5CFPA

Crystal structure of anemone sting (nematostella vectensis) 'humanized' f276k in complex with 3', 3' c-di-gmp, c[g(3', 5')pg(3', 5')p]'
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
181
structure length
181
Chain Sequence
KNVADGLAWSYYFGYLKFVLPELEKQIEKTSKFRSKEKFVKKMFILIPSNCFWDDKIPGSDYDPQNRITFEGNTEPLEKTRGGVKLRHYKHSVYEIKDGENEPWFCIMEYATPLLTLYDMSVAQPGELSREERDAQVVVFLRKLQDILEGDRACQGKYELVTFSPDRDLADVMLRKLKDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Stimulator of Interferon Genes
publication title Ancient Origin of cGAS-STING Reveals Mechanism of Universal 2',3' cGAMP Signaling.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Immune system
total genus 51
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cfpA02
4LOHA 4QXRA 5CFPA 5CFRA 4F9EA 4QXOA 4F5DA 4LOKA 4EMUA 4QXPA 4LOIA 4KC0A 4EF4A 5BQXA 4F5WA 4QXQA 4EF5A 5CFMA 5CFNA 4JC5A 4KBYA 5CFQA 4LOLA 5CFLA 4F9GA 4KSYA 4YP1A 4EMTA 4F5EA 4F5YA 4LOJA 5CFOA
chains in the Genus database with same CATH superfamily
3BE8A 4DLWA 4J1QA 2B5VA 1BN6A 4FYIA 5BNTA 4NCIA 3VAAA 1DQPA 4FQ7A 1TUBA 2IELA 1Q0HA 3MOSA 1PR1A 3AHHA 3KAQA 4OCZA 3EAQA 5AM1A 4LJ5A 1UBFA 4OBEA 4JJIA 3IQEA 2I66A 1PYGA 1VPDA 5ERGB 1VKJA 2FPKA 4TYQA 3TW4A 5EJ9A 4GBED 2VHTA 5AKIA 4C2UA 3H2IA 2HXYA 3MIIA 3E84A 3NHJA 5KYWA 1L5OA 1MIHA 4QD3A 4D8UA 4ZHQB 1QFMA 5KQLA 3IVMA 5CIYA 5ESXA 1TYAE 4B7UA 4ZRMA 2ATXA 4YFVA 4UM9D 3H2ZA 3HA3A 1SFRA 3EEQA 4HWKA 2RB5A 4P22A 4BP9A 5J3JA 4LXQA 1HE8B 5M2QA 4XB1A 1FRFS 2OKGA 3F6RA 3QE2A 4P08A 3Q5EA 4DQ0A 2ODBA 1Z3IX 4E51A 4XYLA 3OQNA 1TZJA 4B6RA 5KU1A 4JYMA 3AUTA 4GAEA 4XUCA 3KJZA 2ZIWB 1YU6A 4QJIA 1TKBA 1ZUWA 2QGFA 2H8KA 4H7DA 4F04A 1PWXA 1F8YA 2X4DA 2G7ZA 1YASA 2XDQA 1TUGA 3H97A 1PD0A 3IUQA 4Q12A 4WKBA 1J7KA 1EBFA 2YUTA 5CM8B 4E14A 5IPFA 2QT1A 4J2HA 1PZNA 1DJOA 1XYGA 3QMVA 1MGPA 4ND2A 4PM4A 4TL8A 4E5KA 1DKLA 3L5KA 3U5TA 4HBGA 1YB7A 2WINI 2FG6C 2F3UA 1YHZA 2WD9A 3I6YA 3X1WA 4CDMA 4RHTA 2Z2ZA 3MPOA 4TQUS 2J9FB 4LRUA 2AW5A 1K5DA 2AWNA 4BKRA 3AO0B 3TRFA 1K7EB 3ZHOA 1QE3A 1ZIDA 2Q2WA 4XLLA 1R4MA 5DEOA 3HO6A 4GGOA 5KYGA 3MMSA 5IJAA 4WCFC 1ORDA 2R6ZA 1CY1A 1NUQA 3NCHA 1CY2A 3FUCA 3PTAA 1SCUB 4DLUA 1JVBA 3OZIA 3LL4A 3GUHA 4REMA 4MWOA 3OFJA 2JZOA 3TLMA 2K5UA 1TZBA 4MICA 1UKZA 3AVWA 3UMCA 1Q1NA 3EIEA 1BQEA 2ZTVA 1HDIA 1KJQA 3HCPA 3LIPA 1NUAA 4HR7A 5JPIA 3MHTA 1KHTA 2X0JA 2P2LA 1U2EA 2QKYA 3F2IA 2P4EA 4IM7A 1H8HD 3HEBA 4ZT3A 3PX7A 1AD2A 2XQKA 3LBYA 4AO7A 1YZHA 1E1MA 3DPIA 4ZC8A 3AF5A 1SB8A 5ER6A 3ZLTA 1Q1GA 3L18A 1KBZA 3MGBA 4Z7JA 1NBIA 1ZSVA 3HWRA 2ENUA 1EX7A 2OXTA 1XF1A 2WD7A 1FSPA 4EO9A 1EWRA 2NV6A 4HLUA 3GDGA 2GASA 1ENZA 1P5ZB 4HBZA 1JHVA 5EHGA 3HDQA 2YH2A 3JD2A 3UB2A 1VKHA 2WG1A 4QNNA 2OL4A 3KCQA 5H16A 3U3DA 3CRNA 3CZCA 1Z47A 3OZ7A 5ALKA 3RR2A 3CCFA 4AKEA 1VSUA 1ZGJA 1FP6A 3KVOA 3TB6A 4MDYA 1JKJB 4PZUA 4JVLA 4HNHA 4Q9JA 1HM5A 2FZKA 3LW8A 1A98A 1KYZA 2PS1A 4L0MA 2PLRA 4RLHA 2B8TA 2QX6A 3TVYA 4I1YA 4AP5A 3FF4A 1ZR4A 3SZGA 5EJ7A 1H3NA 1BX0A 3QGMA 4OQLA 3TFWA 1RC8A 1XCBA 1UH5A 1JE0A 1ADJA 2WABA 1W19A 1DAIA 1XVIA 1MPXA 1N4DA 3BF7A 4G1VA 2NVBA 1F8UA 3DGFC 1KI6A 1ND6A 5E2BA 3U13A 1P81A 2X58A 1VE9A 3COYA 1FL9A 4YAIA 4B9EA 3JQEA 4PO3X 1RJWA 3H2BA 1E3TA 4F3YA 1R16A 1HYQA 1L5VA 2AFVA 3NIBA 3LQQA 4OU5A 3MXOA 1IUPA 5AXAA 1YI8A 3UTDA 1G7TA 3AESB 4K9DA 4G65A 3V8RA 3H5OA 4BCCA 2YNMD 5IU6A 3Q5GA 2ZE6A 4LCEA 4CMKA 3E4CA 3U4GA 4ZO9A 1Z45A 1VMDA 2ZR0A 4KQFA 1G20E 4BJ3A 1XFAA 4RTMA 221PA 3L3BA 1XDWA 2XTNA 2VOJA 4ZOAA 3EF0A 3ROXA 3FJOA 5I8PA 2GJ9A 2YS6A 3PJDA 1P2UA 4N54A 1RXEA 3MM4A 2JK0A 1HFJA 4JP5A 4O63O 4YDRA 3AF1A 4DT1A 4LFAB 3I28A 3PF8A 1R66A 2Q6KA 3V4LA 4W99A 3FGZA 2EP7A 3VNSA 4L4RA 1NW9B 1ZM2A 3VKFA 1UDCA 3MTBA 2C3MA 4HRXA 2WSSD 1P33A 1PQPA 2YICA 3LA6A 3W5JA 4F3RA 4WNAA 3M81A 3I9V6 4F12A 1K2WA 5BT8A 1TO1E 2FSIA 3GFQA 4LFCB 3ICQB 2L18A 1TJ4A 1E0DA 1HT1E 2IXTA 3NHPA 5EY5B 2WE8A 2HK9A 1ENPA 3K2BA 4OSEA 1USVA 1L4UA 3I8OA 4X7MA 1NR5A 2DUJA 3ZHTA 4E3WA 1SKQA 2QEQA 3UOWA 1ZUHA 5G4LA 1TB4A 2DZDA 1SC1A 3HFRA 4WK0B 1P4HA 4WA7A 1RI2A 2X6TA 3HXQA 4PO1A 3T1HB 2MSCB 4IDDA 1UJCA 1BEEA 2CZGA 3CX7A 1LNZA 1TIBA 2MMCA 3DE1X 3GGJA 3OX3A 4CG1A 5IXYA 2XNDD 5J2TF 4EJMA 2WWTA 3AW9A 4DDUA 4DSOA 2AMLA 4KN5A 2HLDD 1XMQB 1G8KA 3FB1A 4NAVA 3K0HA 3RIXA 2CNLA 4FKMA 4BNUA 4QJ3A 4YMVA 1GGHA 1IJKA 4I6JA 2DQ4A 1CQZA 3J7AC 5JXIA 5K4GA 4YY3B 1P3Y1 4C43A 5A7HA 5KMGB 2JLXA 3E15A 2WK1A 3RQSA 4NHOA 2IXBA 1A88A 4PAGA 4FI3C 3LT2A 4B44A 3RE1A 3TN7A 3ZDDA 2C3UA 1KJ8A 1QYVA 3UMGA 1LS1A 1G3MA 4XJTA 1QV7A 3DOFA 3S5JA 2F1HA 2XZLA 1L7OA 1W1IA 4LVNA 4R68A 3B6MA 2YC2C 1U90A 4IDCA 3F7MA 1C7ZA 1X1CA 2I87A 3F9CA 4YUAA 5GIPE 1EDDA 5DX8A 2PV7A 2VF8A 2VT3A 1GPWB 4ZO8A 5BSHA 1AK9A 2VJMA 3IILA 1RXWA 1OASA 2GHTA 1GCIA 4LSGA 2AI1A 2VCYA 1T24A 1XVLA 2W2KA 4TOIA 5C1IA 1MENA 1R6AA 4CT4B 2AN3A 4CE6A 5JTUA 4PSAA 2CLOB 3K09A 3QVKA 4WBNA 3FRIA 5J1TB 2QP3A 4GI7A 1WY5A 3LNCA 1Y4SA 4MWBA 1KMIY 2H2AA 3PX2A 4MGEA 4B4UA 1T6BY 1FP4A 3PDCA 4TKUA 3HVUA 3OMWA 3B82A 3AKEA 1TM3E 4KVGA 2O3UA 1JA1A 1PTJA 2WU0A 3AY3A 5K3FB 4WZAA 2NUTA 1R6UA 2OGZA 3TPZA 3F8SA 2ZM5A 4FZJA 5BV8A 1P4GA 4QOGA 5H3HA 4G0QA 4HPJB 2CNWD 2VPTA 