5CFPA

Crystal structure of anemone sting (nematostella vectensis) 'humanized' f276k in complex with 3', 3' c-di-gmp, c[g(3', 5')pg(3', 5')p]'
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
181
structure length
181
Chain Sequence
KNVADGLAWSYYFGYLKFVLPELEKQIEKTSKFRSKEKFVKKMFILIPSNCFWDDKIPGSDYDPQNRITFEGNTEPLEKTRGGVKLRHYKHSVYEIKDGENEPWFCIMEYATPLLTLYDMSVAQPGELSREERDAQVVVFLRKLQDILEGDRACQGKYELVTFSPDRDLADVMLRKLKDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Ancient Origin of cGAS-STING Reveals Mechanism of Universal 2',3' cGAMP Signaling.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Immune system
molecule keywords Stimulator of Interferon Genes
total genus 51
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cfpA02
4F5YA 4EMUA 4F5DA 4JC5A 5CFOA 4KSYA 4F9EA 4EF4A 4QXRA 4EMTA 4F5WA 5CFMA 4LOJA 5CFNA 5CFLA 4EF5A 5CFRA 4QXQA 4YP1A 5BQXA 4KBYA 4LOLA 4QXPA 4LOIA 5CFPA 4QXOA 4F9GA 4F5EA 4KC0A 4LOKA 4LOHA 5CFQA
chains in the Genus database with same CATH superfamily
3HA3A 2ZJYA 3ASZA 5EXEA 1SEPA 1K3TA 2VXYA 3BGIA 4E94A 5FDFA 3FJOA 5AICA 4DCGA 1OC4A 1PX2A 4RVFA 4ETWA 1FW6A 3ZV6A 2GUWA 1JLHA 1IN6A 2J7PD 2ZRDA 1N5OX 2BGLA 2FZVA 1Y6RA 4KW7A 2BM9A 2IWHA 3TL6A 3AIIA 3CNLA 1XDZA 1E5VA 2H0RA 3IDAA 4J16A 4NZMA 4OHKA 1D4FA 4WN9A 3S6JA 2AKEA 1ANKA 1IJFA 1JAXA 2DLNA 1UDCA 4H1UA 4IIJF 4V0OA 4W9NA 4I0WB 3G82C 5FTWA 3E82A 3UT5A 4TLDA 3WXBA 2COUA 1R6DA 2DULA 5CNJA 4M6WB 2VK4A 2WMOB 4EFDA 1Y6GA 4WLVA 3B5IA 1L8LA 1RW4A 4FEYA 4PS0A 1BS1A 4GSKA 4GYWA 1EFRD 1SG6A 3R3ZA 4RPLA 5FHRA 2FSVC 1RE1A 1T9CA 3GG9A 3BKXA 4PYOA 1JLRA 3TRDA 5I4IA 1VZ3A 1DXYA 1JEEA 4EITA 3BVPA 2IYOA 3NHAA 1W0KD 1FDWA 3KJHA 4I1VA 1NC3A 3OLYA 4MUHA 1QS0A 2RK6A 3W2FA 5BW5A 3G2PA 1YAJA 3FVTA 5K6TA 2GHIA 2GEJA 2HCBA 1C7RA 3R4CA 3AHEA 3IOEA 3PXBA 2PL5A 3IKMB 5ERXA 3THYB 3V8VA 5B12A 1QG0A 3TCNA 2V6FA 1KJWA 2H92A 1QE5A 2Q21A 3C3WA 1QHEA 4OVKA 2VAVA 2AEFA 2AOUB 1TZJA 4IHAA 3DBRB 3LUFA 2ATVA 3ZQ4A 2GZ2A 4BVLA 5JAUA 4FMPA 4Q05A 1CQPA 5ULLA 2NUAA 3DBOB 5FLYA 1IM8A 2DY0A 1OE0A 4I1SA 3ZE8A 5JNRA 2GXUA 1OWMA 4D8YA 2FMUA 4IXMA 3A3PA 5TJHA 4O33A 4JQCA 3LA8A 1R74A 2FLKA 3D5TA 4RVSA 1Y4AE 2A1TR 2ZBVA 1X3LA 3A37A 4PX3A 4XUCA 1GXSB 4BAZA 3ZHYA 3KPYA 1KARA 2YS6A 3AFNA 3MTJA 4MGHA 1U9IC 4FCVA 4F6LA 1A4IA 3PUHA 2JZNA 2Z43A 2XB6A 4UM7A 1TQ8A 4WCVA 2QT1A 3CTPA 5B1EA 3RSHA 5C5IA 5JEEA 3PX7A 1S2NA 2RHWA 4B83A 3PL1A 3GBVA 2Z1DA 3SDSA 3SS7X 4ZK2A 1YTUA 3GLQA 4HB4A 3VVBA 1IXSB 3L0CA 1YD7A 4AX4A 4QBTA 1F20A 4TSFD 4GLOA 1UJ6A 1IEQA 2C58A 3IP6A 1C3OA 1FVHA 1YRHA 2RHHA 3MHPA 4KJXA 4YLEA 5A5DA 2XKAA 3EYAA 1N5KA 3OESA 2IY9A 3CVJA 2CNDA 2BKVA 5EMJA 4JC5A 4EVIA 1W93A 1BWQA 1KQOA 3PRKE 4N3NA 4XEHA 3UB4A 1TA4A 4D96A 1E3LA 1GGHA 3MTGA 5ES3A 3KZMA 1E6LA 1RRVA 2N1BA 2YFYA 4FQ5A 5HGJA 2XUDA 3UH1A 5C8ZA 3KJQA 3SAJA 4GF5A 3WRXA 1FVFA 3G17A 2RKOA 4JLAA 4XWYA 4BQNA 3D0QA 3VR0A 1RFGE 3TIIA 2NXNA 4UMEA 5F1KA 1B16A 1BHQ1 2OCYC 1XGKA 4I08A 4OOFA 2XWQA 5ALFA 2DERA 4JT2A 3FMGA 3NNNA 4NECA 3A9UA 4MP6A 4JK3A 3ICEA 3DYIA 1S89A 1PQ4A 1F1BA 4HFRA 2XCTB 3BHJA 3IAUA 2FWIA 3EZ2A 4LTDA 5LYYA 3MJFA 1A9SA 1G60A 1XTIA 2VZ0A 1WXDA 1AQ6A 2ZT7A 3VSAA 2XUQA 1Z25A 2J31A 3KSRA 4ZICA 4XWKA 2I8AA 3C97A 1YKFA 3VDXA 1E2FA 2CXSA 2FU5C 2HNBA 3TSWA 4KPUA 3WHKA 1BC5A 1FDIA 1HG1A 1SG0A 4OXXA 1PV4A 3VO9A 5IASA 3QJGA 2ZXUA 3PITA 2O3JA 4G26A 5HK8A 5U1PA 5FBVB 3FI9A 5B1DA 2QX8A 4M6WA 3MW8A 4JI1B 3ZN2A 3VPXA 4CIXA 2NSJA 4KLNA 1KBQA 1NN0A 1OYVA 2V0CA 4D4LA 4H16A 4B3SB 4NAHA 1YHYA 1W25A 4YRBA 1SUDA 5E4YA 5I7EA 4DZRA 4ZYWA 3HLTA 1C4KA 3PS9A 2HDNB 3VYTB 2P1RA 2OAP1 4WN9B 2JGMA 3GPIA 3QVVA 1MH9A 1O8CA 4FGZA 1X14A 4O5OA 2LCFA 4IXTA 4TS1A 4TT8A 2IEBA 3O75A 4IJVA 4YDRA 4Z0PA 5T4EA 1IAVA 3V7WA 2W6IA 3T3IA 1UP6A 4MVJD 4BFYA 5IWAB 1S9HA 1BXGA 4GPTA 1X7ZA 1G19A 3IMKA 1VLQA 4RQUA 3V5NA 5KDOA 1ZJZA 2P9JA 2IOFK 4NYIQ 1TYDE 1J25A 1V8DA 2X0NA 2C95A 2X0DA 4AB1A 4D4JA 1N7JA 1U8EA 3D7RA 1UFRA 1WZEA 2VWQA 1U94A 4MR8A 2X22A 1FQJA 1KEPA 3C6BA 3LV8A 2PWPA 1DJPA 1FTNA 3HE3A 3K2BA 3OI7A 1Z0JA 3WLMA 1LTQA 1ZVQA 3L06A 4QU8A 1VQ1A 1CY4A 5I7SA 4XD7A 3GQBA 2BEKA 3NEJA 3T7TA 3Q72A 1MHPA 1ML4A 3QF7A 4QG7A 5DOVA 1KQFA 3FKJA 3HG7A 2VTKA 1P5ZB 1M5RA 4NEGA 2UVPB 1KO1A 2X5OA 2BFEA 3C48A 3CF4A 3FPSA 4TS4A 2EF0A 1QMPA 1OIWA 2JD2A 3W9YA 3ZWQA 1N5LA 2C7VA 5F3RA 1OD6A 2JFNA 3VNBA 3ZI0A 1FZQA 2NZVG 4IWNA 4Z7JA 1NX6A 1WXIA 4N3CA 5ADWA 2QDKA 1ZESA 1O0BA 2O19A 2DLCX 1L5FA 1SVOA 3D4LA 2MDTA 3IH5A 2CBGA 3IUEA 4GP9A 1PQUA 2WIGA 4HDOB 4MWZA 2MJLA 2NXEA 5JS8A 3CEJA 1XTJA 2UZ0A 4PZLA 1FP6A 1QFJA 1BE6A 1FS6A 1L7OA 2EP8A 1IY1A 1AM4D 4HDRA 3CCCA 4M60A 1YHZA 2V3WA 3CO5A 3OHPA 3NDPA 3HYSA 3SP1A 3FB1A 4CJXA 3AOGA 3EIXA 1EA7A 4M76B 3BIFA 1E4EB 1ESEA 3PUKA 1SVKA 5ERYA 2O3QA 3FJ1A 3JARA 2BGGA 1DE0A 3NAMA 1WV1A 3WRXC 5FLXA 5E6SA 4QJ3A 4B8ZA 4DFDA 3L1UA 3V46A 3L4JA 2WJZB 3JWEA 3BDAA 2D62A 2QG6A 3PNSA 1MB9A 1EQAA 4AP5A 3TLKA 