5CFLA

Crystal structure of anemone sting (nematostella vectensis) in complex with 3', 3' c-di-gmp, c[g(3', 5')pg(3', 5')p]
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
187
structure length
187
Chain Sequence
b'GSNVADGLAWSYYFGYLKFVLPELEKQIEKTSKFRSKEKFVKKMFILIPSNCFWDDKIPGSDYDPQNRITFEGNTEPLEKTRGGVFLRHYKHSVYEIKDGENEPWFCIMEYATPLLTLYDMSVAQPGELSREERDAQVVVFLRKLQDILEGDRACQGKYELVTFSPDRDLADVMLRKLKDSELEIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Stimulator of Interferon Genes
publication title Ancient Origin of cGAS-STING Reveals Mechanism of Universal 2',3' cGAMP Signaling.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Immune system
total genus 53
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cflA02
4YP1A 5CFRA 4QXOA 4JC5A 4LOHA 4EMTA 4QXPA 4F5YA 5CFMA 4EF4A 4LOIA 4QXRA 4KBYA 4EF5A 5BQXA 4QXQA 4LOKA 4F5DA 4F5EA 4KSYA 5CFNA 4F9EA 4LOLA 4F5WA 4F9GA 5CFOA 5CFPA 4KC0A 5CFQA 4LOJA 5CFLA 4EMUA
chains in the Genus database with same CATH superfamily
1NW8A 1P5JA 3BXOA 1GYRA 4II2A 1GLNA 3UUEA 1WCWA 5CDHA 1KPGA 3GRUA 4XJTA 2CLSA 3EULA 4DQLA 1K7FB 4I6JA 4JCCA 4YJHB 3K15A 5D5PA 4B6RA 5D87A 4Q16A 4YT5A 1ZRHA 2VZ0A 2WZDA 1EZ1A 2AEEA 1E1LA 2H92A 2KSQA 2OHXA 3M3PA 4RVDA 4D4JA 3MZ0A 2I55A 3ND5A 3RFVA 1WP9A 2ONCA 3I52A 4M46A 4HSEA 3HGQA 4RV9A 1DV1A 2Y1FA 3CF4G 3DO6A 3TW8B 3H4MA 1N7JA 2DZDA 4QGSA 4QHSA 1U7HA 4LHZA 4ZV9A 4M1QA 1CP2A 2P2CA 1I4TD 4WLNA 4L74A 2CLCX 2WYVA 4MUBA 3SPXA 4C2UA 1L4UA 4KRYA 5EXDA 1XF1A 3FD8A 1SHKA 2KYRA 3TRFA 1CR1A 3EIWA 3EGXA 3O4RA 3F4BA 2GHQA 1XDZA 3AF6A 3AF3A 2VEOA 5IPFA 1MJFA 5IC4A 4R9SA 4RCZA 2X7HA 2AR9A 5I4IA 2O8EB 4LI0A 1NOIA 2AN4A 2ESRA 2P9QA 3WP0A 1V43A 1GL3A 4AUMA 3WC4A 1KR2A 2BBTA 4EW3A 621PA 1ZEMA 4MCIA 1E69A 1IH8A 3LSYA 4IXWA 4M0UA 2AUMA 2ID4A 4C43A 1NM5C 4BAUA 3FTCA 4L2IB 1ICEA 2PT9A 2QGNA 3NTLA 3HCWA 2DCMA 4D8VA 4TV8B 2J41A 4R31A 1GKUB 4OIFA 1ZM9A 2N0SA 4UD6A 5D6OA 1N9KA 1T9CA 3HV2A 1PR1A 3W78A 4TVOA 4UEOA 4QG7A 5FPPA 1Y81A 3I23A 1XZJA 2XMPA 5TRTA 2DBZA 2O7QA 2ZSFA 3OEHA 4KGVA 4AM8A 2YJNA 3HB0A 3L82B 2AFIA 1GEGA 4IUDS 2MYUA 3SXPA 4L57A 1YQWA 1BJKA 2FCRA 3MTBA 3G0CA 1RRCA 1G6KA 4FKMA 4P08A 2X9VA 3PNMA 1T5HX 1H2WA 1SOVA 1DRKA 1UP4A 1NPYA 4IF6A 2RKOA 3AHCA 2JLSA 4L15A 4X9XA 4TYYA 1WEKA 3ED5A 5GOTA 3ZNQA 1U9IA 2H06A 1CE8A 4DG5A 4P31A 4RVGA 1HTWA 1L8AA 4CLHA 2B8EA 1SPBS 3B9QA 4DAOA 3C6KA 3G88A 4UU8A 5M5BA 1A9QA 3HFSA 2XGGA 2W11A 5TPZD 4GW3A 2CDBA 5IH7A 1JHPA 4Z6KA 3TLZA 5JRZA 2EFJA 2VAVA 1C1HA 1QFYA 4DREA 5LYJF 1GG9A 3W77A 4U7FA 3H6GA 1EQUA 4G01B 3LQKA 2CMDA 2YHIB 3ZGVA 2N47A 4FPXA 4KZPA 3PL1A 5ENDA 3ZHVA 3B38A 4KPUB 1IBRA 1NRIA 2W6PA 3OE7A 5IT9A 1GZ7A 2P30A 3ZWAA 3FHCB 2QVCA 2QRQA 3AR7A 3OZWA 3STTA 4A3SA 3C6BA 3UA4A 2Y76A 3VR2A 5FLEX 1AZSC 3RTGA 2OFPA 4YRMA 3HKBA 4DC0A 2Z09A 1FS4A 4H3VA 1VLQA 3DOOA 1XU9A 2UZ1B 3OZEA 1UIMA 2Q4TA 5EJ2A 4B4WA 1F4LA 3B6ZA 3G0BA 3EIQA 4KMSA 3OHMA 5BSGA 4RGBA 1CRWG 2Q8QA 4OY3A 4R1MA 3RUPA 3D5QA 3R6GA 3ICVA 5CITA 2G4VA 2YC2C 4IS3A 3BYZA 4D4HA 3H4TA 5AQ1A 5E4FA 2BE9A 1GUBA 2ZUSA 2H1LA 3B1ZA 5FOSA 1RYHA 5F9MA 2R1UA 1M2FA 4Q66C 4TXMA 2D1TA 3T99A 2QUKA 4D9EA 2A5LA 2WE7A 2EWVA 3I4LA 5J4KA 2XKBA 3L8HA 4UM9B 3H5RA 4YEDA 1ZVVA 3U17A 3PLNA 5ALIA 5IDYA 3ZV7A 3KSBC 2DY0A 3TLAA 1U2SA 2R6HA 1NVMB 5E0KB 2UU9B 1VIVA 5KNCD 4ZMRA 2GM5A 2BIFA 3K0FA 4IIDA 4ROSA 4ZU6X 1ZOPA 4DQUA 2WIGA 1PUIA 4DV6B 1GAXA 4BIMA 4PSAA 4J43A 2P2SA 4B2LA 4HGQA 4IDFA 2PMEA 3OY2A 5KTSA 1ZOIA 1HEUA 2NZXA 3UV3A 3B1WA 1HDXA 1H05A 1TF7A 2XNSA 3H2GA 2ZJ0A 2WTXA 1OROA 3H2SA 4MW2A 3T1VA 1P77A 3KL2A 4R01A 1I1OA 3K92A 3WICA 4UVGA 3AY7A 4C9BA 4YP7A 5FAKA 4P35A 4JBLA 3KB1A 2HRRA 2WHYA 4W1QA 4PG7A 4L3WA 1G6HA 2OHVA 3AHDA 3PSAA 1U7OA 1U63A 1TCAA 2QX6A 4L73A 4IGIA 3QEMA 2XUAA 2OCDA 1VPLA 4B7ZA 2CF6A 2QTCA 2JFFA 4TKMA 3UW3A 5LQMA 2GM4A 2HQSA 2O8CA 1CE8B 1H6CA 1C7EA 4EL0A 3HN6A 5IXJA 1MFZA 2R84A 5H16A 4GKVA 5J40A 5TF0A 4GPAA 3DDCA 4TRJA 1DMSA 2M9MA 2V6FA 4WI1A 1QGZA 3I04A 3CLUC 1EDDA 1EFRA 3A6PC 2GRJA 2FRVA 1M7HA 2FMHA 2WW8A 4MQFB 3TQQA 4EB6A 4KW7A 1WUKS 4EYOA 3CMMA 1WU7A 3LVQE 2AFHE 1BMFA 4NMXB 2FPKA 1AN9A 5AVXA 4EGFA 2JCSA 4KJXA 1QVZA 1T5TA 1XRJA 3R44A 2KWIA 1OREA 5CP8A 1N3IA 3IS3A 2JFQA 4W7SA 2QF7A 4BNTA 4OBEA 4BB9A 1COWA 4MRMA 2OLEA 1JHYA 1P1RA 3DLTA 4JXKA 4Z5XA 1X2EA 2E4XA 5KHOC 2EYUA 3DA8A 1M2VA 1IWPB 2WI8A 2C2WA 1RJEA 2R8YA 4WNIA 2QRHA 4DYHA 1WMSA 3FPGA 4OHFA 3UEOA 4NSNA 4G4IA 1L1QA 4D57A 5JADA 2ZDQA 4IZ6A 5CB0A 3CLUD 3E8SA 4LZWA 3KT3A 4LDJA 4Q1CA 2Q4EA 1ZKDA 3DLHA 1O94A 1NQ5A 2JA1A 3H6KA 3P2IA 3SZLA 2ZGVA 4REOA 1MH9A 3T54A 3TCKA 4BJ1A 3WL3A 2WFAA 4MKRA 1PJSA 4LXXA 2J48A 2J8ZA 3CBQA 3HNPA 1FSZA 4P3XA 4XWTA 4L8LA 3GFBA 2ZJ1A 2PJZA 1CERA 2CBGA 2Y9PB 3ZWKA 2ATIA 2O8NA 2X8WA 3AY0A 3IP3A 3JQGB 4DCGA 3M4NA 5JO9A 4E5NA 3ZDQA 4V1CB 3KAQA 2DWOA 2GN6A 3HVIA 3L6CA 5I9BA 4ZCRA 2JG3A 4ZEXA 2J85A 2P4EA 1E98A 2F1OA 1FB5A 5FI1B 2KQUA 1FNMA 2XV1A 1YZ3A 5DRYA 4HXGA 5IS2A 4DUYB 4CMAA 4RXUA 1RYDA 5B5SA 3AFOA 3SDSA 4NBSA 2PRIA 4I55F 4Z4EA 3IJEB 3EEIA 1O9GA 4R2XA 1UK9A 2H8GA 3V8RA 1BMFD 3CT6A 3N2NA 3FTNA 3HDVA 3OQBA 3ZLTA 1GQRA 3LHSA 1PT7A 1LPOA 2DBYA 2EJTA 2QTFA 2JBHA 2HMSA 