2XQGA 4BNKA 5AK0A 3ZDZB 3QSGA 4OX9B 5IJWA 4TV9A 2CJWB 2P0EA 3MUNA 2GCPA 4IVRA 3NASA 4NU6A 4P3NA 4R1OA 1E62A 4D9BA 3P26A 3X3HA 5LMUB 1QE5A 4N18A 3B9QA 5KZMB 1Z13A 3Q11A 5K8IA 3BDIA 4Q18A 1AO0A 2VZLA 3QW4B 1U3GA 1QVAA 1J8MF 2RKWA 3P0RA 2RBGA 2WJ4A 1Q14A 1PZHA 1UBGA 2KI5A 4OUDB 1VLZA 3IA2A 5FLEX 3TNDA 3ILHA 1NHGA 3ZVKA 4GI3A 2EHJA 5IG2A 4NE9A 3KYBA 1WBBA 4Q9AA 16PKA 4ZVMA 3ETGA 5FNVA 1IBSA 2ZRIA 1N8NA 4JB3A 1WDTA 1H2EA 3X1KA 5JDCA 3G2MA 1HG1A 4GOND 4OD0A 5G2OA 1QDEA 3QIVA 5K05A 3U7QA 1NBAA 1T2CA 1UOQA 2X2EA 3IDZA 1XJ5A 3OIYA 4UMFA 3HFSA 4WEOA 3EA5A 4GBGA 4QRDA 3KSZO 1NT2A 5C8YB 2O5CA 2QTAA 4NFYA 4DNPA 5A3SA 3QLEA 4TUYF 4KUEA 2B30A 1RQ7A 1UDRA 1J23A 1Z2PX 1XXHB 3MF4A 2JGDA 1UZUA 3EZYA 4KXXA 2JG3A 2QTLA 1VJCA 4FGKA 2VZEA 2I34A 5J2UA 1TA4A 4DQXA 5IAJA 2BRUA 4HYEA 1E60A 1PL6A 1Z2DA 1C0LA 2E18A 5D5QA 1XCMA 2AFIE 5F5LA 1HWYA 2AG5A 1TVEA 5A6SA 1Y4UA 1EPUA 2P2GA 4Z4GA 3R9XA 1XKTA 1X6VA 1MEJA 2QTZA 3HUDA 3KNZA 2GTIA 2XCRB 3DZFA 3NBUA 3DBRB 1SA0A 3X2FA 2OFPA 1I30A 1ULBA 5DRYA 4RLSA 3GOQA 5KSZA 2GZAA 3WJ2A 2AL7A 2UVQA 1MVLA 2XXAA 1SAYA 4FCVA 2VDVE 4P4UA 4KV9A 5THQA 3IO3A 2FJUA 1WB5A 5FORA 1H4SA 1ODIA 4IKPA 2AG6A 3W6PA 5ECGC 3VQTA 5LOVF 1E69A 1YDGA 5BXQC 5DLQC 1G5FA 2EX0A 3A26A 5CURA 1NVUQ 3RVMA 1TEVA 4MQEB 5CT9A 5JJCA 1OVGA 1ZEJA 2CXXA 1IUOA 3AHIA 2BE9A 2ILTA 3EG5A 1MN6A 2YIVX 1MC1A 2NO6A 4FDTA 1QYRA 4OL0A 2QOEA 3SR4A 3A2NA 5JJ5A 2JLUA 1UJ6A 1FDWA 2JIPA 4QBIA 4FGZA 3H3FA 3FCXA 4D3ZA 2JI6A 5C9ZA 1G6KA 1MNAA 3JQ9C 1NY5A 2PDAA 2WVJA 4LZOA 1GEEA 1NW4A 2X41A 3SEZA 5CB6A 5JSKA 4D0RA 1RLJA 1Z4MA 1WTAA 2C3YA 4IIGA 4ZXFA 1XA3A 1SZJG 2PEYA 3Q3IA 2WMDA 4MWZA 4EGCB 4XFKA 3E0QA 4R05A 4X3CA 1HEYA 4RELA 4N9QA 1FTQA 1YS6A 3O94A 4A8PA 3V46A 5BN3A 4X65B 2JRLA 1XMVA 3RVNA 1PX2A 1NJ2A 1NR1A 2A35A 2EFDB 4DIFA 3ROFA 1PL0A 3LY8A 3BXHA 2WTUA 3FPGA 4A16A 3QELA 1LBTA 1NUPA 4AYXA 3K9QO 3I5YA 4YT8A 4YT2A 1JMYA 3WMEA 2CB9A 2DFLA 2J41A 2P0YA 4MB6A 3UCFA 3ZQJA 4LOJA 3SIRA 4YLYA 2BUCA 4WNYA 5ALVA 1R27A 2AFHE 1PRYA 1O0BA 1V9SA 4FGWA 3KL2A 3EF3A 4CUKA 3USZA 5FI0B 3OD1A 1ZS9A 2BN4A 5F5XA 3STTA 2DWQA 3DHVA 3DL2A 3EFHA 3TAUA 2V7QD 1XEXA 4RSRA 2GN0A 1U9JA 3G7UA 1C3LA 1J9GA 2P2DA 3DBIA 3IQZA 3S5UA 4EZIA 4JWTA 1PQUA 2J0UB 1TF7A 2C8KA 1FNSA 1ZMTA 4ZD6A 5BUZA 3WGIA 1YR6A 4HDMB 2GN8A 2QAIA 721PA 3EXEB 1QRUA 3VVCA 3UK1A 3VDQA 4AJ1A 5A5GA 1Z2OX 1SRQA 3MJSA 4LYJA 1N7GA 1UQTA 2FEOA 2GK7A 3B52X 3D54D 4YJFB 3KL4A 1J99A 2UDPA 2Y4NA 2ZB4A 4UE6A 4Q05A 1QMPA 5EXPA 4KREA 1SD1A 5FL3A 4UEQA 5ALQA 3DZJA 1TD1A 1SXJA 1YBHA 4X64B 1N2GA 2HWWA 1UDAA 3A6ZA 4JOCA 4QBTA 2QSZA 3GU3A 4FZ5A 1V5WA 4H4EA 5DKFA 4PV7A 5EIFA 5REQA 5KJCA 3AM1A 4FHDA 3R5HA 4IHJF 5AI9A 3ROPA 1OBHA 2AA3A 2ATIA 2OAGA 2H16A 2FOXA 3QF4A 4I2VA 4DPKA 1MPTA 2QU8A 2V1XA 3G0GA 2JCGA 4OA5A 4BMZA 4JI6B 2NXJA 2O59A 3H1TA 3A4YA 3O2QB 2G06A 2SHKA 3PRHA 1G5IA 2Q2NA 3VYUB 4B4VA 5LP6B 2IS6A 1RWOA 2AOTB 1RFLA 2WKWA 2FMIA 3DOUA 4FEAA 3LDFA 1GDTA 4K2AA 1M76A 4H16A 1ZDMA 2C5GA 3MWJA 4J0QA 1NXSA 5D87A 3VH4A 1NURA 1N5KA 3K73O 3PD1A 4GNKA 5E6RB 1O2DA 3FHTA 4FHEA 1Y9AA 4H6WA 1E77A 1KXZA 2EQBA 1FS4A 3E1GA 1OSNA 1GPJA 1YI1A 3RHSA 3WLPA 2J7PD 3OFKA 1XT6A 4RZIA 1M73E 4DZZA 2OHFA 4RD0A 2ANBA 5JFOA 1NZJA 1SQ6A 5ADVA 1E3WA 3C3KA 3Q9UA 2BLNA 2LW7A 4IFIA 1AA9A 1NFQA 1RI1A 3IP9A 3QLUA 2IYOA 2Q1SA 4TT3D 4HDCA 1RWNA 1OBFO 1EJBA 1NW5A 3A1NA 4PAOA 4B76A 4KAAA 4F6RA 2BKLA 1UM9A 2FUKA 2HKIA 2H3HA 3T3IA 3R0XA 5K8JB 3DT8A 3AEKA 1O9GA 4JKIA 2XB2A 3DDZX 4CQLA 2XBUA 5E2IA 1BCRB 4Y18A 1AF4A 1KY4A 1VLVA 1GZ3A 3Q2KA 2WSBA 3L05A 2JAOA 3PDIA 4HAUA 2C57A 1IWPB 1D04A 3KHTA 3DFUA 2GK3A 3PFBA 5AVSA 2IZ6A 2HIHA 2RJOA 1N1DA 4HDSA 5JCPA 1E94E 1TUEA 1BZYA 1HQDA 3P7MA 3TZKA 3WTCA 2CEAA 3RVQA 1I2ZA 1N3YA 2D1FA 3L7OA 4JX8A 5I7SA 5GGYA 5CT5A 1Y82A 4GS5A 4DV4B 5E3HA 1IAQA 5C8ZA 1EM6A 3FI0A 2ZAOA 3DWFA 4MUXA 1TA9A 2WZBA 4U63A 4ZOLA 1EUDA 4QDXA 3CZ5A 5EZYF 2HOQA 4LVCA 3UWDA 2V4ZA 3FW1A 3AR9A 3D3KA 1QX3A 3KOYA 4GI1A 3RVLA 2GAAA 3IMCA 1EVKA 1N5LA 2ZRAA 3ISVA 4RK5A 3UHPA 2YN4A 3LFTA 3HADA 2GAJA 5KOYA 3E2PA 3BCHA 5KJ1A 4DW8A 2OBXA 4PSCA 1I6KA 1E1DA 3HUTA 3K3PA 1NVVQ 4QDKA 4A23A 3IP5A 2G40A 2ECFA 3SIXA 5KTPA 1GYRA 4OAQA 3R74A 1A04A 3M6LA 1FMJA 3TOVA 3PLNA 1T0JB 4E15A 3AEXA 3QX3A 1KKMA 2VHQA 2FQYA 2DY1A 2QE6A 5FOQA 1SCDA 1EGMB 2RGXA 4JH0A 1MQAA 1VE5A 3NAMA 4FEGA 4IDGA 4B82A 2FHSA 1YZTA 1RAAA 3NT2A 3IESA 1E1CA 2JFZA 2A67A 3PPYA 1L6IA 2KWIA 4LWOA 5IKXA 2W43A 1ECFA 1ELOA 1EM8A 1I4EB 3CWQA 4Q9IA 1XQWA 4ENQA 5DI3B 2FP4A 2XCLA 3N8KA 4RQUA 3PKIA 4NABA 4B75A 5I7HA 2A33A 3CVJA 3JY6A 4FKBA 1NONA 1KA9H 2ZUFA 1E1YA 2EX1A 2VUTA 2JD1A 2V0CA 1YR8A 5FFNA 2P6RA 4LXXA 1D1SA 1N4AA 1F6DA 3SSMA 4QYIA 4IHAA 4UCXA 3DKKA 1ND5A 4Z9AA 4BX0A 1TC1A 1LK5A 4NYJR 1VJ5A 4TTTS 2G5PA 3H5RA 3N8HA 4CM4A 1C0KA 1FU4A 5KINB 2QTWB 5HJ2A 2NW6A 4PWYA 1T1RA 1B8OA 5SYNA 2BEUB 2BGTA 1PSZA 4M7PA 2Y71A 2XMDA 4XYGA 3AFGA 2FE1A 1PVOA 4DR2B 2XGMA 5F12A 4PVCA 3U3RA 3NATA 1MOZA 3KB6A 4ZJUA 2DQSA 3T3MB 3V34A 2OV1A 1E2FA 4UDOA 4RVNA 1DEKA 2P79A 1FUUA 1SVSA 2A9FA 2BFCA 2BW0A 5C7YA 1VSVA 4K0RA 1EAYA 1GTZA 4RCVA 4J0EA 4I55A 1QAQA 4Q4LA 4UMVA 2OYCA 3UV3A 4Y30A 1XMOB 2JDID 2E37A 3RFXA 4IFBA 3W5UA 3QVSA 