5CFPA

Crystal structure of anemone sting (nematostella vectensis) 'humanized' f276k in complex with 3', 3' c-di-gmp, c[g(3', 5')pg(3', 5')p]'
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
181
structure length
181
Chain Sequence
KNVADGLAWSYYFGYLKFVLPELEKQIEKTSKFRSKEKFVKKMFILIPSNCFWDDKIPGSDYDPQNRITFEGNTEPLEKTRGGVKLRHYKHSVYEIKDGENEPWFCIMEYATPLLTLYDMSVAQPGELSREERDAQVVVFLRKLQDILEGDRACQGKYELVTFSPDRDLADVMLRKLKDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Stimulator of Interferon Genes
publication title Ancient Origin of cGAS-STING Reveals Mechanism of Universal 2',3' cGAMP Signaling.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Immune system
total genus 51
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cfpA02
4F5DA 5CFPA 5CFLA 4QXPA 4KBYA 4YP1A 4EF5A 4LOKA 5CFMA 4LOIA 5CFQA 4QXRA 4F9GA 4JC5A 4LOLA 4EF4A 4QXQA 4F5EA 4F5YA 4LOHA 4QXOA 5BQXA 4LOJA 4KSYA 4EMTA 4EMUA 4KC0A 4F5WA 4F9EA 5CFRA 5CFOA 5CFNA
chains in the Genus database with same CATH superfamily
4C3ZA 1WABA 3TLZA 3WLJA 3LYHA 4HTFA 1PUIA 3BHJA 1TAQA 2HOQA 4FP9A 2J08A 3K1TA 5HZMA 3GZJA 3FOZA 1TLLA 3X1MA 3TZLA 4F2PA 3R5FA 4QDKA 4ACAA 4EUSA 1MW8X 3IDOA 2D7JA 2W90A 3GVHA 3TZQA 3I6QA 2N0SA 2X8LA 3LRPA 5C18A 1HDCA 1O95A 3IIMA 1DO8A 2EOAA 4MRNA 1N2OA 2C42A 1A9SA 1Q22A 4BZXA 5MF6A 1FJXA 4DMLA 1DHRA 1XALA 2JFQA 1PJ4A 2OR3A 4C30A 3NXKA 3I62A 3QG5A 3GQBB 4IJ6A 3GDFA 3RVKA 3AU8A 5BMVA 4F3CA 3J81A 1UJMA 2KLHA 3TIIA 4O2LA 4AP9A 1NSYA 2HLNA 4WIAA 3I2IA 2WFMA 4ZHQB 1UADA 3WISA 4DIUA 3GGJA 4RKWA 4MI9A 1N9ZA 1NN3A 2MHCA 4RSMA 3QBEA 3ZD7A 3UTDA 3OLVA 3QFTA 3HJRA 2UZIR 3D2CA 2ZSBA 4ND8A 4R8MA 4K6MA 3WRYA 1VMEA 1NX9A 4IRXA 3Q3HA 4PVCA 1GPBA 5COBA 3VC1A 4B40A 4EB6B 4AMGA 1KSGA 2MJLA 5IDVA 3ZGOA 4J29A 4RZHA 5DEIA 4LQDA 1DHTA 1XK7A 2BBWA 3Q7PA 3GT7A 5A02A 3N2KB 1F0PA 2IL1A 4YUAA 2IUEA 2Z30A 4G5XA 4Z3OA 5JCZA 4HLNA 3ZGVA 2I1LA 4NBVA 1XZBA 2B37A 3BJEA 3RC3A 1C14A 3FNRA 3NAMA 2UUOA 1ZN8A 4OYYA 2PSSA 1OAOC 2NSHA 2PMFA 4GD3Q 4JJ7A 3KSDO 3TNDA 5BP7A 1C3LA 1CC1S 1GPH1 2CT8A 2PSDA 4H1HA 2YDXA 2FCAA 2VCEA 3BA1A 1OXMA 4RY8A 4XJSA 3JAKA 1NRJB 1H1LB 1I3OA 1SUWA 1UBLS 3MRTA 1OVGA 2OFOA 3EDYA 4M7WA 4OAQA 1W30A 3T61A 3WWEA 1MB9A 2ZUSA 5LQDA 3IP5A 1X3SA 2W0SA 1TTQB 4I4TB 3SVTA 3TLGB 2VBIA 1P3DA 5LQCA 4BNTA 2PNJA 2DF8A 4QA9A 3RLIA 3W6UA 4HNUA 1KPGA 2GCOB 1DELA 4GICA 1WG8A 3MAGA 1LQ2A 4MMZB 1YZUA 1YMQA 3TPZA 1A9XA 2C8JA 1ZH2A 1BVRA 3BD8A 4HNAA 2HU2A 3GFSA 3KZKA 3SHOA 3A1UA 4XJXA 1V9CA 1YC2A 4OI1A 4KIGA 1C9EA 4BS9A 2JANA 1LRJA 4NFHA 4OYHA 1XI2A 4R1PA 2B94A 2BM8A 3QBTA 4YRQA 1U7ZA 4EW1A 4UTPA 1P2FA 1DGQA 3EODA 1JB1A 1T8PA 2HPAA 4XR9A 3EK2A 4UM9D 2DFVA 1EK0A 2V9PA 2P1DA 4PO3X 4R1OA 3UFBA 1ZN9A 1ZUHA 1H6CA 2I91A 2H2WA 3HDYA 5CLJA 3GLGA 4LOAA 1ZJWA 4CT0A 1FLVA 3E3LA 3KK0A 4TLLB 4W4TA 4EPVA 4AKHA 1Z17A 4X41A 3AUTA 4EECA 5LA6F 3O75A 1JQLB 1X7XB 3TX2A 1Z9BA 3ACDA 1JDJA 2LWIA 3ZX4A 2I33A 3MTEA 4QRDA 1L3CA 2YJGA 3W5UA 4EUFA 4FDUA 1E1QA 1Q50A 2UUPA 3VDNB 5LMCA 3SICE 2PXHA 2QRVB 2WG1A 4HNTA 1RLTA 5ALSA 1UAGA 2BAGA 2CJWA 4G07A 3QK7A 3TW0A 5KMGB 5HKKD 4B3RB 2DLNA 2X14A 4NJEA 4IRMA 5ULLA 4ITVA 2Q1XA 1SPBS 1Y9EA 2CXXA 4IIHA 3IUJA 2BI4A 2Y0DA 2KWIA 3MJCA 3HXKA 4MKZA 3LPDA 2C4WA 2TS1A 1EFRA 2ZS9A 5HUHA 3MQ2A 2FX5A 4YGXB 3WLMA 2JG3A 1VL8A 4B3FX 2YJTD 3B6EA 3DEFA 2ZRKA 3IV9A 3DMDA 3CH7A 3ZWNA 1E1NA 1RZ3A 3WNCA 1ZOOA 2OYRA 3HU5A 4XJTA 4ZP1A 1R8YA 2NADA 4ZODA 1BU8A 1TJ4A 4Y7CA 2NSLA 2ZYUX 3L7IA 3B89A 4G9BA 4RNDB 3HSYA 1W1IA 3BG5A 2M2IA 1I94B 1G20A 5DNCA 3KALA 1XMPA 3M6LA 4ZCMA 3HEMA 1VXRA 4WESA 4XI9A 4G97A 4A2WA 3F6RA 2QL9A 3R6LA 1XNGA 4G8CA 3T4XA 4B3TB 3FB1A 2Z5GA 1UDRA 2QQGA 5K1ZA 2VFAA 4PS1A 4YEDA 3AF6A 3MG9A 4QG3A 2F62A 3WLAA 2WWWA 1KPHA 3MMSA 1PNVA 2FDXA 5AW9A 5JSZA 3TG2A 4BX0A 5HMLA 2DXIA 1UIRA 1GEGA 4RY2A 2ONJA 3AVUA 1M2EA 5ARBA 5KNDA 1KTIA 3Q9SA 4C87A 1T9KA 3NIDB 3PEWA 1QR6A 4ZFNA 3F9RA 2DR2A 3EXHC 3V4ZA 3RODA 5FNVF 3N05A 3IVXA 1KH1A 3GLFE 3L1UA 4R2JA 3GLSA 5LXTA 4EGAA 1KJWA 1OC4A 1JPNA 5FBWB 6GPBA 4IIDA 4QKQA 1T3TA 4UNRA 1THMA 4R6WA 1GFSA 4BLSA 1WTCA 5F2OA 1WW8A 3CT4A 3HU1A 4BMXA 1P7CA 3UGTA 4WFQA 3T5MA 1G2PA 2Y0BA 1LDGA 1XJ5A 1SXPA 2VZLA 2ZAGA 3LTEA 1L8QA 2EFEB 2QVLA 2WUDA 2JJ8A 3TOXA 3MHTA 1EJ2A 3SHVA 4LHEA 1HF3A 3SJBA 1NU6A 1H05A 1Q12A 4EGSA 3AVVA 2EF0A 2YWHA 2OVFA 3NBQA 2AZDA 4Q82A 4YNBA 1D1TA 1UMDB 2BFEB 2BR5A 5BYJA 1KEWA 2G1KA 4KH0A 5EKDA 5B53A 4YCCA 4YRGA 2WPNA 3AYXB 1MCZA 5FI0B 1RI4A 3UC9A 4GR5A 5P8WA 2PQ2A 5BVHB 3D4BA 1SXJA 4JSRA 3EMBA 1U0TA 1W4AA 2NV0A 1U9CA 2LIPA 3M33A 1COZA 3CPSA 1KC1A 5JFTA 1QLHA 1DBQA 1LZKA 1O5IA 2W6JA 3EF1A 1QB7A 3E0QA 3QKSA 4OGGA 1FFBA 4WFJA 2QIOA 3FCYA 4G1CA 2IPLA 4QHTA 1PEYA 1I4LD 1USGA 1W46A 3KWLA 1H2ZA 3E22A 4LJ4A 4O2BA 5G4KA 1HLPA 2JCSA 4H7EA 4KQKA 1Z22A 4R1UA 2EJTA 3VA7A 5C81A 3JAMA 2OK7A 3F7TA 1U4NA 1XO1A 2H1FA 1C3OB 2Q27A 3GB9A 3IBCA 4WK2B 1HI9A 1HQDA 1WAMA 5C4GB 4UNIA 4EENA 3T3GA 3IAM1 3OZDA 4YQEA 2JAOA 4JGBA 4P0PB 1E1KA 2ZSUA 2I4OA 2X40A 3SF0A 3WDLA 2GA8A 5JMTA 1IDOA 2J46A 3CMCO 2UYHA 3QFFA 4UM8B 4CDMA 5JWRA 4N5DA 3AVWA 1CUVA 1XYVA 5B3KA 3BXEA 2VRCA 5D5QA 3KNZA 4XTRA 1I9CA 3EMDA 3ACCA 3DZHA 1TKRA 