5CFLA

Crystal structure of anemone sting (nematostella vectensis) in complex with 3', 3' c-di-gmp, c[g(3', 5')pg(3', 5')p]
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
187
structure length
187
Chain Sequence
GSNVADGLAWSYYFGYLKFVLPELEKQIEKTSKFRSKEKFVKKMFILIPSNCFWDDKIPGSDYDPQNRITFEGNTEPLEKTRGGVFLRHYKHSVYEIKDGENEPWFCIMEYATPLLTLYDMSVAQPGELSREERDAQVVVFLRKLQDILEGDRACQGKYELVTFSPDRDLADVMLRKLKDSELEIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Stimulator of Interferon Genes
publication title Ancient Origin of cGAS-STING Reveals Mechanism of Universal 2',3' cGAMP Signaling.
pubmed doi rcsb
source organism Nematostella vectensis
total genus 53
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cflA02
5CFQA 4YP1A 5CFLA 4F9GA 4LOJA 4EF5A 4LOIA 4F5DA 4EMTA 4KSYA 4LOHA 4QXRA 4EMUA 4QXPA 5CFRA 5CFNA 4KC0A 4QXQA 5CFOA 4F5WA 4EF4A 4F9EA 5CFMA 4JC5A 4QXOA 4KBYA 4LOKA 4F5YA 5BQXA 5CFPA 4LOLA 4F5EA
chains in the Genus database with same CATH superfamily
3MBKA 4IJUA 2AH5A 3VMFA 1KFBB 1U0EA 1QU3A 3V2IA 5IBRA 5IF3A 2EWVA 1NXOA 5CA1F 4DMRA 3DHNA 3MJEA 4BC1A 4WOBA 3O26A 2QV0A 3HVUA 5TXGA 5T64A 4JUDX 5LP6F 1UBUS 2X3UA 3WOVA 1EVEA 2QRKA 4M36A 2GA9A 4PXYA 1PQUA 4P3PA 2ZSHA 3Q12A 3RSLA 5TT1A 5JI3E 4RMJA 1TVMA 3MS4A 3SI7A 4BX0A 4JL5A 1GIAA 2PR7A 5DX8A 4CV2A 4W5QA 4O33A 4LA4A 1XNHA 4JBYA 3EZFA 2CNWD 5JVDF 3IL2A 3CZPA 1VLJA 5BXYA 2ZYHA 1JZSA 3B51X 3R0JA 1YRBA 4QUAA 4B82A 3ANYB 3SPXA 1ORVA 2VS1A 1U0TA 1R18A 2PFGA 5ALXA 4CF4A 3EPHA 3KO8A 2BH9A 1YZQA 1SXQA 1H0SA 1TC2A 2GAIA 2QN1A 4LZPA 2IV2X 4JQOA 3H2GA 4B71A 4I2VA 4GPEA 3Q88A 3MUOA 2GK4A 1IJKA 3KUCA 5ALZA 4ARUA 2WQ6A 1WXGA 4E5KA 4ND4A 4O59O 3GCDA 4MW6A 4C0JA 1UM9A 5JZMA 3LUGA 2BT4A 1TMYA 3EHEA 4ZPJA 3NG1A 4OA8A 3S29A 4B79A 1RDFA 2K2QB 1RI3A 4F2HA 1FZQA 2EFGA 1UM9B 2J3MA 1KMHA 4I4IA 2DY0A 4KK4A 4LZAA 4ND6A 1NM5C 3HUEA 2RC5A 3CO0S 4KKXB 3VI4B 5AVWA 1Z2OX 3H2KA 1ZBQA 2PHZA 3OTHA 1KMHB 5A5DA 5BW8A 4MKGA 1BFDA 4GLJA 1ZSYA 2WWRA 1XAHA 4R8VA 5E9QA 3DVLA 1J09A 2DBZA 3VR1A 4J1TA 4OMFG 1UKAA 2C3YA 1S7CA 3KPUA 4RXTA 1Y7HA 2ZPAA 1PT9A 1ACMA 1Y8QA 4PO9A 2JFUA 2O1EA 2FFJA 3WGIA 4LV5B 5E1DA 2WAOA 3C98A 3DL0A 2ZTLA 3I64A 2DQKA 3L49A 4N7BA 3TIIA 3RTGA 5BSUA 1Y8QB 1JMKC 2H11A 4Y0NA 3T54A 5B6PA 3THYA 3TQIA 2EDAA 4QDJA 5JSFA 1JDBC 3THYB 1T4GA 2C3MA 1DWPA 4ALIA 1E99A 3WBKA 3MELA 3OF5A 4FZVA 2BV3A 4BNDA 2NUBA 1KP9A 5AKJA 1JYFA 5KTMA 4KQEA 2P6UA 2BM8A 2GN0A 4KOAA 1ONNA 4KIJA 3O8RA 5CDUA 4KVGA 4BNDB 3GGPA 3GAFA 4M55A 4MO9A 1Y8ZA 1TKCA 3ZX4A 2EXXA 4FNOA 1T9DA 1SUFA 4LQDA 1YBVA 4M54A 1VSUA 4ACBA 4DXDA 1VRCA 2Q9UA 4KN5A 1T2EA 3TAHA 4CG1A 3V8EA 2HBRA 4EWLA 4BEBA 1N5MA 2ZKIA 3GV0A 5JIBA 3D5TA 3ZU6A 3E8MA 1I33A 4JCOA 4V2IA 5TGZA 2YS6A 1YJ5A 5BW6B 3F4BA 4DUPA 3GJ4A 4CT4B 2YVKA 4XVQA 1EFVA 3ZLUA 1S01A 1H2HA 2XLCA 3C8HA 3FNIA 4RA6A 3HUDA 3UC9A 4QARA 5B1EA 3HB4X 1MJGM 1J2EA 1EFVB 1PUIA 4RA6B 4YHBA 4DUYB 4BB9A 1EDEA 2X0JA 3PD1A 3VZRA 1OIWA 3L8YA 5IZCC 1IN7A 1CUWA 2I7VA 4S04A 4R31A 3GJ8A 1JEOA 3WLEA 4LMAA 4ZHQA 1ZD5A 1NW9B 2JATA 4OYHA 4JA0A 3WICA 3WX0A 1J24A 5BNZA 1J06A 5HUHA 1RM4A 4Y6GB 4ZHQB 4UZFA 2WUGA 3HB7A 2NP7A 1WQ1R 3KKPA 1F0PA 2DFTA 2PH3A 3GLSA 1L9XA 2BL4A 3QVJA 1QFYA 2A8YA 4IIDA 4EHLA 4UAJA 4M87A 4X63A 4TM7A 5B6IA 2BGWA 1ZXXA 3MW8A 1XTPA 2PX3A 3BXOA 1LPBB 3DWIA 3QA9A 3BSYA 4LXGA 1PZGA 3QA3E 1MKYA 4M1ZA 5GJCA 5AW3A 1KXJA 3H5NA 5DH9A 4F9TA 5AVTA 1K7YA 1ABEA 4CI9A 3RYIA 1JPNA 3F8WA 3S44A 3QX8A 4DA0A 2WAXA 4WZZA 1ZITA 2YZNA 2UYHA 1H8HD 3U62A 5H1YA 1CB0A 3RYIB 3EMBA 2OZPA 3B1XA 5ARCA 3H0EA 4J49A 1QR6A 4KSBA 2C0CA 1EAYA 5ABPA 5AKLA 1E2LA 1F06A 1L4HA 2IDMA 2VO1A 3KU4A 4D26A 3CT6A 1K27A 4D8VA 4A10A 1C2TA 4MIYA 4UJ5A 3OZBA 1SKMA 1IZYA 4MWZA 3UA3A 3MJSA 3UK2A 3WMRA 1AA6A 4MVJD 1N7JA 4HBGA 1ZNZA 3LRPA 1XNGA 2A86A 2QDKA 2XMGA 3L4EA 3K1ZA 4GSKA 1KF0A 3HU5A 4HT3B 3V4FA 2H9IA 2IE8A 2WWVD 1R6BX 4BNHA 5BN1A 1E9VA 3BYZA 3ZJYA 4YDHB 1LK0A 1VMIA 5IKMA 4CLDA 2K4MA 2D7CA 4TS9A 4PICA 1T9CA 1LDBA 3NDBB 4A4DA 5DGDA 5HW0A 3AWIA 3G5TA 1SVUA 3EWIA 2EX4A 3I4LA 2ATVA 2PZEA 4GGPA 3L7NA 4NICA 1EBBA 5FTJA 2QP3A 3GP8A 3ZJTA 2E85A 3L7MA 4Y9DA 3LYUA 1JIXA 4HLUA 4RS3A 4DZZA 3ZTWA 2G36A 2Q6OA 3JWIA 2QENA 5KNBH 4S0XA 1XK6A 1SK9A 2XGSA 3ECSA 2HBYA 1IZ8A 3IPAA 1I7NA 3OEYA 1KZ9A 4I8XA 2C84A 2WMDA 4J7XA 4U7FA 2PGXA 4RK1A 3RKSA 2YWCA 1CY1A 2VK1A 3EIFA 3VZQA 3V97A 3PIIA 2CFSA 2J9YB 4B85A 2OT3B 2P1RA 2NSLA 2QW0X 3OKAA 1CY0A 1ZICA 3V8BA 5AWFC 3JRWA 1IU9A 1JNYA 2AR7A 2QT1A 3EQ6A 4PLPA 2VFAA 4U39A 4D2IA 2OXCA 2FSUA 1SOWA 3C6XA 4HN9A 2JHCA 2Q5JA 4Y6RA 4LYAA 4DBLE 1Y4AE 1FFXA 2QSYA 3NUZA 1PWEA 1V7ZA 1KE1A 2VJNA 1N4AA 4NJEA 1NUHA 4GR5A 1L4LA 1FFXB 4EARA 4NYMR 4C0XA 3U5TA 4NJEB 5EZYA 1PFGA 5JFTA 4M8IA 4B2LA 1CULC 1HTBA 2OL4A 2ZYSA 1XK7A 2B4AA 2ZVDA 4QA9A 4ROSA 5EZYB 3OAAA 3C7DB 3B9RA 1IMJA 1BRTA 1OPXA 1QF9A 4JBIA 4KDRA 1CP2A 3GH3A 3DLPX 2PLWA 4XQ0A 4YAWA 4DMMA 5BWOA 1RBQA 4EMUA 4EO7A 5F9HA 4DANA 4KPYA 4UCWA 4D4LA 1A98A 2ZYGA 3JTMA 4M2LA 2ZRAA 5COBA 2I6GA 5KBYA 2YKGA 3NANA 2YRFA 2PZFA 3PG5A 2VCHA 3JVVA 4RLSA 1R6XA 1YQ9A 3FPKA 2SECE 1I7DA 2P67A 1Y3AA 5IK2A 3TQHA 1HDCA 4LY9A 2XUDA 3CX7A 4OJNA 4GI3A 3UV6A 4NDNE 