2CUZA 2JGAA 2WKRA 2XXJA 1PHPA 1SKUA 3FMGA 2WD8A 3JYOA 1XDUA 1V11A 3L7NA 1AKVA 4BATA 1VTKA 3DZHA 2GARA 1KDPA 3B1JA 1Q1QA 2DWCA 4TSFA 2X8AA 5HMLA 5CDHA 3WKCA 3FI9A 4I1RA 4IDQA 3DEHA 3VGJA 3TFOA 4GVXA 3HH8A 1IN6A 1UFOA 1ZCFA 5JO9A 1Z6GA 4CV3A 4RACA 4PAQA 2DEUA 5HDBB 3ZZMA 1GPLA 2XQIA 2H7YA 3DHEA 4JJ8A 1UT6A 2NVOA 2FN3A 3WL3A 3DXYA 1YDFA 3IELA 4U7HA 3UGJA 5CPBA 5EI5A 4AUNA 1YZUA 4C6HA 4HGZA 2A9OA 4QO8A 5A2QA 2O19A 4HATA 2JARA 3M6UA 1EBBA 3Q2IA 2BBTA 4Y2TA 3W8EA 2UUPA 1UAAA 3P0FA 4EYKA 4XZ3A 1UAGA 1ZMXA 4MGZR 2PD3A 4E0BA 1FMCA 3F4LA 1GFWA 1T8UA 4HDOB 4PGAA 5ILGA 5J47A 2FKAA 3DVRX 3DTNA 1OA0A 4M1MA 2OCLA 2X5KO 5FHQA 3V2UA 1S6YA 3SU8A 1DRJA 4BVGA 1OGYA 2ZIXB 1IOLA 4BFVA 4X24A 3TSCA 4HYTA 4BRWA 4KH0A 4PPQA 4E2FA 1TOAA 3B78A 2WIJA 5IMSA 1QUFA 3I5AA 2AXPA 1SURA 4L6CA 5AESA 3NGLA 3AFIA 1B0AA 1N5JA 4QBKA 4A0FA 1WZUA 2REOA 3ZCXA 1GG9A 2V7VA 4F3KA 1FUEA 1H2RS 1MB2A 2I1LA 2E6UX 4MWSA 4LPKA 4HX2A 1VIAA 3MERA 3NAZA 3V2IA 2GVZC 1N75A 1SUSA 3BD8A 4Q3DA 5DCLA 4ZHQA 1EKXA 3PXAA 5JNVA 3ZK7A 4FN5A 4CGYA 1MR3F 1R5NA 2PLNA 3TD2A 4YCSA 4Z4IA 2AN5A 2J5QA 1H22A 4WLFA 3WV4A 3O7WA 3ZY5A 4U39A 2B8EA 2CCJA 3ROKA 4LOIA 1T9GR 5JQGB 4L22A 4CFZA 1RTTA 3NHMA 4TV9F 2Q9BA 4PNZA 5DVZA 4ZIRB 3ZVMA 3DXXA 4UM7A 4EOGA 3BVPA 1UKBA 1ZUIA 4OGLA 5TMDA 1JIIA 3WHPA 1WF6A 1F0KA 3EVFA 1QOZA 1G5HA 4J75A 5H3CA 3TR5A 3VH2A 3DTTA 5A0TA 5J5CA 4A4DA 3X1MA 5TS3A 2FXIA 1E2JA 3Q0EA 2PMWB 4RGBA 1HEUA 3FSRA 1NSFA 5JWHA 5HXAA 2XUQA 5DGXA 1MMFB 2DCMA 4BRSA 1BWQA 1M8GA 4RVFA 4XB2A 3JQ7B 3LV8A 1I10A 1XTRA 4IAOA 3DZDA 2VSXA 3SIPA 4Y67A 1XB2A 1ESZA 1QOPB 1NKTA 2GN1A 2J9FA 4QA9A 4QODA 4YXWD 1GAJA 1SD5A 1M2OB 1Y9ZA 2CHUA 5FNVF 4YX9A 4AAYA 4L8FA 4YI5A 3OQPA 4MUNA 1JILA 1M10A 1F3OA 2CLIB 2P9YA 2XUAA 4LGVA 3THRA 4GVLA 2QW1A 4D9KA 1RHJA 4J2OA 1SCUA 5EINA 3F49S 4RVOA 1B3RA 4ZU1X 4ZCIA 5GWXA 2BHTA 3FGNA 3S0JA 3H2GA 1AQLA 2RKOA 2VDMB 4KQHA 5H80A 2Q5IA 3GNTA 3CXUA 5J2UF 3GP5A 3H4TA 4MCJA 1JWAB 2AXEA 3IV6A 2PXCA 2X14A 3G2LA 3MWEB 3OZXA 3VZRA 5HRUA 3GJRA 4NCAA 1GZDA 3W2GA 2RHJA 3DD5A 2ZI5A 2O2HA 1JG6A 1Z2EA 4KXVA 3MCAA 4Z6KA 2JFVA 1MJNA 3VNUA 3D4LA 3BH7A 4JEHA 3GMSA 4WQMA 2YKGA 1DFIA 2AX3A 4WJZA 4KR7A 1KZHA 2FI1A 3G5AA 2XIQA 4RL6A 3VPCA 3TIGA 1COWA 1XUOA 4LXGA 4TLBA 3T6KA 5DTJA 3DZIA 4PY2A 1ZP6A 1LF0A 2RC5A 4JUIA 3CF6R 1JKJA 2VDWB 4Q19A 5JDIA 3IE1A 2GBGA 2QAGC 3GPLA 5HHTA 1GR1A 1Z5ZA 1Y37A 3AHJA 3TQQA 4RAQA 3EDMA 4JDUA 4JP2A 2XZOA 1C9KA 2CKDA 2XB8A 2XMGA 2CNBA 1M5TA 3D6TB 3Q1LA 4IJ5A 3P5SA 4IRMA 4UEWA 5GAJA 3SE7A 1VMAA 3BOSA 4NCJA 1GN9A 4R7TA 5HF8A 1L3CA 3PD0A 4YRBA 2ZLBA 4BNIA 1H6AA 1L5YA 2NMVA 5DO9A 1MG5A 1WCYA 3AESA 4GF5A 4YMWA 4TLEA 5EERA 1UOEA 2PY6A 5AVOA 2O1SA 1PR4A 3AU9A 2X4IA 3ITEA 5NULA 1ENOA 2DTDA 3DPSA 4MRPA 2P90A 5F98A 4XQ0A 4UNQA 1DC4A 1DWOA 4K1XA 3DNPA 3WR5A 2G6TA 2HPAA 5B12A 3Q98A 1CXZA 4ZPJA 2XGOA 3AG5A 2AHRA 3EH2A 1KL7A 1TTPB 3RRZA 5HFNA 3TTWA 1OJ7A 4Q7MB 4CV1A 5FV7A 3WGVA 4Y1EA 5F52A 1JL3A 3LPLA 1M7BA 2IYLD 2E5LB 3NHKA 1GTG1 1G7SA 1IEWA 4O1IA 4BV2A 3TOCA 2VDKB 1C9JA 3WGHA 4M86A 5CFMA 2HQ1A 2WC1A 2EW8A 2XZDA 2ZB8A 3A9CA 3KV1A 4HB0A 3OU6A 5AHOA 4ZVNA 3U3ZA 4A91A 1H4QA 1V6SA 3GVPA 3L6CA 5K0BA 2XE4A 5SZHB 3RABA 1DHTA 3IVRA 3GA5A 5D86A 5BSVA 4R9RA 2IOFK 3LVRE 2J30A 4UAUA 3ZCQA 1WPRA 1Q6YA 2ZT8A 1SXQA 2AVDA 3OSZA 3UT5B 1FMFA 4IXWA 1XRLA 3SN6A 1ULSA 3F8TA 4RTKA 1JIKA 5LZ8A 1FXUA 1FVXA 2DR0A 2DPLA 3OO0A 4HEA6 1CVIA 1ZBQA 2NQ2C 1UIRA 2VXCA 3GFOA 4I6EA 2PSDA 2WHPB 4WPGA 2C2XA 4RK0A 3NHYA 3VR5H 2JIMA 4WECA 3IT1A 4OSOA 4D96A 4HB4A 3EEBA 3N53A 1EWYA 1QIIA 3DL7A 4HEA1 5AVXA 5KMGA 2M1ZA 1ODKA 1N2JA 3C1UA 3DWEX 3PUHA 1U7XA 3HN7A 4UD6A 2Q7DA 1X8KA 1NQOA 4CF5A 5TC4A 4FINA 1XK7A 2GH1A 3K0CA 3LW7A 4G8CA 4UHKA 3UJAA 1CX9B 1JHYA 3M8KA 2ZSJA 3SQOA 3RANA 2FF7A 4FN4A 5CXQA 2OR3A 4RPIA 3WIVA 2PUHA 3IURA 3ROQA 5I9LA 3JQGB 4HPXB 4BWGA 4ANFA 1K86A 1RWQA 1E4OA 1GA4A 3M3DA 2GAOA 1F7UA 3FNQA 3RIMA 1OE0A 1Q0LA 3OVMA 5EHNA 1JQDA 3SVLA 1EK0A 1R0CA 2DSTA 4C3UA 1DCTA 2UAGA 3IDAA 4WZ6A 5AKHA 2DLDA 1HH4A 3IYLW 2IPMA 1GGEA 5BOSB 4E2XA 5KBYA 1C7EA 4H08A 3OZSA 2WAAA 2XT0A 2GD6A 4J3JA 5H59A 3BZUA 3TTTA 4AD8A 3X1ZA 3G59A 2YHIB 4W1SA 3VKHA 1M1YB 1UZLA 5JCOA 3GGGA 1DIOB 2R47A 3DE0X 3R7SA 4ED9A 1FJXA 3OICA 1NYRA 1RRFA 1Z7GA 2ZWAA 3D5TA 2NU9B 2ZSUA 4A92A 1UPUA 3PX3A 2MSKA 4EZBA 2BTEA 3EUWA 4IGAA 1Y5IA 2F3PA 3KPYA 5K3FA 3ZU4A 2QN2A 3R9KA 3AJDA 4L1KA 1YB1A 4MJ3A 5COQA 2AZDA 5FA6A 4PR3A 4H1WA 5C8DA 4LPSA 3KVNA 4HMOA 2QT9A 3GBSA 2FR1A 4F4HA 1W48A 5DHPA 1W5TA 1QGDA 3ZDCA 2HZBA 2OD2A 3G5UA 4QUKA 4UBLA 2CJWA 4WZBB 2PGNA 5T41A 5LD2B 2C1XA 5B3JC 1NATA 3WRXC 3R76A 1EG2A 2QSYA 5KNBD 1FFWA 1YDWA 4ZZ3A 5HGXA 3TQFA 1HE2A 5F3DA 3PUZA 1J8DA 1NKSA 2XYVA 1SIWA 4NV0A 5DCYA 4O8ZA 1PZGA 1ZIXA 5CTAA 5FBKA 1PQWA 3TI9A 3B2EA 5LFAA 3IQHX 2Y4OA 4GFDA 2XKAA 3NEAA 4OUDA 3K15A 1GQRA 4QLAA 1U2TA 1N77A 4NE7A 2QV0A 4URUR 3V8QA 4EO7A 2Q62A 4RYDA 4BJ6A 4HVLA 2PRIA 1Z0KA 3AUYA 3FHCB 2W6IA 1USUA 3N2LA 3OZRA 4B4DA 4BEVA 5AW7A 2CXRA 2QMZA 3FFTA 2BSAA 4E6PA 4W5QA 1OGJA 2P9QA 2DQKA 3N6VA 3PQ3A 3R3WA 3SM9A 2JD2A 2HQOA 3SLGA 1QLJA 4MI6A 4ZOLF 2QLBA 2EZ8A 1LQUA 3LBIA 4LC0A 1NW3A 4RFLA 5C8YA 5AW6A 5JSUA 5JD3A 4NS4A 