1MG0A 2Q2WA 5EZ5A 4US2R 4BQPA 4C4XA 3GD7A 3SLKA 4W5JA 4D57A 2VT7A 3I9NA 2I9PA 4OH1A 5LLSA 3N7UA 2LP4Y 1UBGA 2WBLC 3CZRA 4XCVA 4AYXA 1L7XA 2YWDA 1LV8A 3AHHA 2NU8B 5EWLB 4ZOQI 1U94A 1VL6A 2HSJA 2WT4A 1K68A 1I4DD 1EUDB 5FOTA 1NXWA 4TLDA 5CVCA 3JVIA 4WAUA 2XSZD 4XEHA 2QSUA 1ZDMA 4PYMA 4DT1B 2JASA 1NNEA 2HJSA 3FTFA 4ZI5A 1A1VA 4XM1A 1GPAA 4MWDA 4ENSA 2CDRA 3ITEA 1J5EB 2FW9A 3CS3A 2FRDA 3DE2X 2R4TA 3S5JA 5A3RA 1SO8A 3GNQA 1XZAA 2FPIA 2QRLA 3L6RA 4BFYA 1KI9A 4LS3A 4QUAA 2AT1A 3DDNA 3DXXA 3QPVA 2FN9A 2C54A 1ZSYA 3LQ2A 3S1AB 3QEAZ 4UUMA 3ZV6A 3PA6A 4TVSA 2VTBB 1KL7A 2B2XA 1IQPA 2L18A 3NBMA 3ETGA 2E4YA 3OY7A 1XA4A 4KBYA 4PHGA 3TBHA 3W8RA 4DANA 4Z0TA 1RRKA 1BVHA 2FCRA 3VC2A 5B37A 1XQWA 3MWGA 1HDEA 3A6ZA 1IBSA 3N7TA 1EFUA 3L06A 2XYQA 4LKOA 4PXSA 4TWIA 3QKRA 1XAHA 1YIAA 4QM6A 5CM9C 3BL5A 4A23A 5GVSA 1QRRA 3CINA 3DTVB 4LSMA 5JAOA 2YW9A 3T3NA 4O1IA 3ZJVA 1S96A 2VLIA 3TB4A 5DN6A 3M3DA 1XNRB 3V9AA 3PPXA 2FPOA 2UUCB 3UB2A 4ARCA 1AQUA 5K6AA 2RIPA 3RTCA 1FZTA 1DO0A 2MR6A 4OJKA 3P96A 4EUEA 3CX6A 4HGPA 5AT1A 4YUWA 5CFMA 1W36B 1MTOA 1ACMA 2REBA 3SE7A 3AZOA 3WRVA 4M60A 4WK0B 4YFYA 5HILA 4BMOB 1Z45A 2W4IA 4JNCA 3U3MA 4KSCA 4L15A 5EVJA 2WKQA 5J4LA 3ESAA 4NRDA 1NUPA 1FX0B 3DOOA 1NTOA 4PLFA 1DI0A 3HBNA 4XE5A 2H2HA 3RYHB 4Q7QA 1W94A 4ZANA 3UNXA 2FZCA 4M2LA 1C30A 2FG7C 1EDDA 1SZJG 2AV6A 2A92A 1D2HA 4URUR 5HX7A 1JKXA 2ODQA 4LXQA 5J5CA 4C2TA 4WLVA 4FJ1A 1O6FA 3LWZA 2BT4A 1S7GA 3G2QA 4G26A 4BGDA 1U1FA 1L7EA 1M34E 1J25A 1E20A 1A5TA 1E3DA 2H0RA 1S89A 2OOSA 3I12A 4TS4A 4A0HA 4BLOA 3B7WA 4ZIRA 4ZYWA 1PT7A 3LQ1A 1SBQA 3QPAA 4FYPA 1E6CA 1QX4A 1X42A 1ZD3A 2IYWA 3ND5A 3Q9LA 4ZT7A 1D7OA 1PU2A 1KVRA 1CJSA 1PG2A 3L4SO 1LLCA 3M6WA 2CVHA 4V2UA 4ZT6A 4DA8A 4W5WA 5T6BA 1XA3A 3PUJA 1NLYA 3BJIC 4LSGA 1NG1A 4A0SA 4QQKA 5CDHA 1OZGA 3H9QA 4IRUB 4I0WB 4MHOA 3V4RA 2NYRA 5IKMA 5JBIA 3AVYA 1FSFA 1P2BA 1WHTA 2XGOA 3CQ9A 3M7IA 2E6UX 3MJRA 4FNOA 5CR9A 4IFEA 2BEUA 3Q1LA 3ZOKA 3GPLA 2QUBA 1FW6A 1XMSA 3BFKA 1KAGA 1HY3A 3T06B 3X1YA 2WJWA 1T2DA 1IEXA 2PL3A 5DHTA 5FFNA 3BA6A 3C5HA 3TE7A 3G2OA 1EFKA 1JQ5A 1SEVA 1R66A 4LYYA 3HO8A 3RC7A 2H4WA 2YZ7A 3H7IA 3I09A 4ZALA 1D07A 5IDWA 3F47A 3QPUA 4PO8A 1CUWA 1L1EA 5J1TB 5K8JB 1N9GA 3IURA 2NG1A 4KTTE 1C7RA 3TR6A 2PX6A 3D7RA 1PL6A 1ILWA 3P0IA 4PSDA 1X8KA 1ZWKA 1WMDA 1YK0A 3TCKA 1ZKDA 2TRSB 3OJFA 5HR5A 2MU1A 3DE4X 2IHYA 4AZVA 1YIDA 3ROFA 4YMLA 1JLLA 3HKEB 3PRYA 6ABPA 3A6PC 3NWBA 3OEED 4UCXA 5CIYA 4ZICA 2BH2A 2N1BA 3TLAA 5FLEX 4RA9A 3PCRB 3KPYA 1AY0A 3NDPA 4GVLA 2C9OA 2CEAA 1TIKA 2FMIA 1GV0A 2V8OA 5EE3A 4U8HA 2AF3C 3TJMA 3SN6A 3WIUA 1SA0A 5LQRA 1NONA 1KORA 4L3WA 4F4FA 1L1RA 2VP5A 4B1FA 1O1YA 2QMHA 3OP1A 4FT2A 4R31A 1ECBA 3P9CA 4HLDA 2Y9MB 4MW6A 4JC4A 1FXWA 1Q0ZA 3CEJA 3PR1A 3MMPA 4US0R 4EA6A 4TT3A 5LU9A 3ZK9A 5IASA 2JHCA 2O1EA 5HQTA 2X9NA 1ZVQA 3GIWA 3H86A 3NHWA 3RUAA 3MJHA 1WQ4A 4KWEA 2JBAA 4EL0A 2G6BA 3TSOA 4N6OA 3IEMA 4WBNA 4G1BA 4M8SA 4WKOA 5JXWA 1GZVA 3EFHA 1E69A 3OCJA 2HBRA 2GXUA 2BI7A 1X2BA 1YDFA 1Z4PX 3W34A 5LZ7A 3R23A 3U4QB 2EARA 4YMGA 4LZJA 4KWHA 3IJEB 3ZHZA 4TOIA 2EL9A 4LKRA 1MH1A 5GZ1A 2XMSA 1Z0SA 3P2JA 1I36A 1D03A 2HWYA 1XTUA 2IY9A 4LV6A 4DBLE 3QJYA 3A1WA 4DA0A 3JD1A 3VNUA 5BSKA 4D1YA 3EW9A 5LD2C 3TOZA 4HWKA 4ME6A 1JTEA 1GLGA 3ZIAA 4C7JA 2C2MA 5HUJA 4MUNA 3G1TA 2YZKA 1G55A 1L5VA 1NLMA 1E3JA 2MT9A 3IDZA 1I6KA 1JFVA 3V4PB 3F9CA 1LXCA 3BHMA 3KCNA 2FTKE 1Q0UA 5CG2A 1H6DA 5FAXA 4JOBA 4LJYA 3JTEA 4NCAA 3SX4A 3FUCA 1KIFA 2GPNA 3I05A 3OT4A 2QR2A 4GUAA 4BCBA 4EYQA 1RWXA 1YACA 2HQSA 2NNLD 1PCXA 4OATA 1KZHA 4AN4A 1PWYE 4TQGA 1NC3A 4MCJA 4AT1A 1TE2A 4O2AF 5FWAA 4UQLA 2EKLA 2X13A 3JASA 3BRSA 3VR6A 1PBNA 3L40A 4Y6QA 2XB8A 3VFDA 1FNDA 3AKEA 4HJRA 3PXAA 3K7EA 5EXXA 4XQ9A 3GG9A 1Z2OX 3TLJA 2UKDA 3DZDA 4DLRA 2B1RA 2TMKA 4RZSA 1RXWA 1YE5A 3NVDA 3DZFA 3NAGA 1EK6A 2ZTLA 4I8XA 3PL1A 4P7KA 4A03A 1HFWA 1MV8A 1PE0A 3BBPA 3TRJA 3H17A 4JT4A 4Y0NA 5H70A 3UOWA 5A5VA 1ONBA 5A9SB 2OFWA 3BX1A 2ECFA 3KYJB 5DNAA 2WHYA 3AR7A 1NQWA 4R2KA 4W9MC 4MV3A 1S2GA 4C6TB 1Z5GA 2FUNB 2K87A 3LPNA 4N7JA 2Y6VA 1ONPA 2A57A 3I58A 4PEVA 4FXPA 5G41A 2OHGA 4RJ2A 2W6ZA 2HHJA 5BORA 1V8ZA 1J2YA 4PIMA 4AZTA 3L7KA 2DKOA 4XPIA 1SD5A 2MWMA 1V7QA 1T8RA 3KXLA 1FUUA 4FSDA 1EI9A 4GZLA 5DLQC 2ABWA 1XXLA 3ZDDA 4B8ZA 4IV5A 3QE4A 2WPDD 4JFRA 5AW1A 4LFAB 1ZHOA 4MPTA 3JRXA 3V2HA 2PWAA 4DXDA 5C8VA 4YJ2B 3Q6MA 1Z28A 1NW8A 1OHHA 3CZCA 3SC4A 4JLOA 1FDSA 4ZOLA 4A16A 4QXPA 5IHXA 3VYTB 4NZYA 5CRIA 1QOPB 3WHKA 4MJ7A 4MYCA 2ZFUA 3H05A 3QLUA 1FLDA 2NTJA 3BC1A 5BN5A 2UYCA 4HFMA 5ITVA 3LUBA 3EN0A 4OP1A 1W2HA 1BWRA 4IDPA 3DE1X 5BQPA 5B6IA 4LJLA 4PC6A 3ZBQA 3G17A 4XX1A 2OBMA 2AQKA 3R3SA 2Y1WA 4X93A 1W85B 1L5LA 4CMIA 2DUWA 3GDWA 3BMNB 4ASUD 1OLSA 4MGHA 4B44A 3HP1A 2EIHA 2NAPA 3X1XA 5TMEA 2ZUWA 2E82A 2P2CA 2AXQA 1YU6A 2IA5A 1Z2NX 4NZNA 1L4YA 2P41A 4JJ6A 1YO6A 4HO1X 5D01A 4C4PA 4MZDA 1VE1A 4NG5A 5KNCA 1HYBA 2AUTA 2HIMA 4GYKA 1YMVA 4L4UA 1FRQA 3JD4A 3DP7A 2AGVA 4YV1A 2JAHA 1D4AA 1E2IA 1RP1A 1CHNA 1P3Y1 2AX3A 2D5CA 2V6MA 4KR0A 4PFSA 5KNBH 1SCIA 3GLHE 4F96A 4R2WA 5CJ2A 5B4VA 4CEJA 1DMRA 3RH0A 4ZO8A 1FUEA 3L0DA 2C2BA 2PKQP 4QBFA 1KQPA 2I3ZA 4IKOA 4HDOB 3RBZA 4IVQA 2Z58A 5K6RA 