1JXQA 3BQMB 5A5EA 4UAUA 2H07A 2DFPA 2R7KA 1LI7A 3R5XA 4UMVA 1VIDA 3NJ4A 5EE3A 1JEYB 3KXIA 3I5UA 2FVYA 2J5RA 4S1WA 5F52A 1HLFA 4EA7A 5HUQA 4JA2A 1KFBB 1AV7A 3AQIA 2VQFB 2PUCA 4GP6A 2OXFA 2ARKA 1Q6ZA 1R4NB 3P8ZA 1MZPA 1SOWA 3HDJA 4QNNA 4RV9A 3W8DA 2FN4A 2OXRA 4QRIA 2BFEB 2RARA 4LEIA 1HMPA 1SHJA 2R25B 3FZGA 2P11A 4TLCA 3F7OA 2JJMA 1KR5A 3I5YA 3FGPA 3ABIA 5EL0A 5KCMA 4YI5A 2C77A 3UEOA 5JDIC 3G13A 1V39A 4WNIA 4REMA 3JSXA 3LF1A 1J2TA 2K5UA 4AP9A 4HSEA 4DQUA 5JYDA 5AKEA 4JT8A 1HSZA 2JLCA 4EG5A 4B3IA 1O95D 1DC5A 4HGZA 4ZMSA 4ZQFA 1RR6A 1W52X 3B6EA 3N6RA 2PVSA 4S1NA 2IZ7A 2C96A 1NWHA 4PGAA 1Y4ZA 3ZBQA 1W35A 3KD3A 1IJEA 2YIMA 2H1IA 1HBJA 1BVUA 1VLZA 3D6NB 3IUPA 3KL4A 3KXPA 4GI5A 4V38A 1JR4A 5KNDD 4EUKA 1GNQA 2WE8A 3NUZA 1CZHA 3O90A 3WNQA 2QRVA 3QLEA 3MINB 1DXOA 3ZV4A 1UADA 3AEYA 1J7KA 4ZIRA 1DAGA 1I51A 2X8JA 3BFKA 3G0CA 3NLLA 4MS3A 3ORFA 1NLUA 2FDRA 5CG2A 3BIWA 5EKTA 1PR5A 1RI5A 1KEWA 1OUMA 2QTLA 1IU9A 2XIQA 3VXKA 2QZZA 2D2EA 4KGVA 1H42A 3QWFA 3H3FA 1ZRSA 5KTKA 2PEYA 3MWKA 2OECA 5G53C 2ZIXB 1KYZA 4DMHA 1XTZA 2GCIA 1N1MA 2AQ8A 4CKCB 2HXYA 2WI8A 4L4ZA 3EGIA 3NBUA 2G8LA 2P5UA 5IW8A 1IATA 4JJAA 4W6ZA 2RKWA 5LMUB 1UFVA 3PQ4A 4EGQA 3ON5A 2O3TA 5G2OA 2VRCA 4TTJA 1XHFA 1U90A 3HDVA 3P94A 3WL5A 3IUQA 1KIMA 2G0TA 1TKAA 3L4KA 1K5GA 2RI0A 5KVQA 3SSAA 1O6FA 3BTOA 4CU2A 5IXSA 4FYWA 1M8GA 3EZ9A 4KOAA 2P9GA 3Q98A 2XVXA 4PAWA 1Z56C 5G0WA 1I7SB 5AKHA 2Z56A 2IPXA 4OSEA 3H42B 3BCRA 4X6UA 5DYWA 3AHFA 2X5XA 3JZFA 2FRDA 3MS2A 2WKQA 3WLAA 2D5CA 2PX6A 2J0SA 4GFDA 2H08A 4N6NA 3JU3A 2ZIUB 1OFUX 1H4QA 1G20E 2XQJA 2NXCA 3ETJA 3OU6A 1UPAA 2W2LA 4RFSB 4HL6A 5E38A 4F3NA 4RF2A 1J56A 3Q7EA 4DMMA 1AUXA 1GNRA 1Y4SA 4OHPA 4C0JA 3KBOA 2V8OA 2FGJA 3EUAA 5B4UA 3P0HA 1JDBC 1ZCBA 1CUBA 3ZE1B 4OQYA 3GAZA 4BNWA 3BQ9A 4GO1A 5M5BA 4MGEA 4Q4HA 3EPPA 3K70C 3ZNOA 3GA5A 2WUGA 2PKQO 3QVJA 3IDOA 4J6EA 4Q02A 3RVRA 3RBXA 1C0KA 4FFDA 1N1DA 3EIEA 4MQ4A 4XJTA 5C5EA 3OZSA 3V8PA 2IHBA 2VUHB 3EGWA 3RHFA 4HH3C 1CS0B 3L1KA 1JMVA 2V3CC 3K0KA 4UCQA 2HLDD 1RRCA 4D98A 3ZTYA 4X7RA 2LGJA 3H0KA 3VOTA 3VTZA 1WJGA 4A0FA 4C6TB 4CIYA 1Z0AA 5TE9A 1CDZA 5BQFA 2ORIA 5I7HA 5DHAA 1QONA 2R6CA 3QJ5A 2OESA 3DXXA 3GN1A 4XWAA 4DWVA 3WIOA 2I99A 3HWSA 4WAUA 5IZCA 2H5JA 3RLFA 4PZUA 2C00A 2IA5A 1ZD9A 3LE8A 4R2LA 2QZPA 2REBA 4PLZA 3TBKA 3ZD9A 4ZP1A 3ZNQA 5JS2A 2HU2A 2VQ6A 2XRMA 2IUFA 4J9UE 2C2HA 2LKCA 2VDOB 5D3MB 2ZI6A 3L1HA 4F4DA 9ATCA 4IMRA 4MQBA 1WNTA 3K9GA 4CDGA 4QAQA 1XNQB 1RLOA 2VHTA 4X8OA 4W1PA 1WW8A 1NUUA 3KSZO 3MOGA 1PEYA 1WRBA 2HNKA 1QHFA 5H02A 5IKOA 5CDSA 4LGMA 1T5LA 3PUYA 2F48A 1QVZA 1RI3A 3GFGA 3G0GA 1MCZA 4GVLA 1PJSA 3TLZA 1QF9A 3M7IA 3ZIAD 5A6SA 2GJAA 1KJYA 1M6WA 2Q3EA 3BKWA 3I9JA 3P5BA 4FGSA 5AW9A 4KWEA 4P7BA 4UM9B 2BR5A 1W7AA 2V6IA 1O0CA 4TKMA 5CFLA 1C30A 1TC1A 1F2TB 1TEXA 3MCWA 5F9FA 2PZAA 3LHDA 1AKEA 3NTXA 5JAQA 5CB4F 4EKNB 5FV4A 3OF5A 3WR5A 4Q9HA 1XZIA 5JAZA 3WGQA 1WDKA 3KTFA 4S0XA 3EWNA 4G41A 4G4GA 5K8UA 5EXDA 2OE2A 4F3CA 2BGTA 1GDHA 1LBQA 3IXLA 3TUIC 3V80A 2R8RA 3W6NA 4DMLA 2QG4A 2BMVA 2LIPA 3E7PA 1KI2A 2HLPA 3DFIA 1THGA 3MAGA 4TKVB 2C7GA 2CXUA 5C31A 1QP0A 3NWOA 4DJAA 1AK9A 2BWJA 4WK6A 4GKKB 1IHDA 2EZTA 3MRXA 4EGCB 2TYSB 3O8RA 3VKHA 2CHQA 3OD5A 4MW6A 1QXSA 5A4FS 5C8VA 5L6MB 4Y9UA 4IXWA 5AKGA 5JJKA 4EBFA 3ILVA 4OX9B 3JAWB 3WGNA 4R01A 3M70A 3W5VA 5ADVA 1K2VN 2JHFA 3ST7A 2ENWA 3R6LA 1W36D 3VNUA 2NPIA 2ZW9A 3KUXA 1BIFA 4CMIA 1P7PA 4OFXA 1DKUA 1QOQB 4EOGA 1SKMA 3BH7A 5ILGA 3TZBA 3HP4A 4JT4A 1X3SA 1BO6A 3T7IA 3V2IA 1P0MA 4FCTA 2CLHB 4ZVRA 4ESHA 1KZ9A 5IT5A 3EGDA 5BSHA 1F6BA 2BEJA 2YN4A 5F4BA 1I0ZA 1L7NA 2OGTA 4Q48A 3RD5A 1LRKA 1ZW1A 3C15C 4F3KA 1EK5A 3VMFA 1VKRA 3AR9A 2FSFA 4FN4A 4ARCA 1UOOA 1IOVA 4HAWA 3ROXA 1R4AA 1AD2A 4Y2UA 4KSBA 4ZCSA 3EZYA 2CFSA 4GLBA 4BE4A 5HFNA 2QVLA 2BPOA 1T3SA 4AG6A 2XMBA 4ZCPA 1YZKA 1IQRA 4W8GA 1H23A 3RNOA 4O4HF 4AJ9A 4LF9B 2GHQA 4O3FA 5KTOA 1A4UA 1XYYA 2QTWB 2IXEA 5BQ5A 3SKYA 3VISA 5I9IA 3PPXA 1T5SA 1XX6A 4HRVA 5AKIA 2YKGA 1OX4A 3GJXC 1N8TA 1UFQA 1NM5C 4MRMB 4N6OA 2NU8A 2VJDA 3F90A 1WETA 3KQHA 1KMNA 3R8FA 5T57A 1PJBA 4UQOA 4BWFB 4Z4QA 1I2MA 1LEHA 2R6AA 3EGVA 3Q4GA 4B4UA 4IVQA 3PDJA 3NALA 3RWBA 4DIKA 4WZAA 4DEVA 4EL5A 4DCTA 3RFVA 4E7PA 4RJKA 1VL5A 3O4VA 4HAZA 4CIWA 2PN1A 4IDCA 3GMSA 1FP4A 1SQFA 1ZN7A 2FP4A 3EXFB 4UM5A 1DRJA 1KAMA 1OV4A 1PRYA 2A14A 2IHVA 1V9LA 3FGOA 4D6YA 4OQZA 1Z0ZA 1D4ZA 2GAAA 4YRTA 4OQ4A 3OPMA 4CV2A 4B80A 5KHOC 5L4NA 1G5RA 2B35A 1RJFA 1L5OA 2OTCA 2VDNB 1V7CA 2UYCA 3E9CA 3ZWCA 2ROQA 5KNDA 1B1AA 5JV5A 3AUJB 5DBFA 3C3BA 4BNFA 4N47A 1WZUA 2WV9A 4AMYA 4DDUA 1ZOIA 3LO8A 4Z99A 3LWBA 5HDQA 2D5IA 1XEAA 3K71B 4EJ0A 1ZMXA 2PQ6A 2OLKA 2VJQA 3MJDA 3AH8A 1NVVR 3K73O 5JSZB 2EEZA 1H0KA 5BVHA 2ATCA 1W581 5AHKA 1NE7A 2F00A 3A05A 2ZYSA 1M7BA 3GK3A 4XASA 4BP8A 5D85A 4UARA 2PV0A 1KEUA 4TXNA 2BAGA 2E82A 2GN6A 2QTHA 2RAPA 3LP8A 1R0XA 3NVMB 4LHXA 2XX3A 4NBSA 1ZJJA 4UUNA 4EK9A 2O0MA 3T9CA 4O4HB 4JC8A 