1TIBA 1AXEA 3EY4A 3UMGA 3V33A 3U9LA 1H1TA 2CVPA 1DOZA 1BGWA 2Z1NA 2Z5VA 4GVPA 5AKHA 1PGNA 1TL7C 3SFTA 3C5EA 3OQBA 3P4UA 1YI0A 5JBQA 4RTOA 1PLLA 1WULS 3DO8A 1QYDA 2B5WA 1GNLA 3NWOA 1UBHS 1JUDA 4Q05A 4CIBA 4EKGA 3AY7A 4C7BA 5IJWA 1MV5A 5HKBA 4R1UA 4KWTA 5DI3A 1ZWLA 4UEKA 3FF1A 3ZBQA 4ZIRA 1X7HA 2XUIA 4RTSA 4KWCA 4ZGWA 1XZFA 1Z4LA 4ZIRB 1SRRA 4KRYA 4HY3A 1QIIA 4Q3NA 1B6GA 1FC0A 3P9ZA 4OM7A 4UDXX 5IAKA 4NBNA 3TOXA 3U0VA 2QZJA 3PHCA 5BW4A 1EEXB 3FLBA 3T5DA 3IAS6 3NBKA 4AYTA 5J3JA 3EPJA 3W5SA 1Y3CE 2D0PB 2VJPA 2GBLC 2QYHA 3LUCA 2A6PA 4LBWA 3VC7A 3W4JA 4CG3A 5C2JB 2YCLA 3FZGA 1CZLA 4LKOA 2C42A 2G07A 3NIFB 5H4HA 4OAOA 3VYWA 4TQAA 4PS1A 4FMCB 3SXJA 3D0OA 4R8SA 2HF7A 4BMZA 4BVKA 1L3CA 2Q3LA 2RI0A 4HH3C 3BCSA 4GX5A 1BC5A 3JZIA 4RD3A 2PXXA 5KAPA 3SKYA 4DM4A 5JDIA 1U8FO 2ZUBA 4MKFA 4UW9A 2NXWA 4ESVA 1I0ZA 4U00A 3ASUA 5A71A 1A7KA 4JBHA 4JKIA 4B3TB 1M2GA 3AI3A 3LKZA 1ZGBA 3HFJA 4BN4A 2P62A 4LI3X 2BGGA 2FR8C 3AB8A 1V6CA 3NT5A 1DTWA 1OXVA 1HH4A 3C1TA 4NZ9A 2A5DA 4IH9A 5LCXA 2XTAA 1H5QA 2C2GA 2EKPA 5EVJA 4D3YA 4DZRA 1AMOA 2YWFA 1AH2A 3L5OA 3CX8A 3P19A 4Y2UA 1DTWB 1U8UA 4EATA 4ML3A 3E1GA 3CEPB 4KV7A 1XQWA 4K6GA 1B41A 3R77A 4Z7QB 2VHXA 3TYXA 2P11A 4OL0A 1RFGE 1BD4A 3P26A 2XKJE 4UHFA 4WK6A 1FOEB 2IZ0A 4PSCA 5DE3A 5P21A 5F12A 2BBSA 2JB9A 1PJCA 3DD1A 2XWQA 2GAOA 2IHVA 1WA5A 2B1RA 2JASA 1Z13A 2Z5LA 1F6BA 3AFMA 2A84A 1TZJA 3B3FA 1I51A 3F74A 3F5MA 4IV8A 2WY2D 3IHKA 2QLTA 1TQDA 2OPBA 3TDNA 1Z63A 3WL8A 3DQPA 1NLUA 4RLHA 2Z30A 2I8CA 1Z0JA 1TW3A 4JGGA 2LCQA 5IT0A 2EWMA 4UJ3A 2D3TA 4WBNA 1A9XA 4QPDA 1N1DA 5ALDA 3S40A 2ZJ7A 3DO6A 3SBXA 3DEJA 3N05A 1O77A 4WBNB 5FBLB 1A9XB 3KQNA 4BNIA 4JN6B 2QRPA 3OICA 1H3EA 1P61B 1EVKA 3KAQA 3H13A 1EH5A 1G8AA 1KYVA 2G28A 4JNKA 4AMYA 3QVTA 2O19A 1R66A 1MJGA 1C50A 1HYEA 2HDHA 1UC5B 1ZXLA 1Y1TA 4PYIA 2WFZA 1DTEA 3K4QA 1L2TA 2VNSA 2BY4A 1QJCA 4FYWA 4LQLA 3ZGZA 4PQEA 1TK9A 5LJIA 4DCSA 3AM5A 4REOA 1OKKA 1XMSA 1Z28A 3E7WA 2O0HA 5ER6A 3DO5A 3X2EA 5AH0A 1H8ED 2PUEA 1MUUA 1BGXT 1I3CA 2ZT6A 4MQ6A 3PJRA 3IMKA 4HMPA 2PUGA 3W5AA 2E49A 4RELA 2PMWB 4EG8A 4EYKA 3UMBA 2ZT8A 3GRUA 1S8FA 1DQNA 1GP2A 2H6EA 4MQEA 4NMWA 2GAFA 1B7GO 4KW7A 4C22A 4MQEB 1IPHA 4B5KA 3R6DA 1G9XA 3BBLA 3GGGA 5BYBA 2PXAA 1TAQA 3A2LA 2PUDA 4MVJG 2V9ZA 1RPTA 1FVXA 4P5EA 5JS8A 2CXOA 4ND2A 3HEAA 3UV3A 4EKIA 3EXG2 3TM4A 4R9NA 4CM1A 1E1MA 2VYVD 5BQXA 2GM3A 5M5BA 3E8SA 4RJIA 1G98A 2BW0A 1IJFA 1HXHA 1NBOA 4A26A 3I2FA 4PGHA 4R2IA 3ROZA 4C20A 4KUEA 3M6AA 3T6KA 3JZAA 4W5WA 4C78A 2CF5A 1XIVA 2EEPA 3UYLA 4NNPA 2C31A 3HYSA 2D7JA 2HBQA 2IHZA 1TZMA 4GWGA 4HXFB 4EGAA 3LE8A 3FCEA 3G82C 2VQSA 1M7GA 4H0NA 3C3KA 4DDWA 3CB2A 4GQIA 1KO7A 4B74A 4BCDA 2EL9A 3VYRB 4TTJA 1NJFA 3UMCA 9ATCA 1LDNA 4GOJA 3ZVKA 3A6LA 5DN6D 4RCZA 4DB2A 2G06A 1S3SA 2JF0A 2DSNA 3ROQA 3UJ8A 4QOIA 3TSZA 3WOHA 5JNWA 1BU8A 2CDBA 2O3RA 2C9BA 1W9MA 3EWNA 4L1KA 4N7JA 4PFQA 4RFSA 1JVSA 1S3GA 3IKJA 3AVOA 3EXFA 3PXBA 3VDRA 3W79A 4DPKA 4EF5A 4YREA 4RFSB 1U3FA 3C74A 4X44A 4DVGA 1JSZA 4HQ6A 2F1JA 4AYWA 3QNUA 5LD2B 2OCAA 3BFJA 4H18A 3EXFB 3KE9A 4Q3LA 1E6UA 4D45A 4OHPA 4DC0A 4MW9A 3N9IA 1GLVA 3NWJA 1FJ2A 4LZZA 3JQGA 4MB2A 1PR3A 4BKUA 5J4HA 5BYAA 2DEUA 4TLBA 3F96A 2AV6A 3JQGB 2G04A 1VJCA 1T4MA 1CIVA 4NCHA 3I9FA 4NBVA 3TOVA 1BSVA 4HO1X 1CQIA 3NOOA 5C8VA 5SZKB 5G0UA 1VPEA 1MXHA 3K1AA 2AFIA 5F33A 1CQIB 1I5EA 1QH9A 4AJ2A 3BHNA 2QTZA 2YICA 4A91A 5K8JB 3ND7A 4B47A 1WF6A 3CG4A 4G63A 1L7OA 3K1AB 4FD2A 3RHSA 2AFIB 4D25A 1M8PA 5E9JA 2QG6A 5ALVA 3WWZA 1WXFA 2GPJA 2X9LA 4K8OA 1DKNA 4X3CA 5EZ6B 4E88A 2VTBA 3TOCA 4KO1S 1VJDA 2WUEA 3FYCA 3PX3A 4GT1A 5H83A 1P18A 5FRDA 2J08A 3AR5A 3MB8A 5I9NA 3RIMA 4YR7A 1JQEA 1OX5A 4F3RA 4ED9A 1CUZA 1NUSA 4QPPA 2BFPA 1MJNA 5CLLA 5B37A 1IY0A 1DBRA 3ABIA 2ZBPA 3G88A 4EG5A 5FPKA 4M98A 2XTJA 5E6SA 4EJ2A 2WABA 1QGDA 2WNIA 2Q0SA 2VPWA 3RROA 1N4DA 1H3NA 2EJTA 2GZRA 5IBQA 3JQ9A 4HRVA 5E6SB 4AUKA 3AMVA 1ISFA 1GN9A 3P9NA 4LDAA 2XT6A 3NIDB 5KWIA 4V0MA 1PDWA 1NBME 3KPJA 4KIFA 4BUZA 1TIPA 1E3QA 2CZQA 1UXHA 2BFFA 4NI5A 1CR6A 4L50A 1WVMA 4U63A 2VHYA 3FFBA 4EJSC 1WP4A 2Y6UA 4LJSA 1AM4D 3ZHUA 1T9HA 2BFFB 1UPBA 2JFXA 2UZIR 3HJTA 4OHCA 1SKYE 4DCTA 3HO1A 4B6FA 1MP0A 3E7DA 2H7XA 4DLVA 5CFOA 3JZDA 4RF5A 4RHXA 2JA2A 4WUVA 3ADDA 2W6ID 2BFAA 2PBLA 1E5VA 1ORDA 4CFSA 1CZKA 5TDHA 2I6XA 4RVNA 4ZT7A 5THQA 3RUDA 3RFUA 3BWEA 4E1BA 4ON9A 1RZRD 1OB2A 4NOMA 1G19A 4LK2A 3VR5A 3M2TA 1K7SN 3AB3A 1R2QA 4CG0A 1BOOA 3GELA 1E1NA 5F2EA 2W70A 4O8ZA 1SKQA 1B8NA 3UOWA 1CJTC 3MGGA 4CLXA 1Z2CA 4EA8A 4YCLA 4BO9A 3KDAA 2C5FA 2CLFB 1KEWA 4AMUA 4X1OA 3ZX5A 3VQTA 1VE5A 1NNSA 3O2QB 2WOJA 5HCUA 1UDWA 4RWZA 1LDYA 3HM2A 1A8UA 4HGZA 2W9XA 4MXDA 4NBLA 1FRVA 3ENWA 4HWPA 2Y1CA 4JVMA 4KEAA 4RVUA 3MWLA 1ODFA 2GHIA 1KVUA 4NQRA 4BRSA 5LQJA 2NUAA 3V32A 4JP3A 2HSDA 2O52A 2PT7A 3TE7A 1E79D 4HJRA 4MW1A 4OQ4A 2NUAB 2IZ6A 2OCIA 4N3AA 3WGNA 3R4VA 1I2BA 2C9ZA 1ZQ9A 3BK1A 4MGYR 5AI4A 4Y18A 4ZYYA 4R2WA 3EZ2A 3K53A 2I4RA 2C4NA 4TL9A 4YJKA 5B4TA 3RVQA 4W6QA 2IUUA 1EXWA 4IFTA 4UCFA 5CW1A 5LWHA 2HPAA 2WHQA 3SLGA 2ZI4A 2EIXA 2XTNA 3RJ5A 2G76A 3HS3A 1UOPA 2IRWA 1MGOA 3OJEA 1EFKA 4JOCA 2KPOA 3CLVA 3ZWVA 1C0LA 1NZDA 4GKAA 4OGWA 1C8VB 2YWRA 