2RH5A 3KYCB 4AP5A 4B85A 5HQJA 1Q21A 2XZLA 4XDHA 1KYZA 1NN3A 2HU2A 3AKZA 4DLRA 3MK31 3BWYA 4BDTA 2AQ8A 1Z68A 2ZBFA 1C0EA 1YI8A 2Z4SA 3ABIA 4WCDA 1P4AA 3UXYA 4E2YA 1QIIA 4BECA 1DQYA 4MQBA 1UH5A 3H9BA 4E88A 5I47A 3T7CA 2WR8A 1YT5A 3LPAA 4EMBA 2FZCA 1VJTA 3H8SA 3LOQA 4LXUA 2O8CB 3AZOA 3I04M 5AKKA 4JIMA 4Q05A 1A8QA 2RBKA 3GLHA 4PYQA 3LBFA 9MHTA 1LK7A 1P4HA 4UCFA 2WINI 1XZPA 4KKVA 2O3UA 2P9EA 4CIDA 2WNIA 5IANA 2VHJA 1N6NA 5IVKA 5FPSA 4A0QA 3CZQA 2AYXA 2ZKIA 2R7AA 4RL4A 4FHZA 2ZPTX 3WRXC 1E1MA 1U7XA 1E0DA 2POCA 1LZKA 1GADO 3A1EA 3QFRA 4FIZA 4QYMA 4ZQGA 1J22A 3GNTA 3LBNA 3WL7A 3UJPA 2Y93A 3CNOA 2CLFB 2IYEA 4GNKA 3ZN2A 4FMPA 1WUIS 2ZSAA 2OLJA 3TTTA 1IN5A 4CV0A 1S96A 4XUCA 1D8AA 4K87A 5CK5A 2FX5A 3PD7A 4AZWA 3CW9A 1XEAA 3UHAA 3GQBA 2CLEB 4PIMA 3WNVA 2X3FA 4HDKB 5AVUA 2J3MA 3OPYA 4AURA 2YXEA 1UUFA 3RC3A 2H1VA 3B52X 1I9GA 2JFYA 2VNAA 5H70A 4KNYA 5E2AA 2BTEA 2CL5A 2C9ZA 1QKIA 2HJGA 1H1LA 1N2CB 1P3DA 1U1GA 4KN6A 3ZJ4A 1TUIA 5B3KA 4C0AC 3GK3A 1IN7A 2BZSA 2G72A 3C4VA 4DMRA 3BWDD 5MGBA 1HO3A 3TG8A 4JOBA 1I2ZA 4PYIA 1USKA 2COUA 4RZQA 2XUHA 4N7MA 4LCEA 3NWOA 2FWRA 2H1HA 4L5CA 4CEIB 3WYNA 4F1JA 4GI7A 4N5IX 3UYKA 3D8BA 1ECBA 2I29A 2VF2A 5TIIA 5AIAA 2JW5A 1VHQA 2ZRJA 3U7QB 1GG2A 1YQGA 2Z8YM 4QAJA 3WLEA 1ZLXA 4UUNA 4CKEB 4J03A 3AUTA 2CDAA 1EFVB 2UZ3A 3ZX5A 4JB2A 4HDRB 3OCUA 2PRZA 3NYWA 4I36A 4E5UA 2I8CA 1MKYA 3QA3E 1SUAA 4OMDA 4ZJZA 3NBYC 3FWYA 5DTMA 3OX4A 1JHAA 4X44A 4EBBA 3L8CA 3UENA 1E9RA 3EIUA 4HBGA 4PYRA 4WJKB 2W6MA 4MJLA 4Y9UA 1BMDA 2OKGA 4OQPA 4AL4A 1V9SA 2IW1A 4H1HA 1BSVA 1GQYA 2AMYA 4Z9FA 1BW9A 4FZ5A 3SZMA 4BAGA 4LXIA 5A6VA 3RPEA 2IUEA 4WZ6A 2C2MA 1NVVR 2WAMA 3TEFA 2YC4C 1IHXA 3DVAB 3ML1A 4LXTA 5CVUA 2HMTA 4OQEA 4XI9A 4PY2A 3OZUA 3QKWA 4MRVA 4B6EA 1ZK2A 4YP6A 3RKUA 1U5CA 3TECE 3AL2A 2HHLA 2ZQZA 3A28A 4DDMA 2OZPA 5SY4A 3H42B 2NUPB 4RZ2A 4I9GA 4N1AA 1MMFB 2GEVA 3A37A 3C8MA 4H6XA 4NG4A 4D44A 5HSGA 4PLHA 3TZHA 1FFSA 5F7XA 4BZXA 2WU1A 3A9TA 4FGJA 4W9RA 3INRA 1VGRA 1DRUA 3CVYA 3LBIA 2RHOA 5DNEA 2ICAA 2QN2A 4IGAA 2WILA 2RHDA 1LH0A 3AL3A 7AT1A 1L2TA 1SUBA 2P2NA 2AG0A 1PGOA 3BKWA 4O8CA 4PLYA 5HHTA 3DMYA 3IMEA 1GTL1 2BL4A 3EG5A 1EB9A 2XTJA 4FD3A 5LXTF 2NZUG 4AKEA 5TEVA 5JSHA 1NNI1 5BYAA 3DZIA 5EHGA 2O3QA 4LHEA 1Y82A 4GGPA 1G63A 1O0CA 1CNEA 4WGGA 3KKZA 3QFFA 4G0XA 1BHO1 2AXEA 2Y0BA 3E9RA 3ESCA 4RVSA 5JYEA 3S2ZA 4TV9B 4BNKA 3MUNA 4RD2A 3BMXA 3PFWO 3A31A 1FYDA 4S24A 3F8WA 1VLLA 2C42A 4O1IA 3QXJA 3REQB 4P2GA 1RP7A 2HTFA 3PUKA 1XZLA 4X3OA 3EE6A 4C6RA 3SDZA 3VR4A 3RHZA 1DKUA 3GT4A 3V4VB 3K94A 2PXCA 2A0WA 2BM8A 2XW6A 3VYSB 4BASA 1LK5A 4K8RB 4WZBB 3IQXA 5LU9A 5LIPA 2J4CA 3WL6A 4Y1EA 5JZBA 3BXPA 3ZBTA 1QVVA 1OYOA 2IEAA 4OHXA 3W34A 1UPBA 4C0SA 3HCPA 3ODPA 4DR3B 2ES4A 2PKQO 4US2R 4KOAA 1C0LA 3F9CA 3EQZA 4IWXA 4TWZA 3COVA 2C96A 1B8UA 2YDYA 2Z4RA 4OQZA 5AK3A 3WSTA 3UMYA 3THOA 3UHFA 5K03A 3HABA 1G41A 4R9UC 2CLHB 1EP2B 3FWPA 1RCUA 1R6BX 2HWUA 2ZETA 4Q12A 2ET6A 5FFFA 1ESNA 3HUEA 4EVQA 1E0KA 4DABA 4EY8A 4RGVA 5JARA 2H4JA 2JATA 5DGHA 5CDTA 3S2GA 1EUDA 1L3BA 1G8KA 2O8BB 1M7BA 4G4SP 3WIEA 5BR7A 5I7OA 3I5XA 2WJ4A 3EARA 2DH5A 4OQFA 5BWNA 1W94A 3BWBA 1PTJC 4PSKA 5ENZA 1T34A 2HZ7A 3T7EA 1E7MA 1JDNA 1T8WA 1A9TA 1NJ1A 3LVFO 1SQ0A 1P1KA 5SYMA 1JPUA 4AJJA 1ZK4A 1HYBA 1NMSA 1YQEA 2H48A 2C99A 4GLFA 3T0GA 1RJ9A 2YY7A 3F3SA 3VGJA 3WP1B 1XCPA 1T8TA 5CCDA 3AEYA 1ZOLA 2CKMA 4Y2HA 5FO1A 1JSZA 1PJ3A 1PTKA 5ERXA 2BMFA 3THRA 1RWBA 3CH4B 1WMBA 1SG9A 2GLUA 3NHYA 3WMRA 2WJIA 5IDWA 5TVKA 5KKCA 3I05A 3TDNA 4NV1A 4BMOB 3NHBA 2BBSA 2TMDA 1VE9A 4IDGA 1W5BA 1ENZA 1GG5A 1WBJB 2CDNA 3MWKA 3S5JA 5IABA 2CK3A 2P1DA 2VYVD 1GD1O 1PW5A 5KBYA 1LX6A 1NN1A 3V2GA 2XDQA 2NAFA 4F60A 4DLSA 2WSSD 1HZZA 1BDHA 3P0RA 3D6UA 4QHTA 2IE0A 1AE1A 2FZGA 3L3BA 3QWBA 3PT5A 4RY2A 5TMEA 2B5OA 1JWAB 1IFXA 1NJGA 4DMFA 3O1LA 3FMFA 4KACA 1V6SA 5IJAA 3SHVA 1MFPA 1RYYA 3ZWQA 4LIPD 3GC6A 1U2RA 5ED0A 4ZI2A 4LY6A 5JCXA 5G1OA 1XJQA 5CA1F 2AD1A 2V0GA 1FFBA 3K9GA 2ZRHA 3QPVA 4H7KA 3NHZA 5KDDA 3BF7A 1DC6A 3EJ6A 4LQDA 3UK2A 5EY5B 3IAHA 1NW4A 4HGPA 1XMXA 2W5UA 2OZLA 3GMDA 2X4GA 2UDPA 1Y4DE 3D5EA 3KUCA 3FW1A 4QBHA 4RA6B 4WOJA 4ANFA 1R6TA 4DEVA 3OM1A 3WQHA 4INOA 2QX8A 4QPJC 4RW0A 4ZRMA 1OLXA 5LQSA 3AF4A 2OQRA 3WQQA 1F7UA 1JH9A 4P7KA 2Q3BA 1RI2A 2G1PA 5F2OA 4ICIA 3AKCA 1R16A 1MOPA 1KAEA 3EDMA 4KRXA 3ZJYA 4B3CA 1YVPA 1RWXA 1WNFA 3F97A 2XE6A 3NUGA 2CUZA 4NE7A 5CPFA 1ITZA 3RUDA 5AVQA 1X70A 1Z8FA 2HWYA 3FDXA 3MCZA 3T5AA 4LQCA 1HNXB 1R7RA 4H4DA 1XRLA 2O2CA 4U6QA 2QMZA 4ENRA 3IDOA 3VR5D 3MRVA 1NRJB 5GGXA 3DEHA 2ZBGA 3HG7A 3W7AA 1NONA 1TEVA 3H5VA 3VR3D 3KPYA 2VI5A 3HFGA 5JS8A 1P6QA 1BROA 4J0IA 3PWTA 4OTZA 2FEXA 2F59A 2P4QA 3BCRA 3GNLA 3T7JA 1RU3A 1Z5GA 1KKLA 2HSWA 4GYJA 3KOMA 2HHAA 3THWA 1P1CA 5BSMA 2PGOA 2GNOA 4Q3EA 3WE7A 4EO4A 4DMCA 1W49A 1FLNA 2OQIA 1J2YA 2XRFA 4MMYB 5JLJA 1V7PC 4WNCA 1OBHA 3TX2A 1VGQA 4JUFA 5ER6A 3D2BA 3K53A 4Y2UA 3D6NB 2X9NA 4AB1A 4CNBA 4UPDA 3SS8A 1ADGA 1I10A 2XCTB 1JSCA 2NO5A 2A3RA 2J46A 4YYZA 1OXMA 1X2BA 5HJ5A 4WXYB 1KH1A 3OOJA 3FKJA 5DTQA 1NLZA 2ZWPA 2XH8A 3I53A 1E5QA 3B3JA 1E79D 2AUNA 4HMQA 3SX4A 4DBLE 4EDFA 4W1PA 1N0WA 1EG7A 5HS6A 2IRWA 2MSLA 5BV0A 5IZCC 1E32A 