4KE7A 5C37A 5AJYA 1HSOA 3HN7A 3EAQA 4C0HA 4D74A 1Q5PA 2FR8A 6PFKA 3PUVA 4QOJA 3HVHA 1YRBA 4GLJA 3QLVA 4ER7A 4OFBA 4ZVQA 3RUEA 4CEIB 4FYHA 4LX8A 3ZE6A 3U7QA 1HYGA 1NMSA 4M98A 3DXZA 2GR9A 3OFKA 3DMNA 2B94A 3SBDA 1B00A 1DBVO 3BWMA 1EP2B 1BN6A 3I6BA 3EH2A 4RIIA 1GTMA 3T52A 5DM0A 3WDKA 4BATA 1EBUA 1XD9A 2OOSA 2IYTA 2GZAA 2CLCX 2PAFA 1HWYA 3ML1A 5JXGA 4AS1A 1ABFA 4Q66C 1RRFA 1Y9EA 4LC0A 4LZOA 5AM0A 5BRJA 3WWEA 1WCYA 2WKRA 1NW6A 2XKBA 2C3MA 3AEQB 4MV8A 4UJ5A 1XBTA 2IL1A 2ZUCA 4EZBA 1UBCA 2XQGA 1YQ9A 2FPGB 1XDSA 3I64A 4NZOA 2A0WA 4P93A 4XE5A 4BUCA 4QRHA 2BI8A 5F1OA 4G2TA 4R2JA 2A5FA 4CMJA 4BNDA 3N39C 5REQB 3R7DA 3O3CA 4HDKA 3TXYA 5K3FB 3OBBA 5JCZA 3LI2A 2PZBA 4KYVA 4FSXA 3QUTA 4DCMA 3GPCA 4DSAA 1QCDA 2F7SA 4DMRA 5EJ8A 2WNHA 2ASVA 2GEKA 2ZIWB 4GUAA 7MHTA 1IHUA 2AE1A 4C7VA 1ESDA 4F8EA 3EMBA 1HE1C 1A27A 3WA6A 2CLOB 1XRNA 5C46F 4YMGA 1UMCA 3VZCA 3CCFA 4C0LA 5BSGA 1CBUA 1ODLA 1T10A 1SXIA 2Y93A 5KQPA 3OZFA 1JG3A 2OVBA 3JD2A 1ESMA 2RGCA 4IUYA 2QM0A 4DG9A 2AK2A 1E6CA 1GTL1 3DO8A 4RDHA 3O31A 3N59A 4XRRA 1ZC3A 2HIMA 2VPIA 2FPOA 1QQ5A 2A33A 3GQVA 1YACA 3L1JA 2XNSA 4NMLA 5DTRA 5JVDA 2ODNA 3LRTA 5HIAA 3JZIA 2HRQA 3B6MA 4A4DA 4ZIRB 5JANA 3DF7A 3A3YA 1XRMA 2VPWA 3N74A 3R8CA 4DSTA 1U9YA 1OR8A 1R8JA 3MWJA 4C4YA 3ED5A 1ZAYA 4PTYA 1NRIA 2DEUA 1MX3A 4IDGA 3C8DA 3ABRB 3MJSA 2BE9A 1EUQA 1MT0A 1V35A 2VO1A 3GZNA 1EB9A 3GJ3A 3U39A 4F1JA 1LV8A 3K4PA 3HY6A 3QZUA 2Y6UA 5CA1A 3N76A 5F78A 1YJ5A 4ZYXA 1VCOA 4XDHA 1O6BA 5JRJA 2NO4A 3WAJA 4U6NA 4R81A 3NC4A 4ZREA 2ZS9A 4IFBA 1L1QA 1EP3B 4Z7QB 2Z04A 5G1PA 4KO8A 2OBFA 2QLJA 2WPDA 1HDRA 2XDYA 4N18A 4F93B 4JMPA 3UA4A 4L78A 1GD1O 4BMXA 3UJCA 1KETA 2PX3A 4WUTA 2X3UA 4FKZA 2JLQA 2W2LD 4OGLA 1Q3HA 1NLYA 5KSWB 1ZUNB 1C2YA 3EVBA 4BX9A 4G5QA 2VPXA 5I9BA 2I7CA 3K20A 3UTCA 4CIDA 4E33A 3F49S 3KJEA 4RWZA 5DM4A 1U9CA 3S7TA 2R4QA 3PX3A 3UJNA 4MA4A 5ECYA 2GLUA 4PSCA 2HBYA 4NFSA 1Z45A 3T4EA 1VFNA 1E2MA 3WAGA 2GCGA 1FZTA 4HV4A 5F5NA 3RIEA 3W2EA 1HGXA 3TTVA 3GCZA 2H48A 4QATA 3DVLA 5HKAA 1DQSA 2QQEA 3BB3A 4TTVA 4PONA 4B3DA 1BE0A 2BJVA 3ILHA 2QW1A 3UXYA 4EHIA 4V0SA 3COSA 1EFCA 1NYQA 4Q4DA 2YJ3A 4ZI7A 3DFKA 2ZAMA 5FV7A 4YMUA 4TV9A 1K66A 3NV7A 5GVRA 5KYNA 1H1DA 4NI5A 4II2A 4OHYA 1ZH6A 5TGZA 5DNEA 1YCHA 1Y4UA 2JGFA 4GC9A 5ETJA 3DAOA 4IMIB 3AUFA 3E5HA 1LBIA 3HYLA 1UM9A 1CIPA 1XEFA 4LN1A 4F9FA 1CCWA 2CCGA 3PG5A 3ZD6A 1CTQA 3RGGA 4WLFA 2Y99A 1DAHA 3AR6A 3E22A 4DCJA 1NTRA 2C8KA 1B3BA 3QKSB 4E70A 1J42A 3B2EA 1PNVA 1PX0A 4FN5A 3C24A 3KK0A 2P91A 5CLGA 4YJKA 5JUWA 4JDUA 2J3DA 3I23A 2BCJQ 2XVZA 4BIIA 1RXUA 1E9AA 3AM1A 4OI0A 1JSZA 4TXJA 4WKOA 4FFLA 3UVEA 2ISCA 5J4VA 3AC0A 4E4YA 1FP1D 1SUWA 4E51A 1HA3A 5LYJB 1G0NA 4AMBA 2M1XA 1EAMA 1GRRA 4P08A 5DSTA 1YFJA 5CPBA 4AVYA 1X8JA 2IYVA 3FR7A 4QGHA 5HTOA 3LQ2A 3BGWA 1PK9A 4GIBA 3TI7A 1EXWA 3I5MA 4GP7A 2DFVA 3ZY3A 1GDTA 4X1YA 5TRTA 1UT8A 1N2HA 3TFQA 2B2CA 3Q15C 3AJ8A 1M6HA 4KR0A 2VH5R 4MRNA 1YBHA 2C99A 1AGRA 3SDBA 1ST3A 4UAVA 1E3JA 5IZCC 4K6HA 1RLUA 4F4UA 3GLGE 3KJZA 3H9JA 3T06B 1TZMA 3F5QA 4UW9A 4E13A 5C5DA 5JQWA 5LDGA 5L4SA 1HTTA 1IN7A 3X1XA 3ISVA 1D2GA 1NVMB 2QRKA 3D81A 2QM7A 2C4WA 2O2SA 2Z4TA 3HU1A 4V0KA 3ND8A 5EWLB 3TSCA 5DNAA 4CPDA 3I04M 3RUDA 1LI4A 5FR2A 4N4AA 3P2MA 3QXHA 5SYAA 4ER0A 1BX1A 3PB3A 2UUBB 1L8QA 3K92A 2W2VA 2A5JA 2ADMA 1VSBA 4QDKA 3FR8A 4KVAA 2JLBA 2XCOA 3MA0A 3RIGA 2GJ8A 2OYRA 2GN9A 4YMWA 4YECA 3AJEA 3K09C 3IOBA 4LI3X 1KJNA 2RHRA 2VK8A 4LI0A 4RA6B 4RCVA 4M1EA 4WTOA 2OORC 2XBUA 1L9KA 3HXMA 3M81A 3I9FA 5H59A 3EXIB 3TBFA 2OMKA 3WOHA 5F7OA 3DBLB 3H2HA 5FBKA 1D9XA 1X7XB 3B1WA 5TPZD 3B9QA 4J0GA 5JJCA 2ENUA 1FJHA 4L22A 3TOVA 4QPJC 2OT3B 5F73A 1KEVA 3FNHA 4TL9A 4U2GA 4WCFB 1C0IA 5D5QA 4M1WA 3W1VA 4F4CA 1GPWB 3DCJA 4MS4A 4BPBA 4BCCA 4V24A 5B7PA 4UCXA 1Z83A 4RQAA 3MZ0A 4P83A 2C9MA 4Q9KA 5DMXA 2I9PA 3GL9A 1R12A 4JXXA 3AR5A 4R8RA 1BYIA 2PT9A 4QYMA 4YYEA 5KOIA 3IEVA 3DEHA 4RMNA 1NNSA 8ADHA 3PT9A 5K6RA 2ZSUA 4I5FA 1MJGM 3SM3A 1N33B 2WMYA 2YXPX 1TCVA 3GPBA 1V3UA 4D4MA 3AEUB 1SKBA 5BSFA 4TYWA 5JSQA 3BXGA 3ZWOA 1OJ7A 5KC8A 3EDQA 1RWBA 2VKTA 1N2CB 3HRHA 1F3OA 2RGYA 3NXKA 1NBHA 3HHEA 1ES9A 2HQSA 3G2HA 1NVGA 2OGZA 3LT1A 1BU8A 4ZPJA 4N5DA 2YWBA 4M1TA 1Y8AA 1ZUD1 4UXJA 3GD7A 1W5AA 3A9RA 4XLZA 4G1CA 5EIEA 2DWCA 4GX2A 4PC3A 3B3QA 3CB2A 3UHPA 3V7UA 3T3HA 5A62A 1JXOA 1LC3A 3VYSB 1E18A 3WGGA 1C2TA 1H2BA 1WMDA 3NBZC 3IB6A 3H9EO 2I7VA 3RKRA 2LWIA 2XMZA 2BT4A 5AW1A 3ZIAA 1K2WA 3WB1A 3BXPA 4M8NE 5A06A 2BHSA 4S05A 4HEA1 3OCYA 4ESVA 1TA9A 3W3AA 1SUPA 3BD9A 1OLUA 1KQPA 3DTVB 4IIHA 4DNFA 2EEPA 4DS3A 5DIZA 1ZN2A 2FUG1 4HZIA 4MGIR 4BQEA 1AHIA 1WP4A 4IINA 1U3TA 2JC3A 2FX5A 2TS1A 4CQMB 3NIGB 4HSGA 4BVHA 1KZGB 4Z1MD 4DM3A 3IQZA 1T36A 1KO8A 3CQ9A 3EZNA 3UHJA 4AFNA 5K05A 4C3OB 2DRIA 3R3YA 1Z7WA 4HDSA 1BJTA 1UXOA 2J3EA 3HDYA 4QSMA 4FB5A 5I45A 3DBLA 1KJ8A 1I9GA 4P4LA 5CMLA 1X8XA 3K9QO 5AKZA 2O23A 1QC5B 3A3KA 4QTZA 2J59A 3TBHA 3EGOA 3VJKA 3D7NA 