2GF2A 4MYSA 1ZMXA 3AL2A 4OJKA 4HATA 5DBGA 4TVOA 5KREA 2HCTA 1NN5A 2PEYA 5TJ9A 4RSMA 5CFPA 3SBDA 5ICGA 1Q7RA 5IKXA 1SU4A 5SY9A 3TTYA 2LCIA 2V7UA 1BOFA 2V7QD 3S5JA 3AR6A 4ZTZB 1QK3A 3EC7A 3PGLA 4GD3Q 3MSXA 5CJPA 3Q3CA 4LDRA 2Q6TA 1CVIA 3TTTA 3JXEA 2IXAA 2J6IA 3DA8A 2HJWA 4K05A 4KXNA 4TQ9A 4WZBE 4BQRA 5A7GA 3P2MA 4HH1A 3ZU4A 4AJPA 5B1YA 5KYNA 2R8OA 1WP9A 4YP6A 5C35A 4DC9A 2WPDD 1MB2A 2H7CA 3PBKA 3FYHA 2KHZA 1VDZA 4HNGA 2JLAA 4LDPA 2VAMA 3V7YA 4PXSA 4K7JA 3VZDA 3IUPA 3MM4A 4FFNA 3N74A 2ZSBA 1G20E 2VWHA 4NH0A 4WN3A 5TGDA 2G1KA 4P34A 3HCDA 2GKSA 1OWOA 1DHRA 3A6JA 3AW9A 2B6NA 3Q85A 1DRJA 1Z7BA 1X9IA 3NHUA 4HB3A 4M9QA 1GZVA 4BFLA 4D4GA 1EK0A 1JX6A 1YFKA 4BASA 2O8FA 3F47A 3EQ7A 2H4ZA 1QH0A 1SNYA 2V03A 2B7BA 3B7PA 1JWAB 4LMBA 3F67A 4ROTA 4OQZA 2P30A 1QTIA 1W0CA 3BJZA 3HYNA 5DSZA 3X3HA 4RQBA 2P9QA 2QMOA 4N5DA 1IDOA 2O8FB 3N2GA 4A5SA 3SICE 4KN6A 3E9RA 4L0CA 4PLHA 1EE2A 1HE8B 1UJNA 2DT8A 3N2GB 3HCFA 4QOGA 3STTA 5I6DA 1DT5A 1UKBA 5T3UA 2BF7A 2B37A 2M32A 1DZ3A 1C3EA 3N8HA 4N49A 5JSKA 3R5HA 4ZGGA 1CJMA 3NHAA 4F5EA 4C2TA 1WZ2A 1KQPA 1RWNA 2E55A 2O8CA 5DX1A 1CIJA 1JXOA 1O4WA 3KB1A 4EL0A 4LZLA 1T3ZA 1YRHA 4XEHA 1CRZA 4RMGA 2ZZNA 2O8CB 1TO1E 2W71A 3RFFA 2LRHA 1LNQA 3TBFA 5KDOA 5HCNA 3QW2A 5FJIA 3S5UA 2DQZA 4C4YA 4CU2A 2ZCVA 3NATA 3V48A 4PYJA 2Y8EA 2YJZA 3NX4A 4YRPA 3HDYA 2GBPA 3LYLA 5FYDA 4NCAA 1BNCA 1EGHA 1RWVA 3EXAA 4EECA 3N1UA 1CW2B 2PL9A 3TECE 3BAZA 1X7WA 3L40A 4L75A 4A8JC 1K8QA 4FFVA 3E9ZA 4ALNA 3P27A 2WFMA 1TJYA 1F60A 1X7WB 2VP3A 3PWZA 3ZNOA 3ZBTA 1JU9A 5G1NA 3WYDA 5BNTA 1PYOA 1WXEA 3JQBC 2LXNA 3DONA 3LNCA 5ALJA 1SD2A 2H16A 4YB8A 1BH6A 1RQGA 4L2IA 4IH1A 3FG9A 2V7TA 3N8NA 4OHXA 1U28C 2OSVA 1JHZA 1ZA1A 3C45A 1PWXA 1X1BA 3DW1X 4L2IB 3H7AA 1P2SA 3PKIA 2NZVG 4IW3B 3ZN2A 4B6QA 1Z7WA 2AFRA 2VP5A 2G4CA 5EE0A 3L4BC 1G55A 1M33A 1XF9A 1KI9A 2AJLI 4YBZA 4F3TA 2VDWB 4CKEA 3LCJA 2EJWA 3DBRA 2Y1LA 3E9CA 1S2DA 2ZCJA 1WDMA 3W7VA 4CKEB 3UEOA 3Q2KA 4U6SA 2JIOA 3QEKA 1K4MA 1CNEA 3DBRB 1DBIA 3QY9A 3WKBA 1E2FA 4ECAA 3F8SA 4FDMA 2W4IA 2H1WA 1FBNA 3CZMA 1OI3A 1J8QA 3N7TA 4RHUA 1Y4ZA 1FLAA 3GUYA 4KVFA 3VR3A 1M2WA 2CUTA 3FSJX 4YCNA 1C80A 2AYXA 5CCBA 4I36A 2Q5OA 2R6ZA 2RFLA 4G4SO 5K3FA 4CCWA 4EAAA 4AC9A 4B40A 3KG2A 1GZUA 2HLNA 2IUYA 2HCJB 3A4NA 2GO1A 1TYEB 2Q1TA 2X8BA 1RHUA 2BOVA 2G82A 3JVEA 5K3FB 5ALHA 4OHWA 4U6NA 4B09A 2ZE5A 1DBQA 1AUOA 1FYFA 1OT3A 1V16A 3VOTA 2XF2A 2HDOA 1TM1E 3SXPA 5JBIA 2JIQA 3DE2X 3QIAA 4OXNA 1V16B 3R7DA 2Q1YA 4ILEA 1P9OA 3G1WA 4GGOA 4UBOA 2P91A 5DP1A 2DR3A 4LZNA 3HXKA 4X3OA 2BFMA 2D5AA 2Y0EA 3KSUA 4I1SA 3PFHA 4A6PA 5JEDA 3H2HA 1Q0TA 2UXDB 2JGJA 1L4MA 2IEYA 2W0MA 4IXMA 3MPOA 3HN6A 4C6RA 4YT2A 3A9TA 2CMDA 3LSYA 5FBQB 5CUQA 4ZCSA 3T1HB 3ECAA 1C0PA 1JB1A 3WAGA 1MJHA 3BQNB 1PVOA 5B2EA 4V02A 3NC0C 3LQ1A 3LTEA 4JUBA 4BN5A 16PKA 4XX0A 4X7RA 3VU8A 1AQLA 1HUQA 3GU3A 2WA1A 2VXCA 1K89A 4BRZA 3H1AA 4QOEA 4BFVA 4XX0B 1XZMA 3L8GA 1U1FA 2YXLA 1ORTA 3VHRA 3GNSA 1KEEB 4EQ6A 4Y7DA 1Q84A 1EUZA 4TTIA 1SUIA 1R0LA 3GN2A 4EQ6B 5KHOC 4Q24A 2F3QA 3DZCA 4LHYA 5ELXA 1AVTA 3T7TA 4FNAA 1NW6A 3D3EA 2VN8A 3LP8A 2X6RA 2AA3A 2VDPB 3MTJA 4NP6A 4Q6WA 4QGGA 1A2KC 4TWIA 2OD2A 1P29A 4C06A 4YV1A 4BQPA 1X0VA 4KH0A 2Q3BA 1JR3D 3CE6A 1VGVA 4MCAA 4MUIA 4LVOA 3F7NA 2ERYA 5BUQA 1K4YA 2AFHE 4P9NA 3DE1X 5AM0A 1U5AA 3C1OA 4PNHA 2H1HA 3D0RA 4M7OA 4WRRA 5KQLA 2FCRA 4S35A 2WBLC 3X44A 2WJIA 3KJZA 4GRAA 5HE9A 4Z4EA 2CHQA 1G8FA 4P0TA 3L1IA 2LUOA 1VL1A 4M9SA 4NFHA 4JEIA 1HQDA 1ADGA 2PWYA 3CPSA 4ERXA 4MINA 3SSNA 3AOGA 2X6TA 1SXGA 1QIKA 3CPHA 1GTG1 2B36A 2OM2A 2Y9PB 1P8JA 2FZWA 4E5YA 2E5LB 3UATA 5JRDS 1SHZA 5E9WA 2B6HA 1EM8A 1L3IA 1J39A 3LHDA 3P0RA 1ECGA 4B2IA 2O6LA 3LO5A 2C0PA 2ZAMA 1EJ6A 3CU5A 3L1VA 1EM8B 2PUBA 1M8KA 5KINB 3DFMA 5KS2A 1QZZA 4XCQA 1Z4OA 3PNOA 2NO4A 5FI3A 3RS9A 1R6DA 4ZMRA 5F1YA 4MTLA 4I1UA 3ORHA 4XFJA 3OZRA 2I9KA 5CM2Z 2BGLA 2OWEA 1BS2A 1Q6ZA 3A1EA 4DEXA 3UFBA 3GJ3A 4YO7A 4JIGA 1EP1B 3N2EA 3FOBA 3C3EA 3Q41A 2APJA 2PQ2A 1XZQA 3BS4A 4PPQA 2A0XA 4O2BA 3LUHA 1JFRA 1AO3A 4CMGA 3JQAA 3TGLA 1K7XB 1DJOA 4PZPA 4C4XA 2Y66A 4RGYA 1THGA 4BO3A 4O2BB 4EGSA 4QO7A 1P17A 3JQAB 1DU4A 3SXUA 1FTNA 4UAVA 1S4MA 5JMPA 3C3DA 3HKCA 3TVTA 1DI0A 3PZBA 3EQ8A 1KYQA 1PNOA 1YDFA 3ZI4A 5DYNA 4X6XA 4UEOA 3QPBA 3AQ4A 5J5VA 3SXUB 4JH0A 4LHZA 1Y9ZA 3HKCB 4HR7A 1V45E 2VYNA 4W5JA 3BWYA 4PG8A 2ZBVA 4X1KA 4YPFA 2O5CA 4IDOA 4KPUA 5DM60 2Z08A 1ZRHA 1V8DA 1G5QA 1Z6PA 2UUOA 3PQ6A 4J2HA 5HFJA 1XQ9A 4MV9A 4X1KB 4KPUB 1IWPB 4GPD1 2W6MA 3VX3A 1BVYF 1TA4A 3STWA 2JFOA 1EVLA 2E2WA 1NQUA 3DOOA 1P6XA 4G26A 3VV3A 4R3NA 1DO2A 4X90A 1SD1A 3VM6A 2ZJ0A 5JI2E 2VJYA 3AJEA 3G2JA 1E66A 1JVNA 2C7OA 5FA8A 1UBSB 4DPMA 4I5IA 3PZRA 3IE2A 5EESA 5HRCA 4JCCA 2I54A 1YULA 4IX9A 1KO1A 1PW5A 4L5CA 5A3RA 2I66A 2C5GA 4C3ZA 1NC1A 3A37A 4AF7A 1PUXA 3Q3JB 4KR9A 4MSUA 2PQ0A 2WDZA 1ZVJA 1ICIA 4RZ3A 4W8HA 2VH1A 1W44A 3DP7A 4OQDA 1ILWA 5ED4A 2O7VA 1F8FA 1TPYA 1JG4A 1IN4A 1U0RA 4YRZA 3BXGA 4ENUA 2IEDA 3O2NA 2DCUA 4TV9A 2XNSA 1CK4A 1JLSA 1MAAA 2JCVA 1T5SA 3L7YA 3SE0A 4TV9B 3SOPA 3FOAA 2PWAA 3CKYA 3VNUA 1PD0A 4RIHA 1KVTA 1QIJA 2CC2A 2ZDHA 4W7SA 3SHTA 4PIMA 1RXUA 2AJTA 3MCVA 3O82A 5HTKA 4CT5A 2PSSA 4R2LA 