4JP8A 1AG9A 1USVA 1CY6A 2XNCA 4IHQA 5T6MA 5TQJA 1Z35A 1AZWA 2XDQB 4NBLA 1SQ6A 2F4NA 4CLOA 4QLOA 3I2YX 1U8CB 3BD8A 3IOBA 2AX4A 2N3ZA 4Y7CA 1DC4A 2PKXA 4ZT2A 3E1GA 1IM8A 1J8MF 3CZPA 1U0BB 3P26A 4DUPA 4YFVA 1NASA 1ZH4A 5LQUA 1NQUA 2O6LA 2OORC 2FKAA 1XRPA 4MDYA 4N8DA 5DTEA 4YAUA 2XQKA 5F35A 1XQ9A 3SHOA 5K3BA 4CLEA 5EIXA 1F5NA 4TWRA 4OHKA 2I4NA 3NBAA 3AZPA 1IK4A 3HDJA 4PN3A 4ZXFA 4OQXA 1LFDB 3NDPA 3QNMA 4TM8A 4ZI7B 1K08A 1JR3E 4KFTA 2WJHA 5I6DA 1UJNA 1NXWA 1XVVA 3HPQA 2HCJB 4IJUA 3EN0A 4W5WA 5DGXA 1EXVA 3OD5A 3T9EA 3CUKA 4JFRA 4PYNA 1SXGA 4DXAA 2VUUA 4NH0A 1Q1BA 3NX4A 1VECA 4G5QA 7REQB 2A1UA 4AO8A 5JCOA 3SVZA 1JFTA 3DMDA 4BJHB 3L1HA 4YJKA 2MDTA 4YROA 1IEQA 3RAJA 1JAIA 1F6DA 3EXHA 1N0VC 1OC2A 2PUAA 1KFKB 4AUKA 3E8XA 1J21A 5ERYA 2WD9A 3C14C 3ZDXB 5AW1A 3ZI0A 1N75A 2F3TA 4MUNA 1Y42X 1N6LA 1XLUA 4DMKA 1NLYA 4WJLA 2PE5A 1K4YA 3Q2IA 2OHOA 3MELA 4GMXA 4YH1A 4INPA 2O5EA 1N0UA 4GC9A 3IV7A 4LGMA 3AHHA 1JNYA 5LOVF 5FI3A 4U5QA 3BZBA 3FKSA 3TPFA 1B26A 1CZUA 2V5VA 4EHKA 5JCOC 5I8ZA 4M7PA 1EK1A 1AQIA 2CC2A 3FTQA 3H99A 4GFDA 1T9GR 2O2JA 5FQNA 5KNCH 3VH2A 3SBDA 3U13A 5A6SA 4FJ0A 2QJRA 3AINA 3TGWA 5EPEA 5FLXA 4EENA 2WF7A 3OA0A 3ROXA 5ALFA 1ZU5A 4S12A 2P4UA 1L5MA 4KGZA 1WEHA 2C98A 5I8PA 2W6OA 4AKTA 4QXQA 3MMPA 3QXGA 3G2MA 4AULA 2WUGA 1H69A 5A3QA 2CLIB 1K88A 1SC3A 1W48A 2Z4TA 1GEEA 1DBRA 4XA8A 4JEMA 4YRLA 3WLSA 2IPOA 3F98A 3EHEA 4DB4A 1OJ7A 2DHCA 2XYHA 4Q9HA 3K71B 4D6PA 4Y3UA 4I14A 1TW3A 2QN6A 3RT1A 1Z6TA 2C0CA 1XAHA 1FP4A 1GZ4A 1Q1EA 3QV2A 4QPPA 5JSKA 5AVTA 1DRWA 2D6FA 2XD4A 2QPLA 2D06A 1FLAA 5F23A 2J3QA 2W6ZA 4MB6A 1HXHA 4J16C 2GBCA 2JCGA 1COZA 3WGHA 2WM8A 3T1HB 5C8YB 1TYBE 3WTBA 4QXAA 4R1QA 1N4DA 4AKGA 1K8RA 1XEFA 1EJ0A 1DDIA 4RKFA 3T4UA 1W9MA 2EYQA 1Y6ZA 2GXSA 1P18A 3IUNA 5B58C 4F3NA 3VU3A 1YH3A 4JHXA 1T1SA 1P0PA 2QU8A 2X8AA 4RFSB 4PNEA 2NVWA 5AXCA 6CHYA 3OFVA 3V1KA 2IZ7A 3WIVA 1JLHA 1KFCB 5NULA 4E2FA 2ECKA 3C7DB 2O50A 4TXLA 1KAHA 3O2QB 4ZAYA 1KEKA 1XXLA 4A2WA 2V3VA 3SQNA 1I2BA 4DFDA 4RKEA 3BEDA 4GMKA 3L8FA 4DV5B 3KALA 3HA7A 2Q0SA 3LBYA 2C2BA 5KVQA 4W7HA 3RJMA 3ROEA 2IYSA 1N5OX 2GBFA 3LLSA 3ON5A 4Z2YA 5LYJA 4BO7A 4F9TA 2YXBA 4MAAA 4S1WA 1T15A 4ND2A 1UBJS 3M2TA 1E2EA 1GPH1 2ZXEA 3DR5A 4O4IA 2HQBA 3T8YA 2VP0A 3GVPA 2RBEA 5I3ZA 4BLUA 2AQHA 4RDHA 3C24A 5FOXA 5FOTA 1K98A 1Q14A 5GJBA 4DV4B 4HL6A 4A2QA 3N0VA 2XMRA 2Q5LA 3UK6A 3O2SB 3OJWA 4IDCA 3DEAA 4E4TA 3LCVB 3ZWXA 5JANA 3Q3VA 4I1VA 2PVCA 3GYBA 3K05A 1HMYA 3G3EA 5F33A 1ACJA 1KZ7B 5EESA 2FG6C 1W1UA 5BWCA 1J1IA 1G5QA 4NCKA 1CJUC 3GUUA 2FCAA 3TSWA 3N2GB 1DGQA 5K0EA 1DXOA 1N57A 5A6SB 2LP4Y 1HBJA 2FZ4A 1NJ8A 2OXRA 3PEWA 3LDAA 2OGSA 4NEHB 1PKXA 1G3RA 4R8RA 9LDTA 1LV7A 1KBQA 3RK4A 4MOWA 4R8SA 1AKWA 2PUFA 1D5WA 3GDFA 2YNMC 2YZGA 3Q6MA 1WOMA 2QJTA 1QCCA 1QVWA 3KJIA 1KSHA 3LSTA 4OD0A 3EPJA 2CNKA 1VE5A 3GYGA 4TLBA 4HMPA 3OOHA 2JIZA 1BZYA 1MX5A 3JAKB 1R8JA 1O8CA 2Y1LA 3HKDA 3QJYA 1ULBA 4IHJA 1SFRA 1QHHA 1U3VA 3FE2A 3HMQA 4P4TA 3FTFA 2GF2A 3ZQKA 3QITA 1JTFA 4F2PA 3B2QA 1M8PA 4DM7A 4Q00A 2FPMA 1KSJA 3DULA 2A1TS 1U3CA 1FFEA 3EBPA 3L43A 3MB5A 4PC2A 5IFLA 2WMNB 4DV7B 1UJ6A 1XO1A 1YMQA 2QMYA 2RSLA 4H4EA 3JTMA 4NWIA 5LMCA 2GCGA 4TVSA 4E51A 2NQ2C 1NUSA 1TLTA 2CVQA 4H1TA 2YNMD 4OKIA 4B2YA 1JAXA 2QLLA 2EGUA 3C16C 3CF2A 1KQNA 3PDHA 4DYDA 2D54A 3EMBA 3UF0A 2Q6TA 1I7LA 4K03A 4X1YB 2Q7XA 2CGEA 1T8UA 4GEGA 2JKVA 1WSWA 1IK6A 1HKUA 4JI8B 1OYVA 3MAJA 4PG4A 3TSZA 3OIDA 1RIFA 4K3UA 2W4MA 1RW4A 2C95A 3B3QA 3MNFA 3IURA 5CNJA 1LWNA 5A04A 1XK7A 5KSZA 2I7XA 1WBDA 1KJYA 1NZJA 1FX0B 2CF5A 3HA3A 4S1OA 1R9GA 3HXOA 2ATEA 4C0BA 2OXIA 3JCZA 5FBWB 4GKKB 1YS7A 4NK4A 3EVBA 3FPAA 1W47A 3O8DA 4LRYA 4U00A 3OHPA 4BWYA 3NGXA 4HVLA 1QMPA 4CMEC 4C87A 1RLIA 1DX9A 3BD6A 4H7PA 1L6IA 1L5YA 1LDMA 4XR4A 2QZPA 5CIWA 4D4LA 5TMPA 3UN1A 3BFVA 3QW4B 5G4LA 2VNSA 3OX2A 1LSOA 3Q7EA 4Q3AA 5EPOA 1YQUA 4QJBA 3A9UA 5JATA 2X2FA 1LDBA 4G0MA 4B5KA 5JZ9A 3COWA 2WVAA 3O7MA 4Q6BA 5CB4F 4JNCA 2D4HA 1SMKA 3E70C 5AKYA 2VPWA 4CG0A 3DXZA 1VMIA 3PSHA 3HY6A 3N74A 4RK5A 5B1DA 1JEQA 2ZYRA 5ESRA 2R2AA 2KBEA 4NV3A 4FX5A 1SVOA 3ADBA 1P17A 4Q7EA 3C6ZA 1HR0B 4PPFA 3GFOA 3QVXA 3VSDA 4JI7B 2VYND 2L69A 1Q1AA 3PE6A 4ZAGA 1ND6A 4IIBA 3ZS8A 2JGIA 1AMUA 2XOKD 2QKYA 4M83A 2J4FA 2P35A 6PFKA 3NMUF 3U19A 4OLHA 4IDPA 1MIOB 4IOKA 5DCUA 3TQHA 1OXVA 3U31A 4YMLA 1P2FA 2WIBA 4K6MA 3OZVA 4JQSA 4GLOA 5JROA 2BF4A 2PMBA 1J00A 1P9RA 4XAQA 1SUFA 4MKGA 1CF9A 3B48A 4B74A 4WLUA 4G56A 4OH7A 4IHJB 1WXQA 3HKDB 3IQDB 4PQRA 5H68A 4I5IA 5HM8A 4A0GA 4B4OA 3DB1A 4W5NA 1QHHB 2IHKA 4S0XA 3VC7A 1Z0ZA 4NEGA 1Z2EA 4C03A 2DECA 2HLNA 4B6OA 5IKPA 1M54A 2IYFA 2MMGA 4QICA 5ES3A 3C8UA 1U0HC 3AB3A 3E9ZA 3SR4A 1H42A 1XRMA 4OA8A 4FLMA 2J3HA 3IILA 2VXCA 4GAEA 4P7GA 2IYZA 5T4BA 3PIDA 4F6CA 3WGGA 5IJ0A 1DCTA 4P5EA 1MZPA 1LZLA 3FNQA 3QHPA 1B8VA 4F72A 1T91A 1UL1X 5B7PA 5J2UF 5IJ9A 3DVLA 5IW8A 4BC0A 2VSQA 3AUYA 3IIEA 4IFEA 4LQLA 5DBOA 2DUWA 1PWEA 3CR3C 3O4JA 3UA3A 1I24A 1YB4A 1Z3CA 1UZAA 1XEXA 1B4DA 5AK5A 3W9SA 4ZJYA 1ZCZA 5C18A 3GX1A 1L1RA 2QI9F 2CXUA 5IM4F 2AFVA 3TB4A 3T5PA 4PFJA 2RI0A 1FYEA 1J23A 4C3OB 5BV8A 5JFGA 3TD2A 1GZ5A 2GEJA 3M4JA 5HJEA 1FS5A 2CV0A 5K0ZA 1U9YA 3BVPA 4JYZA 