1GVNB 1GAEO 2AK3A 3LHSA 1QVAA 2QNRA 2G08A 3K30A 4IDPA 2WDZA 3P2JA 3T3GA 1XNHA 5GJVC 5CTJA 5JXJA 3FHJA 2JATA 4A0QA 4GOLD 4C29A 4YRGA 5ER6A 3F5FA 3SPXA 5CU7A 4QO7A 4HWKA 4MDHA 5AKKA 4IIDA 1F9AA 1EDZA 3E6AA 4EKYA 4MUYA 1PW5A 4NOMA 2CNNA 1VI5A 1EIWA 4X64B 2A4KA 5CT6A 1J0XO 3ZWAA 1VGQA 4TS3A 2W11A 3NJRA 4RFLA 3THRA 1RZRA 2JJ2A 3AXTA 2WZCA 1RWXA 4EVRA 2UZIR 5K3BA 3F6RA 3OQ1A 4IICA 4ZVNA 3OCJA 4R54A 4X00A 2FLWA 3IP7A 1DPGA 2QN8A 5C35A 2XPCA 2RSLA 1M10A 4CEHB 4TQ9A 4U2FA 1FNCA 3LC2O 4X92A 4ENWA 1QIFA 3VNRA 3WZLA 3H6KA 2GTIA 4C2UA 2GBCA 4JOCA 2BONA 1L3IA 4OKIA 1MBZA 5TR9A 1NBIA 1YCFA 2BR4A 3OIWA 5AH0A 1AA9A 4B75A 4YYZA 3STHA 1E3QA 3UV3A 3WLJA 3FH0A 3PFHA 1XMQB 2OB2A 1OFTA 2ZI3A 2D59A 3WP0A 4WGFA 1JIUA 2A2ZA 4WBSA 2Q8PA 3E58A 3LX4A 5ISMA 3RASA 4F4JA 4OJYA 5JTTA 1DJMA 4LFBB 1G8KA 4D3ZA 2DUNA 3VU9A 4UBNA 2R8XA 1MW8X 3ZHSA 5IT4A 1JKXA 4IR7A 2FWMX 1OVGA 4I1PA 1MDBA 5TT0A 4DVJA 3ONVA 3F8WA 3OIYA 4MVJG 1GR0A 1T9AA 1UM9B 2X58A 3DZ8A 3RI3A 1QF7A 4B84A 5HVNA 1SVUA 4Q9NA 2RD2A 3BXFA 4YMSA 3SCZA 2J9GA 4F12A 3AM4A 3W04A 4P38A 1RBYA 4MVCA 4CNQA 4JUIA 4DG5A 5E4FA 2VCEA 3U3KA 1NZFA 3LF2A 3BE4A 4OQMA 4M8SA 3T5DA 1FFYA 1UDBA 5CDTA 4QAJA 1JHQA 1W73A 3OF3A 3V3TA 2CXPA 1YE3A 2F43A 4K6KA 2PV7A 5K8LA 2OK7A 1TEHA 3DLPX 4RV5A 1IXRC 1E60A 2HSEA 4IHJF 4H6PA 2J67A 3OFVA 1E58A 3WY9A 5IN5A 2VJBA 2BFBB 1Z4PX 5AR1A 1QHNA 5EHNA 4LSZA 3BRWD 1NV9A 2CT8A 4EZEA 2EG5A 1CUIA 4I8IA 1M1NB 5IT9A 1XCLA 3WGZA 1Z6QA 2PMWB 2ZOSA 1TTQB 2J33A 3DS8A 4ILKA 4OMUA 3MWDA 4BO4A 1NMYA 4WIAA 1AQIA 1G38A 1M2OA 2B78A 1LF0A 1YRQA 1VMKA 4BDSA 5AKXA 3MWDB 4BLTA 4LF7B 3RS7A 2VJMB 4KWIA 3TSOA 2MINB 4JNCA 4RPHA 3C3KA 4LK2A 1JILA 5ALEA 3F6PA 3R5FA 1YMVA 2DGDA 3UJBA 2EFHB 4A2QA 5ARBA 5TIIA 2A3RA 2C5EA 4N7RA 1QTRA 3PFKA 2C7PA 1NV8A 1GSOA 1YDGA 1SO8A 1CYDA 1YQXA 2DCUA 2VNAA 2ZATA 3T1OA 4RACA 2OZKA 1Q57A 1UMDA 4C06A 1AOXA 1GUAA 1PSDA 4CEJB 4D9GA 2XKKA 2F1RA 3AIMA 3JYNA 4HGYA 3EXHA 4BGDA 3C3AA 4RO0A 3ETNA 4K6GA 3UMCA 1RQ7A 4HLUA 1M6YA 2EU8A 4LOHA 4DJ5X 3EEFA 2QYSA 3H4MA 5TGDA 3P5SA 4J90A 3OP1A 5L9AA 2GWRA 2Q7DA 4IIJB 4R3NA 3ACBA 5F64A 5ALJA 4BJ5A 2JIQA 2QRJA 2GZHA 1G9XA 3UHAA 5LZ5A 3UAVA 5LPNA 4EG8A 4NE9A 1G6KA 4O4LF 4NU5A 1NLMA 4DLPA 2QSYA 1Q83A 3NMUF 1P2VA 2ZVDA 4FX2A 3G6WA 3VPCA 2X0JA 4EEZA 1PQPA 3UKDA 4HNUA 1G20A 3N2GB 3CLTD 3G8AA 4JB3A 3IVAA 4C5AA 1A8PA 1NVWQ 3HDGA 1Y7IA 4GBMA 4HN4B 4D3FA 5IMBA 2BFWA 4HNAA 1DZ3A 1K92A 2GNOA 3ZEAA 4JI8B 4FDTA 3W6PA 5DPMA 2UVPA 2Y76A 2PKRA 2QUZA 3PVSA 2HL6A 4FLEA 2Z3VA 4NH0A 2A9VA 4EYEA 5KOHB 1YOVB 3I2GA 1WQ4A 3PDIA 2QD4A 3PEFA 2JB9A 1P45A 2X5NA 4ECAA 5AHWA 1CR1A 4MVJP 4HQRA 4IQ0A 4UVDA 5HEKA 1SOAA 5HFAA 3GLFE 1UWLA 3GV0A 4W8OA 2V6GA 3OQNA 2PYZA 5D1HA 1RKQA 3II6X 4POAA 5B64A 4QQFA 1PR1A 4CFYA 3UW3A 3DOCA 1WUIS 2CVZA 4DANA 1FFAA 1X7ZB 5LWQA 2XMRA 2B5OA 5INTA 1K8XB 3HJUA 3NBYC 3WKAA 4CKBA 1NC1A 3SZMA 3MWFA 2OCBA 1TPZA 1ZD5A 2AN9A 3I09A 4I4TB 2C8LA 4EUSA 2D1QA 3G8BA 1US8A 1NOKA 5E95A 3FM9A 3OZGA 4Q37A 4ND8A 2OC9A 3NASA 5FUVA 5JE8A 5KBYA 2HA5A 3H2JA 3O91A 1O9HA 4BVBA 5LVAA 4V1CA 1X94A 4A6PA 2X4GA 2HT6A 2ODTX 1SVIA 1OIVA 5TMEA 4FHDA 4DY4A 1TB4A 1AXEA 4C7MA 2PZGA 1F3LA 1COWD 1ZW6A 2WKSA 4QE3A 3RWOA 3PHLA 3EEQA 1CY6A 5I4CA 4Z4IA 4H3HB 4ML3A 4NU6A 4AKHA 1ISFA 4RHCA 3OTOB 1H85A 4CMCA 5FWXB 1TQDA 1JQDA 3DLCA 1MEJA 2BUAA 3IO5A 4ETMA 2V0NA 3IR5A 1H2WA 3G68A 1HLDA 1FYWA 2YUTA 3A4IA 1JJIA 3FPKA 4Z1MA 3Q3CA 4J2TA 2IH2A 4G6ZA 1YHNA 2ZYVX 1OPXA 4ARVA 4PLWA 5L3SA 1TFUA 5K3EA 4ZT3A 5EERA 4I46A 5LP6B 4ITUA 3OF2A 3FYUB 4MJ3A 1HI9A 2X9VA 2BYTA 3ZTTA 1KHHA 2ZYHA 3VHLB 3HACA 4G4SO 1XMSA 3C41J 5GV7A 4PFSA 4OP2A 5FP0A 3VHRA 4FUQA 1PJ2A 3FYTA 2AC7A 2JLAA 3TOZA 4BTLA 2C88A 4U7PB 3CKKA 2WHXA 1ZGGA 3CZ5A 4OHOA 4NMHA 1JJ7A 2I66A 2E55A 1IAQA 3FOCA 2E4XA 3ZPXA 4B45A 4EQ6B 1NOIA 3D3KA 4TLLB 3EVTA 1I6MA 4R7TA 5C0OE 1ZICA 3WLSA 3VVLA 1E94E 2IZZA 3SEQA 1U3DA 2V5AA 2JKYA 4QM7A 2OHJA 1XAJA 2FR8C 4H59A 3KUKA 1BZYA 2KMLA 2WD8A 2Z5VA 3A0UA 1ODCA 1WB5A 4XGKA 2OFWA 3HEBA 4UHFA 1JAIA 5EN4A 1H6DA 3FUVA 3KKNA 4W9NC 2F9MA 3NBKA 4JROA 2QI9C 5CIYA 2O5CA 3K8OE 1U4NA 2HMTA 4LISA 3E9MA 1V6AA 3C39A 4M7OA 3JPYA 4P2BA 4PIMA 4JIMA 2BFMA 3D8UA 2FFBA 4FEAA 5KWJA 1OH5A 1I8TA 4HWTA 2W4IA 4IOMA 5JJIA 1I1HA 3K15A 4AY4A 4W1QA 3T94A 1KI8A 1Z8FA 3F2VA 2QA5A 4PR3A 4JHLA 1T34A 1DP4A 4IJQA 3I2IA 4JKYA 3V97A 4Y6QA 1IOLA 2A5LA 4QO8A 4XDGA 3ASVA 4I4TF 4H7JA 3EGXB 4H15A 5C1BA 5TLSA 1FB5A 1O95C 4MOWA 1EXNA 3GUUA 1EGAA 3KZNA 4FVTA 4O1IA 5AYVA 3VJMA 1KOJA 2WYWA 3H18A 4O4JB 2DUWA 5TNXA 1YCDA 2X4IA 4MWSA 1VG9B 3SBXA 4A5OA 2JW5A 4CIAA 3EXEB 2PRYA 4QT4A 4K26A 2NO1A 5FA8A 2ZJ7A 1J9GA 3IAM6 1DIOB 1DX4A 1SBNE 1H0HA 3GCWA 3UK7A 1DRWA 1GSAA 1S01A 3FFXA 2B2NA 2ISSD 3OTIA 4MPDA 5J59A 5K45A 1XKTA 1F2UB 1ORVA 1IQ0A 2BSQA 2J1LA 3GJ8A 3T7JA 2BMWA 5CD9A 5KHAA 1U2QA 4YJ3A 2XWPA 4D0LB 2ZYTX 3KB6A 1H69A 3C3CA 3L01A 2P8JA 3VPFA 2WLTA 5KYWA 3J7AC 4R1MA 2DTEA 3JWPA 3BJMA 