3EAGA 3P1JA 4K9LA 4J03A 4RK0A 3EMKA 3DD5A 1P9NA 1ZGAA 2EBHX 4DPMA 3ZVMA 1PX2A 1JAYA 3SS9X 2QLFA 3RU9A 3S2IA 1W25A 1E96A 1U5CA 5LP1A 1UMBB 2ES4A 3O3OB 1NZDA 2BLLA 1PSZA 3UGJA 3EXIB 1WIWA 1HRDA 1SVOA 2FEMA 2YHBA 3IMCA 3KQWA 3E0XA 5C31A 1G8JA 3D4OA 2EJWA 1NA5A 1RS0A 3FETA 1YS6A 1YJAA 4RD6A 1R5NA 4OKNA 3A14A 7ADHA 4EW6A 4RH1A 1DDOA 5DNUA 2IEDA 2O1SA 4RIGA 5FQOA 2PVPA 3MZ0A 4EDFA 1WU8A 4JA2A 5LP6A 1RACA 2V5VA 5IHPA 5HFJA 3BMQA 1U4SA 4DHEA 1YZFA 2Q5QA 2Z5LA 1C4OA 4MIEA 2PUDA 1OGJA 1HT1E 3AR4A 3VH2A 2H2DA 4R98A 4KIUA 1WCIB 3EEYA 4W5HA 8ADHA 2HQOA 1OXUA 3CA8A 4A15A 4Y6PA 1EMDA 4HS4A 3DFUA 2Y27A 3K05A 5ALNA 2FP4B 2NXCA 3AG5A 5JXGA 4TV9F 3B3GA 4NF2A 2R8ZA 4R2HA 2HKIA 2DZDA 3W78A 2GK3A 1SM4A 1KYZA 3VPHA 5CT8A 2HU8A 4TYMA 1RHMA 3UHJA 4HF7A 2ZRCA 2JLZA 2W98A 4ZREA 4QDUA 4DV2B 4QXOA 1C8VB 1JR3A 5DBFA 5CVVA 5EQJB 3LSTA 5A3JA 4RKRA 5B7PA 5FPKA 4MULA 5JRZA 1E8MA 3LPAA 2UUAB 1IY0A 4XYMA 2HPVA 1GR1A 1PGPA 2IUUA 3R3ZA 4UZFA 4LNHA 3BKXA 4AJLA 1N6NA 5IWAB 3OZGA 4JYBA 2NSDA 1P29A 4BJ1A 1V4VA 2I4IA 4HRVA 3UJ9A 4DR2B 1MA0A 3QW4B 3I9OA 1JJ7A 1G0OA 1P17A 1XGKA 1YKSA 3GZTB 1RQGA 4WW0A 5DI3B 2JK1A 2JVIA 1U0OC 3VH1A 2ETXA 2AB0A 4FC6A 4HAIA 1GGMA 4Q1AA 5AK0A 4DOMA 4AJ9A 4MARA 1TPYA 1H2HA 2PJZA 2WR8A 4D9NA 3TVYA 3GJTA 2RGNC 2OB1A 3R0IA 3E81A 4GI3A 4M49A 4U7GA 4JKOA 3QENA 4YONB 1C1YA 4II3A 3H3FA 4ID9A 3FCEA 2VKQA 4E6PA 1J2TA 1Y4AE 1HH4A 2IXFA 2A3NA 4G4SO 1U2PA 3JZFA 3SZUA 5K0EA 3QU7A 1UOQA 3U13A 3VR1A 4QGFA 4RGQA 3B85A 3OCYA 3FDZB 1RKVA 2O23A 4GDMA 2YWGA 4I1SA 3SE0A 1QGUA 5H1YA 3PXUA 2HRBA 3W4JA 1VPEA 1TZMA 1KP3A 3V1KA 3TGLA 4LG1A 1XDZA 3ND7A 4M0DA 1ND5A 3JQAA 3W3ZB 5KB3A 3IGFA 1HGXA 1Z5OA 3LP6A 4HWTA 4C07A 1AOXA 4X63A 3WGMA 4ZU6X 5GZ6A 4MOWA 2YY7A 1R0ZA 4R6XA 4E13A 4EMUA 3I45A 3OUTA 1R16A 4UEKA 2ZYTX 3QBDA 4OSEA 4HH3C 4MCAA 2D3TA 1F20A 1A5SB 4JBXA 1IM8A 3AHFA 3ZI7A 1TU3A 1BMQA 1CQJA 4FW8A 3VKGA 3B9PA 5AIAA 5FUVA 1ZK1A 5D86A 4BAUA 2B6HA 3L46A 4FGLA 3IEKA 5TEWA 2DKNA 4ERNA 1PT8A 4ZQCB 2I6TA 1U7WA 4ZMRA 3KJXA 4JJEA 3P2MA 1RKUA 4IYRA 4BJHB 1PFUA 3A58B 3GZNB 4IIJB 3C1OA 5FUYA 4CR8A 1L8AA 3TL6A 2ZS7A 2IOYA 5BNTA 5JHGB 1E3SA 4PGMA 2A33A 5CLIA 2RD2A 3HN2A 3HR4A 4U5QA 1VLMA 3ZJYA 2ADMA 5CTAA 2ATXA 1I6LA 4IHAA 2D2VA 4R1MA 5ER6A 3WV4A 8MHTA 3IKTA 1A8PA 2CD9A 2YXLA 4BNDB 4EF6A 3UYKA 5JPDA 1EVEA 1K66A 2RKWA 3K1AA 5JS6A 1P0CA 3EXFA 3H11B 4X8LA 2F8MA 2IEBA 3PR2B 4A0FA 1QAOA 3GPDG 2QTGA 4JLKA 1GQQA 8AT1A 1ORDA 4Y3UA 4K7JA 2WMNB 1PYGA 1M6VB 1E4EA 1GYQA 2RAPA 4MCIA 3WGHA 1PR2A 4W9NA 5A1JA 1BW9B 4NZPA 3WB2A 3TDNA 2O4UX 1D4ZA 2DWPA 1PJAA 1TZKA 5IAGA 1Y8RA 3QYFA 1T3LA 3Q15C 2VYVD 3WQRA 4R1TA 4DC1A 3IIEA 4FMDB 2AZTA 1BS9A 1UWKA 2WNHA 3FCSB 1V48A 3D3WA 4C4AA 1KQGA 2FWNA 2UDPA 3E7DA 1DG9A 4ZGGA 4ENWA 3O2NA 2CNDA 1HDGO 5FPQA 3W2TA 1Q0LA 3TVDA 5DHUA 5BR1A 4LMAA 1IXYA 4FYYA 3VPDA 5JHHB 4MS1B 5HEKA 2OZEA 3R7WB 3T6KA 1QIKA 1CJTC 1KBOA 4FFWA 4M38A 5L3VA 4D43A 3VU0A 4FLEA 1TM1E 1OV4A 3MN1A 1NKSA 3NG1A 4QICA 1MQ9A 1Y0BA 2XWJI 4KXLA 4YFVA 2W2QA 2O14A 4EJ6A 2P9GA 3HVIA 4EUKA 1X77A 3BFJA 4RETA 4QBTA 3C8ZA 4MWBA 3T5BA 4I55F 2NOAA 2VP4A 2R6JA 1L4NA 1QH8A 1KMQA 1Q92A 4YP5A 3DFZA 2D3WA 1VG0B 4JP1A 2VHTA 1WD5A 3UAZA 4DB4A 2B1JA 3IO3A 4YMUA 1KJZA 4XQGA 4DF3A 3BSYA 4WUVA 2X3YA 5KNBD 2BEWB 1HYEA 2H0QA 1J1ZA 2XUJA 3BWEA 2VJYA 4H17A 2ZYVX 1M8JA 2JKYA 2WIBA 2XYHA 3K0FA 2J0VA 4MEBA 1TK2A 1MAHA 1U0GA 2ZTUA 1HDIA 1IZ7A 1O3YA 2AW3A 3G2KA 4LE0A 4OQZA 4PZCA 5TS2A 2F48A 3ZIUA 2HSEA 3VSAA 3ZJ5A 2B8NA 2PWBA 2CYBA 3LZ6A 3Q3EA 1XZDA 2WKWA 3JATA 2KBEA 4FMCB 4N39A 1QF9A 3U49A 3HB0A 1Y3BE 2HRQA 3TEMA 1P18A 1Z13A 2OG2A 3K0HA 3QA9A 4OHKA 3EB9A 4KQIA 4Q6BA 5U1PA 3ZN2A 3YASA 3PDIB 2IOFA 1KFJB 4INPA 4L22A 5DRYA 3Q8XB 3I5MA 1O96B 2XUIA 3BMCA 4Q9JA 3T9BA 1SBTA 5JS1A 3CC8A 3ZU6A 3H5IA 5THQA 2OZPA 2VK2A 3WJ2A 2O4CA 1WHSA 3WLEA 1YL6A 5T8KA 5L7YA 2GX6A 3CFYA 3O73A 1ABBA 2DOKA 2J09A 1E4VA 4Q16A 4X20B 3ITNA 1CUZA 1ZUIA 3EPHA 3SK0A 2ZYSA 3N2ZB 2SHKA 1P81A 3A70A 5ALEA 2QI9F 4OX9Y 3HVJA 3WAJA 4NHEA 1AB6A 2PN1A 3P9QA 2PGAA 1DOZA 3W8FA 1FQOA 3W5JA 3N7AA 1NXQA 3BIFA 2W2LA 5K0FA 3WQQA 3ZU3A 3R3YA 3ELUA 3OLCX 1EJ6A 2WD7B 2Z08A 1UXKA 5A4DA 2R00A 4CL0A 1JJAA 3OLYA 1JALA 4JXJA 2AOUB 5A4JA 1A50B 3PP8A 5HE8A 3GLIE 3I6MA 1WXIA 4JITA 1SULA 1UBKS 1Q14A 2HLPA 2IU3A 1SG9A 3UJ7A 3W05A 3EX7C 4M1YA 4AYTA 1IQ0A 1VLLA 3N8GA 5SYAA 4K0KB 2C1EA 2PH7A 2XXAA 3STYA 1TM5E 4ZAGA 4M1EA 3ENNA 3VOAA 1ISJA 1XYYA 1QCDA 3FH0A 2WIDA 4R7ZA 4GEKA 1W76A 5ADWA 2HK8A 3OZ7A 4JUDX 5DHFA 4MQLA 3U7GA 1QO0A 2GJ4A 2IKQA 3ISJA 1KO1A 2V7GA 5EQFA 3QQPA 1YCDA 2Z4TA 3PENA 4H35A 3M2PA 4LIPD 5EHNA 4HAUA 2QLTA 3RR2A 1VIDA 4L8LA 3BWBA 4WBSA 3IIJA 1T9DA 4GWKA 1OPXA 4JSYA 1Z62A 1A98A 2HREA 3MERA 1KARA 4C7KA 1YKFA 1G5TA 1DCFA 3V00A 4P4SA 5SZKB 4TTPA 3BTUA 2ZVPX 2PTHA 4RACA 1CQIA 5GINE 5CB4F 5TQ0B 4XXHA 4GKAA 2YIMA 3CZ4A 4DG5A 1MX1A 1PR0A 2IS4A 1DX6A 3PHJA 4YT5A 4F5EA 2YFKA 5FOXA 4KR7A 5HOQA 1K7CA 3CUYA 4LV8B 1SG6A 4MVJP 4NYIQ 4I9NA 1L1QA 2I3BA 4EY5A 2BHSA 1XVVA 2IU4A 5KYWB 1GQYA 1ZG3A 1ULUA 4JAVC 2BKLA 4B6PA 2OO3A 2XQJA 5KINB 1VGRA 1HDRA 2HDHA 2VH5R 1FMLA 1COWA 1G5FA 4J4HA 3W8EA 3GRFA 5DCLA 1TGVA 3QMWA 5D3MA 2Q6OA 2E48A 4DLTA 