1FFCA 1KEZA 2E48A 2ZYIA 1W4ZA 4JEIA 4OHMA 3WISA 3ZDCA 4DEYA 3T1NA 2E37A 3M83A 1E1CB 3CJTA 4I1OA 4NIMA 2H4FA 4EB3A 2I66A 3H4IA 4HX5A 4UEKA 4L0CA 5IK2A 1XBTA 5EE9A 3MT0A 5IM5A 4CE6A 3BUSA 4KVAA 1ZNQO 1V1JA 3IDSA 4O2AB 5CX4A 5L4NA 1I3KA 1K5GA 1XMVA 3AR6A 4GE3A 4PC6A 4UXIA 3NI2A 5C3UA 2Y6UA 4PNHA 3ANMA 1KKUA 4TV9F 2X8LA 4QLBA 1DEXA 3PENA 3OPXA 2Y3IA 3G02A 5KNBA 2MYTA 2CCKA 2HLHA 2IBMA 3IIIA 4FGSA 4LZLA 4WKBA 2CZQA 4GVPA 3KFLA 1RM3A 4PZ9A 3WR5A 1B2LA 3ETEA 5EJFA 6ABPA 3L7OA 1N2CE 3IA7A 4ZCPA 2R3SA 4R3NA 2AC4A 3VPBA 4YVFA 1E2BA 1J56A 2ZRDA 1C9NA 3MTQA 5C32A 2VDVE 3FF4A 2JRLA 1QX4A 4M36A 4REQB 3W5JA 4QRDA 4HAVA 1FUEA 2RARA 2JJ1D 2ZSUA 3ROZA 1N7HA 3AVYA 4B5LA 3NU1A 3MIZA 5HGXA 1YQTA 3R9IA 1ISMA 4WY2A 4ECEA 3FOFC 1BJRE 1NQTA 1NVGA 4YJ3A 1JFLA 2GBPA 3DE6X 3E3MA 3I2KA 3QWFA 1ZONA 2A5FA 4Q1AA 2ZRQA 4FXOA 4N65A 1CYEA 4C0JA 3P0IA 4IVNA 1ZICA 4QJ4A 3TMKA 3N7AA 2AQKA 3SHQA 2V54A 3KSUA 4MUFA 4X62B 4ZOCA 5JTTA 1E4OA 5ESXA 4CQJA 4YRRA 4HATA 2HY7A 3U4HA 5B1SA 1DQPA 4Y0AA 3RSGA 1UKEA 2QX4A 4GRIA 5BYKA 5C8DA 3KYIB 3KUUA 2WWYA 3NYQA 1SCDA 2PH7A 2OENG 2PYIA 3T95A 2PV0A 4XQEA 2H65A 4ERXA 3KOZA 3B60A 4NESA 5IJ0B 1D6MA 5KDOA 2R1VB 3HWWA 1UC8A 4ND7A 4DY6A 4QOEA 3BWEA 5ALXA 2VSYA 5K3EA 1I33A 2W00A 3V97A 1O1YA 5IJ9B 2X5JO 4FI3F 2QVXX 3D1LA 2UVQA 4BB0A 1VHLA 2WPNA 3GT7A 4GUDA 1XEXB 3NXSA 3EOZA 3PWSA 5E38A 4ZHQB 3OO0A 4GBMA 1SIBE 3W5IA 2BZ1A 2XMBA 5JYBA 1I7NA 2WPDA 4KYVA 4A1FA 5JAZA 1SH7A 1FBTA 5CFOA 2R68A 3IVXA 4JNKA 2REQB 3H3FA 4PANA 2C78A 1IXRC 3KRTA 5GINE 4IJVA 1ZMOA 4C6SA 1IY1A 2QPOA 5BWMA 1VDMA 5G41A 2O54A 4E03A 3ECAA 2B4AA 2CJFA 3DXYA 4LBVA 1OSNA 5C52B 1NF2A 2SKDA 3A05A 4HFMA 4PO3X 5D51S 5B57C 3G13A 5TGDA 1R5JA 4NZZA 3V4SA 3F5MA 1SXPA 1NW3A 1PQWA 2GN0A 4F86A 3VKWA 1V41E 1VYHA 2VP3A 3GOHA 4NS1A 1JHVA 1FX1A 3OVMA 2PG3A 4KQEA 5BN3B 3K0CA 3QELA 1SKUA 2EGHA 2ACEA 4HB4A 2HI0A 4HDOB 2IEDA 3IMCA 3HYRA 2X58A 5SYAA 1KQPA 2A58A 3QE4A 3NNDA 2FRDA 2P40A 4JLDA 3KQHA 1W25A 4DBVO 2ZTMA 3DDHA 5B58T 3CLTC 3K9HA 5I7EA 4TMVA 2VC2B 5CT8A 4UHKA 1YZHA 5BUZA 2P9JA 1O8BA 1Z2CA 2D2EA 2EP7A 2HDNB 2JJQA 5IAAA 4RAQA 5A05A 3SSOA 4A0HA 4RIGA 1ZR4A 1SR8A 3NONA 1TTHA 4QXPA 4WZBE 5ALVA 3NHLA 4QOGA 4RS3A 4EELA 1I0LA 2PWZA 3L1VA 4FW8A 3M2PA 5H7XA 3H0KA 3JATA 1DLJA 1Q15A 2DPHA 3HU5A 3K31A 3T3GA 5KWIA 1FTNA 1T8PA 3INGA 4YMGA 2VJAA 4F5EA 1JDPA 1P31A 4YJ3B 3DNFA 4XGIA 3QOFA 2ZYHA 2WPDD 2VJQA 3BFKA 3PUWA 3D7MA 1WOYA 1MB4A 5IBRA 3UMCA 3CLTD 4EX6A 1WBBA 4JLJA 1KXZA 2ZIVB 3A9CA 1SVUA 3QK7A 3R5SA 3NLLA 4C6TA 5LIRA 1XPUA 3HO1A 1TX4B 4Z9XA 4YIHA 3PEYA 1UMCB 2ZR7A 5U4QA 2I03A 4N18A 3FUXA 3FRJA 4D8UA 4RHCA 1MB0A 2PLNA 1CP3A 4NFLA 3Q5GA 3EPKA 4LOIA 2LD4A 4GNRA 4OQDA 1W19A 3KHUA 1IJBA 5IDXA 4YASA 1OZGA 2EQBA 4MIOA 4FFDA 3ZU2A 2FWMX 3P9RA 3F9IA 5AD1A 5C37A 3GLTA 4GP7A 3VQTA 1PL7A 1QXSA 4OGWA 1SXIA 3RU2A 4URFA 4YWHA 1UPTA 1VHWA 3MG9A 5ECDA 1QV6A 3KB2A 2F3SA 4R4JA 1MGPA 4C22A 1V9LA 1T36A 4OB8A 2NZWA 1N33B 1I3MA 5BRJA 4KQJA 1V5GA 3M0EA 3K6SA 1E64A 3P2EA 4MSUA 1TIBA 1ZP6A 1QU2A 2IYXA 1O9BA 2Z5VA 4HN4B 4TUYA 4MROA 4KBFA 2G17A 3H1BA 4I4CA 4IJWA 2HD4A 1H9CA 4Q7MB 5DDIP 3EX7C 1TRKA 1RHRA 4P7JA 3SMQA 3D1JA 3GIWA 3QIVA 4NKRA 1I7SB 4CKCB 3FN4A 3LIPA 4RHXA 4ZOLA 2V3WA 3CFYA 4CPDA 2ETXA 3U80A 4DF3A 1JKXA 1X92A 2FK7A 3KUXA 2OV2A 4F9EA 4N6OA 4BKUA 1YBVA 1MVNA 3GFQA 3I9JA 2VPTA 4O63O 2W2PA 5AJXA 3L8DA 3II6X 5IWCA 3RT7A 2HHCA 3LPCA 2CLKB 3G8BA 1QDLB 2AOTB 1H0SA 2P69A 4GHWA 3WL5A 2AWOA 4C3VA 4BEBA 3G5MA 2W2VA 2X40A 3D6JA 5ALNA 4BP9A 3AY6A 4ZI7F 1MB2A 2X6RA 1GGEA 1B8NA 2QRGA 1JJVA 3QPDA 3I9KA 2W48A 4TSFD 5CA1A 1PJRA 2BCGY 3PQDA 2B9EA 5J2TF 3PKZA 1W34A 1EIWA 2O5CA 1M1NB 1Y8QA 2YN2A 3LW8A 2QK4A 4LJSA 4B73A 4FKZA 4GXQA 4V39A 4X94A 4K9QA 5LDHA 2FQQA 4G5RA 1NF8A 3QLVC 4OGKA 3ZY5A 3KDPA 5CLFA 5AR1A 3NIGB 3V00A 2D1RA 2Y0PA 4CLRB 1XZDA 4QJ3A 1GZ3A 1MTOA 3FPJA 3NW9A 3AVXA 1WQ4A 2Z1MA 1WU8A 3A6LA 3QBDA 1XCBA 1JXMA 1ZXXA 1BS1A 4UVHA 2A5JA 4XX0A 5TGTA 1SB8A 1PZHA 4WKGA 1R64A 2P62A 1W5SA 3BB1A 1XRRA 5FWDA 3WAGA 4YJFA 1AK2A 1R88A 1XTVA 3RUAA 3V1TC 4YRIA 5K3FB 4KK4A 5TR9A 3GJ4A 4C6TB 3L0SA 1V6AA 4C4OA 4HP8A 4ZVNA 2NZYA 2BMJA 1VJRA 2J9FA 1PNRA 1JMVA 4QVKA 4WK2B 3ZDEA 2PK3A 3KU4A 4F93B 1VYTA 3VGPA 4XXHA 1LLDA 2R8RA 3UWSA 3J7TA 3HKCB 4R83A 3CF6R 4WA8A 3LPNA 4BLWA 1VE6A 2JH8A 3KV1A 3NAZA 4WZAB 4AWXA 1KDPA 5GMOA 5REQA 1QH0A 2ZUEA 5LM3A 3LAWA 5C8VA 1KJ8A 2PPVA 2CFCA 4HNRA 1LXCA 5H3LA 2DF8A 1VL2A 2H52A 2FEKA 2IODA 1NMEA 3SEAA 1EDOA 4CDRA 3AUUA 4AS2A 1RI4A 3WLNA 4KE8A 2QE7A 4D0RA 3K6SB 4DV3B 3U44B 5IVDA 1K06A 2DUJA 2GK6A 5ARCA 2NUAB 2W43A 3DAGA 3EFEA 4TUYB 4CCYB 1AGRA 1E4YA 4DRYA 2XA9A 5T4HA 4G65A 2V7VA 3KR1A 4MLDA 1RADA 1P6XA 4NH4A 2E85A 2FX3A 1KRHA 1XRNA 3K4HA 4HTFA 1IOVA 3AFMA 3FKQA 2O7SA 3D43A 5DFAA 3VVCA 3QIAA 2IOQA 4IKEA 4BUJA 1ESZA 2R11A 1E2HA 3VZRA 2RHRA 3JARB 4L4UA 1AU9A 1EB8A 4B3FX 5MHTA 1DJQA 3CPSA 1PEKE 3T7IA 1OFUA 4N9QA 2PZAA 3HRIA 3MTAA 4FUQA 2FPIA 3G8AA 3MMZA 4P53A 3I83A 2GN8A 3A1CA 3X1XA 5LNK1 3LT4A 3N1UA 1UXJA 2ORIA 2XUPA 5JJCA 3PR2B 4QGAA 2WFZA 1B3RA 3GBSA 1NWCA 3MWJA 2H0QA 4TKLA 3LC7O 2NU8A 1X9HA 1RPJA 1JLSA 1ZIXA 3DUFA 3W8RA 4YO8A 4AZ0A 2HJVA 3HCFA 5D3KA 4V1CI 