3QE0A 4WOPA 5MGNA 1P6XA 1DADA 2ZPAA 1TJPB 1HE5A 5KQRA 5H80A 3JQ8B 5TY0A 3NP7A 1GO2A 5DRYA 1HDIA 3DEYX 5JNUA 1FU8A 3HO8A 3TIVA 5BN3A 2G88A 3FMVA 2ONKA 2WVAA 1U3CA 5AW5A 2VTBA 4MINA 3V6LA 4Q47A 4UUAA 1TQ6A 1L5GB 2VXOA 2OD2A 1DG9A 2V3VA 4XEUA 3OIVA 4ZT5A 3D54D 1QB7A 1XKQA 4ZCQA 5KNCA 3DBIA 5LMCA 2CCJA 5AI5A 1J0AA 3WSVA 4BEBA 3BSFA 4EEXA 1PDWA 3OA2A 1KVRA 1L5WA 4YDHB 1QP7A 4XYMA 4QL3A 1ZNWA 3VNQA 1ZD3A 2HJWA 2X13A 2WEKA 3SS9X 4BNZA 3S0JA 2C9BA 3ZR4B 2PMKA 4J49A 2O48X 3FLEA 4PTLA 5KYWB 3HXOA 4W5OA 2ODQA 5LFAA 3IUSA 4D0GA 2W4MA 4L7QA 3H5NA 3LBYA 4DLSA 5ELLA 3FWHA 3UMMA 2BFNA 2QBYA 3U7FB 4OUKX 4OGKA 4D4KA 3QU9A 4LZNA 4RZSA 4EPXA 4ZOAA 2BHRA 3EXEA 2GPJA 1IK6A 2W2XA 3ETEA 2HRDA 2IPAB 4IV5A 3GLGA 3DOJA 2FXIA 1Y7TA 4KC0A 3AU8A 1QYCA 5FFMA 1JZTA 3OMLA 2PUHA 4GMFA 4HEHA 5TQVA 2FSSA 4IPTA 3SOPA 1MC5A 4A0SA 4CHTA 1XCMA 4IGKA 1E1QA 3BRCA 3U31A 1RMYA 4OEHA 3RREA 2C78A 5SZIA 3HCDA 2WKWA 3I6ZA 3LGAA 4Q00A 4B3GA 5ALYA 3NWEA 2HMAA 3VTAA 4P35A 2A1TS 2WSSA 3IB3A 4WBNF 3KYIB 3GZ4A 1U1FA 1OW3B 3I6IA 5IH7A 4H08A 3G8CA 4QGBA 1WULS 2RH8A 4D9CA 3ICOA 1Q0TA 1YA6A 3HP1A 4RENA 3FAZA 1KSGA 2BMJA 3BMNA 3SYNA 4NOJA 5BMVF 5J47A 3HR7A 3GVPA 4DIBA 3GXBA 3LP6A 4FLMA 3DPUA 4J0CA 3D02A 3KOOA 5KEIA 3L4EA 3HA7A 3QYAA 3CW8X 5C8YF 4YIKA 3AP3A 7REQB 5HKKD 2BRUC 2PO5A 5IG2A 4H27A 5F4ZA 2X5JO 4EMUA 2RGNC 3WGOA 4FYPA 3OEYA 4PPQA 1KGDA 1T0JB 5KC9A 1SUSA 1T3GA 3TL2A 5MFZA 3U4AA 1AMNA 3PTAA 5DJ5A 1JTEA 1U8UA 2YY7A 1VBNA 3A4NA 4B1FA 4ALIA 3R44A 2V58A 3U62A 8LDHA 4HRYA 3K7EA 5I7OA 2J0EA 4YJHA 4QPCA 1EAYA 2JGAA 5G3YA 4KGDA 4XGIA 4GM1A 3AM5A 4MAMA 1EG2A 2ZT5A 3AFOA 1B42A 4CLDA 4BLRA 2C98A 2VH2A 4E21A 3AHDA 4EG4A 4LKOA 1P2BA 2PKQP 3KELA 2W8BA 1IM5A 1P81A 1UQTA 3E1GA 3Q5GA 3GJYA 4GC5A 5KAMA 1IIBA 2C4HA 3A1TA 2WT9A 3GDFA 3TD6A 1BOOA 3QBEA 5TB5A 1V1RB 3CRVA 5L95A 2G83A 4K28A 1E9BA 1P4RA 2QR3A 3RRJA 1GZ6A 1LLCA 1NFQA 2GOYA 4QJIA 5I01A 3V1MA 1AA6A 5JDCC 1AUPA 1RXVA 4M37A 3SC3A 4BJ1A 4HMPA 3CU5A 1NQTA 1U7ZA 2V9ZA 3LOUA 4J7UA 3OIUA 3RVOA 4BZWA 3IQWA 1YUMA 5BV0A 2O2XA 2BVNA 2IHYA 4PX2A 1LSOA 1OU4A 2ZI7A 1IONA 1E1YA 1YR6A 3FOAA 3I2YX 3JVIA 1GIAA 4I81A 5E2IA 4G81A 3TX2A 2R8YA 1K8QA 3DZHA 3WVNA 1EFAA 1D7AA 4DA8A 4I2NA 4RM2A 1N3IA 5EOVA 1EUZA 4FEGA 2VDJA 5LB2A 1G8JA 1NONA 2P0YA 5LSAA 4HNAB 3A0RB 1ZONA 4NDAA 4RJIA 1A2OA 3RIXA 1PE0A 1SUIA 3ZCTA 5HIKA 3E9YA 2RGXA 4YDQA 1MJGA 4E03A 1ODFA 1W75A 5DBGA 2G63A 2ZIXA 5A4AA 5HP4A 4PFQA 3KE9A 2E21A 3OFNA 4C4XA 1EWRA 3HVKA 3RSCA 1PEDA 3T9FA 1S6YA 4GI1A 1E79A 3KLMX 1XCOA 3KOUA 2NV0A 3KSBC 1M72A 3E0QA 4NU8X 5FORA 4XYLA 2R48A 5ALRA 2WTMA 4O4HA 4U5QA 3QHAA 3UQZA 5FADA 4P0QB 3O74A 1N6LA 2X42A 3E70C 1WWKA 3NORA 1Y7LA 4A03A 4Z3OA 5LBUA 1W46A 2P2NA 2UVQA 4GS5A 4PWZA 4NNPA 3OMXA 1QR2A 2RCYA 4GXNA 2GFQA 4I4TA 3X1YA 3TG2A 4GWKA 2LVBA 4M0UA 5LA6F 2G1PA 5B3JA 2GXSA 1NY5A 4LYHA 1M8KA 4XFKA 3WDLA 4QULA 1NUTA 3M4JA 3WAKA 3RQSA 3KKQA 4WNAB 3SBOA 4LE2A 4BNLA 5DM60 2P9ZA 3BXHA 4LSWA 3BTUA 3IAHA 1RD4A 2RBEA 3JZAA 4WHMA 5K5EA 4JLUA 5E7MA 1L5NA 2FUEA 4JOQA 1T29A 4JP3A 4RADA 3CINA 2O6HA 4KODA 1YI0A 3SX2A 5D3ZA 3NH6A 3AR3A 1E6KA 4B46A 3CRMA 4QQ8A 1MNQA 3E81A 3AOEA 2ZJ6A 4KI7A 4CG3A 3PUJA 4D44A 5KYUB 4UHJA 1RJ9A 3H5RA 1CUHA 2Y0DA 4FI3C 4GPEA 5C9ZA 3R0ZA 5L3QA 1HFWA 1Q74A 5KJ6A 4XIGS 2BBOA 3G9QA 4BVAA 4NX2A 3OQVA 4CVNA 3K0SA 2EERA 2YV2A 4L74A 1T9ZA 4U6SA 2I55A 2ZUWA 5HPYB 1A5AB 4F45A 1JEYA 3OTHA 1GPMA 1E20A 2DCMA 3GDHA 3I01A 3TGWA 4YQYA 4TVKA 3IBTA 1M34B 4UTRA 2EP5A 2ETVA 4MYDA 1OAOA 1D03A 3JASB 1B93A 3JWIA 3I1YA 5HCNA 1ODSA 2HZ7A 3PQCA 4X1KA 4KQJA 2GX6A 3VC1A 4AZ3B 2L82A 3PEEA 4HVLA 1YVPA 1BVYF 1F5NA 1KVUA 2J3MA 1BH2A 1DINA 4IEFB 4CEJA 4K1LA 2CD9A 4IJ6A 3HDQA 3B3AA 4P7KA 3QOWA 4X65B 1O6ZA 4KB5A 3OM1A 3ANNA 3RSSA 2JI9A 2IX3A 3G23A 1U3GA 1VXRA 2VP5A 2WZDA 3HCNA 3B1KA 4LXQA 4RORA 3TYXA 4F85A 5KREA 1GZ3A 5ITZB 1FQKA 1BDMA 2ZWOA 5J2TA 5CD1A 4FDUA 2YHUA 4YMIA 1FPQA 4NICA 3D4IA 4H31A 4O4IA 3LQQA 2QMEA 2QL9A 4LDAA 4OJTA 2ZI5A 3S8MA 4YR7A 2UYHA 4DRXB 4YRPA 4ERNA 1UPUA 3ERCA 2GILA 4GRAA 2HCTA 4KXQA 1WVMA 3BJIC 3IRVA 4BYGA 5EA2A 4Z49A 1ST2A 4Q9IA 2BELA 3HU3A 4KO3S 1BDBA 2Q6VA 5DHFA 3N8HA 4AM8A 2BGJA 1KKMA 3P0RA 4IS3A 2AOWA 1M1NA 4CV0A 1V16B 2NGRA 4LF6B 4CMIB 4FSDA 3A6DA 3NHKA 5FJJA 4LXHA 1NBMA 4NWIA 1ZJ4A 3FDFA 4AN0A 4QFBA 1EZ4A 3PQDA 5BUSA 5IEJA 3OQPA 2PL1A 2Q5FA 4N7BA 1XR3A 2FNAA 1USWA 1XAIA 3I73A 4C7OA 3AOEC 2IEDA 4F0JA 4ZDKA 2P9HA 2P9TA 1X9HA 5FJIA 3BGDA 2W42A 3ZLJA 1WDWB 4RHEA 2OZEA 3MWEA 4GSLA 3INYA 2OV8A 5HQ3B 3MTIA 4ES6A 5A1JA 3DEKA 3CRNA 1NASA 5FEMA 3LHIA 3RV3A 1HLGA 1P2DA 3BN3A 1F2VA 1N5MA 3KLOA 3R0XA 1Q0PA 2EWMA 2I67A 4QNRA 2XCIA 1BXKA 2ZRIA 3DZDA 3GGCA 3MLBA 1BAPA 3OHMA 4KQMA 4LYJA 4EW2A 2QAGA 4QZVA 3AHGA 1OASA 1AQLA 1CT9A 1Y9JA 3T1TA 2QRNA 3DZKA 3H9UA 2DJ5A 3LUPA 3R0QA 4BOYA 5ICEA 1JW9B 4LF4B 5ESDA 1N1GA 3LIIA 3ZDYB 1ISRA 4Q7LA 3PQ5A 3V8NA 1QZUA 3C3XA 4JP8A 4PG6A 4PV7A 1VCNA 3V9AA 3WIDA 1JWLA 