3J81k 1Y1KE 1OMOA 1VPDA 3G9UA 2QK4A 2V5AA 4NOKA 1OKKD 1K4YA 4OL0A 4HQNA 4AN1A 1T1EA 4L8YA 2AFHA 1JW9B 2HO5A 4IW3B 1KOGA 3LFUA 4C5CA 1F51E 1CUYA 2IQ5A 2VEDA 4FUQA 1K6MA 1KNXA 1OTHA 2IIQA 1DB3A 3BIXA 3JX9A 2MTBA 4DMRA 3QV2A 5FL7D 4LF8B 3HRHA 2ZRDA 1GNQA 4JJFA 3USCS 5I9BA 3A31A 4FHEA 3B12A 2B78A 2DTDA 2PY6A 1UJCA 3F4BA 4HDKA 2CMHA 3FZNA 1JSLA 3OTWA 4KHZA 3TMYA 3TUIC 1SUSA 4U7PB 4D2IA 1L5RA 5EYPB 3VSEA 2VQDA 1LS6A 1EIZA 1OY1A 3WR5A 2XNSA 3D8NA 1M67A 3HDJA 1B74A 4WDRA 4AM8A 2X7HA 4BN0A 2XZLA 1GUDA 1K06A 5DU2A 5AW5A 5H80A 1RPJA 4TS3A 4QLAA 2GNOA 1H85A 3E27A 4QE3A 1IEQA 1GZDA 5BSEA 3CVUA 1ZR2A 4II7A 3BUSA 4MYRA 3NUZA 3W04A 3KO8A 3SU8A 1HC7A 1RKXA 4IMJB 4QU0A 1ZH4A 3NJ4A 1QRSA 4O1HA 2BBSA 2ATIA 1V8DA 3COWA 5L4NA 1KGDA 4L85A 5ECGC 4N1AA 5KS2A 2QY6A 2W2OA 1KKLA 1NVMB 3KLMX 4Z3DA 2FWIA 1IZ0A 1N6RA 5ICGA 3OJXA 4HS9A 2R6AA 1W6RA 4DC9A 1SJ9A 4FYXA 4JI8B 4NV3A 4O4LB 1PZFA 4EOGA 3HNPA 4RK5A 5B64A 2OEPA 1ST2A 5H3LA 1FRVA 4FSXA 4S2EA 2ZSKA 3E9MA 2H92A 3OM8A 3WTBA 3CW9A 3EGXA 1CQXA 2VJPA 3KUDA 2JARA 3FLEA 3FUVA 4HX2A 2XR1A 2E21A 4KXQA 2RMKA 3DKPA 3G2JA 1YBAA 5AVQA 1FNSA 5JH7F 2WJJA 4UUOA 3RV3A 4LVNA 4FYKA 4U7TB 4JI4B 5BRJA 1EXWA 1PZMA 1U0SY 1ORVA 3NT2A 1FJ2A 4MLZA 2GUGA 3DTVD 2EKDA 4UNNA 2YJ5A 4UVIA 3Q10A 2G83A 1N8KA 1ZC3A 4RQTA 5CNMA 2B2CA 2Z4RA 2GFHA 1T4GA 4DMGA 2C4NA 5DXFA 1NUSA 2AI2A 4GP7A 5G0VA 3UGQA 3DJYA 1GSHA 2QUIA 1Z73A 1MT3A 1KYXA 2XEDA 4JLVA 2EWVA 3K5PA 4C14A 3GJ0A 4A6XA 2ZKLA 4ZZ0A 5JS7A 2AE2A 5HA5A 3H18A 1W36D 3WQHA 1QP4A 5BSUA 1EFLA 5MN6A 5K7SA 4NTZA 1F06A 3NV9A 1T0PA 3E15A 4BU0A 1OFUX 4GI7A 1SZCA 3FYHA 1II9A 2C3PA 2QLLA 1B0AA 4W8OA 4B4KA 2M9MA 2Q6TA 1L4LA 1YZNA 3IOBA 4CI9A 3CWQA 4ZJYA 4I4LA 3LUDA 4W7HA 1H3FA 1I7PA 1YQUA 2X1MA 1R4ZA 3GUCA 3V7NA 3KFLA 1A9PA 1XF1A 3NBYC 3VO9A 2RGXA 2I6GA 4KO3S 5B1HA 1NW4A 1PS9A 5DBOA 3CBGA 3E3OA 1VZ3A 3SC6A 1WXDA 1DIOB 3K20A 1N57A 1K3TA 4WQMA 3HXQA 4CCSA 1U0NA 4HNVA 1C5KA 2L42A 4P3NA 4GL4A 1UT6A 4ZVPA 4ZHQF 1SAYA 4RW0A 1SC3A 1RRPA 4RL6A 2Z9CA 3NYRA 4YN3A 1E1CA 3HHEA 3F97A 1MPTA 3CIOA 3FAZA 3LRTA 4LHVA 2QJOA 1N2ZA 1ZQ9A 1ESNA 1JMKC 3VKVA 3NWPA 3NWEA 1QFYA 1BYUA 4X0EA 5JJKA 2Q3BA 2NQ8A 1U0JA 2Q1YA 2VXYA 1YULA 3DFKA 4CCYB 3CF6R 3FYSA 5TEVA 5IM4F 3HG7A 3EC7A 1PL7A 3KOMA 4ICIA 3MB8A 4ZEOA 3RVPA 4RWEA 1QYIA 1F8XA 1AA9A 4OJQA 3AH8A 3DO5A 3CZ5A 3FCCA 2IX9A 5K6TA 4FFRA 3CR3C 4WZAE 4PN3A 2ZBDA 3G9TA 3NIBA 4NLLA 1O89A 5JDCC 1F8FA 1H42A 1QXSA 2L69A 4KI0A 3N6VA 1KFEB 2XMZA 3WL6A 1VE5A 4ESVA 3B1VA 3BT7A 5EIEA 3IV6A 3OJEA 1O97D 3QOFA 4OL9A 3U7IA 1CUEA 2GPJA 1PQWA 3ESZA 3RJTA 2H1WA 5HDBB 1YAHA 2WZDA 3DNMA 4RGBA 3IS3A 5DMHA 3RU3A 3S2SA 3V7FA 2MSEB 5DGHA 3SZ3A 2RK6A 8LDHA 1Y3HA 3PEUA 3GFBA 3GY0A 3L5KA 2ASEA 1FQJA 2YCBA 2JHAA 2WWGA 5FQNA 4B85A 4DJDC 2E4VA 4B6QA 1WSBA 1O94A 1KSFX 1ZJJA 1AU9A 3A4LA 1ZCZA 1ZL0A 3OCCA 1WS6A 2ORVA 2HIGA 3COSA 3PWZA 1K6IA 2H59A 4FNMA 1R6AA 2OM2A 3VVCA 1NBAA 2BGIA 4YAUA 4HT3B 3PNLA 1SKMA 1R5JA 3T4PA 2QRUA 4UPVA 4MO2A 4UFPA 2OCPA 3VOBA 4GLLA 3TLCA 4DR4B 2Z2KA 5EZSA 3RSQA 4J4TA 3LWNA 2R79A 1ZD4A 1BEZA 4TMKA 5FYDA 4KEAA 1W2WB 1NW9B 4XWGA 1NF8A 4CU2A 3KVVA 2XKJE 4B5LA 1WUIS 1ZH8A 2GK7A 2VH2A 1FP4A 4IMPA 4XDGA 3WK9A 1O77A 3QQ5A 5LFAA 2PMKA 3ETDA 3IUPA 1W75A 2WE8A 4HQRA 4F5ZA 4UHKA 2V8BA 2QLNA 3F3MA 2X2FA 3EIXA 4XWTA 5DYYA 4F5YA 4MROA 4RD4A 3OE4A 4ZK2A 2VXCA 3DQQA 1UANA 4K9PA 1YUMA 1L9KA 4FJ0A 5JVDB 2E49A 1HO3A 2CXSA 2ZXEA 2QF7A 2E3JA 1M1XB 1W2GA 2F43A 3MWEA 3O94A 3M9WA 3PUIA 4G67A 4Q4AB 5FBHA 5HFAA 2YS6A 3OE7D 1IPFA 4JWTA 4R68A 2GEVA 4EHDA 2I0FA 1PG5A 5C8YA 2ORED 3G0GA 3UUWA 2DPGA 1UP4A 2HIAA 3DLPX 3KOOA 2C2ZA 2XMDA 4HGRA 3TQTA 4BIMA 4EQ6B 3LCVB 4UE3S 5L3QB 2VQEB 3DDZX 4LRXA 3GVPA 2VWHA 5G4LA 4CT5A 4LDPA 5B58C 4AQYB 1J8MF 2X4LA 3NHAA 1ZVVA 1JFLA 3NBUA 1PT6A 3QE0A 4D7AA 4ZMBA 2JCXA 2VRNA 3WYBA 3ZI4A 3KQMA 2CBZA 4UOQA 1CB7A 2D13A 1PEKE 3CNOA 3D5TA 1WSAA 1BD3A 1GNTA 2W58A 4IX9A 2HXYA 1UJ6A 2B69A 3ZDBA 1A5AB 2FSVA 2VDMB 3KEOA 3X0DA 3DOCA 1OH5A 4LRTB 4XWOA 1YE3A 3MQ4A 4KRXA 3T3OA 1NVFA 1W35A 4HTFB 4GSLA 3O4IA 2G4VA 3KJIA 2H4JA 4RO0A 4G5GA 3LT4A 2XB9A 3OPYI 4WNAB 5D7BA 3TQCA 1I24A 2ZRQA 1X7YA 3PQ6A 3C7KA 4ZVRA 3WAKA 3V4OA 3CYFA 1Z6PA 2Z6QA 3L0PA 4RDHA 3LNTA 1XOIA 3QU5A 2OAP1 3TKLA 3QLTA 2H4HA 4BB5A 1CS0A 3MTGA 5L45A 2NACA 3FVTA 4BFWA 4XYEA 3BDVA 4R1QA 2Q9UA 1GUYA 4G65A 3NQ41 4TTVA 2YWBA 3QHQA 5A1TA 3IR5A 3C8MA 4FDAA 4C0QC 1UC8A 1FTWA 2XUAA 1WR8A 4K86A 3INNA 3N3BC 3V32A 1F9AA 1A2KC 4ND5A 5DHQA 3MQFA 4QTTB 3G6WA 2C7BA 2GR9A 3MIIA 1K7SN 3OLWA 4FBGA 3LVRE 1DAMA 3IP9A 4KN5A 5F5XA 4XIIA 5K3BA 1QPGA 2J41A 3JVDA 4D9GA 3SBDA 5L7TA 1JHDA 2ZM5A 2J3QA 2WF6A 5J40A 2W6QA 4OHZA 1AN0A 3K16A 2P3OA 5JECA 1SKBA 3A4IA 2D0IA 2OFFA 3DWFA 5BWNA 2O50A 3AF3A 3I4LA 1VA4A 1OT3A 2ZW9A 4TLEA 1V16A 2ERXA 3KUUA 1KAOA 1O5TA 5KDDA 3IMKA 3ZWYA 4NBTA 3U16A 4PLHA 1LK0A 2UZAA 4N7MA 1WF3A 1CY6A 3CY6A 3LYLA 4Q7LA 4PG4A 4E88A 2IYUA 1MOZA 1F5SA 4JT9A 3AQIA 3P9XA 4GPIB 5AMXA 4PZAA 4TL7A 3F1LA 4Q4DA 2FSFA 3C70A 3HYTA 2WTBA 4B7ZA 2PE5A 2JCBA 2GMWA 4ROSA 4KDFA 3VNAA 5E1DA 2IZ6A 2W2TA 3DMHA 2AEJA 1AC5A 3OWXA 4AMYA 1RCUA 4EX6A 1GP2A 2JGDA 4FONA 5AJZA 4E5YA 3IP1A 4O08A 3DL4A 1OI2A 3IL2A 