2O5RA 2FR8A 3U16A 3DMHA 1RWMA 3F3YA 3LKZA 3BL5A 1E61A 2BMAA 2IIVA 5JAMA 1N5MA 2F43B 4ZODA 1ZZGA 3QTBA 2IOHA 4U7GA 1Q0TA 1G2PA 3HLTA 4G3XA 3E7WA 4NEQA 3DOEA 3RR2A 4QJIA 3COPA 4S04A 4KOEC 1Y5NA 3QXCA 1C9KA 2PT5A 4TN1A 2PTGA 1TPYA 4EPVA 2X6TA 2C58A 2LCIA 4HQRA 4XPIB 4DLTA 5HS4A 2XMDA 1IAVA 4EPRA 2PUTA 3FSGA 2NPIA 1T6YA 3N8NA 2FG7C 4QUEA 3W2TA 3G9TA 5D1NA 3ZWCA 5DYWA 4LHXA 1ZRMA 4Y1RA 5DLYA 4WAUA 2BM9A 2ZUUA 2B21A 5I9SA 1QYVA 1XP5A 3CWZA 4I3GA 4MV6A 4AQYB 3RB8A 5CXXA 2PDAA 1WDKA 5HF6A 2H6EA 3WYGA 4G1BA 1KTIA 5CDGA 2V3CC 3DYBA 1E6LA 4TLMB 2I22A 5LOVA 1VSUA 2VBGA 1XLVA 1WSDA 2VP2A 3RRYA 1HH4A 3T3MB 4B9AA 1XYGA 2F1HA 3MWFA 4NPHA 4P83A 2FHSA 3E35A 1N2EA 4QE3A 4PW0A 5DZSA 5FOWA 4AU1A 3E9DA 1F20A 3VDMA 2F1IA 4PZEA 1NWHA 3N3AC 3C4JA 2Q5HA 4HWPA 3LUPA 4MGEA 1NVVQ 1ZOSA 4GM1A 1YS4A 1XHEA 1JECA 4D9JA 3IXMA 1LPPA 2RH8A 1GQFA 3OFND 5AFSA 3PE3A 4FXPA 1JEYA 1N32B 1G59A 1GAJA 4BO3A 3TLMA 5LCXA 4BJ5A 1N6RA 4BUZA 2RGNA 2AJTA 4RBNA 1UWLA 2Q1XA 2YIJA 4OYYA 1EZZA 5ALSA 5E6RB 1H6BA 5CM2Z 1RBYA 1HFJA 3UJ8A 1KMMA 1X7YA 4F4JA 1NVBA 2A3NA 2LIPA 3CPJB 3EVGA 3IQIX 2OAQ1 4FVTA 2FF7A 3ZZ1A 4B9EA 4ZJUA 2NZVG 5H4HA 3KEMA 3M34A 1BN7A 2E21A 2VQ3A 4QHYA 2JLYA 1J5PA 2ZJ7A 3LUBA 1DQNA 1WP4A 2GA9A 4GDMA 4MUIA 3U7FB 2K6GA 1UQTA 3DM5A 4PIPA 2FXVA 4DCPA 3EVCA 5DBFA 2QQFA 1ADCA 3IBCA 1IHPA 1YFLA 5LUBA 3T1QA 3CG4A 3PD0A 3C97A 1ZHOA 3GLUA 1ZVMA 3T3EA 1NIJA 4BFXA 4YJ2A 2BOVA 3STWA 3DUFB 5HZKA 1HLFA 1KPHA 2REXB 2IWRA 1H2BA 2CFSA 2MJLA 4HYQA 3VR6D 4R1OA 4R69A 4WDRA 3W0LB 4YY3B 2BYTA 3BC1A 2P4SA 3KJFA 2XMQA 1NA5A 3Q8KA 1Y63A 5ALEA 1RC8A 5LZ4A 2FWIA 3QYJA 3W2IA 3S8EA 4KDEA 1OXTA 4JELA 2XMZA 2G36A 2HK7A 5KYGA 3G2JA 2CCGA 4JU8A 1SIUA 1T25A 5TX7A 3MB8A 2GKOA 3TW4A 2VHZA 1IPHA 3KZKA 5DK4A 1OVMA 4CYMA 2R00A 1V7CA 1ADYA 4QM6A 1E92A 2VIIA 3BGVA 3R0ZA 1QWSA 1N3YA 1Z5ZA 3LHFA 4EJSA 3N2LA 4BWFB 5ITSA 2V9PA 3CX4A 5HEKA 5IT5A 1SJ9A 1Q17A 1PGPA 1REQA 4H7FA 3QW2A 1U2DC 1EQ2A 2PX6A 2ZUWA 3WGVA 1XVIA 4L9SA 1PR5A 1Z08A 4K6CA 1WPRA 3EQ6A 1UJ5A 5EIHA 1ZD4A 3FUVA 3HBAA 3T5CA 2OGTA 2L17A 3DLAA 2C1ZA 5TVGA 4MDEA 4RSRA 1JQ5A 2ERCA 2OHJA 4BYMA 2G6TA 5AUPB 3DHWC 3RFFA 1BD4A 4MHTA 1BQEA 1N4AA 1GCAA 1GILA 2BTQA 2QZJA 3LTEA 4YCDA 3MOGA 3PXBA 2PMKA 2H54A 3GDHA 4I2VA 4RPLA 3BTVA 4FYXA 1KSGA 1BX1A 3IV9A 3O94A 2AXQA 2ENUA 4UDNA 3TOXA 3SZ3A 4R8KA 3W5HA 4IAOA 1N0HA 4YB8A 2XIJA 2R86A 3MHTA 4RABA 4W82A 2ZJBA 2OLKA 3ABOB 4ZAFA 5EXSA 5KPJA 3MLEA 5EUCA 2QD3A 3A1NA 2OB1A 4EYQA 1AKEA 4DRXA 3OPYI 1JQEA 2CNWD 1H6AA 1GAWA 2WUEA 5J59A 2Y71A 5BW5A 1GXSA 1YAHA 4U9HS 1B6SA 2C8JA 1C2TA 2OK7A 2VPZA 2WJZB 3EXFA 5J1TB 3MXOA 3F96A 1OH7A 3GAFA 4P86A 4QT4A 3AR8A 4QNMA 5GADl 2XBMA 1BDJA 5A3SA 4QL3A 1IXKA 2ZZNA 2A9OA 4WBNB 5GM1A 4NZOA 1CT9A 4YN3A 4YJ2B 3BWXA 3AILA 5EYPA 3WGTA 3A6JA 3REFA 4IMJB 1GO2A 2NT3A 3IMGA 3OEWA 3Q85A 4QYIA 1Y1QA 4A6DA 3U3KA 1IHOA 1M72A 4M55A 1LV8A 1E3QA 4M38A 5DRTA 5JEEA 4KO3S 4R9RA 4AJKA 5K45A 1PW7A 2P6PA 1A9OA 1R0LA 1IULA 2WAOA 2YXNA 4L4SA 4TS4A 4FYIA 5EP1A 1D7OA 1E3DA 3AHIA 4OJQA 5A62A 3TZEA 5MDHA 5THQA 5T3YA 5JZVA 1VJGA 5F77A 4CETA 2GAOA 3WBBA 4BVFA 3SJZA 1UPCA 5F64A 3OQMA 4Z7OB 2QAGA 1ZD8A 4Z2AA 2QYSA 4D3FA 3DE7X 1OZHA 1L4LA 1SHTX 2FSPA 5EE0A 4QGFA 1F8YA 3SHTA 1FZQA 3I9V1 2GPTA 1C5KA 4QOIA 2RK4A 1OVGA 3BCHA 1OA1A 1BD3A 2XCUA 3FFBA 1E99A 5CB4A 2BR5A 1GNTA 3UB2A 2J07A 4MS3A 2GQ0A 4WKOA 2A8YA 1B8OA 1QYRA 2FLWA 4G07A 5EE1A 1MW8X 4KE6A 4R3WA 3CCFA 4LWPA 2WKWA 2ZWMA 1EE2A 3ZNNA 2QNRA 1WVGA 4JOQA 5MN6A 2H11A 2Y67A 1JW9B 4LYYA 1TCVA 2HUPA 3BM5A 1SXJA 3BJIC 3OZTA 1CUVA 1G60A 1SB9A 2XGMA 3PEFA 5BN4B 3VU0A 4E7PA 2GX6A 4KXWA 2B1RA 2C0QA 2CXNA 3R7NA 2IXFA 2P2LA 4XVUA 2BGRA 4BN5A 1V7ZA 1LDEA 2H59A 2C0PA 1ADJA 4US1R 1QUEA 3S2IA 1I51A 4KL8S 3T06B 5JS7A 4QUHA 5LLTA 4JYMA 2RI6A 4AP6A 5H4GA 1X0VA 3IELA 5THXA 1T0JB 4Z0PA 2DQZA 1CEXA 4QGGA 2A0XA 2OXTA 4E2XA 1EESA 4JKIA 4LCBA 4F3CA 2RHLA 2ZREA 3NAQA 2QN1A 3SE7A 3VTZA 3ZVLA 3TAXA 4B7CA 3WXMA 5CB8A 3F2VA 4A8HA 1VSQA 3FPHA 1OZFA 3S29A 4BNLA 2FN7A 2F00A 4FT2A 4KQHA 4DRXB 1QK4A 2CHUA 4JVNA 1KPIA 1KVSA 4JLBA 4ZEVA 2EP5A 1GXSB 3PXDA 2VTBB 1RE0A 1H94A 4EHNA 1ORRA 1RR6A 1YRAA 4LX8A 1G8FA 2I91A 1D7AA 4RH1A 1LU9A 2P0EA 1VE7A 3F3MA 3NDBB 4BQIA 1H2RS 2XXBA 3CHYA 4JB0A 3QVGA 5FTLA 1TAUA 3AEUA 2OCIA 3E61A 4M53A 1IG0A 5IM4A 4LJ7A 1Z34A 2E5LB 1ULSA 4R0NA 3FIJA 4FQ5A 1ST2A 5EYPB 2BHRA 2X0RA 5ALDA 4PZYA 1PT5A 8GPBA 5DXFA 4QNNA 3CRRA 3OWOA 2UXDB 3JZMA 3ZZTA 2BMEA 4HMOA 4FSHA 4U4AA 2ZJZA 5IVPA 3TF5A 2H9YA 4M49A 2W58A 2QG9A 1BVYF 3RS4A 1S2MA 1Q16A 5FUWA 2DR2A 2AZMA 1FXWF 3CGGA 1GVHA 3MUEA 1RJDA 3KKQA 3JQRA 4V0NA 3QLUA 4OL9A 4KB5A 1GA1A 1YKGA 2R4QA 3CCBA 3C3JA 4QDXA 1WE2A 1YKFA 4FKBA 3E2PA 3HEBA 1UXKA 4YCAA 3AUAA 1PS0A 2QDKA 2QAGB 1B15A 1LK0A 4JS0A 3GRKA 4NFSA 5FOQA 1FVFA 1ZK0A 1ZNWA 3TLYA 5HF9A 1Q7TA 4JI4B 1PJ8A 3JD3A 4C08A 2Q6IA 4Q4CA 3IH5A 1D2MA 1GUZA 1XMPA 2PUJA 5ARBA 2OMEA 4RVCA 5KYNA 1JFSA 5CX1B 4OUDA 4KXMA 4X61A 4YTEA 2YZ7A 2QV0A 1SZCA 4N0PA 5AHOA 1PF7E 4RA9A 4LDNA 3F73A 4YGXB 1XNHA 3MWLA 3PPXA 5AKIA 2XCLA 4LDRA 1RS0A 1A82A 2RGAA 3P9ZA 2JHFA 1X86B 2GBGA 3QI7A 1M66A 1SXJB 3F67A 3GN1A 2NZ2A 2Q45A 3EXIA 4D3DA 1H3NA 3AJ9A 4A7PA 4GKAA 