3CF0A 4PSDA 5B4TA 4II7A 1XXHA 4FSXA 4EBFA 4XVHA 4RPHA 4H1TA 1XZMA 4I9FA 4W8GA 2IW1A 1JVSA 2L42A 3RF6A 1CUXA 3RYCB 2V6MA 3F5DA 2J85A 4KO2S 5M29A 3PXBA 5JSHA 4CL0A 4D4KA 1AS0A 4W6QA 1M2JA 3SSNA 3E3MA 3DBRA 3THOA 5LMZA 4MINA 3QU9A 3U7GA 4G0MA 3K6RA 1H0HA 4XOIA 2RHMA 3SZRA 2KBEA 4K9NA 3GUUA 2LPMA 2VPWA 4R2HA 5IARA 1SHZA 2BKAA 2QRNA 4MIKA 2WA2A 1SN7A 1LX7A 5LA6B 4LYEA 4LDAA 2Q4OA 1HYHA 3AEQB 3D6NB 5I5GA 3AJ8A 1E6KA 1JIVA 3EXG2 1RRGA 1NVBA 2CVFA 5F73A 3VV2A 1KYWA 1LNSA 4YHHB 5CFLA 2F55A 4M9UA 1LX6A 5KAMA 2FLWA 4UMDA 5HJEA 2XUIA 4MQEA 4BB9A 2YWEA 4DRXB 2OFXA 2RD2A 3TR6A 4DAOA 1Y6QA 4EARA 4J7CA 1TM1E 1DBIA 2Q6VA 3MQFA 1E6UA 4IYRA 3C70A 1A2QA 1MAUA 3OFSA 1XP5A 4B8WA 5EJMA 3EA4A 4NBRA 4ZI5A 3CCBA 4IH1A 4MW6A 4YRLA 5C3UA 1FOEB 1YONA 3GVHA 1P8JA 1R8YA 3JQAB 3GRVA 3UK6A 4XYMA 1CUFA 1U3FA 1I2BA 3E9QA 3IEPA 1UQRA 5K6TA 3AKZA 4CEIB 3DV0B 3CUSA 3C3YA 1CHNA 2W4QA 4H1VA 4G5HA 4D9CA 4DIOA 1KZ9A 3QG5A 2XCIA 6GPBA 5AVZA 1L3IA 2IYNA 5B7QA 4NBUA 3FMOB 5TF0A 2HSWA 1H5NA 3PA6A 4WXMA 3ZWVA 1C3XA 5H70A 1Y1QA 4IWYA 3RQIA 1C9DB 4ZT2A 3V1NA 1YT5A 2QX4A 2D4HA 1RWKA 4JC0A 4RKYA 4WLNA 2ZBEA 3CVXA 5KTRA 1AM4D 4A10A 1AQJA 3UUEA 5JZ9A 1TYEB 2FRDC 2ZE7A 3QNMA 4I55F 3LSTA 4IOKA 3UCXA 3R6LA 4A0SA 4HLDA 4FYKA 3NZEA 4Q4HB 2ZYUX 4HLNA 1IDOA 4PLFA 1O03A 2ACWA 2XVAA 5E7JA 5JS7A 1MO4A 3EMDA 1T2AA 2AN9A 2P67A 4W7IA 3NWJA 2EKZA 2IA5A 5A71A 5EP2A 4NWIA 4CHTA 1NVEA 2Q5OA 3HV2A 4P31A 1GITA 5TEWA 3VVMA 1AU9A 4CYMA 3NAQA 5J4YA 2W0SA 2GNAA 5TB5A 5CITA 3V48A 2ODQA 1K4KA 2NU8B 1EVLA 1JNXX 2X5XA 2N1MA 4HAWA 2ZI6A 1O0SA 1GQOA 4KAFA 3OE7D 5HSGA 3IL2A 1E2PA 2RK4A 2J59A 4Q9KA 3OEED 2J0UA 3I92A 3Q3CA 2C5AA 1XZDA 2KJQA 3EVBA 1DB3A 1SOMA 1VXOA 1IK4A 1TEXA 1WUKS 2EERA 2P6MA 4HDMA 2RJ3A 4UXJA 3TRJA 3GPIA 3EXEA 1WSAA 1P5HA 3G0HA 3C6ZA 4KFCA 3M2PA 3GRFA 3QUBA 3HB0A 4HAVA 1SC3A 3WAJA 4YJFA 2HV8A 4B6EA 1RLIA 5AJXA 3EA0A 4X5OA 4IL5A 3PC3A 4LIPD 3VC1A 4BLVA 4D57A 4RD2A 1X9IA 2OAQ1 1K75A 4C20A 1NQVA 4MLPA 5J58A 5D8DA 1EP1B 5KYYB 4B3XA 4B73A 1MW8X 2GLUA 3WL7A 2Q2VA 1GVHA 4YUYA 3QFHA 1UFVA 1R10A 4X3OA 4CMHA 4PINA 3OZFA 3E81A 3NH9A 4TS1A 1IBRA 3AXSA 5TMBA 5JJLA 3PGMA 3OCWA 1HETA 1FXWA 1G63A 5CFZA 4US2R 3WGNA 1ZM4A 4L8LA 3VYWA 4ZN6A 1JLLB 2YWFA 1JAYA 4BFTA 4FHFA 4R7ZA 3DV9A 3VX4A 4BUZA 5LP6A 2AOTA 2XB4A 1WW2A 5F4BA 3WOHA 5TIIA 4LCBA 5JI3E 1JWBB 1MQSA 4BLSA 1A7UA 3D3EA 3DE5X 1YR3A 3CUVA 4IGFA 4J0CA 4QELA 4ZHQF 4JT2A 2PBZA 1VMEA 2D2XA 1K3FA 3HZRA 3FVRA 3D6UA 1TUIA 4NU0A 5E6RA 2HRBA 1U2SA 6LDHA 2VJPA 5J40A 2ANCA 5J9FA 2CBGA 5D3KA 5KYVA 4ND8B 3O8OB 1PF7E 1XZJA 1YK1A 2P78A 3DDOA 5H83A 1WHTB 2WPDD 2ZBPA 3BQ9A 4OM7A 3COPA 3ZIAA 3HCBA 1FTGA 3DE2X 4MUMA 3TDNA 1O95D 2PJZA 1HDZA 2WT4A 3LDHA 5K3DA 4JI8B 1LTHR 4GI2A 3L4JA 3T7EA 1TFUA 2H1HA 1UPXA 2WNIA 1P1RA 4NZMA 1A76A 4RIGA 4V03A 1YR9A 2BI8A 1H93A 4LWQA 2HCBA 3O2SB 5IMBA 2QL5A 4RXUA 4AUEA 3W3AA 1T0BA 2C98A 3IEMA 1BCRA 3LX5A 4OGFA 3MAAC 4PCLA 2VRCD 3PQ6A 2EWVA 1CF9A 4LXTA 3OSUA 3PRYA 2PU7A 1C4WA 1NF3A 3O6VA 1CUZA 3AEYA 4NMWA 2HF7A 3GO4A 5BVGB 3K92A 1SUCA 2X9GA 3DHNA 3HDYA 4JN6B 4YRJA 1E7MA 2AI3A 3OQIA 2PYIA 3PRKE 1XE3A 1DKRA 5E7IA 2QNBA 4AXBA 1GGMA 2E4WA 4UU8A 5EZQA 1EINA 4AKHA 1N0WA 2QD3A 3QOWA 2AQ8A 5TPWB 4ZI3A 2G67A 2QMEA 3GRAA 3NBYC 3LPNA 4F4FA 2O1XA 1C4KA 3CISA 4ZA2A 3CR3C 4EHDA 2I6FA 4MVYA 3M1LA 4L3WA 3WL4A 4AX4A 2MSNA 2IDKA 5DWVA 3DVQX 4AIIA 2GI4A 3H65A 1MXHA 3DO6A 3PQ4A 4M49A 4XUDA 3E18A 3MJTA 4UUBA 3PEEA 3ZLUA 5JNRA 5HUJA 3OTIA 5GVRA 3FD8A 1QWSA 1RACA 1SK8A 1N25A 1HQKA 3DE7X 4EB6B 1R9MA 2G4VA 3M6WA 2FSPA 3DH0A 3SAJA 1MO2A 2RGUA 3BEDA 5AMXA 2ADFA 4D4LA 3D6VA 4C05A 4OP2A 3Q3HA 4Y1GA 4LY3A 3VSDA 4ZICA 2Z6AA 4RTPA 2QXUA 1DXQA 5CGZA 1BDIA 5JNLA 3L84A 2C00A 3JS5A 1GZ4A 3DOJA 5FTMA 5HBGA 5DSZA 2WFAA 4X1OA 3VKUA 3EULA 2JW5A 3L7MA 1RE1A 1Q74A 3K05A 3ETHA 3H4IA 5IZCC 4BTLA 4JASB 2R6CA 1XPJA 3LZ6A 4FTWA 4KB5A 5JHHB 1JKFA 3R0JA 1RM3A 4YJ3A 5DI3A 3OO1A 4RPLA 2ZUTA 1YE8A 1FX0A 3U3KA 2IS4A 4PG4A 4YJHB 1ZIYA 4BFSA 3MTAA 3A05A 3DBHB 2FXVA 2OV8A 4TWAA 4YJGB 5TPZA 4G01B 3TJMA 3SC6A 1JGTA 3TS1A 3P9YA 4TYMA 4BIMA 1O08A 1BMFA 2DE0X 2XYPA 2YINC 1G59A 3B1FA 4AJEA 4UZSA 2PV0A 2WWHA 3I2IA 4LK2A 4Y6LA 2UV8A 4EPXA 3SD7A 4A9AA 2VF2A 1Z2NX 4NMXB 4MYUA 2HLHA 4D9HA 3IIIA 2BEUA 3MFQA 3K8OE 4J7AA 4LY9A 2GHQA 5GV8A 4H18A 4D4GA 1CERA 2PRKA 3LAWA 2BR5A 4DEXA 3ESCA 2VDPB 2VK1A 1IRIA 4EMTA 1WMDA 3DCNA 1KP3A 4KLZA 1NJ6A 2V58A 3FM9A 3L6UA 1NOJA 3O73A 3GFBA 5CXSA 4G8JA 2UUCB 2IODA 3OCYA 1QWOA 4XYEA 3SFZA 1HRKA 4DWWA 4G0WA 1JBKA 1OD6A 5EWLB 3UHFA 1QG2A 2P68A 2VTKA 3ADOA 3E9DA 3LDUA 2P4QA 1T1EA 2GPAA 3FGPA 4LOKA 2VJDA 4JP3A 3BTOA 4O08A 1N2IA 4PICA 1MT0A 2AOXA 2FR8C 3BJZA 4ENWA 5FH9A 3G2HA 4B7AA 3OLZA 2OGTA 3QLVA 1FPMA 4MW0A 4IQGA 3TZBA 3I9KA 5A5VA 1BCSB 4N0MA 4GQIA 2C88A 3RHTA 1RC1A 4F84A 1H65A 5KOJB 1L4EA 5E6UA 4N7JA 4YACA 5K0EA 4UCQA 3NWEA 2B20A 2G72A 2OO5C 5ANRB 4C78A 2VK2A 4LAFA 3W05A 1ZAKA 1AGNA 4KXLA 3BRWA 3X1YA 3IE2A 3EDOA 3T1OA 4CKEB 1BRMA 3C3DA 1UK8A 1ZY2A 1ZQ1A 2WIAA 3GT7A 2JFWA 5FNZA 2BGNA 2W4IA 1A95A 5LZ7A 1AN9A 3FCCA 3CIFA 3QVTA 4OQNA 3UT0A 3HDVA 5ALFA 4D79A 1RYFA 2GD0A 1P4AA 2HADA 1NNI1 3KZVA 4W7SA 4EQ6B 2IYVA 2RFLA 3TG8A 