1XO1A 2PS9A 1YO6A 1YQEA 4KPUB 4QUGA 5DTJA 3RDPA 3BD8A 4G9EA 3WKDA 3VKVA 5BN4B 4Y8VA 4EGFA 4D99A 2F1KA 1WMBA 2PSFA 4G4SP 4HP8A 1KEKA 1T8PA 3OZRA 4HGNA 3GLTA 2AQHA 5EE9A 2Q5JA 1FW8A 2JIBA 2ZEJA 1OPRA 1ECFA 3L84A 2XYHA 3AR8A 4BKPA 1QMGA 2VUTA 3LPAA 3EEYA 4X60A 4AP6A 1LS6A 2GD1O 3ZY5A 2WU0A 1KGSA 4IDNA 3IT3A 1NDHA 2AOTA 2JZCA 4O02B 1RYFA 2JI4A 2XGOA 3CT6A 2CE7A 3C74A 4LYAA 1LVHA 5GONA 5B7NA 3KXDA 3MJRA 3E9DA 1SPBS 1LDMA 3ITEA 2PLAA 2XCQA 1ZISA 2ZCUA 3H1BA 4H7FA 2QY9A 2WW8A 4PLFA 4AUKA 3P2EA 3MFYA 4JVMA 1ZWLA 1ACJA 2HMUA 1C1XB 2OC4A 2D0DA 1KFCB 4X63A 4NYJQ 2YHBA 1RAHA 3DDZX 3LNCA 4Q1DA 3WMFA 5HK9A 1E59A 3V4SA 1Q44A 5CT8A 4HXFB 4O8ZA 4E5YA 4A2WA 1KI9A 1ATIA 2RK3A 5IJ9A 3ONFA 2OHGA 2CXTA 1HUQA 2DFDA 3AY3A 4EPWA 4HXGA 1NI5A 1XVTA 1ZUHA 3DE6X 3E8XA 7YASA 3M6MD 1RQRA 1U0TA 2DP4E 1FS5A 3AWDA 1GRCA 4TZTA 5FRDA 5SZJA 5IJ9B 1ID8A 3N1UA 3PQEA 2QD1A 3HI6A 1FMTA 4PLCA 4BO9A 3QELB 3T7EA 3TX6A 4EJMA 2FXVA 2KWIA 2I33A 3RJTA 3KR0A 3M34A 3R8XA 2QW0X 3WX0A 1OLSA 2WG0A 1U5AA 1X0VA 3WL6A 1VLMA 1RM4A 2H06A 1B3RA 2W4QA 4LMBA 4XJVA 5EXXA 1JSCA 3GFQA 3GEIA 1U99A 1ESZA 3SGLA 3H11B 4F4HA 1FK8A 3AEKA 3B1XA 4I5DA 3I32A 4AU1A 3NETA 5ALTA 2FYTA 1U0FA 4YQEA 3LDAA 3ILSA 3OZ7A 3L6CA 4BMCA 3O4GA 1PTJA 4H6XA 2BJWA 3CX4A 4FP9A 4IAOA 4IKPA 3VH3A 1P2FA 3AF1A 1OAKA 1U5CA 2H5LA 3PPYA 4Z9FA 3C3JA 2EW1A 3N2IA 3AGQA 4ZAGA 2P6RA 4G0WA 3IT1A 1X1AA 1OY1A 1ZU4A 1JDBB 2H85A 2NZWA 2L2QA 1MENA 3EVGA 4HVTA 4PYIA 3ESBA 1P19A 4TWBA 1E1LA 3HY3A 1ZGJA 2QMQA 3BB1A 3D3NA 3QMMA 2I8LA 4DC9A 5IU6A 5KOHA 3O1LA 3DOHA 4Q1EA 1ACLA 4DZZA 2I7DA 1U1GA 4AZWA 3CXRA 3O9VA 4MKRA 5GTDA 1NR5A 1S8FA 4L15A 1AF7A 1H93A 1SQ6A 2VDKB 3BWXA 2ZRJA 3EMKA 1NJ2A 1DBSA 2BGUA 5E6RB 3RSFA 1LLQA 4QUBA 4FBLA 2HU5A 2M2IA 2R3SA 5EHGA 3UC9A 4MKZA 1U9ZA 4WLOA 5HKKA 2VHEA 1OOEA 2ZTUA 2G0NA 2QE7A 4FWBA 5AVWA 1EEHA 4DV2B 2ZRAA 3SYMA 2YWEA 4PHFA 4URHA 1DBPA 1J1ZA 2DHRA 1FLNA 3GW8A 2B3DA 4RY0A 3MB5A 4TOIA 2OV4A 4X1OA 2PMEA 3VYWA 2XRFA 5K01A 2I76A 1DSSG 3OE4A 4ZVPA 1DARA 3E7XA 4G5FA 4IJUA 4MYTA 4PLGA 1JHZA 5K2MA 4F4FA 1S2GA 3DQPA 1JZQA 2H18A 4O2BF 3TOCA 3C1UA 3SSOA 2SECE 3D3EA 3TGLA 1AK1A 2IIBA 1D8AA 4CKBB 4G2NA 1GNLA 2W6JD 4ZYVA 3QEOA 3K72B 2I1WA 4F6CA 4J03A 5BORA 1H3FA 4ND1A 2MSDB 3L6OO 4W1RA 2YWGA 3ZU2A 3UG6A 3G0OA 3GX1A 1DXHA 2PVPA 4ILEA 4EJFA 4Z51A 2PBRA 2F1JA 3Q7IA 3EEBA 4XJSA 1GA6A 5EIBC 4GUDA 1ZX1A 4E1VA 4DPMA 2VTEA 4IJKA 3SVZA 4K0KB 1QYDA 1GZ7A 2WNSA 1AZTA 2G9RA 3OFSA 3P96A 4A8JC 2MINA 5CVVA 5KNCD 3DDUA 5GOZA 4EUEA 4NJMB 3QWAA 4RL4A 1K9SA 4IQ4A 1KEZA 2GK3A 4BX8A 1TVKB 1YU6A 1ILEA 2BEWA 3PJRA 3UWSA 2F1HA 2OCDA 1NFFA 2CNBA 3AY6A 4G65A 4NYMQ 3ZLUA 2BEUA 4YY3B 2HDWA 2RI1A 3VPAA 2GRUA 1RHMA 1U02A 1T3TA 3PEUA 1UM8A 3QY0A 4US0R 1Z29A 3L4SO 5BRAA 3MFQA 2VSXA 3L6EA 4YRJA 1EVIA 5LOVB 2QGNA 4NJEB 3PBKA 5AW8A 1X9GA 2HGSA 3AVOA 4FFNA 3V8RA 1CP2A 1AS0A 1OLOA 3RVPA 2QRVB 2BTQB 1QIKA 2AD5A 4ZA2A 4IUDS 2AYZA 2FWBA 1OXBB 1CFJA 3U3OA 3C5HA 4FHGA 3RS3A 2WWYA 2AXEA 3OM8A 3RYFA 3QNMA 4UTXA 2P2ZA 2PLFA 1ESNA 1KRHA 1UL1X 2AUMA 2CXRA 1XAHA 2C2GA 2PUTA 3P4XA 3R6GA 1YC2A 4DDHA 5HRCA 3O8DA 1RXCA 3D1VA 3JVUA 3CUWA 4IDEA 3GOQA 2O2EA 4WKPA 3X1WA 5HUJA 5JARA 3WBJA 1GQRA 4BX3A 2CHFA 4HDRB 3EPRA 2O14A 2E1PA 1LQUA 1YZLA 3PGLA 2YW9A 4RCZA 3ZHVA 3R7SA 1G1AA 2HMWA 3I72A 2PUAA 2HA3A 4NYMR 2VOJA 5CFNA 1W4LA 4EJ6A 2A59A 3T9BA 1XEXB 1N2JA 1ATZA 1P4AA 1LLFA 3L05A 3KJNA 3PPWA 3DEAA 2DWPA 2IHKA 3N6VA 2NZJA 1UZAA 1TVKA 1ZNQO 3HMKA 2H1SA 2VP3A 3REFA 4Z4GA 5HIIA 1R4NA 1PL7A 3OURA 5A7GA 3UGJA 4KK4A 1MAUA 3VU0A 4KTVE 1JKMA 4P22A 3GDGA 3L7JA 4UBOA 2YQ5A 3F5DA 3KJIA 4RDCA 5C34B 1S4MA 3MJHA 1FNMA 2CK3D 4XIJA 3CUEF 4H1VA 2EARA 1W6UA 2G70A 1M8JA 3A6JA 5L7WA 3S44A 1F6DA 3G0DA 1SHKA 1Q1GA 3OOEA 3Q2IA 1XXLA 3QOYA 4PC7A 5F7JA 5BSWA 3FIUA 5AOCA 2VSOA 2ZWIA 1KI7A 4UZSA 1TKBA 3H8JA 4I6GA 4X6YA 2HTFA 4TROA 4UNSA 1JDUA 1X39A 1YS9A 1G8GA 3EPKA 2Q46A 3G7UA 1UXIA 2H4ZA 2AZMA 4C2AA 3AI1A 4KAAA 3QKIA 3FUUA 2DTDA 3L8MA 3IOMA 4MCHA 3NGLA 2YQZA 2BV3A 1THZA 3FDZB 3FSEA 4UQPA 4Q1CA 3O2NA 2PIAA 3RF7A 2J0QA 4EHJA 1RKBA 3SLGA 3UPDA 3VR6H 3LW8A 5HF5A 4BUJA 2REXB 5T4BA 4EFNA 1HNZB 2NU9A 3OJ0A 4RJTA 1GP2A 2I7TA 4Z8XA 4EGAA 2WD7A 4LV5B 3NAZA 2XA1A 4RSGA 1U2TA 2GBLA 2O5RA 3K6RA 1QKKA 4MB0A 2V7TA 3GH1A 3ZWYA 2QVBA 4D3SA 1RJ9B 1OROA 3EZGA 3KWFA 4Z2AA 4FLFA 4DSOA 1XMIA 3PCRB 1G0OA 4LE1A 3M4NA 2NT3A 2QVGA 2TECE 3F7TA 2GTPA 2YYSA 3G1WA 1RVV1 2ECQA 2H7CA 2QLTA 4HBGA 4NE7A 5AVKA 4JLOA 3VTFA 5MN6A 1DRVA 1HE8B 5KSZA 3F6CA 1IXZA 1RXWA 2VQSA 1A9QA 2GZMA 3I04A 1NVVQ 5B6JA 1H3EA 3HCBA 5KI6A 2CV1A 4C88A 1EUDA 5COBA 4FBGA 3O3MB 3A3NA 3EQ7A 4EG7A 1V2HE 4R51A 4HYYA 2EOAA 3TW6A 2NSHA 4NOLA 2ZBPA 3DEIA 3IKTA 4RD2A 4MUBA 1G8YA 2J8ZA 3LQ4A 1XZLA 4YQFA 1OH7A 3FTEA 1M2EA 1JEQA 2EKDA 2IYFA 1R5BA 1T4GA 2AFIA 3CPSA 2IPMA 2ZRKA 3WL8A 4UTPA 4PCUA 3U40A 2CB0A 4LHSA 3KHKA 4LOKA 2AG1A 4R0NA 4ZQCB 4AMGA 1Z82A 2PL3A 3PF8A 3EGCA 1N78A 4E5NA 