1L5NA 1AV6A 1A1SA 5J58A 3BSYA 4G5HA 4KAAA 4D9GA 3L9WA 4Q47A 1KZ1A 2FSVC 1WZIA 1DFHA 3G2PA 4JBXA 4YLGA 3VXKA 2NYAA 3DNPA 4NDAA 1UBLS 5L7TA 2GZ2A 4N9WA 3SM9A 2XX3A 1TEHA 2CLMB 4UZFA 1YRQA 3MINA 1XL1A 1U7ZA 2MSKA 5ICCA 2BKLA 1E3IA 4XH9B 5JNVA 1YOVA 3Q11A 1LCIA 2YVUA 3HTXA 5EXTA 1IHUA 2JANA 2WSMA 5JC8A 3QWHA 1Y1SA 2AZTA 3EFOA 3FUTA 4Q3KA 1XJWA 2J5RA 1NBMA 4K9PA 5LYYA 2RGDA 3KYBA 1Z0AA 1DIBA 5P8WA 4C7VA 4DUGA 2JLXA 1SNYA 5TQ0A 5FUVA 4A2CA 4I4TA 5JALA 2JLUA 2Y0CA 3NNSA 3GIDA 5AKLA 5B55A 1OI7A 2VDRB 3T3NA 1BA3A 1IUPA 1DOHA 1T2EA 1SQFA 3OQIA 4RDIA 2JAQA 1PBNA 2IUSA 2Y9MB 4J91A 4AG3A 4ZMSA 3VPDA 4HDNA 3TR5A 1M76A 3AEUB 3VU8A 2Z0MA 4LZZA 2J5KA 3C8DA 2J59A 2GWRA 4Z9AA 4BNDA 4MPRA 3RIXA 2OG2A 4HNQA 1TZBA 1NE2A 1WHSB 1RAAA 1YL5A 2D2IA 2FSGA 4GLBA 3VDQA 4LBYA 3M8KA 4WASA 5J4HA 1W36D 1FJGB 3TRDA 1EBFA 3QPWA 4EO7A 1KOFA 3R7BA 4AP9A 3NP9A 2YVAA 5DLQC 5CJPA 4UBIA 2XXAA 1P80A 5HRCA 4LXYA 4WOKA 1U8UA 3E6AA 3ESDA 1A4IA 4H7IA 1UM9B 4BPBA 2LIVA 4LDAA 3W5CA 4E5MA 1QWOA 3OTWA 4MUEA 2AZXA 2ZJ4A 3LECA 3P1JA 3ZCXA 4EVRA 1W5AA 3BX1A 1YA4A 2JVJA 3AC0A 4RHEA 2GVDC 5CDFA 4W9MC 4EKDA 1G3IA 2HCBA 3LX5A 4B6SA 2GPWA 1V8DA 2J45A 3A4NA 1XLWA 4FBMA 4H4CA 5EIBC 2XTAA 3JD0A 5EJ8A 2X8JA 3SEZA 2EG5A 4UD2A 1HG1A 5AVJA 4F7WA 2BFBA 3CUTA 4KLNA 2JLQA 3PA6A 5IT0A 3V8PA 1JPJA 2ZYWX 1NSTA 3OP4A 5EMMA 3D4IA 4RTRA 3I58A 5A1JA 4FYVA 1OLUA 2IPNA 4Q5IA 4QSMA 1LD3A 3AHFA 4K9NA 3A32A 4PAMA 2OPBA 2XUQA 4L28A 2XNDD 5HCIA 4CM7A 1N5KA 1LVHA 1Z7WA 1QG4A 3NFRA 1VLZA 3NWBA 4OHBA 2IOFA 2PKEA 5D01A 1E7RA 2ZITA 5B36A 1FTGA 5BN5B 3UJ6A 1FU8A 1S89A 4DA9A 3BE8A 4FMDB 1MAAA 1YS2X 1RM4A 2ZP1A 1TJYA 3FXAA 1R0RE 4OAPA 5IKOA 5EMHA 5G1PA 3RRXA 5GZ3A 4LZJA 2GDZA 5EIBD 1QH1A 2YV4A 4YPFA 5C2JB 4V0ME 4RD4A 3EFBA 1JJIA 2EIXA 3T9CA 1L4NA 5KX5F 3LCJA 1BU5A 1GT6A 4IRUB 5HDQA 1VSBA 4GPIB 4CLXA 4LX0A 1WW2A 2RC5A 1KIFA 5LVAA 1NBEA 5BV1A 3A58B 1BXRB 1RXEA 4IM7A 1PJBA 4BV9A 3MWEB 1QAMA 1HYGA 1XE3A 5CNKA 5A9TA 1P5HA 3BSSA 1F0NA 3G85A 1X1BA 4I4TB 1MB3A 1DHTA 4B3GA 1X1RA 4F56A 1GRCA 2OP1A 3PDJA 2BI8A 4TKZA 2G8NA 1JG1A 1ODFA 1RXSA 4WUTA 4CM9A 2YY6A 5D86A 4NDNE 1RM0A 5AW6A 4HDNB 2WU4A 5EJIA 3U3DA 5BVHA 2OBFA 3D54D 4BE7B 1Q2XA 1RYEA 3CN9A 2O2IA 4FNGA 4KWCA 1HT2E 5AM4A 2R6DA 3UKJA 5TNXA 1SUPA 4Y6PA 3QMWA 1KJNA 1YUNA 1I5OA 2P9FA 4YHBA 5K3CA 1H3EA 3VU9B 1F8FA 1W2GA 1UBHS 2HF2A 3I9V6 5CVCA 5BQ5A 3LDHA 4QATA 4Y6LA 3EZGA 1MA3A 5JVDF 2PJDA 4U8HA 1ZRNA 3AW9A 3GLSA 1ISPA 1CV2A 4RZSA 1HDOA 3E22A 1LDGA 1SCQA 3HB5X 2AR0A 3PXXA 1JXQA 1CWUA 1XZBA 2EX0A 3QI2A 3I6IA 4M22A 1NP7A 3CURA 2J3LA 1NAIA 3ORQA 4LJAA 4TVKA 1A96A 5CW1A 5E4YA 1HETA 2NQTA 5M3BA 5K7SA 2CMFA 3PWKA 1E9SA 4WA7A 4MW7A 3EGDA 4WOCA 1I3LA 3J81A 1B42A 2EFCB 1YQ9A 1I36A 4ID9A 3LO8A 1Y8CA 3HBJA 1PWZA 4JC4A 4QDJA 3UANA 3U9LA 3UJ9A 1MO6A 4O4LA 4R98A 1TMOA 3BICA 3G5AA 1GN8A 3KTAA 1U0FA 4Y1FA 4NAVA 4KQWA 5J2TA 1G5PA 2UZAA 1ACMA 2BFBB 3GFPA 3G5UA 4V02A 4DXDA 1E1KA 4BRUA 3KXDA 3GCZA 3VZDA 1O95C 1D0IA 1MHPA 4NJEA 3CCCA 4I50B 3U0VA 2C29D 1RAFA 3GNQA 4DLLA 1EVZA 2QLJA 1MUUA 4WK6A 2K87A 3AF5A 4FHDA 1KNXA 1UT5A 4NBKA 4KQ1A 4P8RA 4CM9D 1KYXA 2DVMA 2WP0A 5DULA 3GV0A 1U90A 1ZFNA 4EGSA 2ZUCA 3O95A 4FSXA 1RABA 2GEUA 4HAOA 1T2AA 4OYLA 4NYJQ 3VNBA 4HCJA 2CVPA 5CLGA 2H0AA 2YOHA 3B3GA 1QHIA 3GA7A 4IGFA 3NRBA 4CIVA 1EM8A 2GHRA 5L3SA 4Q9IA 3OH8A 1LPSA 2BGLA 3U3JA 4HT3B 6REQA 3KEOA 1SQ5A 2J1LA 3FGZA 1EFAA 3KTFA 4D9FA 5MN5A 3CX3A 2W42A 3DM9B 4CDGA 1XD2A 5E4JA 1O95D 1V95A 2H2IA 1P4SA 4WZAE 4C0KA 2DU8A 2FFJA 2Q8NA 2X8BA 1Y0BA 2XMCA 3HCEA 1PX2A 1UM8A 2CHFA 3NTVA 1EWQA 2GM9A 1IQPA 2ZK7A 4XWWA 3U2QA 1T1EA 3DOIA 3Q7PA 1QQBA 5DT9A 3EEYA 3GGGA 3ND6A 4JHLA 3OUZA 4ZZ2A 3IRUA 3GG9A 3S2YA 1N1MA 2O14A 5KNDH 4A0SA 3K5HA 3PICA 2AS0A 3HI6A 3I42A 4RDXA 2H5JA 2K7ZA 3MGGA 1CS4C 2R96A 4XM1A 4ZIRA 4DR1B 1RVV1 1E2KA 2WD7B 3TZKA 2DETA 5I8WA 3ANTA 1K1EA 5CT9A 1M1YB 1Q0HA 3SNKA 1P2TA 3RF6A 5TB5A 2QTVB 1H8HD 2BMWA 2HJRA 3H65A 4LDQA 1YRLA 1FP6A 4C14A 1RKXA 5B2FA 2M6SA 3Q10A 4I1UA 4CMJA 4MUMA 3N76A 3VR6H 2CE7A 3K6JA 3Q8XB 3GAAA 4HQ6A 2BZ0A 4OREX 3L02A 4QFCA 1FIUA 1Z15A 3BRCA 3RRFA 2ZAOA 4Y6SA 4NOMA 4LWQA 1Q1NA 3EUFA 1XCGB 3T5TA 1GTZA 1PQUA 1R18A 3CJRA 3ESZA 3FCXA 3N28A 4FYYA 4IFTA 4PYKA 3RCBA 4ZYUA 1TJNA 3D59A 1TEZA 2OUIA 1D1QA 1A5TA 2W4IA 1P72A 2VNHA 3QBEA 4RX1A 1XTJA 4MRNA 3SJAA 4A27A 1LEHA 1DI0A 4DANA 4J0HA 1HZJA 1SEVA 1PFUA 2OQVA 4IWNA 1GAQA 5EJ9A 1DCMA 2OV3A 3DAHA 1AUXA 3KBBA 5BORA 1UFRA 4PYLA 2ZT8A 1EWVA 4FYHA 4O4LB 1X1CA 1UJBA 1KS2A 4Q7JB 1J06A 4R71A 1Q95A 4L5IA 1JJFA 1L7BA 2P79A 3GHHA 1IN8A 2HF7A 1VQ1A 4ESVA 1KFJB 3R3SA 4HPJB 4JJIA 4NJEB 2H2GA 1N3LA 4CF4A 1WIWA 1PYDA 2ZIZA 1JSLA 4HS4A 3QMMA 4FP9A 3VPFA 4UUBA 4ALNA 4TXHA 1CUZA 2P9TA 1J99A 3HYLA 3H3JA 4PNZA 9ATCA 5KTPA 2IIQA 2A14A 1HTBA 4QOFA 1HG0A 3OLQA 3H9JA 1C14A 2Q1WA 3EOBI 3NAMA 3QYFA 1JEJA 2BRUA 1JLLA 3A2MA 2WJAA 5DLPA 2RCYA 1OGJA 5GV7A 2WZQA 1U04A 1DEOA 1SZPA 4G0ZA 4UBKA 4A82A 1YACA 2QRMA 4OATA 4ZZIA 1YK1A 3V3TA 3GJXC 5K0LA 4BE9A 1TKAA 5L3SB 3N75A 1NN5A 5FBQB 1E7YA 1UMBA 2B1GA 2G9UA 3D0RA 2XR1A 1C30A 4HQOA 3O0TA 4D5EA 2I6QA 3CLKA 4BU0A 3PC6A 1Z73A 2CSUA 1JDJA 4R7ZA 4MZDA 1F2TA 1ND5A 5E7MA 1JKJA 4W5OA 1LLFA 