1DKUA 1BS2A 2JIZA 3PVZA 1GKYA 1NI5A 1Y8ZA 2Z58A 3LPMA 2BGWA 1XZNA 2P1DA 1TRKA 4MVJH 4R8SA 1PWHA 3NFYA 3EQ9A 4HG2A 3GLRA 3W4IA 5DU2A 4C7KA 4M1QA 4UU1A 3LKVA 2ZIXA 2J3HA 2VRNA 3CE6A 3WRYC 3V4OA 4KFUA 1PNQA 1GUDA 3TXXA 2E82A 4HSGA 3R0IA 2CNNA 2Z56A 4RDCA 3VA7A 2PSEA 1T6YA 3FKJA 2UUAB 1E6WA 3UH1A 1SVWA 1CUYA 2YS7A 4IVNA 4NPHA 4GL2A 3U9LA 1DSSG 1V1RB 4R5HA 4TX1A 3NB0A 1GZVA 1BIFA 1QIDA 1AS2A 4UBNA 4GRAA 2CE7A 3HYTA 1ZD5A 4IIYA 4KYIB 3TCXB 1H94A 2DPYA 2I6TA 2ZBFA 4JP8A 4W5HA 2YASA 2PKEA 1FMLA 3K6JA 1WBDA 1OWMA 2DT5A 2JFNA 2NM0A 1OZFA 4QOHA 1OB5A 3JQQA 3WQBA 2B4YA 3T7RA 4LE2A 4ONEA 4E4YA 4KX3A 1VFPA 1XJWA 3AOGA 1YQDA 2XV1A 3MBIA 2V9PA 1IQPA 4JJ4A 4EK9A 4Z7OB 4XIYA 3C5WP 3N6RA 2ECPA 4AQ7A 4ZIRA 1UJ5A 1ODFA 2MIIA 2G5TA 3KKKA 4LRYA 4NOKA 3KQNA 3PIIA 3KR1A 3EUFA 1D4ZA 2C4WA 2C78A 4KRXA 2PT7A 4FYPA 4DJTA 2BZGA 1K8ZB 2VOEA 2WFLB 1L1QA 1QKKA 3I9OA 2I6XA 5KTMA 5K51A 1U3TA 3JQ7A 3H2SA 3L40A 3NHSA 1GTJ1 4N47A 2O23A 4DN6A 3LKZA 5DTIA 5DZSA 3CPSA 3PQ5A 1SZCA 2BFDB 1FFCA 1A69A 1MIOB 1C81A 1M2OA 4IW3B 3OPXA 1VYTA 3QXHA 5DHTA 2VNHA 5DBOA 3TUIC 4EHKA 2E9SA 1VPVA 1TM2A 4BFXA 4O33A 1OYOA 3QJYA 1HTBA 1G42A 2L0XA 5DOZA 1DO2A 2YQZA 5DNEA 1MA3A 3OC6A 2A9KA 1PQ4A 5C8YF 4Y6RA 2P6NA 5HQTA 4PX3A 1I9GA 2FQ1A 2RHBA 4I3FA 2Y0EA 1G8YA 2HCFA 2QW0X 3QLJA 4RTQA 2B36A 3D7SA 2WDPA 4RF4A 5IAAA 6ABPA 4RZUA 2FX2A 3B8EA 4DDKA 3GY0A 3G2JA 3OZTA 3G8BA 3RU2A 3MWEA 5FI1B 1V48A 2RHWA 4EITA 3NU1A 3Q8MA 1JMKC 1IQ0A 3CEMA 4Q1VA 3RYHB 2GB4A 5CMLA 1GXSB 3C6MA 4KNWA 3W4KA 1WNFA 5FBHA 4NCBA 1U2GA 1BS9A 3U40A 5U4QA 3NNDA 1PL7A 3P2YA 3WDLA 4BYGA 1H66A 3BKWA 4NBKA 2GBPA 2WUFA 3KLNA 3ODGA 1PBNA 3BAZA 1YJAA 1F38A 3RRXA 1RHRA 2F1OA 2IU6A 2QUAA 1K97A 4OJNA 2ASEA 4XTRA 2DULA 2VDWA 4LA4A 4FMCF 4J0GA 3RF7A 1XHLA 2R79A 4C0AC 1ICIA 2OCGA 3QJGA 5E1OA 4OLAA 4DCNA 3GT3A 8AT1A 1K89A 1ULHA 2WAXA 2FV8A 4RBNA 2E1RA 4I5EA 3FZNA 4MQ4A 4MW5A 3TLZA 4IIDA 2IEGA 1Z0ZA 2CVPA 1JDJA 4EP1A 2I55A 3Q7TA 4FD2A 3TNFA 3HJRA 4Z99A 4C9BA 5JR3A 1J0EA 3V4ZA 2C5HA 1QH0A 4I4TB 4LZWA 3NPMA 1A8SA 1A8UA 1M75A 1U8TA 2G9UA 1GSIA 3LKDA 4TTJA 2JJ2A 1YZFA 3DDCA 4EJSB 3DJYA 1KI4A 4OF4A 1DG9A 1JPVA 3IXMA 4PO9A 4UQOA 3HWSA 1ZICA 2CHEA 4LKRA 4C2BA 4E4RA 1V3UA 3TCKA 3TJRA 5K09A 2P41A 2K7ZA 4KKVA 3ZTTA 2H4ZA 4N3BA 2ZB2A 1JHXA 3FAKA 1FW6A 4JFRA 3C3MA 4XWYA 3M6XA 1T8WA 3R7LA 1KDTA 1JYSA 3O4FA 3R7FA 1TZKA 2N0SA 1JZTA 2Y99A 1LSJA 3ITNA 3FWHA 3K20A 4DARA 5CHYA 4GKBA 4OTZA 3TLEA 3ZWWA 5EQDA 1UJ4A 4BTEA 1HT2E 1ZK3A 3T5MA 3I2HA 1GNRA 2QTCA 5LYYA 4KWEA 1XJQA 3HJGA 2BCEA 1Z39A 5GJVC 3WWDA 4CL8A 4BVBA 3FN4A 3AKCA 4D9MA 3WIBA 4MCIA 1NBHA 4ZFNA 4O1MA 4RZ2A 4HX5A 3UAZA 1E1NA 1IC6A 2F7SA 2ZRBA 2OYSA 3ASUA 3EIFA 1TYDE 2FW8A 3G7SA 3P9CA 3UO8B 3V8MA 3LI2A 1P60A 1PWYE 4N6OA 3DAYA 4PZCA 3TH5A 3UT5A 3ENQA 2JLSA 4BBPA 1V37A 5LJLA 4DSAA 5C8XA 3BE4A 3WLJA 2F3QA 2WJHA 2GEDA 3ODPA 2QN9A 4R54A 3VPSA 4PRZA 5FBZA 2OXEA 2D0DA 2FW0A 1RAGA 2WHPA 1GNPA 1NUUA 2ONZA 3RVDA 1YRWA 3SBEA 4BUJA 3CBGA 2H0RA 3M82A 1DBSA 4DB4A 3GARA 3AUFA 4INJA 1DAOA 1PJLA 2VYND 4JR0A 4PLVA 3BGDA 4DC1A 1BHSA 4YWHA 4AC9A 3HCWA 1Y80A 2VAWA 3EJ6A 3OZBA 3PQCA 4GR5A 4H7KA 4KBGA 5HOQA 3U09A 5C7OO 3LRTA 1VE1A 5LJIA 2ORWA 3E7FA 3NTLA 4KE9A 5LUBA 2HMUA 1DEAA 1U6JA 1NF8A 2A57A 2ES4A 1U0RA 1TMYA 1MEOA 2PT9A 3MD0A 3GJYA 4BX3A 3O2JA 5G53C 1RYBA 5ABPA 3BXXA 3JQGA 5F64A 1NW6A 4RVHA 3B6ZA 4O0MA 2W2LA 1TE2A 4XGQA 1Z5GA 2ZJFA 5H81A 3RUCA 1FXWF 4GGMX 1ML3A 1NNSA 4GXRA 1KE2A 4BNYA 2XOXA 3C16C 5MN5A 2JVJA 1Y6GA 1MOSA 3LCJA 4RO0A 2WV7A 5BOSA 5DBEX 1HX7A 2P62A 2GQ0A 3FHLA 4H7IA 1RPJA 4Z2AA 5LP6F 1J1ZA 1KJJA 1U0OC 2ESRA 3QKUA 2YHIA 4FZ3A 3L7IA 1J07A 4JKOA 1M1YA 1N9GB 1SCNE 3GYBA 1Y8RB 2ZJOA 2RGEA 3OMXA 4ZT4A 2A7QA 5AXDA 3C7DB 1VHJA 4KV7A 2AZMA 1E2HA 3QBTA 1SCAA 4BQPA 2BE7A 4TMWA 3WV5A 2NU9A 3JZFA 4OFZA 2BIFA 2G80A 3CHYA 5IN4A 2FSGA 4Y2HA 2V3VA 2XE6A 4GPZA 5FLXA 4HWGA 1D6NA 2X9LA 4OHCA 3CZQA 5KNDD 3CPEA 1OHHA 3QPWA 3G2QA 4H0CA 4IXNA 1L1FA 2CWWA 2JIQA 1YGPA 3RJTA 4YV1A 2ORED 4WZBA 5GZ6A 1JU4A 2HMYB 2EJWA 3WNVA 1RQNA 3AIOA 3ZOZA 1OH7A 1W96A 2JASA 4C0LA 4QWMA 5G3ZA 3Q12A 4K3UA 2CHGA 4Q7LA 1W76A 2GD2A 4G0NA 2H08A 2QD4A 4NE2A 3WYGA 3K9WA 3NHBA 1EX9A 3CZ4A 1EFRD 1U11A 3A9SA 3D8SA 1KP9A 3IHTA 1FK8A 3PIRA 3AGPA 2B1GA 2X5OA 3H84A 4PCUA 5TJ9A 5WRFA 2AR0A 4HDKB 4C0JA 4EL0A 4M22A 3LECA 4ZCPA 2IY9A 1DJLA 3E1SA 3RSCA 3PL1A 5GZ1A 3A4IA 4BASA 1ZK4A 2DKFA 4Y98A 4EPVA 2IYYA 3LCMA 1GGKA 3CF4A 4WA8A 1GU0A 3FPEA 3LFUA 3SS8A 1F8GA 1XLTA 3OURA 1QO7A 3DW1X 1M2VB 2GPWA 3O92A 4O59O 2I2DA 1OI2A 2WPNA 3ACCA 3UQZA 4WOJA 5K0ZA 3W5AA 1P5RA 3M0EA 1P3JA 3CTPA 5LM3A 4P8RA 3ST7A 1BD4A 2MSLA 2O8DB 4MPTA 4YAOA 3OQ6A 2F9LA 3P9RA 3RYCA 3B12A 3KFVA 1I3OA 4H3KB 4Z0TA 3RW9A 2VXBA 3WADA 1GG5A 1IG0A 4EVSA 4P32A 1E8NA 1ULTA 3KB1A 3HFJA 3IEUA 3PPWA 1HL3A 1O5TA 1VA4A 4G4SO 1CFJA 1MX9A 1KEPA 2A1UA 1OZAA 2I4OA 4KIGA 4WDQA 5A62A 5LU8A 3IMEA 2J45A 3NTVA 2OHVA 3KQMA 2EJUA 3KYIB 3UFBA 3CE9A 2B4TO 2P4SA 3ZHUA 4D97A 2C3PA 4QXRA 3KLOA 4I4CA 1JHAA 1YS7A 1YWGO 2WNSA 5LA6A 3VDXA 3AEQA 3MJEA 3U9SA 3WIOA 5DNAA 3NNSA 3NP9A 5F76A 3DBLB 3R24A 4BGIA 1ZJWA 4ODIA 5DV9A 3RSQA 1XQ9A 2R1UA 1A5SB 4P81A 3N58A 4JUAA 4YJ3F 4DRXA 1DDGA 