A 2VJYA 2J9RA 4MGKR 4INJA 3IR6A 2QX4A 2I7CA 4ND8B 3D2CA 3N53A 2ZR7A 2GGSA 1Q1EA 2VWHA 2LBPA 4G5OA 5ECYA 3WIUA 1J24A 2ILVA 3B3QA 1PWZA 1VJRA 3MOGA 4MGYR 1QV9A 1SA0B 3LDFA 4HN9A 3KEFA 4FFWA 4C6SA 4DLNA 4P0QB 3ZYZA 2K2WA 3COWA 4MVJH 3HC7A 3N2NA 3V32A 3ODPA 1NNUA 3K5PA 2C2YA 5D7NA 3U0VA 5BSKA 4XAQA 1G20E 3A58B 1Y0BA 2EFEB 4MB6A 4NTZA 1X7XB 2JGDA 3NHMA 4B4VA 3F0TA 4QPPA 1VBMA 4FT2A 3AXTA 4FMCB 4KXWA 5F7JA 3V2GA 4CEIA 4Y9TA 5DPMA 5HMLA 4YUVA 5IXYA 1KIAA 3IQZA 1KMIY 3MRTA 3KKEA 4GPD1 4IF4A 4M4SA 2VUHB 4MQLA 5FHRA 5J63A 2VYVD 3PUKA 3LCRA 2ZETA 4L95C 3RLIA 1ZBDA 2B78A 2QRMA 2YICA 3PQEA 4PE5B 4R7GA 1YB5A 4C0SA 1MO3A 1UAGA 4AY4A 3EVZA 3OH8A 4EITA 5LA6B 1I3OA 3V8PA 1SCBA 2BE7A 2M2IA 2O20A 5AKEA 4RJIA 4WZAA 4CPDA 5TSDA 3QYAA 1PFYA 3GL9A 3TTWA 4BFYA 1WMFA 3I2HA 4LYAA 3TZLA 4FFBB 1WS6A 2DWOA 4KB5A 1CY8A 2F1RA 2J45A 4XXHA 1Y9DA 4G1BA 4TV9F 4ARIA 1XEXB 1J0AA 1GPMA 1QYWA 2FAXA 1Z25A 5DNEA 1PGQA 1N9GB 1RNLA 1M8GA 2ODBA 1F4PA 2W2KB 3KJEA 3PFNA 1NVAA 4R31A 4NXNB 1FSZA 2XUDA 1OVMA 5FLXA 1G64A 4C6TB 2PKQO 4YRBA 4M1MA 1K2VN 1FNMA 3MD0A 1CB7A 1VCHA 3VH2A 1VE7A 3C3WA 1K97A 2I6UA 5FPTA 1OFUX 1HDEA 4J0FA 5H81A 4AS3A 3SWWA 3SIWA 1I3KA 4UHDA 4CXMA 4GYYA 3TRJA 4B83A 2DF8A 4Z2AA 2VOEA 3A06A 2OCPA 4E2YA 1HDIA 2YJ6A 2ZYRA 3DV0A 1W4BA 4MQ6A 1JB9A 2OSBA 4ZOLB 2FQXA 4D46A 1S9HA 1DAKA 2Q4RA 3OPXA 2VNHA 3DF9A 2Q3HA 3OWOA 1I7QB 3TUZC 1W94A 3HY3A 1SU8A 5CLHA 2TMYA 1YJ8A 5ARCA 5FPSA 3BZUA 4P2BA 2HR1A 4AUMA 1F2VA 1KKLA 1NJ2A 3BA6A 1MAHA 2C98A 4FDAA 1Z4JA 2C31A 1BU8A 4K9LA 4MVCA 3WKAA 5E6RB 2FPSA 4RD2A 3NYQA 1E5XA 5L3QA 5KWJA 5BPHA 4C4RA 4EY7A 3QFRA 5I7AA 5BUCA 5FO0A 1RZVA 3WGUA 5LVAA 1B4DA 2CUKA 2OHHA 2HQSA 1VDZA 2WDZA 1H94A 3F4BA 1J2JA 1EFRD 3OJEA 2XB8A 3K4PA 3NHWA 5E3JA 4BMDA 3AIIA 3EASA 4D3DA 2FEWB 3RK1A 2JIBA 4RHXA 5K3FB 3RD5A 3WK9A 3OOEA 3I42A 4LJKA 2QV7A 5J2UF 1C3OA 4YRZA 2D00A 2PT7A 5KTRA 3REFA 4C2BA 5FR1A 5FBRB 4FI3C 2PE5A 2F8MA 3VNRA 3LQKA 4KN5A 5A06A 4XDGA 3M9XA 4B44A 1HR0B 2C9BA 2ERCA 3QUSA 3ZNQA 3SS9X 1NUUA 2CN1A 3OOHA 2N46A 4MR9B 4QVIA 3AFIA 4ZU1X 1TD9A 4LDPA 5A9SA 3KUXA 1RYEA 2GK4A 3OZUA 4Z8XA 1MW8X 1AXGA 4KNVA 4KNYA 5JAPA 2HF8A 1SIWA 5FI5A 1RTKA 4K2HA 3KSRA 2BZSA 3MJ4A 1JTFA 3GT3A 2X3UA 3HDHA 4J4TA 2E4AA 1T25A 4PFSA 1V6CA 1SBIA 2HYDA 2MTBA 1UBLS 2GXUA 4W5OA 1E3DA 2J4CA 1EQ2A 1QS0A 2HXGA 4FFLA 2GBFA 2B1QA 2P5SA 4GZ5A 5LZ8A 3LPLA 4F4JA 2AZXA 5AXBA 4QPDA 1EFVA 1QYRA 2F64A 3GOHA 1WULS 2DBVO 3H5WA 4JJ7A 4Z86A 2IFTA 3TKYA 3ZWQA 4B6SA 1I14A 1C9DB 4Y9DA 4G9GA 2L82A 1W2GA 3K9GA 3FUWA 1D9XA 2YY7A 3WMEA 2VJNA 1PRYA 2VXYA 2QTAA 3RARA 3NHFA 1U3WA 2QD4A 2XUHA 3SEQA 5JZ9A 4J1SA 3PFKA 5DHSA 2HMAA 3HYCA 3L0YA 2O5RA 4GEKA 5ALSA 4I55F 4M1YA 5CGQB 4E94A 1B6SA 1VHDA 3MELA 4DLKA 1WW3A 2JKZA 4ALIA 1JX6A 2GJ9A 1LI5A 2G7ZA 1GDDA 2OESA 2QZPA 1LLFA 1OMOA 4MUGA 3GYBA 1JVBA 5JMWA 4DIMA 1FPMA 4OUDA 2DWUA 1Z16A 2OHXA 4MUXA 3UG6A 4BWFB 2YMPA 1TM5E 5ALTA 1AO0A 4HLCA 3W05A 1UDXA 1JEYA 4DILA 1SWVA 2R86A 3KUUA 1ONBA 4LDAA 2IE0A 2D4AA 1GTRA 1QVVA 2OLKA 4MUNA 3ZHUA 3AIOA 2JLSA 3MGAA 1FE8A 4YRNA 3AXSA 1L7PA 3AT1A 2YMLA 5FL7D 2NUPA 1QB7A 3K4QA 2O48X 3F9CA 4CHGA 2GMWA 3TG2A 1JG3A 1HL3A