3ZH9B 3OKCA 4FDUA 4B3BA 5F7JA 3UJDA 3IJ5A 4B1FA 1OV6A 3FPEA 3K16A 1RPNA 2BRUC 5A4MS 4ZVQA 3QSYA 3ZD6A 4UXJA 4BGEA 3EODA 4XRRA 1JVNA 1UMDA 2HCRA 4IXTA 3KDAA 4IW3B 3RH0A 5DNYB 4CMKA 3DFUA 1II9A 4DR7B 2P3QA 2SKEA 3DVRX 4IIXA 4F21A 4E09A 2ZSIA 1SG0A 4X1IA 3DW3X 1IVYA 1X7WA 4X91A 4XWYA 4WOBA 3UOGA 2UYYA 4LSGA 1JAZA 1IEXA 1E3WA 2QT1A 4IIYA 2X2EA 4BO9A 4EB8A 3CRW1 4YUZA 4CIXA 1ZYUA 3WLOA 3K1AB 5CM9C 5DI9A 4EFMA 5HUJA 1S9DA 5TGZA 3ROTA 3TIIA 1R37A 1OBVA 3L49A 1IEWA 3C0KA 3TVDA 3IO3A 4POAA 3W4IA 2GMWA 1E1DA 1RYMA 2P75A 3BE5A 2FEWB 3K0EA 3TOVA 3AUJB 1VG1A 2DWQA 3IXQA 3STXA 1B93A 5DEOA 5E9QA 4QM7A 4FM9A 1R9JA 4COOA 3RVSA 2NO9A 4Z4IA 1DFIA 1TKCA 4NI5A 3TZQA 1E18A 1P44A 4Z4GA 2PU5A 1E7QA 1BYUA 1N25A 1XA3A 2VHXA 2YV1A 3BCUA 4QEKA 5C4MA 4KFSA 2C2XA 2DQYA 2RAUA 5DM60 2NYVA 3CX8A 1XN1A 1LI7A 1H4QA 1Z45A 5EVCA 5CYOA 5LA6F 2WU8A 1UBMS 2HJ9A 3HA5A 1YU6A 4KQCA 3Q5DA 2BAGA 1F8GA 1ZISA 5CYFA 2AC7A 3GUVA 4YAKA 5JMWA 5JR3A 5E6SB 4MX8A 1R0WA 4U7PB 1E77A 1EEXB 3NDJA 1FF9A 7MDHA 2NZ8A 3KC2A 2VRCD 2X9LA 2F8SA 1V1MB 3G0DA 4R81A 1UZNA 4EKIA 5FULA 3DZCA 4NYMR 2V7GA 4QPDA 3ZU4A 3RO7A 1J97A 1YJXA 2OFWA 3KAKA 3WFIA 2D2VA 5C8ZA 2ZIWB 3B5IA 3E5MA 3NANA 6LDHA 4XGKA 5JD4A 1JLLB 1Z0IA 2NO1A 4JC8A 3V80A 5D85A 3WMFA 5IFKA 2J0SA 3THYA 2I3DA 4FHGA 1XVUA 4MA5A 3BXHA 3E7FA 1VL8A 2XDAA 3GRPA 2KB0A 3MSXA 2OILA 2CB0A 4R2IA 1GU1A 3T38A 4HV4A 2XPCA 2EKZA 3R3UA 4ILKA 4GOKA 2I2XB 1C30B 1CJBA 3OJ0A 4QNRA 5AUNB 4BGDA 2ZI5A 3H7IA 2OYRA 3C15C 2HN9A 3TOCA 3PS9A 3OSZA 3BWVA 4OUKX 2G9ZA 2ZE7A 3NORA 4KV7A 1UXGA 1ULHA 2E18A 2JLAA 4WCFA 3CW2A 1N7GA 4YA6A 4MUXA 1JBKA 1JYSA 1Z82A 1B73A 1VI6A 1L4KA 1WD7A 2AYZA 3M6VA 5T5QA 5HE9A 2O1SA 5L3VA 4YDSA 3OJOA 5DGIA 2ZDGA 4LF5B 2FQ1A 1E4VA 1OX4A 1Q1QA 4RETA 4BV3A 2IYRA 3CA8A 4TROA 2BKXA 4H7HA 4MUYA 2R2GA 1UMDB 1GFZA 2B34A 3GD7A 4HZUA 5K3OA 1G17A 3QJGA 3EF1A 4ITVA 2JLCA 4MWBA 7YASA 3NHKA 4NPAA 4X1IB 4F4CA 3D7SA 1X7WB 4RS4A 1KFBB 3NVDA 1K5PA 3GEIA 5J47A 3IP9A 1II0A 5F2KA 3TKLA 4R8MA 1IBMB 4YRNA 4R2LA 3UKOA 5EZ5A 3VMFA 3ND7A 2YW2A 3M5PA 2PUVA 5H81A 2JC3A 2OOKA 2JGDA 1IWOA 4PYMA 4TTAA 2IV3A 3TDKA 2AI2A 1G4AE 3ND8A 3INYA 4LOAA 3K6KA 3VPSA 1CS0B 4OX9Y 4LYFA 1TU0A 3CH5A 5FDFA 1ENYA 2HEGA 2R62A 1DC7A 1BE1A 1XKXA 1YZYA 2WYOA 1LQTA 4J1SA 4OXQA 5JDIA 4DB2A 2UUPA 3I09A 2Q3EA 3KUDA 1AK9A 1Z8DA 3ES9A 4AMVA 3W6PA 5MN4A 1YI1A 3ZBPA 5KTKA 3KKNA 3P9QA 5JNUA 1PO7A 5J4LA 1XYYA 5BY2A 4TTIA 3VOTA 4DQXA 2QLNA 2R7LA 3LUJA 4YXWD 4RSMA 3CQ9A 3ZXSA 4GLLA 5KYWB 3R9XA 1ZCBA 1OAOC 4N7BA 4PGHA 4Q7LA 3OTOB 4OYRA 2HU8A 2YJGA 1SELA 2PS1A 4Y0NA 2XAAA 4DILA 1IAQA 3UJ3X 2O19A 4A73A 5AJYA 3LC0A 3KBOA 5IBPA 3UAOA 2VDUE 3GG2A 4I81A 2JGLA 5TMBA 1W4BA 2O8DA 1N2SA 3FBGA 4MS4B 4PRZA 3ZBQA 2R47A 1GTJ1 3AEQA 4B17A 1G8YA 1H0RA 2SCUA 4E22A 4A23A 1W85A 1TVKB 1K7YA 3FCCA 3KXIA 2AJBA 2YIMA 5JWRA 3NOXA 1VZ3A 4HEA6 3WRYC 2G0TA 4KO8A 1YDFA 1MOZA 2WTAA 4FWIB 2XLBA 3AUSA 4X65B 4ZT4A 4BFYA 2LDBA 3VZPA 3K9CA 5EJMA 2II6A 3D3WB 3G0OA 3FB1A 2H4YA 3W3AA 4DKJA 3BAFA 5ANRB 1ZGBA 5CDYA 3UUGA 4KR0A 3JD2A 1Z6PA 3UQYS 4R1TA 1TUEA 2Z9CA 5FT9A 3ANNA 3RVBA 2BFEB 1NN0A 3DDOA 1BGWA 1P7ZA 2GNPA 1R0CA 4XFKA 1CB7A 1PJTA 2Q50A 4WCFB 4YAOA 3ESQA 1J2RA 4G8JA 3P52A 4C04A 1X19A 3NPMA 4BVAA 3RVDA 1U11A 1G0NA 2YWEA 3WOVA 3NP7A 1MIHA 2VWHA 5ALUA 2PFKA 1VSTA 3FY4A 1C7RA 1PGQA 2J0UB 1NUQA 2JPDA 4Z3DA 2ZE5A 2DUUA 1Y98A 5A2GA 3V4RA 1SCBA 1T0HB 2BHLA 5LP6F 1ISJA 4QUDA 4MQ6A 4F2WA 1VYVA 2MSEB 4CF7A 1RZRA 2GEBA 3RS0A 3B3AA 1TQ2A 1E2NA 2AQIA 5KHAA 1P0IA 2WYUA 4B84A 1G3MA 1O2DA 3A0RB 4RE5A 4G0VA 1T29A 1GSOA 1SBTA 2JGDB 2JKYA 4XVQA 1OBOA 3LT5A 2QR2A 3TTSA 4I8DA 4QO7A 1PDWA 1RRGA 1YJQA 3HDGA 1FDVA 3TPZA 5E4TA 3GLIA 2IIPA 1P9NA 1H1TA 5DMXA 1XZQA 2FP3A 1W8DA 3OPMA 4HVTA 1I5RA 3OEED 3IEUA 4M1TA 4Q9KA 4OHPA 3OCCA 4V2UA 3NOQA 1DBQA 3NHWA 3FH0A 4H35A 1NBHA 1VB5A 4BMSA 2FDRA 2FETA 6GPBA 4YO7A 4DLPA 2J9XB 3PGLA 3OOSA 3ZTYA 1CY1A 1I6KA 1QIGA 2BW0A 1V96A 1YFKA 1LS6A 3G8DA 2ZOSA 4I0WB 4MVJA 3W5SA 3I9NA 2L82A 2VPYA 4RK6A 4K2HA 1Y7IA 2M2IA 3DMFA 2O8DB 4X0EA 1C80A 2VG8A 3TJZA 3S2EA 2GCOB 2PUEA 4Q3NA 3KCNA 2FN9A 2ARKA 2JKZA 2D5CA 1PT8A 1R6AA 2GLXA 2WJJA 4N3AA 1P2VA 4O8ZA 2WT9A 4QX6A 4U9IS 5DHFA 3F46A 3RVNA 3VYTB 2PHZA 1BGVA 4RF2A 1U2EA 3KO8A 4PRYA 4E3WA 1O87A 1UANA 1VG9B 4BJ6A 3C6YA 4QXMA 3F3KA 1ISSA 1ZN2A 2AOWA 3IC5A 2M6KA 3R76A 4CM3A 3UM9A 4XWOA 1ZK1A 4EUFA 1H2FA 3PGA1 2YY5A 3D7RA 4BVHA 1EQAA 1M6WA 4JJKA 1QQAA 1M8KA 2Z1NA 4MP6A 4UMVA 1BJTA 1SC4A 1XZGA 3DBRB 4HWOA 1VMEA 4ASUD 1ML4A 4Q1BA 4BVGA 2QT0A 3F2IA 2CNOA 2X9QA 3O9MA 3RSSA 3A6GA 1QYXA 1T5IA 2QYHA 3EUEA 4H0NA 1O08A 4X6UA 4X60A 2EDCA 5AVKA 3GU3A 4ENQA 5KTNA 4MWZA 4FFMA 2FFHA 4V3CA 2Y1GA 4J8PA 4MTCA 2REOA 5ALQA 1QJCA 3TLEA 3MJHA 1ZAYA 1ID8A 2I3AA 2XJ4A 5GGYA 2W37A 1PGNA 5C8YA 3T9FA 3URMA 5HQ3B 3FPBA 3P94A 3SFVA 3RJ9A 1VRVA 1XMSA 1Z6ZA 2H31A 3OFKA 1RWKA 2CHEA 3DBOB 3LA6A 4Y6OA 5DHRA 4OLBA 5L40A 1OC4A 3URKA 4F85A 4JJEA 2C4UA 2WIFA 3L9XA 2HK6A 3U26A 4RZHA 2I2DA 6Q21A 3L01A 1ZD3A 3D5TA 1BRTA 3LUAA 4UAGA 3RSFA 3NJRA 2UZ0A 2YWFA 3K1YA 1W4LA 4ZEMA 4DCUA 3RVKA 4ZCQA 4R1UA 2QORA 2XEXA 1NP6A 2JI8A 3ISVA 3L1KA 5FD8A 5FLKA 1XYVA 2DFNA 5HFNA 1JP7A 5BYBA 