2C7GA 2OXFA 3LWZA 2Z2YA 1BG6A 3P97A 3NV9A 4N3AA 4D4HA 1FU8A 1A82A 4PIVA 1M0EA 1MW9X 1W30A 3H5IA 4X92A 3UPTA 3AQIA 3QJ5A 3A9VA 4L5AA 1VJRA 3AT1A 3LD9A 4E03A 4B80A 3BBPA 3U4CA 3CKMA 3JQAA 3EGWA 3AR3A 4HGYA 3ER8A 3VNVA 4G24A 3DNFA 2XPCA 1OC4A 1FFDA 4OQFA 2P4UA 1LKZA 4Q5IA 3A06A 3N2ZB 4CEIA 4MAMA 2Y05A 3DV0A 3IUEA 1BAPA 3FMPB 3FVQA 5KYTA 2D7CA 3L8CA 3RREA 3UWMA 2QVYX 5GONB 4EYEA 4HSEA 4L5YA 5C5EA 1Y8QB 5ELXA 1B7GO 2HGZA 2PX4A 4UBMA 3A4LA 4GQBA 4KNYA 1VKOA 3RK1A 3GXBA 3TRKA 1T5DX 3ZGOA 3E9ZA 3R5KA 3FCSB 3EGOA 3STXA 4E1VA 1P39A 5K6AA 4YAFA 3RAPR 2W6NA 4WKNA 1FDSA 3OLQA 4G4SP 2H54A 1RXVA 3UMRA 1HI9A 2VF5X 4MQBA 1KJNA 2OCKA 3F4BA 2WYIA 2ONJA 2HJWA 5ENZA 4Q4HA 2JVIA 2DETA 4HQ0A 2GN6A 4M7WA 1G2OA 5BVHB 2YIMA 3LXUX 3HVKA 4UPDA 2G9VA 4E88A 1NI4B 1PZFA 1V71A 1SU6A 3PYMA 5DIFA 4UDNA 3WGOA 1RWXA 3PCXA 2DOKA 3ZDQA 2VI5A 4MB0A 3HJHA 2FW9A 4BNDB 3GCWA 4OHYA 1RBMA 2NU8A 3TSOA 3DDUA 2F1IA 5EUQB 3U61B 3C5HA 1Z3CA 5EJIA 1WDMA 4MTLA 3ZX5A 2R68A 3EZ7A 4M21A 4QTTB 1D0IA 2IU4A 4JBGA 2J07A 5T57A 4ZCSA 1AHHA 2B37A 2XJ4A 5TT0A 3GNQA 4YQEA 3WNBA 1XRMA 5A6VA 2F62A 4FJ0A 5CNMA 3U26A 3N0XA 1GZHB 1HDXA 1Y89A 5K8TA 1ZZGA 3MTGA 4DPMA 4JXZA 1PW7A 5LLDA 3VI4B 4KP7A 4HDAA 3W79A 1SBHA 1KJWA 1FLNA 2CJXA 3DBVO 4K9OA 4M1YA 5JSYA 4KPEC 1QP0A 4HTAA 4WZZA 1KZ7B 3G5MA 4QDZA 4JSRA 3F78A 3WHKA 3CR7A 3EZ2A 4NF2A 4RTRA 2WMOB 1RWMA 2BHSA 5KYYA 5AT1A 1AO3A 2Y76A 3DEAA 3VSAA 1QHGA 3I62A 4OFBA 5IBRA 1J9EA 2ABWA 2YV2A 4FLFA 2JJMA 4KVZA 3SYLA 1TI7A 3VZQA 2HRRA 2FE4A 5BW8A 2CF6A 1WRBA 4NV1A 2HH9A 1UT5A 5KWJA 2JLWA 5E1DA 3B9BA 1GAQA 3FTFA 3I73A 4H4CA 1PNTA 4EGAA 1P9OA 4BN5A 4L9AA 4CM8B 1MV5A 1JLLA 1QIKA 4JITA 4KUGA 1O77A 2OP1A 1IWBB 3SZ3A 1KDOA 4ZAXA 5KSWB 1ZJ6A 3RROA 1QB7A 2CLMB 2CV2A 2P9FA 1EP3B 2NO7A 4PLPA 1XHEA 2EXXA 5T4HA 5C5DA 1QGUA 2ZYVX 3AB8A 3FMVA 1Z8NA 4JJZA 2P6OA 3SC3A 3GCGA 2H31A 1EE9A 1NQ5A 4MO2A 3HHPA 2C54A 2HHAA 2C5EA 3ESZA 3GFRA 5DHAA 2P6UA 1JG7A 1NMZA 3CA8A 3GLSA 1PZMA 3QPAA 3I32A 1KQFA 3GJ3A 1XCLA 4KR0A 3W7VA 2VRWA 3AUXA 4N7RA 4ND8A 3O8OA 5B58C 1I0LA 4MS1B 5EWMA 4F3CA 2WWYA 1WHTA 3U62A 1TJNA 1BVRA 4QQNA 1U9IC 3DFIA 4TVOA 3LU1A 4DUGA 2NP7A 1NE2A 2DQZA 3A2MA 3HY6A 3VYSB 2VQ3A 2PGDA 5HIMA 2QRQA 1LD3A 5A9SB 4PZYA 3MT0A 4EHFA 1KYTA 2B3TA 4WZAE 1LBHA 5J5AA 3LDAA 4S2EA 4ZODA 4CFSA 5FL7A 3LT1A 5AOBA 4D9JA 3R0ZA 3WYEA 1TCAA 2MINB 2XWPA 4YDQA 5K0GA 1M7GA 1C2YA 1KI1A 1DXHA 3EQZA 2PZAA 3MJ4A 2LIPA 3QWBA 4M0DA 1ZCAA 4OI2A 4NBTA 5K03A 2Q2QA 3CH6A 2G1KA 4IMIB 4AUMA 4P5DA 1YS9A 2G71A 5EQFA 1MKYA 2ZE5A 3ZE6A 4ZEWA 3PZBA 5DASA 5ARDA 1Z35A 2JA1A 2AHOA 2Y68A 3Q7QA 1T8TA 1T6XA 2JFGA 2QR3A 2QUZA 4QUIA 5KVSA 4F5WA 4MWGA 2FPGB 1U4SA 4WTOA 3PGKA 1SUPA 5CM9C 3W6UA 5DYIA 2JGNA 1UBRS 2Q46A 2MSWA 3KHUA 4Y6QA 3UAOA 4TSKA 3T7IA 3QPUA 1QYXA 2Q0SA 3UV7A 5K5EA 1VCHA 2HDWA 5TPWA 3NC0C 4TLDA 4B2IA 2XKJE 1WABA 2MU1A 1K0UA 4KHPB 1GUFA 3PNVA 4FXOA 5I3ZA 3VC3A 3OIDA 5JZSA 4G8DA 5B6PA 3TZ6A 1C1HA 4KMSA 1B26A 2ZVPX 2W48A 4ZYWA 4GPTA 1QLWA 3N9IA 3TTUA 4C5AA 1U28C 3MWDB 1NV8A 1XZHA 1T1GA 4EB6A 5CVEA 3V8NA 1PR2A 1LSSA 3LC2O 3ZPXA 2F17A 1KO1A 4EHIA 1PLKA 4EDHA 2DGDA 4YJKA 2HC9A 4DXAA 1RWPA 4G1UC 1RAIA 2ZS9A 1U4NA 3K9LA 1JQEA 3B2QA 3W0LB 1EWTA 3KM0A 4JVSB 2QTNA 3QZUA 4MP3A 4ZEXA 5EXDA 1FDTA 1PS9A 1K7SN 3NTXA 3ZK8A 4KE8A 5EIXA 3OWHA 3ZDBA 3G82C 4KMOA 1YDHA 2CC2A 2ZR8A 3ON5A 4ND1A 3HY4A 4IDAA 1EQAA 1I5RA 4A6DA 4BQFA 4MIYA 5M5BA 5EAIA 5JPCA 4F6CA 1Q7EA 2I78A 2Q4RA 2Z4SA 3R3XA 4FJ1A 4NDZA 5C51B 1XCJA 1T4CB 2J33A 5ITZB 2HLPA 4Z8XA 5FULA 2A4KA 4J4BA 3OUUA 4YJHA 1UP6A 1G1AA 3U7HB 3QPCA 3DBHA 4DQDA 4YJGA 5ES4B 4OHOA 3CEAA 1RYEA 1RSZA 4JUCA 1EJ0A 2PNFA 2H7VA 2RC6A 1ZD4A 4X1IB 4ER3A 3DFFA 5I51A 4LHYA 3WAGA 1LSUA 2QUKA 4MRRA 1E96A 1HDGO 4P3XA 2WUDA 2QTBA 3D4BA 3SXPA 1OTHA 1PKXA 5T67A 1FFYA 3PNYA 3DEIA 5FBLB 4UBOA 5FDFA 5HTKA 2K4MA 4LX8A 3W04A 3H9BA 4PGFA 4GUDA 2BVNA 1M33A 4P2GA 3UK2A 3FIJA 3AVOA 3DLBA 1IDN1 1QK5A 3B51X 4GYWA 4R0VA 4JI7B 1VE3A 3I53A 2E21A 2RONA 3DZBA 2H51A 4UHDA 4UTPA 2AE2A 3H17A 1FTWA 3GLIE 2H1LA 2CXHA 5ETJA 1GTVA 5KTOA 1XEWY 2HQRA 4KO8A 5EWLA 2QSJA 3EYWA 2WFMA 1A9PA 2B25A 2DFNA 4ECAA 5CFQA 4YP6A 3VR2D 2QJRA 4MKRA 4YQZA 3GN1A 3W78A 1P2FA 1Q0PA 5A3QA 3D8RA 3EDQA 5M04A 5B7PA 1AOXA 1BCSA 1UK6A 2XUZA 1KO5A 1Y5NA 1APBA 1E20A 1RQRA 2P1ZA 1CS4C 3P71T 3WLHA 1RDFA 1P1IA 3NTOA 4PYOA 1AXGA 2QDXA 1N5DA 1OLUB 1OR8A 3FJ1A 3QOFA 1XL0A 2C4NA 2PMKA 4F2DA 1CRQA 5KTKA 3V8BA 3IT3A 4MGIR 3NDIA 4MHOA 4I0WB 4RH1A 1I51A 2PUBA 4UW9A 3DVSX 5IDYA 4KSBA 4CKEA 3UK7A 1THTA 2OZPA 3FFAA 3N0RA 1N6PA 1G0OA 4RYLA 4EUNA 4YCMA 1I01A 2FWPA 1N2EA 5IJZA 2O7QA 1ZISA 2WVGA 4RKWA 4UEKA 3ZE8A 5DNUA 1NUTA 3GRYA 2EZ9A 4CM9D 3WA7A 2B1QA 2HU8A 2JJ1D 2P65A 3CPHA 2CW5A 2RHCA 3O8RA 1J5PA 1ILWA 2FJPA 4AJPA 3ABQB 3PT9A 4IG9A 4EQ6A 5DCWA 4MW7A 3HWWA 4DR1B 2RB4A 4FGJA 1KO4A 4P7JA 3UANA 3DWIA 5FWYB 1ORTA 1E9EA 1QYWA 1SOVA 1OFIA 1RCFA 4OXNA 4Q47A 4ZPXA 2IT1A 4NCKA 3W6OA 5CDYA 1I1OA 1LRLA 3L7YA 3ED5A 4AWAA 2BGKA 4ZGBA 5J43A 2GNPA 4QL3A 2BDEA 3U7FB 3E3AA 5F77A 3F7TA 1NYTA 1DG1G 4R16A 4W82A 3H1GA 1LV8A 4P82A 3NKFA 2GK6A 3CEJA 1V1RA 2HW8A 3ZW8A 1RZRA 1JLSA 3L4EA 5E9JA 4KGZA 5EMLA 3DOIA 3E3OA 1NWHA 5ESRA 