5EIXA 4I9HA 3BMXA 3F5SA 4GBGA 1TZCA 2VIIA 3EZYA 5EJ6A 4QUIA 5L7WA 2QGZA 2B98A 2CLCX 1R10A 3CGGA 1UPFA 3OE7A 2RGGA 2Q6LA 3I1YA 2A0KA 3TKLA 1B0ZA 3AUXA 2MR5A 2G71A 4LWOA 3ISTA 2JFFA 3EIXA 2CVQA 3KOXA 1XA3A 1YZTA 3NUGA 4NU0A 5CVCA 3RVMA 2I4LA 3AO0B 4PR3A 4OL9A 1EM6A 2WF5A 5DB4A 3KZCA 4OK6A 2RI6A 3LHSA 5E7JA 4EENA 3MUNA 2CCJA 2WW8A 4B73A 3ONEA 2XRFA 4B7ZA 1IUNA 2RHTA 1LTHR 1F8YA 4QXAA 5FPQA 4ZEXA 3V80A 5HA5A 5LQCA 1NULA 3QNMA 4JHXA 3ILVA 4L57A 4NZYA 1ZU5A 4OU5A 4GBED 3UMMA 2FPRA 2I55A 2A2ZA 1ZSNA 4NBKA 3IAAA 3I9NA 2HA2A 1SKUA 1VB5A 1GQSA 3CNHA 4UXIA 1GFWA 4DA9A 4CLRA 4CMCA 2FPWA 1JL3A 1A69A 3QEMA 4JI4B 2VKTA 3WLHA 2ATEA 1MQSA 2GJKA 4RKFA 4CLRB 3QQPA 4WV3A 2ZJ8A 4C4AA 1Q11A 3QEMB 1WCXA 2QRQA 1WKBA 4CM9D 3IOCA 2VF2A 1SC1A 4MVCA 4C3UA 1EP2B 1PL7A 3PHLA 4YN3A 2P2GA 4M9RA 3A4MA 2WU8A 1OJLA 2XMPA 5KIAA 3GROA 4B0PA 2AT1A 4RVDA 3DULA 5CK5A 3S2UA 1TM7E 1KJYA 2QJTA 3FCXA 2AEMA 4KQWA 4ZZ2A 3KM0A 5AOCA 4KH1A 5IM4A 2JIMA 4IJ5A 2C5SA 5FBRB 3UGKA 1EDZA 4L8WB 2ZS8A 4FFSA 4NARA 3BD9A 3ZW8A 1RPNA 3FIJA 4RVSA 4FHDA 3RRMA 3IHWA 4CHTA 1Q17A 5DCLA 4EO9A 1K0FA 3WLLA 2REXB 2ZTMA 1NF8A 1GHTA 1XELA 4Q0MA 1QZ3A 3UVEA 4KLZA 1UKCA 4L85A 4IOMA 4WASA 4U0KA 1JA0A 4Z8YA 1XP8A 5LWQA 2QUJA 1ITZA 1EFPA 3UNXA 2WG0A 1YUBA 5ALIA 3SS7X 3O4IA 1I9GA 4I66A 5DXAA 1OFVA 1W25A 3H5WA 3RJ9A 5JLJA 3ZDAA 3P9QA 4HDOB 5BOSA 1M67A 1EFPB 4LYFA 3KTFA 2PWPA 4R2MA 3IEIA 4POAA 1UQTA 2B78A 3UOGA 3NRBA 1KI4A 3AESA 3L7IA 4FD3A 4CYMA 5BOSB 2FSIA 2AI3A 2OZVA 5ADHA 2OWDA 3CKMA 1M34E 1V5FA 2BE7A 3AESB 1YMQA 4WTOA 5J9FA 1H65A 2NU7A 3FCAA 2I6SA 1T9KA 2YQ5A 4F5WA 2IVFA 4GC9A 4B84A 3B48A 3C6ZA 2VZ9A 3I92A 4IXWA 1HTTA 2GM5A 1OGIA 2NU7B 4OGGA 4UMVA 4ZAFA 4JDPA 4LBZA 1LJLA 1UWLA 2CMHA 2HOQA 4JKYA 2K87A 5EUQB 4IDCA 5TS2A 5JJ5A 2QS9A 2VPIA 2HAEA 4XQGA 1J9ZA 6CHYA 3H83A 3QU5A 4D0SA 4GXTA 4P8RA 3BJEA 3RHFA 3KOZA 1JQ5A 3MJRA 3CZRA 4KTTE 1Y9JA 2QD2A 4LJLA 1Q92A 4PLVA 5DBOA 4ZQGA 4JXXA 4RMIA 5F7XA 4UPDA 1F0YA 5IKPA 2ZB4A 3LT5A 1RWQA 2JFHA 2NQ8A 5LNK1 3BBPA 2YJ5A 5DGCA 3IUQA 2ADMA 1A7UA 2NXCA 4KNVA 2FPXA 1LPPA 5EJMA 2A59A 4UZSA 3VI3B 1E6EA 4CV3A 4F3YA 3N7AA 4LYYA 2FPKA 5C9ZA 1OB5A 1Z12A 3CHYA 3B5EA 3E3OA 4I55F 1MIOA 2BISA 1THZA 3OZCA 1BO6A 3M4YA 1RWMA 4ZI3A 3JQ7A 1QFXA 2VYCA 4GXNA 2P5YA 4OFBA 1PZMA 1NM5A 3EVNA 1MIOB 4QDZA 4AN4A 3FXAA 5HJ7A 5I7RA 1D7AA 2AKYA 1PEDA 1NPYA 3OCZA 5COAA 5DBFA 3JQ7B 3R7BA 3QWFA 4CF3A 2BMDA 5BWBA 4YP0A 2WVJA 3RARA 4YA6A 1NNI1 1ZJZA 3QKIA 4Z4IA 1W6RA 1RYNA 4QNRA 4TSFA 3KKKA 4GH5A 4B3CA 3N70A 4HJXA 3IQWA 1GAWA 1XRPA 1AKUA 5AMXA 1AXRA 2Q21A 3EF3A 4BCBA 5IRCD 2MIIA 1XPOA 3NHYA 2W00A 4U2FA 2HJ9A 3G59A 5BXQC 3WA6A 3B5IA 2IOYA 3P9CA 4C30A 2WIFA 3SQXA 4JJ4A 2ZI3A 4BE4A 2MOKA 2P7HA 2YIVX 3MWFA 2Q49A 3MTAA 3QITA 4Y2VA 2AXQA 4XPIA 2I78A 2J85A 5HYVA 3NONA 4GPAA 4N03A 2C04A 1VE1A 1EXVA 5I9TA 5JEEA 2ACEA 4QUJA 4XPIB 4CMIA 1JHXA 3PJGA 1XJ5A 4FHZA 3LGXA 1DNPA 3ZNQA 3BJMA 3FTNA 4RL4A 3U61B 1PHRA 3C4QA 1NQVA 3DAOA 4CMIB 2ZJAA 4LNUA 1XPRA 1DRVA 4G67A 4IQ4A 2EFCB 2F59A 1URPA 1MZPA 1QFZA 3ZGOA 4YMIA 2GBGA 4BNGA 1GL3A 4LNUB 4QLAA 2CJFA 3WWEA 1NIPA 5I8ZA 4K9DA 3THRA 4I1PA 5K0LA 2YDYA 1Z06A 1QIGA 2JVIA 4C4RA 1DBPA 1X0XA 4TL6A 3EGOA 3EULA 3I9V6 5DHUA 1KGDA 2MSEB 3S81A 1L4FA 1DTSA 4DJ5X 4NONA 2CT8A 4TLAA 1OXSC 1QTRA 4I50A 1U0GA 4ER7A 4BMSA 5CB4A 3PUZA 1RHKA 5IZCA 2QLNA 3AERA 4I50B 4FOLA 3DKPA 3SJCA 2QLLA 2WVAA 3IOEA 3ZDDA 3VAZA 4XWWA 5JD4A 5CB4B 1U63A 3K9QO 3AERB 1Z83A 2Q1UA 4OB8A 1PJAA 1K5GA 2D1TA 3R3YA 1GCGA 2EZ9A 2EZ4A 4V0OA 3SZMA 5KOIA 3R09A 4AS1A 5FOUA 4TYYA 4AS2A 4GMKA 3MRSA 4L4XA 1ECPA 4K1LA 2HMWA 5GONF 5JNUA 3VKGA 2VWGA 5LOVF 1HZZA 1NXTA 5EFOA 3UK0A 3WO1A 4QM6A 3DLCA 1CUUA 4BVHA 5DNUA 1ZMRA 2C78A 2HLDA 2PN1A 4L7QA 3PNSA 4LVUA 5A3JA 1NXPA 2DC1A 2EHJA 3OPQA 3OO0A 1NVEA 2C88A 4J0QA 1NASA 1QZXA 4AG6A 3CEMA 3L8CA 1FW6A 3DJFA 5HPYB 1FP6A 1DSSG 5KAMA 3ILHA 1J2RA 1E1CA 4J0FA 1M8JA 2HTFA 3Q7IA 4BRWA 2AUNA 4YWJA 1B8VA 1VSQA 4OHMA 1GKKA 1E1CB 5ERYA 3UUFA 3GEMA 3PEFA 4PZEA 4UAUA 1M1ZA 1WEKA 3T3MB 3OM9A 4E2ZA 3IV9A 3M49A 5IKEA 1E2BA 2J9ZB 1PDVA 3URKA 3RYCB 2OGTA 4MGKR 5J4YA 3EQZA 3LT4A 4WZBA 4D0LB 4DV2B 1AS3A 1IG0A 4GOND 3RABA 1PX0A 3TTUA 1ESCA 2R96A 4URZR 4WZBB 3CLUC 2P0YA 4Y7CA 2REQA 4EPXA 1M74A 4LRUA 4P4UA 2ZVJA 3DE7X 2Q5LA 3ET4A 1N75A 1M1UA 1SPXA 2REQB 3OE5A 5DHPA 3AHFA 1B26A 3ZIAA 4Z1MD 2OGZA 4JVOA 4PC2A 3WDSA 4H7HA 4LTDA 2CYAA 2C83A 2ZANA 4GPTA 1W34A 5EPEA 3VZBA 4EHIA 2OP1A 2J33A 2ETXA 3ETJA 3V8MA 3VR0A 1NN1A 2OHOA 1SUEA 3SX4A 5IULC 4ND5A 1KRWA 5FEUA 1C1HA 1QWOA 3PFCA 4RTQA 2C2KA 4E5NA 5C5EA 3GLRA 5EG5A 1TYDE 3BXPA 1EUYA 4Q4CA 2FQ1A 4IQ0A 2YMQA 4MKRA 2Z0MA 4EHFA 4YAEA 4LCJA 4POOA 1LJ8A 3CN9A 1WXHA 3WKEA 2IH5A 1T2VA 4G85A 2FF5A 2WWFA 3ABQB 4Q18A 5LDHA 1XNJA 4EUKA 1KHTA 1T8UA 1E77A 4GL2A 1XZ8A 5E6UA 5E0KB 3KU1A 1X9HA 3E05A 4NHOA 2QQFA 4O3MA 2HFJA 2CFTA 4GI1A 5CU7A 5TS3A 3O8LA 2KW5A 3KUUA 2Z43A 4G0WA 1QOPB 4YRLA 5E6UB 1IHXA 4BTLA 1SHKA 2J6HA 4AJIA 3LBNA 2IYZA 5TMEA 3PPVA 3I2KA 4EGQA 5JS1A 3A1NA 5CTJA 4Z4QA 1KK1A 3NB0A 2R8EA 1JHPA 3DR3A 3H5OA 2XITA 3DFKA 4Q1BA 1O97D 4IDNA 2HFKA 2RCNA 4E22A 1KK3A 2BTQA 3H16A 5LYJF 3FBWA 1J90A 2B34A 5GM1A 4G1UC 