2IY9A 1C1XA 1TUBA 4IS2A 1TADA 1I5EA 4E3ZA 2P2DA 3CISA 5TY0A 1R2QA 3D8HA 4DR6B 2A5DA 1EA5A 2EJBA 3GLIB 2HB6A 4G0PA 2FGKA 1C2YA 2ZYAA 4KK3A 4W5TA 2WQ7A 5HFJA 4FFLA 1AMNA 4OLAA 2HV9A 2QIPA 3GRYA 2NPOA 4WHMA 1YE3A 5K8IA 2JFBA 1YZFA 2K4MA 2Q0XA 3OX1A 2ZVQX 4XEHA 5SICE 3M9LA 4BKOA 1L5VA 1YHZA 2PV7A 4LF6B 4AY4A 4QVIA 3ESAA 2XEDA 5K05A 4P3YA 421PA 1YB7A 3O4HA 1JDUA 3R6DA 4DBZA 5B4TA 1QIEA 1NFRA 3QUCA 4O25A 4MWOA 2H2FA 4WLEA 4S1NA 1QOPB 1JT2A 3R3ZA 1R4AA 1GKLA 4WNAB 3EH1A 3ZHOA 1BFDA 5CEEA 3KQMA 3QVSA 1C3OA 3HDTA 3KE8A 1QLWA 1P9WA 3TD9A 1EDZA 2TYSB 3W8EA 2JK0A 3PFHA 1N2GA 4IIJB 3UXMA 3KE9A 3MWDA 2BONA 4FFBA 3KV3O 4FB5A 2I4MA 3T6KA 1C1YA 1QZ3A 3CJQA 1FFHA 2AMJA 4MKZA 1FRQA 5A4JA 4KN8A 1FJ2A 3VZBA 5I7UA 2PMWB 3PNKA 5AOBA 4NU8X 2ZRNA 2PA3A 1HLDA 4NZNA 4OXIA 4ISBA 3WFZA 1DBSA 2IXBA 4J2TA 4K6KA 4EJMA 4HAXA 1A4UA 2O2XA 3PHGA 1C4KA 4YUAA 3E3NA 4B76A 1T35A 2PSHA 1TFUA 4C0XA 1Z06A 3PUIA 2IP4A 2VJCA 3DLBA 3ZCUA 1PLJA 3JQPA 2MINB 3L0OA 3R0JA 3GMSA 2WTEA 1CUWA 4IVPA 5EWMA 2BF7A 4K9KA 4XEUA 1T5LA 2HTEA 2XT6A 1HLPA 2ZBUA 4HS9A 2E6KA 1GQSA 3P45A 5CXUA 5JSZA 1A04A 3C3EA 3RU9A 4PPYA 1ZG3A 4UVEA 2C7BA 5B37A 1N7IA 3K8ZA 4JI0B 1DTWB 1DJOA 1R27A 3AFGA 5E1BA 5HKKA 3VMMA 3P27A 1NVWQ 1KNQA 2ZRLA 1DJNA 1RWQA 1QZUA 4B80A 2R5FA 1FA9A 3JYOA 1O6ZA 4XKJA 4AX4A 1DB3A 1EK0A 3ESYA 2VZ8A 3TTWA 5KSYA 5EXEA 1U9JA 4WLFA 2FP4A 1FTSA 3K9LA 1M34B 5KX5A 3S28A 3SIXA 4Q9JA 3M1IA 2CZGA 2XSZA 3GP5A 2ZU0C 5B6JA 5FLYA 1C1XB 1U9ZA 2B5VA 3ETGA 3FCSB 3OCZA 4NNOA 4WFJA 4BLRA 1TYCA 4EL5A 3GEGA 3JVUA 2VJOA 3ZUPA 2O5VA 2OTCA 3OF5A 5DVZA 5FA8A 4D74A 5K9ZA 9ABPA 2XVXA 4WE3A 5L7WA 1R3DA 4DA4A 4D3SA 2FZ5A 2PBRA 5DBIA 2Z08A 1NVEA 1E1RA 1NXSA 1UR5A 2GFIA 1NPDA 2PUHA 4FD2A 1NE7A 1QCDA 2ZG6A 5E3IA 2IH5A 4C06A 1D2RA 3KVRA 4JT4A 4MQ5A 5GOZA 1GPYA 4IIFA 3T1OA 4Y0VA 3L79A 4XASA 1Y9DA 4ARZA 4KGDA 4UM5A 4F38A 4YAWA 2QT9A 4PZLA 4DIUA 2VJYA 2O48X 4KR6A 4WKNA 3JYNA 5KYVA 3OEYA 1NUPA 2AYYA 3QFSA 1SCIA 2QPTA 3JQFC 5GPBA 4QBIA 1SUEA 2EOAA 3QUBA 3TQFA 2O8FA 2C4WA 3KQNA 2W2LD 4E6EA 1TQHA 3M70A 4AO7A 5CLLA 3AP3A 1DWUA 3CONA 2MSCB 4I4NA 3MWDB 5EA2A 1XA0A 3WYAA 3AESA 5CDFE 2Z8ZA 5KOYA 4AICA 4V24A 3E8MA 4MH0R 1K7CA 1HE5A 1T0PA 5ALMA 2WSBA 4OBWA 1T4GA 3QNWA 5IJZA 5KC8A 2WAXA 1SHJA 1ZITA 3AM5A 3KKPA 3PFNA 3RTDA 3VV2A 3A70A 2BUBA 3WB2A 4AJOA 3ANYB 4PGMA 1E3TA 3W7VA 2B2NA 4OEHA 5IC6A 4E7OA 4KEAA 1AJEA 1EFHA 4RZXA 1IDN1 4YV2A 1JN0A 3W04A 1SWWA 4JUAA 3AI7A 3IE2A 2ZAGA 4O2LA 3GFVA 2XTNA 1K68A 4BY9E 5HIAA 2B8NA 1G8MA 3GL9A 4PR3A 1KDVA 1KXJA 2WG1A 3QKSA 4MQ4A 1OLOA 4KIFA 5EFZA 5EWMB 3WIOA 1HK7A 1P2BA 1C7IA 1GL6A 3CN7A 1M8JA 1E5DA 4KPEC 1KYYA 3HU3A 1ANKA 1X1AA 5DE3A 4UBNA 1I4WA 2WA2A 1ZUWA 3ZIUA 3ASZA 5EWJA 5JSZB 2FN8A 4B75A 3BSWA 5ECWA 3CVOA 5E7JA 4E15A 1JF8A 1YE5A 1FNSA 4GGOA 4LF7B 2MSNA 3GEDA 3PXAA 2O7RA 3GGCA 3O3OB 4YRFA 2I6FA 4A5SA 4U7HA 4LF4B 4RTJA 1MX1A 4G85A 1ULAA 3EUAA 4A36A 4QOJA 5JS2A 3F74A 5JQGB 4ZI3A 1IQ0A 2I2AA 1Q7BA 1QO9A 2Y27A 2DAPA 1L5KA 1CZHA 3WIUA 4LC1A 4YAEA 4ZANA 1TYZA 5AK4A 4E2ZA 1C9YA 2OO5A 4PHCA 3T7SA 1JIIA 2GBLC 5BVGB 3KWJA 4N12A 5AW4A 2FEMA 1Z88A 3USZA 2D1FA 3OIYA 4B8YA 1HSOA 1M3SA 1GP2A 3G23A 3PJFA 3A9SA 3CEJA 4LXQA 4CLDA 3FR7A 4X8LA 2A9JA 3CKKA 2DBVO 3GEBA 4CKBA 1YZUA 1YASA 4XYGA 4LHWA 2WWHA 3LNTA 4A92A 1XVTA 4C05A 3AZQA 4JJ7A 1SQGA 3F6YA 4WESB 4F4IA 1GRNA 3BMCA 1I32A 1M1YE 1R6UA 1BDBA 2V8OA 4TT3D 4LOKA 3KKKA 4UNNA 1S6YA 3C3CA 2C20A 3W90A 2M32A 1R8QA 3KP1A 4KDRA 4OAOA 5JMPA 2I0FA 1CRLA 2DFVA 2IFTA 3FYUA 3ORFA 3BN3A 2G9VA 4W9NC 3JZDA 4KWTA 4LHSA 4OXYA 2JD0A 3MT8A 3H5OA 4IP0A 3DHNA 1U1DA 5LZ2A 4BGIA 4UMDA 2BGJA 5TXGA 4HN2A 1LFAA 2OV4A 1YRHA 1OAAA 4Q3CA 2PFGA 2C54A 3CE6A 4C4AA 1GJRA 1P1JA 3KPVA 2AZ4A 4M1EA 3FHTA 1RXWA 1QG2A 5FWXA 2JFXA 1P3JA 1ZNYA 4NG5A 2HXYA 4ZD6A 1LF0A 4ZREA 4FE7A 3ETJA 3KFVA 2BFOA 1KEPA 2JIPA 3KT0A 4HPXB 3ROFA 2JI9A 2BP7A 4DLNA 5M04A 2A88A 3AEKB 3UCEA 3WVNA 5BSRA 2D1SA 4X45A 2DE0X 1H8ED 4MUGA 2QMUA 2FEAA 2DULA 3MJRA 3HRKA 4LXGA 2XA1A 3GJ6A 3IAM6 3KJXA 3DBHB 4TZ6A 1NXXA 2C2OA 4R40A 4RLQA 3C39A 4RJTA 3ZVKA 3GXOA 5IYZB 3EB9A 1J20A 1U0JA 3EVEA 4K28A 4RJ2A 5F7OA 1DOAA 3L92A 3TEJA 1A2QA 4JXJA 2FZWA 4JASB 1PVDA 2XE8A 4KREA 2JAOA 3AHJA 3D7NA 1JTEA 1U0OC 1VA5A 2H5LA 2KW5A 3RFXA 3KQWA 5IXYA 3ZUGA 1JWBB 1TYDE 1ACLA 3N2KB 4YJGA 3LKDA 4QQFA 3UJBA 1QPZA 5EWJB 1DE0A 4BAZA 1K0UA 4C78A 3LK7A 1ZR2A 3SG0A 3MCAA 3TZLA 5LZ5A 1TAQA 1Z7BA 4BLVA 2XDYA 1FRZA 3A6KA 1W88B 3AXSA 1UEJA 1W4CA 1Y3HA 3TS1A 4ZOEA 4PAGA 4YP5A 1JI3A 5ABPA 1SKAA 2Q9CA 3AVWA 3COJA 1YB6A 3E3AA 4B2IA 1U28A 1VJ0A 4RKQA 1IJFA 1X80B 4BBJA 4A8JA 4RVNA 2G07A 1KJ9A 1WD5A 4QKQA 5CA0A 2CYAA 3TJMA 2QXUA 4UAVA 4B4VA 4G09A 3AWIA 4W6ZA 3OCWA 4E1AA 1XFAA 2IQIA 3FUUA 4BFLA 3VKHA 2WG2A 1GNRA 1I2CA 1LA2A 4RCYA 4EY7A 5EJ6A 5KVCA 5HBGA 3GRAA 3KXKA 5C7YA 4XFJA 1X7ZA 3MTIA 4HGYA 4TQ9A 3IAFA 1U0LA 3AW8A 4HR7A 3QVKA 4OB6A 4XDZA 4A8TA 3WK9A 5KWJA 3V34A 3SZGA 2VTVA 2ON6A 3H0CA 5D1HA 3HBMA 1JZTA 2WF8A 2F9LA 5IBCA 2CXTA 5AI4A 4EG8A 3CNEA 4W5HA 1ZH6A 2E87A 4A8JC 2AVDA 3VTAA 3LUCA 3I2FA 1K97A 2EV9A 1TQ6A 5JPDA 3OZSA 3DZFA 4FFVA 3ZV4A 1GRQA 5JHGB 1I14A 5FTWA 3K30A 4F8JA 2HGZA 2CJXA 4CBVA 1BU8A 2PKWA