1NQAO 3H9BA 1UFQA 3CNLA 3MWDB 4L72A 1YRHA 2WJAA 2I7TA 3NHRA 3PJGA 2LIVA 3A9SA 1A9XB 5E6SB 4E15A 5F3WB 3GJQA 3V8QA 4C0BA 3E3AA 5CCXA 3HJGA 4G37A 4HNAB 3EVEA 2H2FA 1HNWB 2FG6C 1BA2A 3KKKA 4NJMB 3GOQA 3KIPA 3VGJA 3T9AA 1KYVA 5AVUA 4YP9A 1ZM3A 3RAPR 2CL0X 3D8HA 4FMBB 1K27A 2WMYA 3JR3A 1CIJA 3T0IA 3KBOA 4KV7A 1B1AA 1SXIA 3RTDA 2O8BA 3EQ7A 1QP8A 3WZ2A 5JNRA 4DUZB 3MGKA 1GU0A 1ZA2A 3UK0A 4EW3A 2FPKA 1PJTA 4EH1A 1BXRB 1WCV1 1WZNA 3BSSA 4F7DA 4IUYA 3SCZA 4ZPJA 1ZZEA 2WIFA 6LDHA 4J7AA 2WHPA 3KELA 4HEA1 4GM0A 3WWPA 4BGVA 3B3QA 3O8DA 4DQUA 1LEHA 3QLEA 2XMGA 1NJ8A 3ABZA 4PSVA 1GCGA 4IIFA 3NBAA 4EHFA 2II6A 3H7AA 5L40A 3M4YA 3MHPA 1HT0A 1N6KA 2VJMB 5BWMA 3VVBA 4L74A 1QMGA 2A1IA 3OAAD 5K0GA 2GVDC 3ORHA 3TRDA 1P19A 3GNTA 3QXXA 1E2BA 3R9WA 3D6TB 1FVOA 2CJWB 4W5OA 2G25A 5T57A 1H2XA 4C0WA 2RCYA 4CM6A 2PK3A 5F2EA 4AL4A 1UAAA 1TC1A 3AR2A 3FVWA 3QELA 4OH7A 1CK4A 2DFPA 4PQGA 5IK2A 1YIOA 1IONA 2HZBA 4YJKA 1H6AA 1VHTA 1YR2A 2Y8EA 4L8FA 2OCGA 4RULA 3HA5A 2JFOA 1G21A 5L53A 4LK2A 1JYEA 4P4GA 5EUCA 2I66A 1IY2A 4G0ZA 5B2ZA 5L95A 1OWPA 1YK1A 2D8MA 3E9QA 4MS3A 3GEDA 5CG1A 1UZLA 4DJFC 3SYMA 2ZYDA 2IS2A 2M6KA 3Q3IA 4ZK6A 2YVLA 2WOOA 2Z6VA 4HAVA 5IH3A 2DRIA 1S8OA 3GCDA 1VM6A 3L0ZA 3R0QA 4J16C 5CA1A 4BXOA 3KPUA 4AULA 4NE2A 2QPOA 2EZ9A 2DPXA 2VI5A 1JFSA 3T7CA 1TUEA 1DKLA 4O4JA 1RAIA 1SUFA 1NUHA 4A10A 3GWGA 1ISGA 1AF7A 3ZWAA 4R3NA 5JLJA 2P79A 2ZCUA 3PNSA 3K0CC 2EG5A 3ELDA 4YECA 5DK6A 4CM1A 3FFXA 1ORTA 3GELA 4EYEA 1XAJA 2QTHA 3STHA 4BCDA 3IOMA 4FFVA 4M9XA 3PVZA 1BKYA 4PX3A 5JSZB 1IATA 1EHYA 2ZPAA 3U3KA 2JLYA 5FJJA 2OGTA 4QEZA 4AXXA 4CETA 1SVWA 1ZOPA 2FW0A 3PX2A 1EE9A 4RS4A 5DHAA 1A9TA 1O03A 3QTTA 2QMOA 1C0LA 2AQIA 1SR8A 3DMPA 2VR1A 4MA4A 1KBQA 4QUJA 3WG9A 4ARUA 3WAGA 4Z51A 1RZUA 2ZJ3A 2J45A 1TIBA 3G1WA 5DP1A 1T36B 2AK3A 4UDYX 3TECE 2VYND 2ZITA 5JD4A 5DSXA 3A11A 1GTL1 1V4NA 4KQEA 1KI4A 1UKEA 4IDOA 3WE7A 2XH8A 1T9CA 3IAUA 4OCZA 4D9BA 2CE7A 1R2QA 3KTAA 1FIUA 1T2UA 5F1YA 2GJKA 4RHFA 3VZCA 2HBZA 3ABRB 3QF7A 4N7BA 2ZUBA 3MS4A 4NEHB 3NT5A 4UCQA 2Z3VA 1JHZA 3UT5A 3H1EA 1NW7A 3DM9B 2UZ4A 3MPUA 1J0AA 1JRLA 1US8A 3FTEA 1SD2A 2H8GA 3GL9A 4P6VF 3WDKA 2OO7A 4KN8A 1LJ8A 3O7MA 4BLWA 3SD7A 1U5BA 2I3GA 2W22A 5I7HA 2RARA 3LCJA 1L5KA 3L18A 1DIHA 4OM8A 3GGSA 1GUBA 1EFCA 3K0AA 4M7PA 4MVJH 4AIRA 4CN9A 3R6TA 1JG6A 1BU5A 1SHZA 3SFVA 4B7UA 5JQWA 1FUIA 3BH6A 5L4SA 1F9EA 2AHOA 2E5FA 3C4QA 1QK5A 3QKSB 2QQ0A 3IE2A 4P80A 2VF4X 4P33A 5E1MA 3LHIA 1H3NA 3OFND 3GW8A 4XB2A 1XRJA 4FS8A 3E22B 1ITZA 1LNQA 3ICEA 2QG6A 3QKTA 4O2BB 4CV3A 5G4KB 1IYZA 3A3PA 5CDFA 4XYBA 2F1KA 5TPWB 4MTCA 1XQ9A 3HL4A 3WHIA 3B70A 5LR6A 4JY7A 5F3RA 4WXRA 2JDIA 4CTKA 2PKYX 2OMKA 3TMKA 3DAHA 2Q5EA 4UTZA 4HQ0A 4HLUC 5HIKA 5JW6A 2QM0A 1IMJA 2QN6A 3KPVA 3IE0A 4IXDA 2XT9A 2BWJA 2EW2A 3O3NB 3UJCA 1LTQA 3GMSA 3W4KA 3TMAA 2XADA 2PEYA 1N0UA 1D8AA 4L27A 4WEOA 4CEHA 4OGFA 1RQPA 2RAVA 4UHHA 5DYTA 1ZSVA 2YFYA 3PSHA 1DRUA 2WTEA 3TZEA 2I6UA 4GWLA 4S35A 2Z09A 3DAFA 4P1ZA 2GN1A 3U9LA 2WWTA 1ZITA 3BHIA 3GU3A 3DGEC 4B76A 1AQ6A 3VU9A 4J1NA 2WJHA 3T1QA 4GPZA 4LY6A 3WNBA 2FQYA 1V41E 1NF3A 2VS1A 4RHXA 2A9KA 1DFGA 1VBFA 2F67A 4A8JB 4PO9A 2X8AA 2ZT8A 1AQNA 4L02A 5TARA 1QG2A 3CB4A 5J4YA 4QVKA 3QKWA 5KREA 3EE6A 3DPIA 4FKMA 1Q15A 1D2AA 3B2NA 4G2TA 4BTLA 1FYDA 1V11A 5AKIA 4CTOA 4ETWA 1ZPDA 3A1NA 3A6FA 3O03A 5K3FB 3DWGA 1OBOA 2NUAA 3DBLA 3E03A 4IKPA 3R0VA 4KLNA 1LC3A 4HRXA 4PIPA 1M6EX 1V1RA 2FK8A 4ZAFA 4ALJA 4H1TA 5E7IA 4DV0B 1WCYA 1RRFA 4OX9B 3M9LA 2AXNA 3V1YA 4PC3A 3H0KA 4DZZA 2QMEA 4EI2A 1W7AA 1LLDA 1QH1B 4NBUA 5LZ5A 1QP7A 3PYMA 2OGWA 1VMDA 3NATA 3ZHTA 4TKMA 4LY9A 2QYHA 2ZVJA 2PX3A 2A9OA 1SGWA 4B83A 2QX8A 3I52A 1V4BA 2CHQA 2HGZA 1XKLA 4BU1A 2A0XA 1DAOA 1BXKA 1DC5A 2QE6A 1FP6A 2ROQA 3ESDA 3GVXA 4FUTA 1WLYA 2SKDA 5LWQA 2BSAA 1NBMA 3LQ4A 5DGXA 4AG3A 3U7RA 4MW2A 3SF8A 2YQ4A 1CTQA 2XPCA 1C4WA 5D87A 5B1DA 1XQ6A 1UR5A 2Q9AA 3OH8A 2DWCA 1E5DA 4J6FA 4P0TA 2HYDA 2Y1CA 1TQHA 1XRNA 1PZXA 4M0EA 4TS1A 5CXQA 5ARDA 2PR7A 3OEHA 3CTPA 3L8GA 4DCSA 3HUDA 4PRLA 3QPCA 4X61A 4A8PA 4YRJA 4BRWA 4QZVA 4TKZA 4FGJA 2PD3A 2ZWPA 3L8MA 1QV9A 4D8YA 1OA1A 1BE6A 1QR2A 2IXBA 1V43A 2JIQA 4LUCA 5D6OA 1JDSA 4X1OA 2HCRA 2XLBA 4TMXA 4PO1A 4LHZA 5CW1A 1U0HC 1ZO8A 4NIMA 3RABA 3UWOA 3C1TA 3W7BA 4D26A 1VLQA 5EMJA 1NUQA 3C6XA 2WMOB 3KXPA 4EEZA 1SU4A 3CLTD 2NMVA 3PC6A 1XRPA 2B9VA 4KYIB 4OTZA 3LHSA 5DKFA 4QOSA 3L79A 4OXKA 3OTHA 4LK3A 2DHCA 5ENVA 2DEUA 2C8LA 4NEQA 3UG7A 1IPHA 2OV4A 2Q6IA 2XE4A 3OQBA 1DV1A 4HRYA 4NEGA 4CMCA 1NGSA 4QT4A 1E3WA 3DVAB 1XC7A 2AQ8A 4KE8A 3NVKI 1S9HA 1BX1A 2FGKA 4Q9NA 5CA0A 3SR4A 3PI7A 1RPNA 1TMKA 2H2GA 2WINI 4OP2A 3EPLA 2IY7A 3Q3CA 1P7YA 4GBED 4HV4A 3JS5A 3F49S 3AXSA 4Y1FA 5JNUA 1NI4B 1F2DA 2RGUA 3ID6C 1MHTA 4C03A 4XRRA 3PX7A 4QUIA 4MGKR 4OIFA 2ZLBA 3IKMB 4GGMX 2W11A 1W5SA 1HDXA 3FVVA 2YZ2A 3VDXA 3VGPA 2CFOA 1JA1A 2HA2A 3OO1A 4MMXB 1A1SA 2ALJA 3IC5A 1GPDG 2JJ2D 2JIZA 1BFKA 2NVWA 3CZMA 2FX2A 3GH1A 4H7IA 3MNFA 4MDHA 2VHXA 4NU0A 1RAHA 3L41A 1EUYA 3VX3A 1MW9X 3HCOA 3T5PA 1YFZA 4XVCA 5BW6B 2WHQA 1WHTB 2HLHA 4YJ2F 3K9WA 4ZEMA 2BEUB 1C9MA 1PR3A 2YNMA 2HTFA 3EDMA 3HI6A 2ZT6A 4Z0PA 1MVLA 1AH2A 5FLKA 1N6PA 3UMRA 2N46A 1LI7A 2FOIA 