2VSXA 3SLRA 3NV7A 3HJGA 3R3WA 1SB8A 2ASVA 2BTQB 1V6AA 5I7HA 4TVKA 4JB8A 1VKOA 1QAMA 3BIFA 4GSLA 4B4DA 3LQKA 4TUYA 2CNNA 1XCOA 3HA7A 1PNVA 5IC5A 2VR1A 3G5AA 1ZUWA 4EYQA 4I55B 1ZM4A 4TUYB 4RKRA 4EMBA 2Y1FA 3VNVA 1Y9AA 2QW1A 2JGLA 1Q20A 5L4NA 1FUEA 1ZI9A 4IJWA 4E03A 1GPDG 4Q3AA 5LIPA 4GNRA 1V3QE 1R9GA 4W1SA 2GXUA 2MYUA 2Q9BA 1DINA 1S2NA 3FVRA 2HXSA 4ARSA 1SZCA 5C1IA 5DNVA 2I1VB 4IQFA 2YX1A 1JR6A 1GUZA 2QNIA 2Y77A 1M6WA 3NVDA 1DL5A 1FVOA 2IODA 1NSTA 1AGRA 5DHAA 2R8ZA 2RAVA 1D4FA 4G84A 3VU9A 4YT5A 5JCZA 3QVWA 1YZHA 3DEIA 3FBGA 1R6TA 1O0BA 1Y37A 5JYEA 5LBTA 3BWCA 4P53A 2YJ4A 4BGVA 2OSBA 1RXCA 3VU9B 3HJCA 3SE7A 5I4IA 3IIKA 2ZRCA 4KSCA 1E1RD 4R0NA 4ZU6X 3FZEA 2Q1WA 4JV5B 3TG8A 4FUQA 4A92A 2QMUA 4Q03A 1R6VA 1O1YA 3RVPA 4PC3A 1X7XA 4P92A 3VDNB 1LW6E 3TIGA 2WZQA 2YFKA 3MINA 2IP4A 2P2DA 1X7XB 2CJYA 1PV4A 3SD7A 5FPSA 1JWBB 4Q9LA 1V25A 2X2OA 4QUDA 4DY6A 2G3YA 3MINB 4WXEA 1C9YA 4XUEA 2Q2NA 4P3XA 3ZGYA 3WGMA 2JAQA 3UHJA 2PH5A 1AKEA 2W2PA 5AJWA 4HMOA 1OZAA 1GT6A 2AMVA 4S3MA 2CXXA 3UQYS 4QECA 1OW3B 2R11A 4PZZA 3PHIA 3MAAC 2Q45A 4TKVA 3DW3X 3GVCA 4HGPA 4JT4A 1H22A 2ZQZA 2J3HA 2PVSA 2YWXA 2PU7A 3G0OA 6PFKA 4NMHA 1HDRA 2HF8A 3OZDA 2KBEA 1GG9A 3B3GA 4TKVB 2OHGA 3BULA 3H75A 3N8IA 4Q1FA 4BLWA 4MA0A 1TIKA 5FH9A 2VA9A 4E2WA 1A4UA 3GRZA 1H66A 2RG7A 2HXGA 2OYCA 3QWBA 4TWRA 3HVIA 3SYTA 1N0WA 3WAJA 4MJ7A 2RB5A 2V3CC 4M99A 3D0KA 1HDXA 2BDTA 4N3GA 3DVRX 3DBHA 1F4LA 2Z2IA 1X86B 1Y8RA 3RWOA 4PQYA 4CW7A 1KA9H 3ENKA 2X41A 5GONA 4L6AA 4QLBA 4IDEA 3DBHB 1CYDA 3BICA 3NI2A 1HX7A 3BQ9A 4FBMA 5GONB 2ZIFA 5WRFA 1MO3A 2QTVA 4J1NA 2J7KA 3BEOA 3WNQA 1CSEE 2K7ZA 5FOWA 4IEIA 4FEEA 4BJHB 2YRWA 1SVNA 2NV0A 5FPHA 5G4KA 3WJ2A 4AP9A 4PU0A 3WGUA 1L5YA 1P74A 4TLDA 4B1FA 1YJQA 1QE3A 3WTBA 1V1MA 3SC4A 3I4CA 5G1PA 3PGA1 4K9MA 4MCHA 5CXXA 1H2YA 5G4KB 2FFHA 3DZHA 1PEAA 2X0KA 1V1MB 1FA9A 2RIPA 4QBHA 2VEOA 4B8WA 3HM9A 1SEPA 4J4TA 3HGQA 1THTA 1YBHA 2FSPA 3TRDA 2W4QA 1E1QD 2EJCA 1ZW1A 3Q9LA 3L0DA 3TIVA 4H3VA 2W6ZA 1KARA 1KI6A 4LF4B 1SUCA 3T4PA 3Q8KA 4H6WA 4MVWA 4NE7A 1RXYA 4TYNA 1DQYA 1KI6B 4HX9A 1YK1A 4I5EA 5IC6A 1OBCA 5JT1A 2D13A 5JZ9A 1J0AA 3ZBUA 3WHPA 1EJBA 2BBOA 1RWKA 4FN5A 3IP1A 5CB6A 2H0AA 5LVAA 3AF0A 3HA5A 2BMJA 4HNRA 3PWSA 3ACCA 2EJBA 4OKNA 4EPTA 4JXZA 3QI2A 4IM7A 4WZ6A 2PZLA 3IR6A 5AVZA 1EGVB 1ODCA 3H4TA 2QVCA 3E2MA 3K6KA 1HTWA 1GQOA 2XB9A 4Q37A 4MIEA 3TD9A 3KVOA 1G3MA 1YRLA 2FEWB 1RQRA 2J4FA 4BYMA 1SKBA 4DV6B 2G7MC 1COWA 1GTMA 1ID8A 4K6OA 4XRRA 1CY4A 2YFYA 5FAKA 3UV7A 2IDZA 3MTBA 2ZAIA 1QRRA 4IIEA 1Y1QA 2OA0A 3R4CA 3RF6A 1NR5A 4YBRA 1IWBB 3K0KA 1YMUA 3NTUA 3OOWA 1WQ4A 2YL2A 3SR4A 1AD2A 2WLSA 2Z8YA 4YMTA 4MRNA 1KZGB 2QN8A 1YCHA 1XDZA 1VZ2A 4ABTA 3QVLA 1FTYA 1OWLA 1WRBA 1P4AA 1LFDB 4ZRMA 5J1TB 3M0EA 2AZXA 1HPLA 4JI7B 1U3VA 2NXJA 2DHDA 2H4FA 3CLKA 1L1EA 2H17A 3LGAA 4IGAA 1SXIA 4GP7A 4MR7A 1CUYA 3LHKA 4RHCA 3TQQA 4Z53A 3DMTA 3SOZA 3S8EA 3SBEA 3D7SA 3DHEA 3JU3A 3KD2A 4HN2A 4KK3A 4YONB 4MR7B 3EMDA 3F6RA 3FFAA 2JI6A 5HKKA 3H8SA 5L40A 3AIIA 3PNPA 3JS5A 4G1VA 4QX6A 3ZXIA 4DSNA 1O9GA 1FFBA 5HIMA 2P4HX 3OX2A 3AR9A 4L3VA 4JOBA 3TTVA 3NVAA 2CHGA 2A4KA 1OHHD 2PY6A 4MUKA 2NT4A 1NL3A 2C20A 4MQLA 2GDJA 3A3OA 5JAMA 2XOKA 2OAEA 2Q3HA 3F73A 2PX2A 2WF6A 1K2WA 2QLMA 2XPCA 5DLDA 1Z34A 4BP3A 5A7FA 3DL7A 4HYEA 1BN7A 1WSAA 3F6BX 1V3UA 4UMDA 2VSNA 4DWOA 5K2MA 4KE7A 1QCDA 3GT0A 3UK7A 1KNXA 1Z0DA 1DUIA 1PFWA 2RJOA 4B3GA 1TYAE 1CZOA 1LX7A 1F5NA 3FN4A 3L8EA 4MV8A 4X65B 1KGSA 2XF8A 1L5ZA 4NDAA 4DRZA 1V8OA 1GU0A 1V7PC 3ZZ1A 3OT4A 4EFMA 4DR6B 4MNTA 2FN9A 1J8YF 3I34X 1GA1A 2BJVA 3QIVA 3KEFA 1ZH8A 1WNFA 3HKDA 2DH5A 3M5CA 4IGFA 4K1XA 4BXOA 2IYFA 4DMFA 4QSMA 5IN4A 1YAHA 2ZUCA 3AYXB 4U5XA 4BLRA 1PLJA 3HKDB 1JHAA 1IH8A 4XRGA 4BXOB 2F1HA 5F5NA 1F6WA 1JQ3A 3UJ7A 1E9SA 3UXHA 1NAIA 4LKRA 1YQEA 1PR4A 3TW8A 1A4IA 4Y98A 1IQPA 4R40A 4L8FA 4S0ZA 3COJA 4BVAA 3QEOA 4KMSA 3VSEA 2PK3A 4PEVA 3T0GA 3TW8B 2OG1A 5TLSA 2IYYA 4AY6A 4O25A 4P08A 2J31A 3TEFA 4DUZB 2XKBA 3FLAA 3P9IA 8LDHA 3D0QA 2H2IA 2NVBA 3FHTA 1VMKA 4R84A 4LOIA 1JHVA 2R2GA 1UXIA 2XA9A 3BORA 1HLFA 5G0TA 2AG1A 2RK3A 3CVYA 1ZVQA 2RHBA 2C5EA 2IUTA 2V7XA 2XE7A 3HWSA 1AKNA 3DWGA 3PFBA 4XQ9A 2B4QA 1RJWA 2W2KA 3U81A 7ABPA 4YIHA 3JVUA 2PZJA 4HXGA 4X84A 5GTDA 1HT0A 1ZN9A 2EP5A 2W2KB 2PS1A 3FPCA 2LTAA 3HBJA 3KIPA 3L07A 1XU7A 1WV0A 4L08A 5ALEA 4BFTA 1W36C 3E9MA 1BDIA 1VRWA 4ND3A 1NUUA 4Y9UA 3ZCTA 5K20A 3E7PA 3D3QA 3G2NA 3P2IA 3PPXA 3ORYA 2PMCA 3COVA 4BNJA 1DJMA 2CXTA 1Q7GA 3WNDA 4ZARA 3FVVA 1JHQA 5EXXA 4JL6A 1UWCA 2ZSIA 3CISA 2ZUDA 2O57A 3O4GA 3OLCX 5JE8A 1VHWA 2WWXA 5JSYA 4OP3A 1RZ3A 1Z74A 1TUGA 1T1EA 4X6UA 2ZIVB 5JNRA 1K92A 4QG3A 1R0SA 5EP1A 1JWLA 1EU1A 3P52A 4ZI7F 4QQ8A 4X20A 3UA4A 1HGXA 1W4ZA 3QFTA 3URMA 1VCMA 3VDQA 3GGOA 1H6DA 4QICA 2PZMA 5FWYA 2A0FA 1BW9A 3QBTA 1JXQA 4X20B 3HPRA 3LBYA 2RAUA 2QUKA 2HK9A 2EGHA 1MO4A 5F23A 2YWJA 2JLCA 2JI4A 1JIIA 1BW9B 2TMYA 5FWYB 5TR9A 2YZMA 3KOOA 5JPDA 1R8SA 2QRLA 3DDWA 1IAQA 3QYAA 3OIFA 3QV1A 2CN1A 2Y0BA 3PFGA 4RPHA 5AD1A 3SVTA 4LX0A 4BNLA 2QVZX 4E0BA 2IBTA 4KFRA 3G2KA 1E58A 2IX9A 3S7TA 3KJGA 3V1UA 1TLLA 4S1WA 5DCUA 4DR3B 1WB5A 1NQ5A 2ZUSA 2BSAA 1OR8A 2VDJA 5I4CA 3DT8A 3TI9A 4LXYA 