1E4OA 4LQDA 3W5IA 2FWRA 2Y27A 4CW7A 3QLTA 1VJ0A 3W1WA 4N0MA 1R6UA 3TQQA 4UTVA 4HDQB 4RMJA 2IYZA 2Q9CA 1P5HA 3M5DA 3SC2B 4EF6A 1I1QB 5DWDA 1C0EA 1AC5A 1FBTA 2H1LA 2VBFA 1JAYA 3CR7A 1FX0B 3EC7A 2VNIA 4HDNA 4KZPA 221PA 4X84A 4CLRB 4DLBA 4L4SA 1FYFA 3IDSA 4W82A 2V65A 5HM8A 2VNSA 4AXBA 2G7ZA 1SAYA 4WKBA 3ROZA 1CF9A 1VTKA 2ZDHA 4KH0A 4ZEWA 2EFEB 1QWSA 1DTSA 3EZFA 3SS8A 2EQAA 2WBLC 4A1OA 3UUFA 3IHTA 1PNTA 2R1VB 4EHDA 2QTZA 2YWJA 4ZKEA 3ZLVA 2EFDB 2G9ZA 5E6UB 1G4HA 3DP9A 1A5BB 1FRZA 2NPOA 3M6LA 4CQJA 3QLUC 1OZFA 2ABWA 8ATCA 3AEUA 4CUJA 1QV7A 2OO7A 1X13A 3CC8A 1OAAA 3GU3A 3QIVA 1HH4A 3BMOB 3HUFA 1GU1A 5J2UA 3A3OA 3KO8A 3OIGA 4D9HA 1FXSA 3ADPA 1J20A 2EZUA 3IMFA 3PIRA 4ZO6A 1IBMB 4XWTA 4B40A 3S1SA 4TUYA 3CBQA 2NZ8A 4OSPA 3ULKA 2GYUA 2DQZA 4WFQA 2ZRMA 4XDYA 5JSHA 2B5VA 2W8BB 5LC1A 3LLSA 1KI3A 4GZLA 4KEAA 3SQWA 1YCGA 4IEEA 1DB3A 3HWWA 4KI0A 5C81A 2PSJA 2XJ9A 2LKDA 3A25A 1CUEA 2VLIA 3EBLA 1DAPA 1FDSA 3TRIA 2IELA 2QE7D 4CKYA 4EG3A 4LNUB 4MQEA 5H7XA 3OEWA 4FBMA 2FMTA 2AB0A 1KDVA 1JHMA 4FMCB 1OLSB 2DE0X 4LDQA 3DG9A 1IBKB 4E09A 3Q8XB 2AI2A 4WZBE 4DXHA 2ZVJA 3BWEA 2LNDA 3VH1A 3F73A 3QPUA 4IL5A 3VHXA 4URZR 4LNAA 4F86A 1T1EA 4PGFA 4WK2B 4LV6A 5DP1A 1NE2A 1IL0A 2RH5A 1N0HA 2BKAA 2R60A 2X0RA 2FTKE 2ZWVA 4FT2A 5FQOA 3ZCXA 1VHWA 4M53A 3ZK9A 2QTRA 1P75A 3BGOS 3RWMB 1J2RA 2VQ3A 4X6XA 5G40A 1CQXA 1PR6A 1E7RA 3QFTA 1SOMA 1QDEA 1H2HA 2XIJA 3WQSB 3WV4A 1ZD8A 5A4KA 2R44A 2Y1XA 3TB4A 4V02A 3BWVA 1PHRA 1ZOPA 4M3NA 3UBTA 3AYXB 5IVIA 5C8YB 3VZDA 3RS0A 2GN0A 1Z28A 2B37A 2ZYRA 2VTBB 4PLYA 4FIZA 3U3JA 4IIBA 4S3MA 4NCBA 1N6RA 3GVIA 5E2BA 3M5PA 5JJ5A 2NUAB 3SQNA 2I6FA 2W00A 2BF4A 1MX5A 2AOTB 3AFIA 3G2QA 3LNTA 4TYNA 3ER9A 1X7YA 5D87A 4L0CA 1XZGA 1TD1A 1TIBA 3TPCA 4OX9Y 1E2BA 2X9NA 3A1WA 2R87A 3IP9A 5GP1A 4PSAA 1U0EA 1VSUA 3RAEC 3E9ZA 5FHQA 1T5OA 2O2ZA 1H94A 3W8EA 5JZSA 1E1DA 4WFIA 2F3SA 1V16A 1MMFB 2D7DA 2HKIA 2IZ6A 4FW8A 3TCXB 5IZ4A 2VBCA 2FFQA 2VAXA 4KE8A 1B76A 4LBWA 3UATA 1VHJA 5KWVA 2VJAA 4J3JA 1I80A 1R64A 1NFRA 2OBNA 3L7BA 1FDOA 4FR2A 4ID9A 2JG3A 2VDQB 5TPWB 3AG6A 3PD7A 3TQFA 2G6TA 2IC5A 5HOQA 5JZMA 3CM0A 1DRKA 5TMBA 1XRRA 1V8ZA 4LZWA 1XZQA 2GCNA 5TS2A 3RSZA 1TK2A 4QLAA 4C21A 5JHHB 2HXGA 3NKLA 1J8FA 3CLHA 4JVLA 1I6LA 2X0KA 4XAQA 3D8BA 5BOSA 1N34B 1KSJA 3TS1A 1IE3A 3PLNA 4AF6A 1I7QB 3PL5A 1ORHA 1LJUA 1FDVA 1V2GA 4Y1GA 1YBFA 4EA9A 4AT1A 3FHCB 2C5AA 1BQEA 2D1RA 3L8ZA 2V45A 3AUYA 3CURA 5AJVB 3CNHA 5TQJA 3PZBA 4Y1FA 3A2NA 4BNYA 4HYEA 4DABA 1WB9A 2NTEA 1O97C 2R6DA 4ZZ1A 1BCRB 4P6VF 3O1HB 2VCYA 1XTVA 3T1YB 2F8MA 1SXJC 2YDYA 3NUQA 1JHOA 4P80A 1W85A 2NW6A 1MN6A 1YR1A 3UK6A 3VC3A 2P4SA 2GO7A 3E2PA 2FKNA 4MLZA 4UBMA 2BP7B 1Y48E 1EM8A 3DFZA 4C7OB 5BV1A 3Q85A 5LU8A 3NCHA 3KCQA 4NFHA 4B43A 3E7FA 2H2DA 3HKDB 2QXTA 3F5MA 1ZH4A 4JJZA 1A8HA 2VP2A 2VR1A 2GEUA 3DCNA 4FNMA 3V32A 4D02A 1OLXA 1UK6A 2HPVA 5IUNC 4QU0A 1R3DA 5AVVA 1OREA 4MDYA 2RGNA 2ORWA 3K53A 3O92A 4GKBA 1EWTA 1L5ZA 2BZ1A 1EI9A 4CM9A 1I0IA 3C6YA 2CVOA 1S5PA 3QXCA 2IXGA 1S1MA 3K0CA 4RSHA 3LFHA 3BERA 2NZUG 5TVGA 1E1RD 4H0FA 1JH9A 3H84A 4WCDA 4CM7A 1X7YB 3T7RA 1NN3A 2HA4A 3MVEA 5ALMA 4EY3A 1EUCB 3EGXA 3N9IA 1LLUA 4Z5XA 3HB7A 1X70A 5ITZA 5FXMA 1SXQA 4KSYA 5EP3A 3KALA 3QFFA 4MPJA 1XROA 1MAWA 1R0ZA 4K2HA 1RAGA 4L5AA 3P9QA 1M76A 2F3PA 2MWMA 4CCYB 5H3LA 2Q1YA 1QG6A 5IYZA 2Q3HA 3DE1X 3GPLA 3OT1B 3ZHCA 1E5LA 2JAXA 1TMGE 2G9UA 2O2HA 3BE5A 2XB2A 1CJUC 2X14A 4JVOA 1DKOA 2VJYA 5JCXA 3FF4A 1N9ZA 1T5HX 1RPNA 1SUBA 4EB8A 1OFHA 2PD3A 1NN5A 2O57A 4RJJA 5JD5A 3D8HA 2A7XA 1ZR4A 1MG0A 2C92A 3UWDA 3PP8A 1HT3A 2FR1A 4YDSA 2VDUE 5AI6A 1D9ZA 1CS0A 1QCZA 2PX2A 3GFRA 3QWIA 1GG2A 5THQA 4KNYA 3JASA 3NEPX 1RDFA 2JEOA 4M49A 4EHLA 3I5XA 2DPXA 3AVQA 1QRUA 2O4UX 3LX6A 2PL9A 1FX0A 4H7DA 4C0BA 5F23A 3TNDA 4G0OA 4FDMA 2GHTA 3F6EX 1VIMA 2P9EA 4NPHA 3NHLA 3ZVMA 3AI3A 4AAYA 4RSMA 4KHPB 4BEJA 3C0KA 2CSXA 2H11A 5TDHA 5CYGA 5ALHA 2XMCA 4KCGA 1WSBA 1KEEB 3GUCA 4Q9AA 4Y3UA 4CFZA 3MJEA 1E2LA 3RKSA 1UMCB 1UAYA 4CHGA 4P98A 1PYDA 2FK7A 3D8NA 4I50B 4D0SA 1VMAA 1NRWA 2DKNA 1FMLA 2AZDA 3PDUA 4FSHA 1V8OA 3CE6A 1BVRA 1PP4A 3H0EA 4JAVC 5IAAA 3GBSA 1UK8A 4KGXA 1R00A 2FMIA 3K9NA 1CUAA 1IEVA 1T2FA 2H59A 5J3JA 4J16C 3RHSA 2HH9A 1Z2PX 4PAOA 2Z6UA 1F0PA 4GL4A 3I28A 3QE4A 3EQZA 1PJRA 1RHQA 1T0IA 2I4RA 5EXTA 5JFOA 2EKQA 2HZBA 5K0GA 5A9SB 3HI4A 3OCZA 4O0LA 4RD1A 4U6QA 1KVSA 1CNFA 1TJ4A 3I30X 2O8FA 2C83A 3VI3B 2YY6A 1IQPA 1D2NA 3AFGA 1T13A 1K7EB 2VH1A 3KTAA 4O2LA 4UU1A 4JUBA 1ONPA 4JGBA 2IUYA 3KWJA 5CNIA 4ZVVA 3W06A 3AVUA 1RPAA 3UWOA 1W49A 1KO7A 1I33A 1EG7A 1VIVA 5JROA 1MQ9A 4TMKA 3H86A 2NXWA 3P19A 4GW3A 1FPMA 5HF9A 3CXUA 2ZWMA 1FVXA 1KJZA 2H2AA 3OE5A 5DYTA 1ZNYA 1PD1A 3BB4A 2RAVA 4YJHB 1RWKA 4OV6B 1JV2B 1YT5A 1J07A 5DT2A 1KEEA 1K7FB 2I4LA 2P0EA 3FYUC 1ZCFA 2EYUA 1T5IA 2OCPA 2CYBA 4LK3A 4DYDA 5KUTA 2CXNA 4KX3A 4W5RA 3T4UA 2ZGVA 1PQWA 1WDMA 1C9MA 1C8VB 1J33A 1QX3A 2V7UA 1EX6A 1ZKMA 1PFVA 2E6UX 