2XA1A 3C5CA 4IXMA 1S4QA 4RY0A 1NMZA 2V7QD 1VIMA 4F04A 4GYYA 4QHYA 3UK7A 1L4HA 3GH3A 3GJXC 4EB0A 4OLBA 3FPEA 2YHSA 1Y1TA 1XF9A 1TB4A 1WQ3A 3OM1A 2ACKA 4Z0NA 4BV2A 3U61B 1V9LA 1G6Q1 3FSGD 4J0JA 2VNIA 4YRAA 1DJPA 1PQPA 1M0TA 1NQTA 2JAQA 4FE4A 1HBJA 1TD1A 5ICSA 4OXRA 2H11A 1RRGA 3V7WA 5HXAA 4WLFA 1AS3A 1X1TA 1DKOA 2OECA 2G9ZA 2ZBUA 4FX2A 2AN5A 4RA9B 3BF8A 5LQSA 4R4JA 3MINB 1E2FA 3B2QA 1UDCA 2IH4A 1ZU4A 4INOA 4RVSA 4EFNA 1SA0B 1QKIA 1RLIA 3E1SA 3TZ6A 4PZ9A 1PWZA 4EJ0A 2AKAB 2BOVA 3OG9A 4JR1A 4WK4B 1THZA 5IJ9A 4IO1A 3V42A 3K4HA 2RGBA 4HOYA 3VMMA 4R01A 1VE9A 3ICQB 5C4IA 2D62A 2ODAA 4IUBS 2Y1DA 2P4SA 2DTXA 2JFUA 1DJLA 1GARA 4IOKA 4KG7A 1HL7A 2QG4A 2W00A 2Z1NA 3VR4A 1GZUA 1KZ9A 1UBTS 3AM3A 4HNGA 3GCWA 3CRNA 2VF8A 1RAEA 2AYYA 3UHAA 4DIMA 4NENB 1X8LA 1RI2A 4URVR 2ZIAA 1KJNA 1BO6A 1TA4A 3MUEA 4YRRA 1QIGA 2GEDA 1U6IA 1G5QA 3D8RA 4RV5A 3UJ6A 2NU6A 3K9QO 2RGWA 2ZIEA 4MVJD 4Y9SA 1R4AA 3ZE6A 3NH6A 4WJZA 4A2PA 2CY0A 1RYHA 2XTJA 2Z3WA 1NATA 5FV7A 5AQEA 2HCFA 4D4IA 1VMAA 2MR5A 2P91A 1Q7TA 3OTIA 3QITA 1NWHA 3K0KA 1GNLA 2GF0A 2OMEA 2RSLA 1YHYA 4AROA 2O2HA 2IQIA 3U9SA 4TZTA 1FBNA 1T1GA 1AXEA 4I4IA 1AJEA 1PUJA 1X1CA 5J2UB 3QVOA 1EXMA 5K9ZA 1M8FA 4RZXA 1QC5B 1ZI9A 5T3YA 5ADUS 6REQB 4XCXA 1OWNA 1JE1A 4RPCA 4AK9A 1XXHE 1F38A 4YAKA 4Z4EA 3CW2A 2G77B 3N75A 1FNMA 2CLEB 2RGCA 4WXHA 5F4BA 3A6HA 1KQFA 1TDJA 3P9YA 2XZOA 3GFPA 2W5UA 3BKWA 1G60A 1F2TA 2QZJA 3C6KA 4FOOA 3DPUA 3UXYA 3IX7A 3PE4A 1P7VA 5C52B 1TJNA 3KE9A 3KT6A 2O0MA 3DS8A 4MRRA 4YTEA 1KYIA 3HBLA 4HQFA 3RGWS 4AX8A 3BXGA 4O8CA 4LNUA 4CV1A 2D5BA 1UFRA 2DP4E 1V8BA 1LBIA 2VRBA 3L0CA 3UWMA 5IYZB 5C8DA 2WU4A 1M7HA 2O20A 1VYTA 4KU4A 4MUBA 3BWDD 3K5WA 3NDBB 5FADA 3ENWA 3AIIA 4HEHA 1USIA 4V1CB 1FU8A 4F6RA 2JJYA 4N65A 4CUKA 3IAAA 3D8UA 1ZM7A 4Q9IA 2AFIB 4YRCA 3MEQA 3V8RA 3VSDA 4BX2A 5CFOA 5JCJD 1U8YA 1C9YA 4P86A 2Z1DA 4OA5A 2NVOA 3RSFA 3Q8WA 3CX3A 3B1JA 3F4KA 4RCYA 3CZQA 3S2FA 4OHRA 1ZW6A 3IPXA 1NG9A 2C1ZA 2P1ZA 4FYVA 1W0KA 2PBFA 2B1QA 3QLVC 4PWYA 5IXSA 2Z8XA 5AKYA 4EHLA 1TK3A 4P5DA 4M9SA 1DJMA 3NO4A 1TCUA 2EGHA 1YSCA 3OZTA 4LAFA 2AFIE 2NSJA 2QUHA 4AQDA 6AT1A 3VTAA 5LQMA 5M2QA 5L6LB 3ZE9A 3C7TA 1VBMA 4RELA 4ISCA 4G01B 4MWTA 3ISTA 4EI7A 4JEHA 4BKPA 4CMKA 4E4YA 5BXYA 4FFBA 4ZOLB 4RXTA 4Y2XA 4DZTA 1L7OA 1ZRHA 1RBYA 2ZE7A 2XGJA 4OQQA 1YGYA 3R9IA 4K2AA 3AI3A 1JHRA 2PQ6A 4IFIA 3S2GA 1DRKA 1C81A 3WGYA 3M2TA 4ZU3A 4ODIA 1P9LA 2OFPA 2ZULA 1MQ8B 5I4KA 4HQOA 4QOEA 3VPAA 1AMNA 3L8ZA 3KTOA 5C8ZA 3ADCA 2DE0X 4KR2A 1CR1A 4S2UA 2A0KA 4OF4A 3R24A 2NP7A 4LWZA 4Z3KA 1JG4A 5BOVA 4QEDA 4Q4HA 4E5UA 1L5HA 3LFTA 1OLSB 1I80A 4IV8A 2F4VB 2O7VA 3U4MA 3ROGA 2D4HA 3EA4A 4YR7A 2G9VA 4C1BA 1P4AA 5C5IA 4ZCQA 4PYIA 1SN7A 3B38A 3HWX1 1KYWA 1RM4A 1U3DA 4QRIA 2EDAA 5JJ5A 3L1KA 1FLAA 2PZGA 3RF7A 4BWFB 4OHBA 5DHPA 1UKYA 1W1UA 2V3WA 4IIJF 3T54A 4KE7A 4ZGWA 1QVZA 4CEJB 3SWWA 1W4ZA 2IVFA 3EZ7A 4RD2A 4WJKB 3AI2A 3UYLA 3EVZA 2P9EA 3STXA 4M36A 5KYTA 2I2AA 1UQRA 3LWBA 5AVVA 5FO1A 1SRQA 2NZVG 1ECFA 2ZOSA 2ISQA 1VJGA 1USKA 1JWBB 2QRKA 4LBZA 1DQSA 5KYXA 3VSCA 2AFRA 3FFBA 3CT6A 2QIPA 4F9TA 1AGXA 1Y33E 3SJUA 2R2GA 2X1LA 2ZZKA 4S24A 3TL3A 2BFAA 1C1HA 4HR7A 3N53A 1UDAA 4G1UC 1XVTA 4JI3B 3VM6A 2IIBA 5H68A 1H5NA 4LOIA 4R0VA 1ZICA 3SIPA 5BQ3A 1E6LA 4X6UA 3CN9A 3KSUA 4WGFA 2DPYA 1NVUQ 1EUCA 3R3UA 1C1DA 1OYYA 5E6RA 1NL3A 3FJOA 4R3UC 1WBJB 4RFSB 4AWBA 4QJ4A 3KPJA 1Q2UA 1A2OA 2XUZA 4EZEA 1K3UB 2ZYGA 5LP6B 3O5AA 4FMDF 2V4MA 3DF7A 2ZIGA 1D6SA 4FFDA 3TZCA 1V37A 4PXAA 4ARZA 3E23A 2FEPA 1F4PA 2HU5A 5AKJA 1NW6A 2QAGA 1NVDA 1QKKA 5AVJA 1NMXA 1T0UA 3H65A 1K4KA 2O2JA 4RFVA 3HUEA 3O38A 2ZUDA 5EUBA 1GTSA 5EJEA 2OWEA 1RKQA 4XVUA 1NMQA 3ZZ1A 3WSWA 5A4IS 1UQTA 2RHWA 3WYGA 4GMFA 1FP7A 2O2IA 2YMQA 4FPXA 3W9BA 1GQOA 3QM1A 1ECPA 3K15A 4TV8A 2Z6AA 1T13A 3G8YA 5KNDH 4F3TA 1Z83A 3ADPA 3RU2A 4BMVA 4OBXA 1GM5A 3LGSA 4CZ2A 1OQAA 4L0DA 1QHFA 4KQCA 4E7PA 4DV3B 5EP3A 1T9GR 2WJ4A 4KACA 4XCQA 1GUZA 1JQAA 3SYKA 4J2TA 4E6EA 2CC2A 5C35A 3RG2A 1ZD2P 3E9NA 2WKPA 3OIFA 1TJPB 1PFYA 1WF6A 5IN5A 1H94A 2CFRA 3FKSD 3KX2A 5KVSA 3ZHVA 2FI1A 2CXQA 1FUYB 3FDXA 3MXOA 4R7GA 2V03A 4U02A 1UBMS 5KCMA 3CLTC 3KQVA 4DWOA 1AQLA 3WMWA 3S2UA 5KTTA 4YWHA 1P5JA 4G1VA 3THWB 4TVOA 1GA4A 1RXIA 3UJDA 3T7JA 3T3EA 4FCVA 3DDWA 4ZJZA 5AK5A 3LIIA 1L5QA 3DEJA 3ISVA 3O82A 3IRUA 5GOTA 3ROZA 1C7EA 3JYPA 2B5VA 1TTHA 3A9WA 3HI4A 4NY1A 4EG1A 3RK1A 3J7TA 3WLFA 4AZSA 4DJAA 4Z8YA 4IMIB 4DEYA 2CXRA 2GTIA 1BGVA 1W0JD 2NXJA 1F0NA 4HDNA 2NVBA 2X8BA 4BN5A 2VTDA 3F8WA 2OORC 2PANA 3LFHA 4BASA 2IBSA 1C3JA 1M2VA 4WXMA 1R8XA 1S2LA 4Y2JA 3O1LA 2E5WA 4BPRA 4BNXA 1MB3A 4L75A 4KQXA 4L76A 5AM1A 1VL2A 1S7CA 3H5RA 3ZGLA 3PNMA 2BGMA 4OHFA 3SX0A 1GPWB 1RP7A 3KQLA 3E2MA 3PQ7A 3K70B 3R4VA 1J7KA 4XGIA 3I9MA 1N1DA 1X92A 3USES 3GI1A 1U8XX 1Y4SA 3IUNA 2GN4A 2JJQA 4JELA 2XOKA 4PLPA 4W99A 4B32A 3C48A 3QX8A 4Z7NB 4ND6A 1F6BA 3RC8A 4CHGA 4FQ7A 3SFZA 2XJ4A 3D2LA 4LXYA 4M21A 2XQKA 3NBZC 3O4VA 1GHTA 2WABA 3FMGA 3GUZA 3M70A 4D96A 2A0YA 1U6JA 2NNWB 1ZY2A 1O95D 4TL6A 3ENVA 4TRMA 1CQJB 1F14A 1XQVA 2QX4A 2K7FA 3TQFA 1D1SA 2C5GA 4MR7A 1AURA 3WK4A 3TN7A 5CD1A 4OBBA 1YZLA 2V98A 5DBGA 1JIQA 2VAMA 2VH1A 3GLKA 3H2YA 4YAEA 