4OB6A 5T3YA 3A9WA 5FHQA 3H4VA 5JS6A 3QFCA 1JJIA 3C8MA 1QMPA 1YDGA 2XTMA 3AUAA 1XAJA 3C87A 1F1JA 1N5IA 3PP8A 2GZ3A 5CEFA 1IUPA 3LUPA 1EDOA 4QEDA 2HA3A 1MEEA 3WLQA 4G5RA 3ZIUA 3N76A 1UMCA 3KAKA 3DEHA 1JDSA 1YR9A 1ECBA 2A5FA 4WCDA 2FKAA 3B38A 1Z6AA 2IPMA 5CLHA 5FNVA 5HSGA 2GOYA 5K7SA 2VDUE 2XXAA 1UMCB 1HL3A 3C3AA 3KT8A 1MDBA 2FMFA 3HB1A 2HC9A 3OU7A 3B20A 1IIRA 1T8YA 2R87A 2VH5R 3OU6A 5FNVB 3QUCA 2WSYB 3PICA 4FLFA 2XXAB 4G37A 2P8JA 3L01A 3ZI0A 2IP1A 1GUYA 3I83A 3MTDA 3V7UA 1KQGA 1P8AA 1O03A 1NR1A 2FQYA 3U2QA 1KWGA 3MGKA 1FEZA 5H02A 1ZR4A 1J0BA 2ECPA 2PBZA 4JSTA 5CDYA 3PGVA 3DVAA 2X0RA 2QLJA 3OY7A 4H31A 1J2UA 1A27A 4GE0A 3RU7A 3QBJA 3EEOA 2EBUA 3DVAB 4HDNA 3I4FA 1R0KA 3A1SA 4XQEA 4B3HA 3LXMA 3D1VA 1ILEA 3ZWCA 1I13A 1B1AA 3CFYA 4FP9A 2MCFA 4GS5A 4HDNB 5I9IA 1GA6A 3W6UA 1BDHA 3P2EA 4L72A 2CXPA 1U3CA 1Z0ZA 2IY8A 3F3SA 5H7XA 1U2TA 2CXQA 3A26A 2VPTA 1PSDA 4FMDF 2W7TA 2A3NA 1Z4NA 2GXQA 3GCXA 1YTLA 4JQSA 3GDGA 5JNVA 1ONPA 1UBRS 5ES3A 2CJXA 2H48A 2XYHA 2GJ8A 2Q9CA 4H7FA 3P9SA 5HG0A 4DCPA 4OOFA 2H1RA 5JFGA 1O89A 3RUIA 1UINA 4Q01A 3DBVO 4U7PB 2O5EA 2QORA 2TECE 5IU6A 5IHXA 2JLBA 1DAPA 2HWUA 2ZVPX 4AQDA 5K51A 1G8KA 1JYEA 2ETVA 3KJEA 1KZYC 4Q9KA 3UCXA 4P3KA 2WTNA 1YRYE 3OTQA 5DTIA 1KYIA 5DSTA 4YJ2A 3DT9A 1Y6RA 3F1LA 3OWXA 3TCNA 2IPNA 3P0EA 4Y1FA 4MA5A 1GNPA 1T43A 3Q98A 3VYTB 4YJ2B 4R54A 3BWVA 4MWOA 2P6NA 1TJ4A 2D5IA 2OZLA 3A8TA 3GJTA 3ETGA 4N8DA 1NW7A 4WXYB 3V1LA 2XVMA 3CVWA 5BSMA 2F1KA 2DLCX 5AIBA 3OHPA 2OZLB 2ZYAA 4DS3A 2QT0A 3M6WA 2Y4OA 3EZ6A 2HJRA 1IHOA 1MA0A 5JATA 5M2QA 5E1OA 1C3OA 1GGMA 1UXJA 1JDTA 1X14A 2OC4A 4TZKA 2GYYA 1O94D 3KR2A 4RCVA 5IFKA 1C3OB 1P1IA 4A8JA 2IK8A 1P4HA 2V45A 3FNHA 5FX2A 3TD2A 3QJYA 3UJPA 4BO6A 4Z1OA 5IAOA 1SUDA 3NKVA 4A8JB 4R1QA 3VYUB 3RC8A 3VKHA 3N8DA 1OBHA 4J29A 1NXSA 2C5BA 4ZA2A 3NV9A 3UWPA 4CJXA 1T25A 1L9KA 2QMEA 2ZYVX 4LIPD 3QYPA 1O95D 3QSYA 2QE6A 2EFYA 3L3BA 2CXHA 3T52A 5KB3A 5FCDA 3ULKA 5EIHA 1LPNA 3NEPX 4QU5A 4NYJR 3NBFA 5ANRB 4DLUA 4LFCB 1OREA 3AR3A 2PRJA 1YHZA 4NG5A 4TKLA 3TTXA 4OLHA 2IEBA 4D41A 1M7HA 1Z18A 3C3CA 3KQMA 1Y5IA 2NWQA 2O0KA 4MYRA 3M7IA 1MPXA 5DYTA 2DFDA 5K8UA 5B36A 2Y1OA 1D6JA 1GRCA 1II8A 3G3EA 3DEYX 1U1GA 4HK4A 2WJAA 2YIDA 1QORA 3JZFA 5GJWC 1II8B 4L27A 2JJ2A 4BZWA 4J07A 1MT0A 2DR0A 1PR2A 4P4NA 4D3ZA 4R4JA 3SZUA 4RW0A 1D6SA 3AKEA 1H0HA 5CH5A 3RTAA 1NAHA 2GCIA 1VMEA 1UZMA 1OI7A 1N8KA 3MYRA 2QTGA 4CDMA 5DYIA 1OVMA 4DNQA 1UC9A 1FXWA 1VTKA 2H4HA 2KBFA 2NN3C 1CBUA 5KNDA 1UBFA 2Q4BA 4M1QA 3NMUF 1PJRA 1S1CA 5LC1A 1Y9DA 2CLLB 3F5QA 1GARA 3K70C 1KJ9A 3CZ9A 4QAJA 1Z33A 3RBZA 4WIAA 5IARA 3K96A 1XKTA 3Q5GA 3A3KA 1Q0SA 1EB9A 4FZJA 4P80A 4QEKA 3RJTA 1LQ2A 3UUGA 1UJBA 4FDAA 2NUTA 3WNBA 5SYNA 4WINA 4DSAA 4EY5A 1P44A 3TZ6A 2NUTB 1K88A 1VB3A 4ZOEA 3I52A 5KU1A 1FIUA 4LF8B 2A33A 3FKJA 2ZWOA 1Z6QA 3NW9A 4H6XA 4PNPA 4UUMA 1RZUA 2PKEA 4WLVA 1Z5ZA 4ZCQA 1PJLA 4OBEA 1VHLA 1OA0A 1VQ1A 3PDUA 5ALLA 4ISBA 1GSHA 1R7RA 1FFSA 3MOSA 4IDAA 3SN6A 4QM7A 2BCEA 2PTGA 4EVQA 1VI5A 3L93A 1K6IA 1OBOA 4TOIA 1S96A 6GPBA 1A5ZA 4EG1A 1YJ8A 4ETWA 4EUNA 5CEEA 4Z9BA 1M72A 1FNSA 2O3JA 3IPRA 1VBFA 3C3YA 5TX7A 4DADA 4UHJA 1E64A 1SBZA 1O6CA 2JJMA 3F1KA 5JCXA 4L9RA 4LJ5A 5AM3A 5A5VA 3SEFA 1I7SB 1XTZA 4KXUA 1PR5A 1U7ZA 1E8MA 4PF1A 1KEKA 2B82A 3IBYA 2GR9A 1AG9A 4OMCA 3TL3A 4ZT6A 3W06A 4BBJA 2IZ5A 1KJZA 2IEIA 2GBCA 3ONVA 4FT2A 4BC0A 3QXJA 4D92A 4YGXB 1NE7A 3TMYA 1NOKA 1KKMA 3E2PA 4ZRNA 1GAJA 3EZ7A 4FYXA 2SKDA 1UJ2A 2QPLA 3THXA 2B92A 2X9NA 3EK2A 4KXVA 4BB0A 2YVUA 4KHPB 3GX1A 2QAGC 4QE3A 3HYLA 3THXB 4RH1A 4DJDC 2VF7A 4AY4A 4MYTA 3OUTA 3D7KA 4KO4S 5IAJA 4PWZA 5JRJA 1X13A 2PZAA 1OAOC 3WISA 3OM0A 3ST7A 4EY7A 1GGEA 3ND8A 4V0NA 1Z15A 1IYZA 3L0YA 4F4UA 1BROA 5JAZA 3DFZA 3Q1KA 2JBAA 1DKUA 4XIGS 5AK6A 2ZRLA 3O95A 3PSAA 3PEUA 1FRFS 4I8DA 5EHNA 5FFNA 4PC7A 1PQYA 2I3DA 3GYBA 2JBAB 4Q3DA 1LFAA 1GPKA 3U48A 2C2YA 3NIWA 3C6BA 3B7GA 4LDNA 2QQ5A 3CLRD 3PHGA 4KZKA 2PYDA 8ATCA 1XD9A 4HD8A 5AI5A 5MFPA 3TKYA 3USZA 2VJBA 4MI1A 2H3HA 4EUEA 2UUBB 3IURA 2WHXA 3ONWA 4PBRA 5AT1A 1T3GA 1XCLA 5FXMA 1ADCA 1JLRA 1GPYA 3LP6A 1TT5A 1J8DA 2B7LA 4QGFA 4EI2A 4FZ5A 1DZIA 3VHLB 1TT5B 2R7AA 1TD1A 4JLAA 1CUFA 4NS4A 1AIPA 2H1VA 3T9BA 2CD9A 2IYRA 3ABZA 5KVQA 1JI3A 1V8ZA 1KDPA 2J59A 2OQ2A 2V65A 2WUVA 4X3PA 5AJVB 2BEKA 2QM0A 2Y76A 2DT5A 2Y9MB 1JH8A 1WUTA 1G21E 3HQ4O 2JGAA 2AD1A 5ECGC 4EYOA 1Y1LA 3VJMA 1E2MA 1INLA 3DQQA 4ARIA 4EELA 5ADWA 2PS9A 1P5RA 3OUZA 3WMEA 4OP1A 4IX1A 4MR9A 2QTFA 1DB3A 5CXUA 4JB0A 4X60A 4XTRA 3TS1A 2V9PA 3P8ZA 2XZTA 3WQBA 4EUFA 5HRAA 4ZICA 4TXJA 4MR9B 4QOFA 5J59A 1S02A 2HNAA 1U31A 4TL7A 4DV0B 2RGNC 2JKVA 5P8WA 4DLTA 3S6JA 4M88A 1XDUA 4LHEA 5LZ7A 3AEXA 1ZWKA 5ALGA 3RR2A 4Q4DA 5CLFA 2EEZA 3H3JA 3K35A 1NKTA 1YVEI 5FIUA 5H3CA 3G49A 1SEVA 1VECA 4MV4A 1ST2A 3PXUA 4OJTA 1KAEA 4BKOA 1FNNA 1QQBA 5BSFA 2YNMA 4BGIA 4XCVA 2BFDA 4JENA 2DQYA 3GHHA 1TEVA 3PKJA 2O4CA 1U0FA 2WWHA 2YWHA 2BFDB 4JC4A 5BSGA 5FTNA 1JPJA 3K8ZA 3TIFA 1ODLA 2N3ZA 2QY9A 3D3JA 4ZC1A 4UUOA 5GJVC 1L5VA 3HO6A 3T94A 4KQMA 3MFYA 1U7PA 3PHJA 1DXOA 3CRNA 3M82A 4E5MA 1DG3A 1YR6A 2OUKA 1ZD1A 3I6QA 4IHJA 4ZQIA 5JASA 3CH7A 2YV1A 2IWRA 1B42A 4Y1EA 4CPDA 2ZJ4A 4IHJB 