3I0ZA 3VTFA 1UZNA 5DTEA 5A4DA 4IJVA 1A0OA 2QPOA 3HA7A 1NASA 1NXPA 1IU9A 4Q1EA 1YIOA 4XPZA 3WHIA 5A5FA 1GG2A 4ZYYA 5BR1A 2PXXA 3FVVA 3NETA 3U19A 4RVSA 5TDHA 3B1KA 1YKFA 3H0KA 3MTEA 4JAVC 1Q22A 3U4MA 1II0A 1J0BA 2BDUA 3H0EA 5JZVA 1E0AA 5IKEA 3EPJA 1L5WA 1S02A 3H0CA 4RV4A 4YJ2B 2CUTA 1IPHA 2OGSA 2ECOA 3ZGXA 4CR6A 1E4EB 3S2ZA 5AW4A 2BD0A 2P7HA 2FFHA 3GJXC 5FTKA 1Z0UA 5DN6D 1TXGA 5IJ9B 2WFLA 13PKA 1U1EA 2HHLA 2N9UA 2HO5A 2HTEA 4MR8B 4B3BA 4ER7A 1JHZA 2Z6QA 2NXCA 4RC9A 3ADCA 3O74A 3B3GA 4WK6A 2VDLB 4I1UA 4WK2B 2H5IA 3MTJA 1P0MA 2Y1XA 4LRSB 2G6BA 5KQRA 3KEQA 2BFDA 2Q8QA 1MIOA 2G28A 4DJDC 2PX6A 2X8LA 2ZR9A 2IF2A 4ZTBA 2Q9CA 4PZ0A 1N2CB 3FUTA 3TXAA 4F1WA 2QP4A 3O4GA 2I33A 2PKYX 4YGXB 3R77A 5AW5A 1SQ5A 4Q37A 2B21A 3GLHE 4GU5A 5TX7A 5JLAA 3ZDXB 5BMVB 5CFNA 4GSYA 2AVNA 1OFHA 4HH3C 4EG3A 2GJKA 5FUMA 4DTIA 2D7DA 4LOAA 1E4YA 4WIAA 4BU1A 1PGJA 4KE6A 2R6JA 3VU1A 4XCQA 1O54A 4URXR 1QQTA 4QYXA 4PBTA 4YR7A 1AV6A 3BZBA 5BYBA 1K7YA 3RYHA 1Z38A 3BB4A 4W6ZA 1E3IA 1GXSA 4TWZA 3BMNB 3K1YA 4JOSA 4LSZA 1O7JA 1KEKA 4YYZA 1RABA 4M0LA 3PR1A 4YFYA 1KQ3A 3G2PA 3HJBA 2AF3C 1DNPA 3B20A 3OX2A 3PJGA 3HMKA 3UHJA 3HM9A 1P18A 2P77A 3DB2A 3TW6A 2AK3A 4POAA 5FTJA 5LA6F 1M1NB 2VAXA 1P0QA 4U02A 1CF4A 1ID8A 2II6A 4NICA 5DSXA 4OB7A 5G1OA 1W35A 4GBJA 1CYDA 1N3IA 1D7AA 3GUCA 4HRAA 5C7IO 2P3SA 5LBUA 1I2DA 5E8JA 2P7IA 3LWBA 1D2AA 2WJYA 3RI3A 4D43A 5KX5B 4LDQA 2NOAA 2BOVA 3QXGA 2RH4A 2Q9AA 2YRFA 4URYR 4XVUA 2ZZNA 3H99A 1EK2A 3MB8A 4HWRA 1VGQA 5DISB 3EZ9A 3WISA 4B0PA 4KI7A 1RHKA 1VCNA 1RKUA 4FWIB 4JNKA 1NT4A 4I4TA 1TCVA 4TKLA 3UPUA 5CCBA 2VK4A 5HZGA 2HQSA 3CRZA 1SBZA 3PK0A 3O4JA 4KO1S 4EJSA 4O2AB 2D6FA 3T5CA 1V8BA 3KFLA 4G36A 1WMEA 2YX1A 3O83A 2DRIA 4R7GA 1T3GA 2Z4RA 4N5DA 2QJFA 3CJQA 3RARA 3ZX4A 3KAPA 1GRNA 2J6HA 2ZJ1A 3FMIA 4C4ZA 1NDHA 3HVIA 4PC2A 3BXFA 1YDMA 4M99A 2GLTA 4GI5A 1HL7A 1Y9EA 2DBYA 1T5SA 2V55B 3Q88A 4WLEA 1ABEA 5KJFA 1BVHA 3SMVA 3ZJTA 3P2OA 1KYVA 4YQFA 4WXRA 4BV8A 3TIVA 3CW9A 3L9WA 1AKEA 2ZBVA 4B17A 1CP3A 1ZN9A 2D54A 2YWJA 1M6EX 1AT1A 3QOXA 4ISCA 4DQVA 1E8MA 2CFSA 4HNAB 1C5KA 2ROQA 4KYUA 3SYKA 4DQUA 2ET6A 4B32A 4NFSA 3CT4A 1BFUA 4RDHA 3CWCA 1U2DA 3BL5A 3NV7A 3BIWA 4WI1A 1U0BB 4FFMA 1T3HA 1KDZA 2PZFA 2R8PA 3FXAA 4XFDA 1ZKDA 2ZRDA 3D7RA 5E9AA 3W2TA 3OBBA 4DWOA 1ZMOA 4J2TA 4MP6A 4PTYA 2TS1A 1W94A 1ZEMA 1DTSA 1ORHA 1ZOSA 4J0JA 3W2HA 1KC3A 1P2VA 4BQIA 2MWMA 4JSTA 1SHTX 2PUEA 1SXHA 5CVJA 3RG8A 3F3SA 5ECWA 4DUZB 2JAHA 4C87A 5T7BA 2Q4BA 2J6BA 2I9PA 2B6HA 4FOTA 5EE9A 1ZHFA 5HF5A 5GP1A 3ANTA 5LDGA 4CI0B 1YJ5A 4D81A 3AR6A 5L9AA 4BO9A 2ATVA 4HZIA 3OZWA 3AX6A 3Q7RA 1DTWB 1GA1A 1FCJA 4WFJA 3UH0A 3JZIA 5LL6P 1QIHA 3ULKA 2ZSFA 5TVGA 3K0FB 3TMKA 1VRVA 1A2OA 3KQSA 3OPYB 2ZG6A 1OV6A 2L69A 3C3CA 2YHAA 2A30A 2SECE 2BR3A 2VJBA 4RQTA 3OAAD 1F0PA 1RHUA 4O4JB 4OSPA 1E5XA 5ESWA 2DERA 2XTJA 3HCDA 1BJKA 3MIZA 5KVQA 1NN1A 2FK7A 2O8NA 1RIFA 1OU4A 4TL9A 1FYFA 1XTPA 1PSWA 2VNIA 2CYCA 3IUPA 4MA5A 3CN7A 1DBWA 4EG6A 1E3LA 3C7CB 3U4AA 5EC8A 3OP4A 5CB4A 3C8ZA 3FHOA 3G8YA 5ITWA 2LCIA 1E58A 1N9GA 2RGBA 3C3JA 2OG2A 3JQ6A 5LIPA 1Y8RA 4YRIA 5DM4A 2FZVA 1AKNA 2JFBA 2PGOA 2YOFA 3QKTA 5KCMA 2YNMA 4RDXA 3OETA 3TOZA 4HQLA 4Q7QA 3AUSA 1CPYA 4KOEC 3LY5A 3FHJA 5KI6A 4NIMA 1U1CA 1YIDA 1KH1A 2TMKA 2EKPA 3MEQA 3KQYA 3ZTWA 1BQ4A 3A2KA 3BXEA 4LNAA 1L7MA 3CG4A 2R6AA 3DMGA 1ZNZA 3OEYA 5BSMA 3OMLA 3I8XA 3IGFA 5L4NA 1Q0QA 4BNMA 1WXDA 4OFWA 5LQSA 3N05A 3AM4A 4R3WA 4CL2A 2QTMA 1AMNA 3ORRA 2Q5EA 5FTWA 2UYCA 1PL8A 1NVFA 2P9HA 2FSVA 1A1VA 5EYPB 5JG7A 4MUIA 1LWNA 2YVLA 3BRSA 1YKSA 2WSSA 1ESCA 1WIWA 2XJ9A 1BXGB 3LHIA 4O29A 4XM0A 3WDKA 3WB9A 4JJ6A 1H0SA 5TT1A 4AMVA 4IXDA 2A9JA 5FO1A 2IITA 3T9EA 2FB9A 4HDKA 1AUPA 5AUOB 5K4HA 1XSEA 3IJ5A 1IXSB 5THXA 5KJ6A 4ZKDA 2EKLA 1OILA 1LH0A 2ZS8A 4D3FA 3U56A 2X8JB 4ME6A 5M7EA 4FFRA 3KEFA 3JD4A 1IQUA 4MJXA 4BAGA 2C2HA 1ZIOA 4CIDA 4NH0A 5C4MA 2I0FA 1M9NA 4RXTA 1KIFA 4R4JA 4TMZA 3UAGA 3ZWXA 4P7KA 1M2VA 2VAVA 3ICOA 3OHMA 2IVZA 2XNDA 4IIXA 2D1SA 4CN9A 4EFNA 4RMJA 4EQZA 5I7UA 2DP4E 2NTYC 1BOOA 2HLDA 2XF8A 4IDHA 4TKVB 4ZGWA 5DYWA 4UZFA 2GBFA 3FYDA 3NEPX 3ZWDA 2O8DA 1JR4A 2P30A 5TMEA 3QEKA 2Q45A 2QRLA 2O3TA 3C8MA 3FSGA 1IN5A 2Z3VA 3O1JC 4FOPA 4HLQB 5C0OE 1X9HA 3W8NA 1S3FA 3IDFA 4U8HA 1GQQA 5CT8A 2OMEA 4G4JA 4CLOB 4ZQIA 5CFPA 5BUSA 2FUG6 1M34B 1W4ZA 3WLNA 1Y7HA 4BNJA 4EPRA 3ZZTA 3CLVA 2EGGA 3JQ8B 4UOZA 4GE3A 4OMUA 2EC5A 3IOMA 1CTQA 1XDGA 4R8MA 3TUZC 2KS6A 5AW0A 1X94A 3DEFA 2C9BA 4B7CA 1UBSB 5JWOA 3R8FA 5LBIA 2IYUA 1UPBA 1BVYF 2ZI3A 3IOEA 3PR3A 4M1ZA 1KQPA 5DSTA 2IYSA 1Q17A 2Y1KA 1FS6A 2Y1OA 3SLRA 4KJXA 3GUZA 4TYYA 2HJ9A 3DBLA 1IH8A 4G5GA 5CHEA 4CMGA 3VR6D 2VDOB 1KK3A 2CJPA 3PFIA 2J3DA 1DQYA 3FDZB 4HKTA 4QGHA 2ERXA 5H8WA 3T9CA 4WMLA 4NZYA 5EG5A 4B3DA 2ODWA 3WK6A 5JJKA 1VG1A 1B6RA 1I0IA 1MDFA 2WJ6A 3FOBA 1YU9A 3HP4A 3QY9A 1ML4A 2A6PA 2EFGA 2JPDA 2B7CA 3NX4A 2HA0A 4I4IA 3ZZNA 1WSBA 1JG1A 2N3ZA 2WDZA 2QTGA 3VXKA 4Z54A 3TZQA 3BWXA 5LCXA 4EY6A 1PG5A 2LRHA 2IPLA 1N2ZA 4BWVA 1QRDA 1J2TA 1S2GA 3L8EA 5FOSA 4U7PB 3GAZA 2GF0A 2D5IA 1QPGA 4QUAA 4DIBA 4FFLA 5GONA 4JR2A 2NV0A 1Y8QA 2V3WA 3RSHA 3TBHA 3H9GA 5HKKD 3TM5A 1RJDA 3LSYA 5JAZA 3GMIA 2M1XA 3WMRA 