2JFXA 4YP7A 1X7DA 4FKBA 1N0WA 3OJ0A 3P2KA 1EBUA 4B3IA 3HU2A 3IMEA 4RLFA 4BRZA 1AHIA 2AL7A 5HVNA 4J76A 4B48A 2C83A 2QL7A 4CIYA 2Z2IA 4X95A 4M9UA 2XQGA 1HDOA 4G09A 4YK7A 3I32A 1BDBA 1B1CA 4FFPA 3ZV3A 1JEQA 1R0KA 1WXQA 4M0FA 3OX2A 4DLWA 2I78A 3NAZA 3KR2A 1RWBA 1E7RA 1TADA 2CVOA 2HFJA 3JWEA 1JHOA 4UARA 1C7FA 3DCYA 4J0QA 4EG5A 3K1AB 3NAQA 2W2VA 2X2EA 1HOXA 2PGDA 3EXFB 3LKDA 2OL4A 1CQWA 1ODCA 2B82A 2ZI6A 4IIEA 2DLDA 1V96A 3LBIA 1SHUX 3LXXA 1RJDA 4O4HA 5BURA 1MNQA 1E7WA 1QZ3A 3AHJA 3EBOA 4QYWA 2JLBA 3WZMA 3X1WA 4YRBA 4UBJA 2DUNA 5DLEA 4XQCA 4AZ0A 4ER3A 5A5EA 7AT1A 4DR7B 3PQ4A 4I14A 2PLRA 4CRWB 3OLQA 4PPGA 4BMYA 4KOAA 2GPTA 3KE8A 4I50B 5H82A 2WKRA 4EI8A 5AKXA 1KYTA 3AUJB 3D3QA 3KEGA 4M9ZA 3HXPA 4ZCRA 5I4BA 3MT8A 3QEJA 5EJGA 5JNLA 1ZEJA 1ZK2A 2AUNA 3COYA 5AM0A 4CMEC 5A62A 5JCPA 3RTBA 5L6MB 2BTQA 2H1OA 2XQFA 5BSVA 1R6UA 4CN8A 5EKSA 4Q24A 1NMYA 3RS4A 4JB8A 3UT0A 2H18A 4K8OA 4W5QA 1ZD1A 1NSTA 4JZKA 4L73A 5GV8A 5MGNA 1IEWA 4U3JB 1G38A 3DMTA 3M4XA 3RSCA 3GPIA 2R1VA 2EP7A 3DHVA 2BGGA 2NLOA 1EK5A 4D3DA 4P2BA 3BK1A 4L2IA 4WUTA 3CUVA 3CURA 1PJ8A 4UHBA 5CM8B 1PNQA 5FTKA 4ZTZB 4A6PA 3VOTA 2HDNB 3SOZA 5FOSA 1DWPA 4IM7A 4F12A 4DS3A 1FDOA 1EX6A 1CY7A 4L0MA 1GAWA 2IE0A 2VDWA 3MMNA 3GIDA 3D4PA 4MVYA 1E2KA 1KMHA 4JXXA 3OU2A 3EISA 1FFXA 1J5XA 1PJ2A 4HRAA 4BNZA 1DZIA 3T0GA 2HDWA 1T43A 4BNIA 1QH8B 3NZEA 4Q18A 1TQ6A 1BX0A 1SKAA 4MR8B 1OLUA 2CYCA 2RJNA 2OQ2A 1ENPA 3EIEA 3LBHA 4HGNA 3GOHA 2VLBA 3PUYA 5FUMA 3GLFA 2B4TO 4PR3A 2N42A 4IILA 1MQSA 1TOAA 3C5WP 3PWKA 3WTCA 2XWBF 4IXWA 5T67A 1OFTA 5KU7A 4OO3A 2W2KA 4DRXA 3ZDCA 4J4BA 5F52A 4N76A 2W6PA 3K0FB 5KJ6A 1L8XA 1FW8A 2NU9A 3T5GA 2VP0A 4OB7A 2PWYA 4KUHA 5LNK1 4RC9A 1E1QD 1G2QA 3FUUA 3WK7A 3P0EA 4LDNA 3ZDEA 1G5IA 1I10A 4OMCA 5BOSA 2RAUA 2VNHA 1I3CA 3ETNA 3B1YA 2R44A 3O83A 1JEAA 3KSZO 1IJBA 4OI4A 5FA8A 1HTBA 4ZYVA 4EHBA 2JFNA 5D84A 2HL6A 4YASA 1G64A 4UDXX 3K5HA 4KPUA 2JI7A 5DYNA 1SIWA 3CVXA 3A4VA 3AOEA 5SZIA 4DEVA 1DXHA 1DJOA 2OSBA 1FDUA 1M7BA 2MSWA 1LCIA 3EASA 1A4UA 2YHAA 3HCRA 3N74A 4ZWNA 2GLUA 4O3MA 1EFRD 1CCWA 4IWXA 4IINA 3TB6A 3GNSA 2FK7A 3PGLA 4XLLA 2WDZA 3DDUA 4PRYA 1B42A 2PBZA 1PJSA 1IN1A 1CDZA 3RV4A 4RTPA 2WUVA 1F0YA 2YJ4A 2ZSFA 3QY9A 3M3PA 1SC4A 2O57A 5AVOA 1R6BX 2J9FA 4EHJA 1ORHA 4IPTA 4Z6KA 5BN3A 5K4HA 1ZFNA 2IYQA 4C7BA 4YRMA 2CYAA 4BVJA 6CHYA 4EO7A 2PVSA 1VG1A 1TQ4A 2ONCA 1R3UA 1KFBB 3EXAA 4H16A 3RANA 4GRIA 1GXSA 3VHLB 4BEWA 4TM8A 2IXEA 3P45A 4AMUA 4YMVA 3P94A 4LF6B 4FXOA 2PX2A 2N75A 3T9CA 2EATA 4KRYA 4X45A 3TUJC 4F3YA 2AMJA 3I42A 4EA9A 1VP9A 2I2BA 4YV7A 2POQX 4PINA 3FMFA 5BW4A 4J7XA 5EC8A 3RS5A 1NVVR 3H9CA 4Q3CA 4DVJA 2AE1A 1Q74A 2Y4OA 3U4CA 4ISBA 1XNJA 1YS2X 1JVNA 1TU4A 3GWZA 5GZ3A 1Q57A 4R2XA 2GETA 4P22A 5DYGA 2NP6A 1JQBA 4JI1B 3VYVA 1A82A 4DCTA 3N2LA 1SHJA 3WXMA 5KNDD 3N76A 3WWDA 2FJPA 5I7VA 1FFHA 1RQNA 1EK1A 3QZUA 3UB3A 2X5XA 3EBLA 4G89A 1NC1A 2HQ1A 1GLNA 4AN0A 2Z2JA 1P6UA 1Z35A 2QV7A 3D54D 1U7XA 4I4NA 5AVKA 2VNSA 2PXAA 4ZZ1A 5DGTA 3PXGA 4H60A 4R1SA 5KSYA 4GPD1 2JFWA 1H1DA 4WCDA 3JQPA 2H5EA 3ICVA 5JAQA 3NHJA 4V39A 3VHQA 1IWPB 1GA6A 4H27A 5LNK6 4P4SB 4G0NA 5BMOA 3G7NA 5H59A 1EQAA 3UFXB 4Z1MA 4Q1DA 4B3JA 5KHOC 1LRKA 3EEOA 1ZNYA 1DLIA 5SY4A 3VNQA 3CF2A 2OOKA 1CR4A 5GIOE 1AK1A 4DDVA 4IIYA 3LVQE 3K0BA 3ZY6A 3OPXA 3BXPA 4IWNA 4FYHA 4WY2A 3MWLA 3VJMA 5EJ5A 3PA8A 4Y2RA 4D02A 1J07A 3TI9A 2VWQA 1NMEA 4QJ5A 5AW8A 1FU7A 1OXSC 2OESA 4G4IA 4GPAA 4IQ0A 4W6ZA 4HB2A 3VAAA 1TCVA 4A1FA 2DH6A 1ZMTA 3RK0A 4BECA 3BCUA 1NURA 1SXJD 1FPQA 2LKCA 2DQZA 2XYRA 3E5MA 3UM9A 2Z3ZA 4FFOA 2WEKA 4MKGA 2O8CA 1Q19A 1PV1A 2V55B 2CXUA 2JA1A 3H2KA 2ZDHA 3GO4A 3HXMA 1BDJA 2W6JD 3N59A 4GNKA 2AFHB 2I7DA 1DRJA 2NV6A 4H15A 3W1WA 1V1MB 2I7XA 3VC3A 5HJ5A 1B23P 3FROA 4LXHA 2YQZA 5F5LA 2GPYA 2XT0A 4AJ2A 2BFWA 1DAFA 1JH8A 1KR2A 1VLVA 3DVQX 3JRNA 4PLVA 3F3YA 2OCAA 1E0AA 2HMUA 3F5DA 1J90A 4TTSA 5J43A 4OP3A 3FNFA 1KOJA 1YT5A 1N2CA 2HO4A 2HSDA 1GZ4A 4HH4A 3K09C 3U2QA 3WFJA 1PZGA 2IOQA 3F8SA 2I22A 4KO4S 4CM9A 2WAYA 5IC4A 2I2XB 1BDIA 1NVBA 2AFHE 1TEHA 2BFOA 3UHFA 2VSOA 1YQEA 2IPAB 3A04A 4FINA 5E4YA 5G1PA 3VR3A 4IHKA 4KDEA 4G81A 4CM3A 2VRCD 4HN9A 4K88A 4GI1A 4JCOA 4QPJC 1TMGE 4D9KA 2BE7A 3G0DA 1T8WA 5T6MA 1SG0A 3IQXA 5DCYA 3L7MA 1Y98A 1WXEA 1LTKA 1J1IA 1NJ2A 1UM9B 5KO2A 4TLMB 1Q5PA 3B5EA 3M81A 4JIGA 3TLMA 2WTAA 1CVIA 2X41A 3IPAA 3MTBA 4BEVA 4AECA 1CERA 2F3PA 3CNQS 3WLHA 4EJSB 4N9WA 1KHTA 1XD8A 3I9V1 2HCJB 2RJ3A 3VO8A 3PV0A 5GQSA 4Y8VA 1D04A 1YXMA 2BLNA 1L4KA 1LDNA 2O7RA 3QVGA 4W1QA 1E6EA 5HMMA 5C7YA 1EZ1A 3AR8A 4RD1A 4Z49A 2IYPA 3FCUB 3KYIB 4N5IX 1KJJA 1EPUA 1JB9A 3OZWA 4TUYA 5EWJA 3CJRA 3U3DA 2X7JA 1ODJA 2YYZA 3Q2KA 3ECCA 4HZUB 4TQAA 2UYGA 2MMGA 1NV8A 5FWXA 2VHCA 3HA3A 2EJVA 4L6IA 5CFRA 3B1KA 1Y7IA 3BE4A 1R6XA 1IL0A 5CTJA 5G1NA 1HL3A 1K7EB 1ZAKA 3HKDA 3AJAA 1RXCA 2X1VA 2XECA 3EYAA 1BEUB 3N0TA 4JHLA 4KBGA 3L8EA 4Z99A 3VJLA 2O3RA 5IZCA 2E4UA 1C0KA 3BCSA 4BNKA 5BUQA 4CLOA 4CL8A 1XAGA 3LUJA 1LF5A 4EABA 5KYNA 5JVDF 1DBIA 1ML4A 1B14A 4ER0A 2NSYA 3AGQA 2BKAA 1G1AA 4IGAA 3ESXA 5GOZA 2YICA 3L7DA 1H2BA 3RIMA 2P40A 1RMQA 2AXPA 4LGVA 4RMHA 3ROTA 1EA7A 5F4ZA 3ZWKA 4ADSG 1MV5A 3WYNA 1AQJA 2NO9A 2OCLA 