1DS6A 4KACA 4YRBA 2QYSA 1J7KA 5J2UA 4MYDA 5MF6A 1I24A 3OF2A 3ENZA 3H3XA 4C0HA 3EYWA 1QAQA 1NR7A 1F48A 1FTSA 1XDSA 2HT6A 3GB9A 1ISRA 4FEAA 4WXHA 1BD3A 2DP4E 2VHZA 4J1QA 4WN9A 3HCAA 5J2UB 5JS2A 4FW9A 3U1VA 2BHSA 1GL7A 4EJMA 3H5AA 3EF0A 3ESQA 3AXTA 3DMNA 3ZWMA 3AI7A 1AS0A 1PO7A 5KDDA 4WN9B 2QIPA 2R8PA 3VVMA 3DSRA 1CG6A 3VKUA 1HC7A 1W48A 3SSOA 1XMVA 4AJJA 1QGYA 5CD9A 2P9ZA 2HPHA 1UJMA 1T2NA 2ZULA 2D7DA 3ERCA 4GICA 3IT2A 3OX1A 4KV9A 5EJAA 2O0MA 5L53A 2BGMA 4IHQA 2ARKA 2F3TA 2W2QA 3KLMX 5JDCC 2P5TB 4BPBA 5IEJA 4DM7A 4G5FA 1X1QA 3QXCA 4D82A 2NTNA 2OZEA 2V3WA 1C9DB 2I6UA 1Z4PX 3KWMA 3MRVA 3WJ1A 3WAKA 1HRKA 2AYYA 3AR4A 4OYRA 4NVRA 1C81A 4I5GA 4F8EA 1KAQA 1MAWA 1A5SB 2AG5A 3GBVA 3T9CA 4BWGA 2PGDA 5T6BA 2J9RA 2JIZD 5EGSA 2OHHA 1KAOA 4UXJA 1OFHA 1WE2A 4WH0A 4MLZA 1C9MA 4K3VA 3IYLW 4RK4A 1CNFA 3VTFA 2Q5HA 3AZOA 2QAIA 2M6LA 2B8WA 1BYUA 2G7ZA 4KOEC 4XUCA 1QO0D 4HS4A 4P3OA 3UH1A 1QZTA 1V2HE 2XSZA 1ZRNA 4FDVA 4BWYA 2O59A 4CM6A 3BMQA 3CF0A 3VO8A 4O4HF 3TRHA 1T0BA 3EARA 1KJJA 2AN5A 2EGUA 2NSJA 1GZ4A 3BMQB 2WHRA 4MYCA 1G2OA 2IXDA 3I6MA 2I33A 5K9ZA 1LRKA 1YZGA 3DCYA 3GAMA 3O4VA 1CJVC 4XYEA 4ZEOA 4ALMA 4ENPA 1HETA 1M2EA 4KQCA 4W1QA 5IUKC 2RBGA 1JEDA 1UXKA 3PQCA 3D8NA 2VXBA 5CRIA 4H1WA 1J21A 3DXZA 4GXQA 4MR8A 3W0LB 5KTKA 4ZCTA 1NVXQ 1N2HA 1B43A 1X7ZA 1Y4UA 3A70A 3IEKA 4HH0A 4ND7A 1XDDA 3EODA 4U7TB 5AM4A 1XTBA 2OXRA 2I2FA 1I3NA 2CEAA 1BG6A 2PFKA 1X7ZB 2H1CA 3ETCA 4MR8B 4O08A 5I7AA 4NBRA 1VP9A 2WVGA 1PD1A 3FKSD 1DAEA 1ZUD1 5FWDA 1YUNA 3BXXA 2B4TO 3RNOA 1I2MA 1SC4A 4TL8A 4Z8XA 4Q7QA 2JW5A 1UDRA 3BIOA 3FYUA 3AUSA 2PMKA 3CR7A 1U2GC 3EXG1 1QG0A 3KQOA 4HWOA 4JX9A 4LN1A 1N8NA 1E63A 3KCNA 4C0SA 1PP4A 2D1QA 1CR0A 2TMDA 3BPSA 3DTNA 3FYUB 3VTZA 2BSXA 2DUUA 3H99A 5J58A 2UVDA 5TMPA 5I4KA 1QG4A 4OQQA 3A1WA 4MW0A 4UUBA 4NECA 5KQMA 4UREA 2DPGA 4R8KA 3GIDA 3C5VA 4FT4A 3F90A 4BMVA 4DF3A 1LLCA 1UQUA 1OFTA 4L16A 3WLFA 4EJ0A 1RLIA 3MIIA 3U13A 2GKOA 3DOUA 3WBBA 4BVLA 2VKQA 3CX3A 5KYVA 1ZGHA 1TE2A 3OZFA 3RM3A 5JRZA 2I1WA 2GESA 3IQXA 4FHGA 4BRUA 5F2KA 4Z0HO 3WXMA 4H3SA 2ZRQA 3AY3A 4HDCA 5D5PA 1GSOA 3ZHZA 4CQJA 3IO5A 5K3AA 2ERXA 1YR7A 1Y1PA 2AI1A 1ZK3A 1MLDA 1PNQA 3I5UA 2FK7A 3IBFA 1TC1A 4HF7A 5EMLA 3RGWS 3VGPA 2GZHA 3EG5A 3NWBA 2PCLA 4G07A 1ULUA 2YIMA 4LBYA 4J7CA 5EIBC 3AW8A 4CKCA 4E2XA 1RI2A 2HR1A 2QNBA 3ODPA 3ACDA 4I9UA 3QJGA 4MHSA 4CKCB 2FPMA 5B3AA 3SS8A 3GYGA 1YE5A 4DY4A 3OTOB 1IPFA 5JD6A 4RDXA 3NM4A 4GMDA 5C53B 3N87A 2CK3D 2WIGA 4BBPA 1U0SY 3D7RA 1HO3A 2ODPA 4IFBA 2GVNA 4QPNA 5AVVA 1Y6FA 1VJ0A 3R5FA 1NT2A 3R9XA 1YZ3A 1XZIA 4MQ5A 4L8YA 4YJGA 4Z86A 5IVIA 3R9XB 4F3CA 5D84A 4JJ6A 5H68A 2H08A 4YUWA 1CUGA 4YJGB 2NTEA 5EA2A 5EJ4A 2IIQA 3O94A 4ZODA 4CN9A 1SD5A 5BWNA 2D0IA 4W6ZA 1Z26A 2F3UA 1ZGCA 1UC4B 2YW2A 1PCXA 4UNPA 4OAQA 3KXPA 5EKSA 3RAPR 3RSHA 1YNSA 4DIOA 2BD0A 3OP1A 4E6PA 3B12A 3DEFA 4CU5A 3D2LA 4LI0A 4R68A 1RCFA 2V5VA 5M34A 4WY5A 1GL6A 1X1CA 2QTCA 3TLMA 2BFWA 1B73A 3C7KA 3SM9A 3PC4A 3WGVA 4CF5A 1YA4A 3OP4A 3P0IA 4C5CA 1GPNA 1ZN2A 4NK4A 2IT1A 3ROKA 4DCGA 1J1ZA 1MX5A 1E2KA 3ASVA 3OOJA 1WSWA 1Z5WA 1O9HA 2H4JA 4O3FA 1FSSA 3DD5A 4NABA 2WK1A 5CHYA 5G4LA 4DPLA 5BY2A 3CLSC 5LMCA 4S1PA 2GYUA 1ZHHA 5T67A 4BP9A 3DPSA 4YRSA 3REFA 2LBPA 1UZAA 3O38A 1QHHA 4OX9B 4DCMA 2CHVA 2C9MA 3FDZA 2JJ1A 4EGFA 4OJYA 2G25A 3AC0A 1QHHB 2AB0A 1CDDA 2VJQA 2NZXA 3FDZB 3KJNA 3NOQA 4RSHA 3DH0A 4IP0A 5L95A 3BWDD 2AF4C 2BKAA 1HG0A 4D9HA 2ALJA 3U4MA 1B2RA 2AOTA 1IY8A 4EW1A 4N6GA 4Z0NA 4HEHA 4R51A 2AOTB 2Z6VA 4G5YA 1GU7A 1GRRA 2CFIA 2ZBEA 3KEQA 1NGSA 1DIRA 4H08A 4P4TA 1USVA 4W63A 1GD1O 5DGTA 4PPGA 4YCMA 1NU8A 3P5BA 3TZQA 3WQHA 2IHKA 2VP2A 2R6GA 2C1XA 4AIRA 5JQGF 2A9OA 2WJGA 4WOPA 3G7UA 2EKBA 4KLRA 2GERA 4CRWB 5A2GA 2WNHA 3MWEA 3DE3X 1C7ZA 1IOZA 1P0CA 4F93B 4I4TF 1YAJA 5KYKA 7REQA 1U0LA 2ISQA 3D5QA 3WJAA 1IPEA 2R1ZA 3GL9A 3RC1A 1XRLA 4DG9A 4BTVA 4LXQA 4URFA 7REQB 2YZKA 4MZXA 1EA7A 5TQ0A 3T4UA 3DOHA 2M6RA 4JLJA 4EABA 3ER9A 4II2A 3O9MA 2RGRA 5DGXA 4M1EA 2JH3A 1MRNA 1SU8A 2FUG6 3I53A 1RKBA 1DDIA 4JD5A 1HKUA 1XTJA 5KOHA 4DR5B 1NJ2A 4CL8A 4G36A 3Q5DA 4LZWA 4G4GA 2BIFA 3OESA 3U7FB 1DCTA 3OTGA 4PLGA 3B1JA 3IVGA 3JQFC 3C70A 3LY7A 3GFBA 4N9QA 4U9IS 5IMSA 2AQ8A 2X5KO 4HX5A 2JCSA 4P0PB 2NVWA 3N0TA 2E4ZA 3AEQA 3BDAA 3V4ZA 1XPUA 1R0RE 1C5KA 2YV5A 2RB4A 2VDOB 3QVXA 4IRXA 1CEXA 2X1LA 2XB8A 3OEED 3ZCXA 2C95A 3C85A 1RD4A 1ZEJA 3AEQB 1JR4A 2ON6A 3IVXA 4J90A 4Q7EA 4WLEA 3PGMA 2ECFA 1UUFA 3D8SA 4URVR 4H4EA 2HRQA 4ZV9A 4N4AA 2RGWA 1FDOA 6REQA 4KRGA 4CVNA 2B8EA 4PFJA 3BB4A 3COPA 3PNMA 1GA4A 1MB9A 6REQB 2Q6VA 4UHBA 2O1XA 4KE6A 1DDGA 3V55A 5KSWB 3A04A 4QIHA 1J0DA 4RF4A 2I6TA 5J4KA 1PJ2A 1D6MA 4FCVA 3KHKA 2O4UX 4QC2A 5JXGA 1JA1A 5ICSA 2CSUA 4LF6B 1QVZA 2VZ8A 4LK3A 4PGGA 2IXEA 1ZIPA 1K4KA 5F5LA 2ZVQX 4D3DA 4ZCIA 5K6RA 4RSRA 4NBUA 2WTAA 3DPIA 1MN6A 1OJ7A 4PAOA 3TXXA 2D8MA 2QQEA 4CM3A 4E51A 3SIPA 4B35A 4IKPA 2OBNA 3EBLA 3OMXA 4OH7A 1EHIA 4NY1A 1HE3A 5KHLB 4FJ2A 1BAPA 3ICQB 3OFVA 1N34B 1BX3A 4DREA 1AKRA 6ABPA 4J1TC 5K8VA 3PIRA 4CM8A 3M34A 3I01M 1UZUA 2FW1A 3G0BA 4YFYA 5BORA 2D2EA 4QVKA 4R3UC 4CM8B 3JRXA 4MHTA 1AGPA 3WE7A 1C7IA 2ACWA 1V9SA 4BMOB 4CLOA 3A6DA 3JYLA 3O93A 4BLPA 