4KDRA 3ZZUA 2Q1UA 2PAFA 4PZEA 1KR2A 4W1RA 3V1YA 2VNKA 1G6HA 3BM5A 3I45A 1VHWA 4GXTA 2PO5A 5FQNA 4N6GA 2HMSA 1LLFA 1P2GA 4D5GA 3KU1A 3TX2A 1FLDA 3M6VA 5HF9A 4Q01A 1GCGA 4MI1A 1HSOA 1QIEA 2R6GA 3COSA 2H11A 2DVMA 3GEIA 1DWQA 2FWAA 2GLXA 2EBHX 2AYZA 2O2YA 3BPSA 1WUTA 4KPGA 3HPQA 1NI4A 1YS2X 1J5EB 4EY3A 5BQXA 5IT4A 1BRTA 3CYFA 2COEA 4US0R 4LHVA 4O3MA 1PCXA 1XTQA 4ESEA 3ZEIA 4OATA 2PWZA 3L9XA 3UMMA 4X0EA 1WXGA 2YY7A 5HUHA 4B48A 1J39A 4Z4FA 2BGIA 1J70A 1F48A 2B94A 3QYAA 5DM60 3ROTA 4JI0B 1E1QA 3G02A 1QMGA 1CQIB 1WA5A 3E70C 2XWQA 4E5DA 5HJ7A 1ZA2A 1WD5A 1AGYA 1VPWA 2GEFA 3KZMA 3LVQE 2FU5C 2W2XA 3B7PA 3LUHA 4OQDA 3HSYA 3M4NA 2IP4A 4ZV7A 4ZZ2A 4DRZA 2PWYA 4L3OA 2IIQA 4NYMQ 3WLEA 4NEHB 3MT9A 1FDRA 3QBDA 2FZ4A 1Y6RA 1U6KA 1CUDA 4N6NA 5BWLA 1NLZA 1FTYA 2VHVA 3KOUA 5JOQA 5H82A 4XUEA 3TBKA 4BZWA 3FYHA 3KSMA 4QYMA 2HRCA 1GUBA 4LTNA 1G1MA 3DTVD 5DM1A 4B84A 3Q6MA 1IBMB 2A9QA 1XJ0A 4QPPA 5C31A 1L5NA 1JECA 1G8HA 2BISA 4JLAA 4PRYA 5JO0A 4YAUA 2ZYDA 3L7JA 3MPUA 3B5IA 4TRNA 5U1PA 3OT1B 1Y48E 5AI0A 4TXNA 1G21B 5F1OA 4CM8A 2YMPA 3OY7A 1PT8A 1TAQA 3S7TA 5IVHA 4I1VA 4LY0A 5T4EA 1EHCA 2IHYA 3L8HA 4IMRA 1A1SA 4BLOA 1WXXA 4HB2A 1KJIA 4L8VA 4EELA 3D31A 1MB9A 4BECA 2ZDQA 5KB3A 2PKRA 2JFXA 3H5LA 4UUOA 3WLOA 3PEVA 3ET4A 1PFWA 1HKHA 4ZAVA 4H2DA 4A3SA 4M37A 2ACKA 3ZV4A 2F8TA 4E5SA 4H27A 3C8HA 4EA8A 3CNOA 4EM6A 2BTQB 3M7IA 4JLJA 1UM8A 2IUYA 4MS1A 4M0KA 4PSUA 5F5NA 1UAYA 2A0UA 3PHHA 3WL6A 4J07A 5JROA 2OQRA 1JHDA 3LY7A 2BM9A 3G0DA 2G9NA 3X1JA 1VZ2A 3DC7A 4UUPA 4G6ZA 3GF4A 1BVUA 1Z0AA 2P0AA 1G8GA 3B6JA 3I58A 3INGA 5IFKA 4RULA 3KQPA 5TVKA 4CKWB 2W6ZA 3COJA 2ZE8A 2MINA 4FCTA 2X42A 1JAHA 5DBGA 2WICA 5GM1A 1DPGA 2C2YA 2C92A 3O26A 4BHTA 1ECCA 4DCPA 1IHPA 4CXMA 3OPNA 4FGUA 4HLUC 1COZA 1OGIA 4HL6A 1JQJC 1JQAA 2H6EA 4RY9A 1AK1A 1KVQA 4LJ7A 2J9YB 2HCJB 3JYQA 5EE1A 3FOFC 4IGEA 4YXFA 1VLHA 2V7QA 2VP0A 1DMRA 2WF6A 3L0DA 2WAOA 1XFDA 2Z1DA 3OC0A 2FH5B 3QMPA 1SB9A 4RL4A 5HE8A 4X44A 5E4JA 4W9NA 4MA4A 4PFSA 4X7BA 3STWA 3ZHBA 3GFVA 2JI7A 2TSYB 3P1JA 1PLLA 3HN2A 4L02A 3RWMB 1YQWA 2C1EA 3Q3VA 1TKCA 1A4UA 4DG8A 2OCBA 4AURA 5IKPA 2QR2A 1W4CA 3QX8A 2WVAA 1CV2A 4LRTB 4M9XA 5IN5A 4NXNB 3ZOKA 5EGSA 1KE1A 4GPEA 4H6PA 5ALXA 4GZMA 1CUIA 2QR5A 2D7JA 4KBYA 2P3QA 3R09A 3AHGA 4Y2RA 2JH9A 6REQA 2BH2A 5EMNA 4DUYB 3MWDA 1BMQA 3C4JA 3WLMA 3SICE 3ZCVA 1A9TA 2AZXA 1CJUC 1XXHE 2KB0A 2NSDA 5F9MA 1U1FA 4HWTA 5AHWA 1UFQA 2A7XA 2Y1FA 3HKDB 4DR3B 1MB0A 2HRZA 1GKKA 2BMJA 5DM70 1P2BA 4WXYB 3V7UA 3GLVA 2G09A 4G0UA 1NMXA 1N0VC 3MOIA 4C7VA 2NT4A 2HZ7A 2YFQA 1L1RA 821PA 1IUKA 2PG3A 5CR9A 5IC4A 1J09A 1DAHA 1G18A 3RAGA 1GCOA 2YY5A 5T6BA 5HFJA 3ELWA 5J2TB 4DIUA 2ZPTX 2JLRA 2G9RA 3GROA 2PRYA 4JI5B 3EDYA 2QAGB 4B71A 4UBJA 4D8XA 1T4CA 1P9WA 5ITZA 2YQ5A 1WU8A 2ZXEA 3EPPA 3EBOA 3A6DA 2VPZA 1A77A 1TGYA 3ANNA 3PDWA 4K8RB 2Y6VA 4Z53A 4BB5A 1TU4A 1UBUS 1EHYA 1DC5A 1TADA 1RJEA 5AI8A 5ALWA 5L3ZA 2H4HA 3ZV3A 1C29B 3CWZA 4NPCA 2QYTA 2J7PA 3ZDEA 4X1IA 1ECBA 5EJ6A 3F9IA 3GMDA 2BFWA 5CT6A 2NAFA 5JY1A 3AFOA 2C07A 3FVTA 3L0OA 4M0MA 2BAGA 2RGAA 4NX2A 1BTOA 4CIVA 2XCSB 2QRVB 4DZTA 4LZJA 3ETJA 1I3MA 4TT3A 3RJ5A 2XRFA 3WWEA 4V0RA 2K2WA 4MIEA 1GIAA 2R4UA 2FCAA 3ONFA 2GO1A 5DB4A 1SXIA 1CETA 3QQ5A 4JLVA 2ZJZA 3COVA 4UNSA 1TRHA 3HPRA 4AECA 2V7WA 2VFAA 1XQ1A 4YYEA 3O91A 2OSVA 4HJXA 1SK9A 2Y1GA 4UNNA 1P45A 3BL6A 1LDBA 5AVTA 1L5FA 3FPAA 2P27A 1QO0D 4ZYLA 2ZYAA 5HG0A 1UMDB 3BL8A 1TVMA 2ZAGA 1L5GB 4LKOA 3SJZA 2QNIA 1QFSA 3QHPA 1FFHA 3PS9A 1R0WA 3PTZA 3LRPA 5ADWA 4QM7A 1L0BA 4BVHA 3T1YB 1NJ1A 1OXXK 2O1WA 2VYVD 4Q21A 2DHCA 1OLUA 3PGLA 4H3HB 3J80A 2WQ6A 2ZCVA 3S29A 1EK5A 2D5LA 2XHEA 1KMCA 1GTL1 1QGED 1UWKA 1LPBB 1ZXXA 3K09C 1O0CA 1XZEA 1GPH1 3OOEA 4URVR 2IBSA 4JC8A 1XQ6A 5KVVA 2FSUA 3IOBA 2QUIA 3RVPA 3VKGA 5KTSA 2X7JA 3HCFA 4I5DA 1PTJC 4MGHA 5CVDA 4DLAA 3W5DA 3OE5A 6ADHA 1UADA 1SR8A 2HA7A 2VP2A 2WJPA 3C48A 4PG6A 2H4FA 1VA5A 4G1MB 4JXJA 1VJ1A 2E55A 2VCHA 1XVAA 5AUNB 1AXRA 5BR7A 1T9GS 4R83A 1J8YF 1EQUA 3H83A 5FWYA 1FRVA 4L28A 4CEJB 1F4PA 3MQ2A 3GC6A 4KG7A 1QNFA 2J6IA 4PVDA 3NCTA 1CQJB 3AZPA 1JFVA 4DNOA 4EA7A 3C97A 1PHRA 1QFZA 2I2XB 1KDYA 3SZUA 1W6UA 2CXTA 4OYHA 3L7DA 5HR5A 4X66B 1N8TA 2PT6A 4TUYB 1E2IA 3V3TA 1KYIA 3BGWA 4UCWA 1KQOA 3OE4A 4EEZA 3ABSB 3CB2A 3MSCA 1R00A 5CB4F 4DTCA 2RIRA 1T1IA 3O2NA 2YWCA 3MW8A 1E7RA 2WM8A 3G1WA 4XEHA 5ECDA 4JQSA 3EYAA 5KQSA 4OQPA 3DL4A 2NGRA 2VHWA 3KR9A 4Q4CA 5HRAA 1YL6A 1RI3A 3ZHVA 5FEUA 5CXUA 3DS8A 2QYOA 1Q0UA 2MOKA 3PFNA 4IS2A 1AUOA 3QY0A 4NZZA 4UDYX 3RM3A 1UDWA 2FLKA 3E0XA 3HA2A 4EFDA 5SICE 5JVDB 4C7MA 4RA9B 1FYDA 1M8KA 4ZMSA 4D44A 2ORVA 3JTMA 3I0MA 1PDWA 1R6VA 3L1JA 4PZZA 4MRAA 1O6ZA 1PT7A 5LOVB 4YJ2A 2Y2UA 3R7DA 2BRUC 2QWXA 5HNKA 5FWAA 1BQ3A 1E4EA 2HYDA 2ZBDA 3ZVLA 1N3LA 2ST1A 3OCJA 5KNBH 3MCZA 4BPBA 4EI2A 5IJ9A 2VHJA 5L8VA 4ARVA 2XMZA 4Q4JB 1Z0IA 4H60A 4MR8A 5JSQA 4GC5A 4RVCA 1RZUA 1U65A 5MN6A 2JDIA 4ZVUA 3WYBA 2NU6B 5K3SA 3CZRA 3IALA 5B1EA 3KLBA 4QXQA 3DLHA 1G3RA 2NN3C 2W2OA 4QJ5A 2CFTA 4CLHA 5HS6A 1T26A 4COOA 1PIWA 1JEEA 4TYNA 4DCUA 2C84A 2IZ7A 4BYMA 1QQBA 4L0DA 2X0IA 3C6QA 3JALB 4MEBA 3UYKA 1CZLA 1U0LA 4P93A 4BFCA 2FMXA 5BMVA 2FN8A 1W44A 5T64A 3V3KA 5FBRB