3L7LA 5E9JA 4M8IA 2XDWA 5EKUA 1ZVKA 2PLAA 2W2NA 3FTDA 1LUAA 4LV5B 4YA6A 3WBJA 4X1IA 4FMPA 1S2MA 1T91A 3WY9A 1P80A 4YRZA 3C3YA 1LU9A 1XIVA 2ZQZA 4JI6B 1WOYA 3GRKA 4PRKA 2X4DA 2I9KA 1PEAA 5ALIA 1YE8A 3MT0A 1PSDA 2Q2QA 1Q0RA 4NICA 3VKUA 1N7GA 3A4YA 2O3SA 2QGFA 1T4CA 3AY3A 3LT5A 1TKAA 2R1TB 1KI8A 3OO0A 1O95C 2BFCA 2G5PA 4DLSA 4QPDA 3RRZA 1GG5A 4C2BA 1Z8FA 5JD3A 4YPOA 3WQSB 5ESWA 1Z7EA 2C96A 2AG1A 1UK7A 2FEKA 2QOEA 2WW8A 4N6NA 2ZJ8A 5GGYA 2FX3A 3TLEA 1KAEA 5DM4A 1M3SA 1DRWA 3G3EA 4AKTA 1ZJ5A 2BV3A 4Q37A 3OQMA 4NBWA 1K9VF 1KY4A 2QS9A 3QH4A 4KK4A 5AM5A 5DSZA 5EQDA 4DLLA 2F3SA 4IICA 2XD4A 2X0FA 2N3ZA 4NFSA 2G9QA 3QVLA 4YAWA 3M6AA 1P72A 3N87A 1XU9A 1L5SA 1MIHA 1TYCA 4EPTA 2RIRA 4U0JA 2DYKA 2V7XA 4MUYA 4OXIA 1YQWA 4PLTA 2CUZA 3D4NA 3AESA 2GASA 3DLCA 4E46A 1KY3A 3FJYA 3GJ7A 4URFA 3ZWBA 3B52X 1E3LA 4Y1RB 2FWJA 3ORSA 2DCUA 1DIGA 4MK4A 3IKJA 3K2EA 1XKTA 3ZCVA 5IT5A 4ZCIA 3LXUX 4OQEA 1EWKA 3QGMA 4GL2A 1XNHA 2C3YA 1YOVA 1QFZA 1H66A 1B73A 4XD2A 2PUHA 5THXA 4PYOA 3TNJA 4E2ZA 4JC0A 1PJCA 1P2SA 5BT8A 1YD7A 1M2OA 3PFIA 1EXNA 3LBAA 5JY6A 3ZOZA 1EP3B 3CKLA 1RADA 3GEBA 4FQ8A 5DNEA 3ZWPA 3DLIA 5FWNA 4H7JA 1QCZA 4QO7A 1TLFA 2X77A 5DP2A 4QLBA 1MABB 1ESCA 1MXHA 1TMYA 4XLTA 2FV8A 3PITA 5ELLA 2GXSA 1GFWA 4OPMA 5AKLA 3S7TA 5FLXA 4FHDA 4CF6A 4EKYA 4NJOA 1KRWA 4FR2A 1A3CA 1K7YA 1DC4A 4H3SA 5ECYA 4WN3A 2PD4A 2QQFA 1P2UA 4K9NA 2XE8A 1DX9A 3DNFA 1Y82A 5JMWA 1Z0FA 4HXYA 2O19A 3CRRA 2CHEA 3LBYA 3P9SA 4CMHA 4F3NA 3H5VA 4JWKA 2H1CA 1U7TA 3DH0A 4OK3A 1MENA 1XEAA 1UZAA 2QRGA 4H1UA 3A8TA 1ZP6A 4QQFA 1IG3A 1GTZA 3Q40A 4J94A 3ADBA 1GYPA 3A27A 3KT3A 3QWBA 2ISCA 1Y9JA 1PV2A 4HDSA 2FAXA 4TT3D 3ZYZA 4F93B 3M4JA 3VR2A 4I1VA 3SBXA 2XF2A 1CS4C 4DCMA 4DADA 1T5LA 3FBWA 5CPFA 1IJKA 1ECGA 1V0JA 4J8PA 3K0CA 4BDSA 5PNTA 4MB2A 3B2EA 2XKBA 2EBFX 3OT1A 1P9RA 3GJZA 2OQRA 1XDSA 1P4RA 1E5VA 1E60A 3ZQKA 1QPBA 2CWWA 3QMMA 3LPMA 5CW2A 5LA6A 1JHXA 4UOEA 5ALKA 1NVKA 1SD1A 1YCFA 3M6IA 4NZ9A 1GPJA 1QKJA 2DBVO 4U6NA 3R7DA 3GFFA 1CW2B 2A1TS 1GG2A 2HF2A 3SQNA 2F43B 1HYGA 3CNBA 3GJ6A 3RRXA 3SQLA 4N48A 1P0FA 3EXHB 3ULKA 3DSRA 4DYHA 1J8VA 4L1KA 2NTVA 3DZIA 2AMFA 3ZIAD 1ONOA 2J31A 4EW2A 3KYCA 3Q6NA 4UASA 4LE1A 5EE1A 3B1XA 3ILHA 4MDFA 1JZSA 4BTEA 4A5SA 3EZXA 5KHLB 1R50A 5BSWA 2J5QA 3TOSA 5GAJA 1OZ0A 1I6MA 2QBYB 3V1NA 3F71A 1WCXA 3RT1A 1SUBA 1ZH0A 2HMYB 4Q7KA 1DUVG 3SGLA 2OXEA 1IQUA 2VPIA 1P1IA 1PJ3A 1SQSA 3AJ9A 4M6WB 1N2JA 1V6AA 2FPMA 2ID7A 2QTZA 2ZIZA 3I53A 3LUHA 2V0NA 4H7KA 3KQHA 4MHTA 1F2UA 2IX3A 3I4FA 2I8CA 2N9UA 2PEZA 5I47A 2I71A 2QN8A 3RVNA 2W2PA 4FFNA 3FNQA 4WOPA 4YC7A 4MP8A 4AQ7A 3M5WA 4HGZA 3VR6D 1M1UA 5EGNA 1MRZA 4G4GA 2PL1A 4UHCA 4DR3B 1BD4A 4KVZA 3EVCA 2WZCA 2WV9A 2YXPX 4Z1OA 1T9AA 1XP8A 3AB8A 2R6GA 1JHYA 1J2EA 1M7GA 3DV0A 3VPGA 4BO0A 3HXOA 3FFAA 4NE7A 3JCZA 4X1YA 3HKBA 2B8WA 4ACBA 1G7CA 3BICA 1CY2A 4KQ6A 2V1UA 2G7MC 3DQZA 2H65A 3OM9A 3ZLBA 2YVAA 4D81A 3N28A 3IAFA 3A3YA 3K3PA 1CS0B 4NS4A 1NBOA 2C5AA 5AI4A 4IP0A 4RIIA 5ALLA 3RW9A 2ENWA 4AF6A 4XTCS 3NEJA 1SC1A 2X22A 1NAIA 4ZT3A 2XI4A 3UO8B 1E99A 1NP6A 1VP3A 1WW2A 5AJXA 3W6NA 2W37A 2BW0A 1KC3A 2HQBA 1O6GA 1Y7LA 4U2DA 5BR8B 3QUSA 3H99A 3C14C 4RKEA 4NZOA 1FMFA 2FPGA 5FNVA 1MTZA 5TY0A 1UT5A 9GPBA 3C87A 1P0MA 4D8XA 5I9IA 4TS9A 5LBUA 1XTSA 3LWDA 3ME5A 5DRTA 1VHLA 3IEPA 3B5JA 5AI5A 2O2DA 4ZQFA 1J97A 3DXZA 4QASA 3RUFA 3AC0A 2HEGA 2ZPTX 3ZY4A 4J7CA 1GL3A 1SU6A 2ZJZA 4A3SA 3ZZMA 4EJMA 5ITZA 1I7DA 3TW4A 2PYDA 1XVUA 1OHHD 1H5QA 3L3BA 4JBLA 1U2GA 4WZZA 5CVEA 5BWOA 4HTAA 5CX1B 3R3HA 3O31A 1V16B 2VATA 3K8YA 1KBZA 3FB4A 3PG5A 3PKIA 3Q8MA 4MQFB 3VZRA 4CQNA 1YVPA 4IBOA 4PTYA 4ETIA 1CRQA 4BBZA 4ZN6A 1HPLA 1YI0A 2NUTA 4OHUA 5ITWA 4HWOA 1RQRA 1SXJC 5CURA 1O58A 4BYGA 4NXMB 5KYUA 3A9UA 4RHTA 4P08A 3N1UA 2J07A 2JHPA 4K87A 4MHSA 1SC6A 4XM2A 5A0FA 2MMCA 2I4RA 4UAUA 3O8CA 1L5NA 2WFZA 2Q7OE 4PCLA 3HP4A 3L7AA 3QG1A 3GRPA 1RU3A 2H6EA 1LFDB 1QF7A 5BN1A 2JLRA 2AD1A 2JGDB 4J7UA 2QTCA 4OA8A 1K5DA 721PA 1Q0QA 1R0LA 3JZDA 1EVIA 3DONA 4TXLA 9LDTA 5KNCD 1J2RA 2P4QA 3HJUA 2B34A 2V7BA 1WW3A 3JYOA 2KE5A 4IG9A 2Y1XA 4N3AA 4O2BF 2R6R1 1X13A 4PNHA 1N2GA 1XMXA 4WNIA 5AHOA 1NIPA 1IHYA 5K0LA 4XR4A 1KU6A 2H1SA 1C80A 3RE1A 2BKXA 4X6XA 3JYQA 5U4XA 4Y1GA 1V2GA 4CFZA 1RXVA 3HJCA 1NQUA 2XUKA 4OUKX 5CFZA 1K6XA 1R5OA 2R6HA 1BS2A 3B20A 1L7DA 4EA8A 5KOIA 4WNCA 4HSGA 1RJWA 2I7CA 2JFPA 2I54A 3CEHA 2JGRA 1QFSA 1XL1A 3QIVA 1MO6A 3HM2A 4ZJUA 4R54A 2CFIA 3I0ZA 3QEOA 5I3CA 4BMSA 2NU7A 2FJ0A 1G2OA 2PJUA 4INJA 4KNWA 3QVSA 3K71B 2JKZA 1JR2A 1W47A 3DMGA 4Y98A 3W9YA 2UUBB 2O05A 1NRXA 4QGSA 4KODA 3G13A 1NF2A 4WKCA 1YC5A 4TMTA 5K0NA 2IIPA 4AKEA 4KGXA 4Y2YA 5CVJA 2ODEA 5LKRA 2QVYX 3GLVA 4P34A 4BBAA 5KOHA 2IY8A 1MPXA 2PFSA 4KYUA 1MJGA 2GAOA 4OQDA 3LT2A 4ZVUA 3CRZA 4G1FA 3JALB 1XRSB 2ERCA 3AERB 1OSNA 5FT9A 4CTNA 2FRDC 1DKRA 1Y4UA 1YI1A 4H1VA 4B6FA 2NO1A 1J0XO 3HYLA 1XZGA 3QELB 4GR9A 2L19A 3PWSA 2GHQA 5E2AA 4BMZA 4YPFA 2Q62A 2IH5A 4Z4FA 3BB3A 3TAUA 5I7SA 1E3IA 3IEIA 3OQJA 2P5TB 3T4UA 1D8TA 2OENG 1T3SA 2PRYA 3U40A 4MS4B 5K0BA 3EVAA 4R83A 1F7UA 2HK6A 4JQYA 2IRWA 2QY9A 1I2ZA 4EG6A 5A4MS 2PU7A 6NULA 3DMYA 1T6ZA 1IY1A 4ZEVA 3I9JA 1ZNWA 1IN4A 2P9QA 1QQTA 1JR3D 1LW7A