3OFSA 2WMOB 2X9GA 3AF4A 4YR9A 1PGJA 1RI1A 3QKRA 4HNUA 4EOGA 4GLBA 5GZ6A 2AMLA 2INGX 4IIGA 2PNJA 4CLOB 5H9VA 1I1OA 3I05A 3LC1O 1FX1A 2P41A 3G7SA 2OTCA 3QKRB 3RT7A 3WV4A 5LMNB 4A36A 1PWHA 2OILA 4BE9A 1T8RA 1EKXA 1X1AA 3PLAE 3R1IA 4C2AA 4E46A 2PKRA 3KRTA 3BF7A 4YAKA 1OI2A 3NETA 1YDHA 4Q4JA 2VHJA 2JGKA 4D6XA 5KKAA 3NASA 3OM8A 3WIDA 4IWXA 1TZ2A 1DP4A 3B6IA 4Q4JB 3KCQA 1MAHA 3AFIA 1W87A 2DG2A 4QVIA 4DV7B 4AO6A 4IOKA 4CL3A 3RADC 1QHIA 3LNTA 1FQKA 1NXWA 1I0IA 1R8QA 2FRDA 2WKSA 3FSGD 3D3WA 3G2HA 1FYWA 4IXDA 4PZ9A 3K6SA 2JLVA 3DGFC 3ZGVA 2PANA 2I3AA 3W6ZA 1J2JA 3I0MA 1HNWB 1X3SA 3D3WB 5DM4A 3UY4A 3K6SB 4RLFA 1V8PA 4LHSA 1TM3E 4PW0A 3NAMA 2WTBA 3K0CC 1ATIA 3SKXA 2DCMA 2VRWA 4FN4A 4YQFA 3IPYA 3H5TA 3PNYA 1LDMA 2HT1A 4EAQA 4AD8A 1BHJA 1X70A 4M0CA 3RSFA 1VYVA 3E5MA 1Y5MA 4C4PA 1TAHA 2W4MA 4D8YA 1FP7A 4CL2A 2R7KA 4JQCA 3GZNA 2FG7C 5DNAA 3DNMA 1RLMA 1DJNA 3U7EB 1YS2X 4F2DA 3GLTA 1IJEA 4I9GA 3QVKA 1TI7A 1RU3A 3DNPA 3GCWA 1ABBA 3LZCA 1MMFB 3VVBA 3L82B 4UU8A 1PYDA 3K4PA 4DT1A 3RS2A 5K4HA 5IYZA 2C4UA 4COOA 4E70A 4EA7A 1T5DX 3IVCA 3VJRA 1NKVA 1K6JA 2X86A 5H3LA 3OD1A 3UIEA 2ZLBA 4CQLA 4DT1B 5IYZB 1U2EA 1PTKA 1NZJA 4CQLB 4DDKA 4JYBA 2QE7D 3M1YA 3SU8A 1IY1A 4RK0A 2O8EA 2R7LA 5DRYA 3VPBA 5CA0F 3TRFA 4P2BA 1DWQA 4TMKA 4DRYA 3DB2A 5CNKA 5F76A 3RFTA 2OCLA 2WB4A 5BN3A 4IUCS 2O8EB 4QBGB 1W0JA 1U2RA 4HDKA 3NHZA 3TMKA 1RXVA 2I62A 4L5YA 3GLIE 1P9RA 5BN3B 7GPBA 5FD8A 2WM8A 4HDKB 1KY2A 3HNOA 3MT8A 4RH3A 5HR5A 2VQDA 1BE0A 2WU4A 3H5LA 4MS3A 4TMZA 4UFOA 4X97A 4UNRA 1HEUA 3CYFA 5DEOA 4WUTA 3J81A 3AVYA 1DIGA 4HAUA 3TB4A 4MS3B 4OI1A 1FX0A 3W8FA 2FSSA 2QMQA 4IL5A 1AZWA 3JR7A 4ARAA 1W96A 2OOSA 3GJZA 2O2IA 5LKRA 4YDQA 1O9BA 1FX0B 2GZ1A 4OQFA 2JZNA 5FL3A 5D6NA 3EJWA 2WTMA 2ZSEA 1YA6A 1L5SA 1H4SA 3KX2A 1MG5A 4RXMA 2PH1A 1SXJA 3MAJA 3EDYA 3DM9B 4R6WA 3INGA 3K9FC 3RJMA 4ZCRA 1WBBA 3ROGA 1V5IA 3DC7A 4C07A 1OQAA 1SXJB 3HBNA 3UBMA 3ZWPA 4WFQA 4ZAXA 5JHGB 1T1IA 2HF9A 4V24A 4E94A 3NJ8A 4ZVTA 4KB5A 1V1JA 2ZETA 1L3BA 3H5RA 2JJYA 5BYJA 5U1PA 3PYLA 2PL5A 4GZMA 2GNPA 4IDGA 4W9MC 1E20A 9GPBA 1RWPA 4A8PA 3G5MA 4J94A 2DWUA 1D03A 2IVZA 2HPZA 2AI2A 3BMNA 1QO7A 4MPRA 4IGEA 1GRNA 1G5TA 4AJNA 1K8YB 3CW9A 3AFHA 4TMYA 3ZW7A 3LDUA 3BMNB 2XUPA 4TVSA 3ZW9A 2O5VA 1JFFA 1OTYA 3HSKA 4QTUB 1JJVA 2I2CA 2YV3A 1ECLA 1LV8A 3CQ9A 2LE0A 2IV3A 3KXDA 4CL0A 2JLUA 1JFFB 3QE2A 4MV6A 4Y2JA 1M5RA 5AK5A 4MVJE 1ZGZA 5LA6F 3TH5A 1QIEA 1E96A 1VHQA 3LVRE 1GFZA 4E5PA 1FMJA 1L7DA 1CKEA 2KS6A 5BR8B 1T91A 4DTIA 2R84A 1NRJB 3MNFA 4J0EA 1RYMA 4KJXA 1T2DA 1MO2A 3ZV3A 5DP2A 1C1XA 3FMPB 3IALA 4A0GA 1E32A 2NNWB 2A0UA 3WZLA 3PNVA 4IFEA 1P9WA 1TNDA 1Y3HA 4ZKEA 2PL1A 3S2GA 1C1XB 5GJBA 3K6JA 4G0ZA 3FDJA 2I7CA 2RMKA 1K8XB 3H2ZA 3HBFA 3NRCA 5AJXA 2AMYA 3CM0A 3DVSX 4B3JA 4CV1A 2JZOA 4AZWA 4LWZA 3TJZA 4TYWA 3HCPA 3B5JA 3ORSA 4NYIR 1Q1AA 3PPYA 4CIXA 1F4PA 4HQKA 2X6QA 4D8XA 4MRVA 4G1BA 2IU0A 4KXYA 4MDYA 3DTVD 2OVBA 4O4JF 4C2UA 4BAGA 4WDQA 5LP1A 4OXQA 3M89A 2QD5A 2VUTA 3M4NA 2ZEJA 4ZPXA 5A9TA 3ZUGA 2QUBA 5HMLA 1M2OA 3IAXA 4E12A 2CNDA 3S1LA 1Z0IA 3GDFA 4Q93A 3VPSA 3KZ1E 3O90A 3PNQA 2GN8A 2PTHA 1JDPA 3ICOA 1YBAA 1M2OB 4I1IA 4Z4FA 1KFKB 1FCJA 3HH8A 1VHTA 1O87A 5B3JA 1NP6A 2YBEA 4IUYA 1ZC4A 3FFTA 4HBZA 4DLWA 1EJ0A 2I2WA 1MO5A 3B6EA 3LECA 1QE5A 2FHPA 2EFEB 1V5WA 2VHTA 4MUAA 2NMVA 3H5IA 3HXPA 3QFSA 3BGSA 4RHFA 4XLTA 2E82A 5E4TA 3RSCA 3SK0A 1ODSA 2SKCA 2QJOA 3BXZA 2Q46A 1W94A 3TLGA 3GUHA 2VNAA 1LNSA 3KUDA 2C2OA 3TCXB 1G21A 2G17A 1XZAA 3SF0A 2VOEA 3SHFA 1Y1SA 1KAHA 3BGOS 4HLCA 1GAEO 4R05A 2WJJA 3RHZA 3TLGB 3VC2A 1VC2A 3CZAA 3RIHA 3X1MA 4YRNA 5D1HA 3MK31 2R86A 2FFQA 2RHWA 2R6FA 2AEEA 3GPLA 1PT8A 1YC5A 2IYNA 3GBPA 2I4NA 5DOZA 1N2SA 1Z17A 3TGWA 3WSWA 3WG9A 3ZZNA 4QT4A 1ZJ6A 5EHXA 3AR7A 1C4WA 3EGXA 1E6KA 2XH8A 3DYIA 3HWX1 1EX6A 2MSLA 4MTCA 4X41A 2C29D 3TDKA 4C1NA 5ITSA 5EIAA 4DLNA 3EGXB 3VSDA 2O50A 3WL3A 1JIKA 1FMCA 3HWWA 2BI7A 2XRMA 3S4YA 1A9SA 4XFKA 2NVUA 4KSYA 1W581 1GZ3A 1WZCA 3OC6A 3U4IA 4L0MA 3DZJA 1J00A 3VU1A 3DDHA 4RX1A 2FQWA 4KZPA 3DHWC 1DIBA 4N0EA 1Y3IA 3EGWA 1AUXA 2BF4A 4PHFA 5ICFA 4BJ6A 4F1WA 1NOIA 3JQAD 2K5UA 3KBOA 5LXTF 2IYLD 3C14C 3IQGX 2XVXA 3NHRA 3FROA 4R1TA 4E5SA 3GZJA 1P72A 3EDRA 4B2PA 3USCS 1U3DA 2XXJA 2FRVA 2QN3A 3FDIA 3GNTA 1W30A 1CUXA 2H29A 4NBSA 3GLGA 1APBA 3AG6A 2VZ0A 4MRPA 5SICE 3WR5A 4DUGA 1KDTA 3PCXA 1TB4A 4H17A 3GLGB 1U0HC 1YJCA 1XN1A 3H9JA 5HFAA 5J5AA 5BMVF 3S68A 1NSFA 3UF0A 4BNKA 3NBAA 5EJ5A 4FSXA 3KETA 1C14A 1QDUA 2FN4A 1TMKA 2GK3A 2KWIA 4FR5A 3WK8A 3MJHA 4DYVA 1XHEA 1P2TA 1R4AA 1S7GA 3RUHA 3FTPA 4A03A 5FB3A 1W2WB 5DDIP 1FUUA 3K94A 5FA5A 5D51S 5EJIA 2HX1A 3W9SA 5JYBA 1XEWY 2PGLA 1FDRA 1VCOA 2Z09A 1G3RA 1OGYA 3GFQA 1JBKA 2ICAA 2I4OA 1WMDA 4GO1A 4S24A 1J7JA 2OXIA 2V7PA 4LF5B 3RQIA 1L5QA 2O1SA 3GMTA 3WZ2A 4EPRA 2XECA 2C5HA 2R751 4MUJA 1V47A 3SCZA 1T6BY 1H6AA 2PS3A 3IJRA 3ZTTA 3ZWBA 5K5EA 1DAGA 2QL9A 6YASA 1J99A 3QBDA 3G68A 2E9SA 3T8YA 3PQEA 4OYLA 1W8IA 3U7QA 3R0ZA 4DDVA 2PKYX 3HZRA 2HEIA 4Z0TA 1ZJ4A 3QPUA 3S2YA 3VBCA 3KJFA 4FGLA 1PLKA 4D7AA 5KX5F 5EJFA 2LZ0A 3U7QB 4LZJA 3ZJVA 3GEEA 1KS2A 1Y3BE 2HA4A 2WE8A 3N2IA 5M3BA 3UKJA 1GGVA 4JDUA 2DAPA 2QW8A 5B3LA 5ICCA