4IM7A 1HOXA 1Z6ZA 3H05A 1JE1A 4RHXA 5D1NA 3GA7A 3MERA 1ZM4A 6ADHA 2AQKA 2NSYA 2IHUA 1MV8A 1Q15A 1SCJA 2LD4A 2XHZA 3HA5A 1XZFA 2WF6A 1ZGAA 2D2FA 3OO0A 2VNKA 4EW3A 4E12A 5CEJA 1FJGB 3AVWA 3ZE2B 3EDYA 1P60A 3GJ5A 2PWZA 3SN6A 4BFVA 2REQB 3CPJB 4LDNA 1DWOA 3SBEA 1CERA 3IALA 2Y1KA 4W5QA 3UGQA 3QVSA 3PFIA 1EGHA 5FO1A 3BZBA 3LH5A 4OF4A 5A9SA 3QVOA 4QECA 2K87A 2Z08A 4WVFA 1SVNA 2UU9B 3QRWA 1ZHOA 2VEDA 4TL7A 4B6FA 3AEQA 2N1MA 1GKUB 4RLHA 5TF0A 1X9IA 4YUAA 3OSUA 2OB1A 1HL3A 1TIKA 1KMIY 1MFPA 3IERA 3TKLA 1KYXA 2HA2A 3QVLA 3TJMA 1UR5A 2VJMA 3L41A 2XCSB 3TN7A 1Z3CA 3ROGA 1E9EA 2GJ9A 3WQBA 4QNMA 3SXUA 5GONF 4M1MA 4KLAA 1XQ1A 2NZYA 4P58A 4Q9LA 1Z22A 4BGEA 1KJ9A 2B7LA 2J85A 4GE3A 2EFGA 4AWXA 4ETNA 3GP3A 1R10A 4TWZA 2XCLA 5ALXA 3U7QB 1PHPA 1I4LD 4A0HA 2IEYA 1I2AA 3CEPB 4JZKA 1WEKA 2OUIA 3P9YA 2BFBA 2VSYA 3F78A 3IP3A 3RVSA 4MQ5A 4OUDA 1J5EB 2VJOA 4PU0A 2VBIA 4BQSA 1ZGHA 2EJUA 4MKGA 3TRKA 1NZDA 1AS2A 2Y6VA 2KBEA 1A3CA 4KITB 4MCJA 3LCMA 1VSQA 1C41A 2O54A 4B2YA 1HQYE 4DUYB 3CH7A 2ON6A 3Q5EA 1FBNA 3Q40A 3RT9A 5JO0A 4QU9A 3PHIA 3H2BA 2C57A 3FBGA 1G5HA 1NPTO 2NO0A 2WU4A 1IN5A 2F9FA 3QSGA 2ZIGA 3I4FA 4MEBA 4PPNA 2HFKA 1NQXA 3INNA 5AK6A 1UBHS 4PG7A 3ETLA 4FC6A 4WD3A 2FOXA 4YJ2A 3ADBA 2VK1A 4EZIA 1CNEA 3A1CA 4GEKA 3PC2A 1U1CA 4F8JA 1ZHFA 3QYPA 2BHLA 1MO3A 2PX4A 1Z33A 2FUCA 1P1HA 1MGOA 4TTPA 1Y6QA 1W87A 4B3RB 5ARDA 1LBEA 4JI3B 4RL6A 1DZIA 1D4OA 5EEGA 4U1RA 2Q3FA 4PAMA 4FHFA 3RPEA 4TMVA 2RKBA 4GM0A 4N8DA 4D6XA 4NG5A 4QLBA 5I7VA 3AUUA 3EZXA 3IAM1 2IQ5A 4CF5A 5IKXA 2C4NA 2X41A 3MCUA 4RKRA 1MAAA 5JH7A 2R5FA 2DC1A 4PFKA 4NHEA 4RXUA 5L4LA 4JUAA 5JZBA 3T54A 1Q1ZA 2H1RA 3ZZTA 2PE5A 4RK7A 2R6GA 4F9GA 4O63O 1I4TD 1D2RA 4BBAA 2YWRA 3NG1A 4NE2A 2OMEA 1XNRB 1KI4A 2CLKB 3U3MA 3JWJA 4F3YA 4C87A 2P7IA 2CLEB 2V03A 1JA1A 2GD6A 1EWKA 3D6VA 5EJFA 1UBSB 1NOJA 2G28A 3SXJA 5BV2P 5C8YA 4EENA 3THWA 4XCXA 1OTYA 2QUKA 3IBFA 4WEQA 4WL0A 4C03A 3THXA 2FEMA 1E4YA 2WG1A 4RIGA 4U3JA 4A23A 1CUGA 1K6EA 5D3KA 2Z4RA 1DAKA 4NLLA 3A28A 1GAJA 2WJ3A 3NS7A 4JLPA 4AECA 1I14A 2J9FB 3IELA 2OILA 1KZHA 1Y33E 1SC4A 2YV5A 4NFYA 1XYGA 1YFKA 2ZR7A 4G37A 3MD9A 1GG9A 2C94A 4OMCA 4TVBA 3LPLA 4UNNA 3GFFA 5TPWA 3VHXB 3LC7O 3M4XA 1MIHA 3VO1A 4EJSA 4XM0A 2R00C 3EY9A 5KDLA 1Z9BA 1UC4B 4QYIA 1F2UA 2QRGA 4EPYA 3GROA 2W37A 4HS4A 2AFRA 4PNZA 3MUEA 3SSMA 3JRNA 4TSKA 2ZAGA 1Z68A 2POQX 3KYJB 3SC4A 4EYSA 5BWMA 2A86A 5BO5A 2ZIEA 4AMVA 1DJOA 2E4AA 4QJBA 1B6SA 1T36B 1V5WA 3IQFA 4M86A 3UC5A 5G0UA 3RH0A 5JALA 1A5TA 1SQ0A 2W43A 2XUAA 3DZJA 2FPUA 3F2IA 4HN9A 4MJLA 4TRNA 3RM3A 3O5AA 4AS2A 3FDXA 2I3DA 4TV8F 1NNI1 1G3RA 2P1ZA 4B71A 4DLAA 3ITKA 1NVFA 3CLSC 4L5CA 1ZOOA 3IVCA 5FBRB 3FGNA 3IPAA 4QVGA 4DHEA 1DJQA 4NZYA 1DFGA 3DNFA 1N3BA 2A0XA 3BMCB 5EZYF 4F9EA 4URYR 1IY8A 1GQQA 2V7XA 4G5SA 3AIOA 4D41A 2P3SA 1C9KA 2CXOA 2HF2A 1K0FA 5BQXA 3PFFA 4K9KA 1O9GA 3D6HA 5DM70 1UWVA 2QOEA 4ODIA 4BWYA 4EPRA 2LUOA 3P7MA 1C30B 1O58A 2Q3JA 3RYIA 3FW1A 4JWTA 4Z4FA 1SOVA 4EY7A 2R5NA 3CZ4A 4GGOA 4U2CA 1P9RA 4E6EA 1TK9A 1XA3A 4NMXB 3ZUPA 1BHJA 2DT8A 4OP3A 1DCKA 2DH6A 4LC9A 4YK7A 5AQEA 4MX8A 2EX1A 1ISIA 2EKLA 4OREX 3UAXA 1KYIA 4DB4A 1I94B 2C8JA 2JVKA 4MJ7A 1CUYA 1U7WA 1PGPA 3MIIA 4I9GA 5ALDA 1P0IA 5B58C 1TTTA 1W36B 4X6LA 1DKPA 1MEEA 2BUBA 3ENWA 4P34A 4E30A 4U7DA 4JZYA 4HPJB 4JY7A 1WPRA 4K6CA 1SKYE 4Y6PA 2BTOA 4KNVA 4NFLA 2B8NA 3O8OB 5DZSA 1JB1A 5DW0A 4LGYA 1MRSA 2ZAYA 4KBFA 3TE7A 4NRDA 2C03A 1RLTA 3PXUA 3HKEB 5DNDA 4WCFA 2AS0A 2OAGA 4NMMA 4CM6A 1V4BA 5I5EA 3KQNA 4KFRA 5DNUA 1G5FA 3H1EA 1TA0A 5FWAA 3IEXA 3KJFA 3OVMA 2Z3WA 5AFSA 3LYLA 1VBMA 5CBKA 3L1VA 3CEMA 1EX1A 1CF2O 2Q2OA 2ZSFA 3H8SA 2O2CA 4JVNA 1YKGA 3U9LA 2IOHA 2J09A 3B3FA 3EQ6A 5IDYA 2Q2VA 2RCNA 4HUTA 1LBTA 3DL7A 4HDNB 1JL3A 3HFJA 2O0KA 4ZI7F 1QAMA 1E4VA 1R5OA 5K0SA 2XYRA 3FRHA 4GT1A 4OFZA 4NCHA 5FUYA 3ZE7A 4A7PA 1S8OA 2I6GA 2HI0A 4WOCA 1GAXA 5HMMA 4QPZA 1IUKA 4IXDA 1NXQA 3W7AA 5HXAA 4E46A 2PSSA 3BRSA 4V39A 1FTSA 3EBPA 3SU8A 4B79A 1OMOA 4F60A 4PVDA 1GV0A 5CGZA 1Y5RA 1KWGA 1JEQB 2WJVA 3V33A 4MVJA 1GCOA 4E3WA 5C7IO 3NHBA 3DBRA 5THXA 2PA0A 3OFJA 4JJFA 4AKTA 2XMQA 2OHOA 3CH6A 1RPZA 4L28A 2AI1A 2QTMA 4Q01A 1L4GA 1ZSVA 4RMGA 4G67A 5ALKA 3J81A 3BMXA 3ENVA 1GTRA 2ZKLA 3DEZA 1O87A 3FPBA 3GJQA 3QG5A 4S1TA 1QS0B 1NW7A 4E5MA 2CBZA 1L7RA 4MGYR 4P92A 2HY7A 3DCYA 5KNBH 1LY1A 4TXMA 3U7EB 4UTNA 4Y1RB 4IIUA 3DVAA 1E62A 2Z0MA 2GVZC 4JX9A 4ER3A 1Z5GA 1YL5A 3LECA 2JK1A 1R4MA 2LXNA 4YLYA 1A2KC 4U00A 1RQNA 5DXFA 4UVGA 3I12A 4F3RA 3W5DA 2F8SA 1S2MA 1R9MA 1VL2A 3DT8A 1N57A 1DLIA 3MT9A 1QRSA 3RUFA 3WJ1A 1OB2A 5FOQA 4JEUA 3ICVA 1MTZA 1CZLA 3HUEA 5LQUA 2BEVB 3U56A 5LNK1 3GD5A 2FPLA 4FYJA 2O8CA 1NA5A 2AG6A 1BROA 3VR3D 4ALLA 1FDRA 4Q7QA 5FPKA 2QN2A 3PE4A 4AKGA 1IB0A 4I99A 2D2IA 4QYSA 4EYQA 4KQ2A 4BNUA 2UUAB 2PPLA 1YB1A 1KK3A 3W90A 2VHJA 1G8HA 4DCPA 1JXAA 4E11A 2Q9BA 1DIAA 3FSJX 3S70A 4ND4A 2ODPA 4JB8A 3P4UA 3QVKA 2IYWA 4FMCF 5AUQA 4JHXA 4RZIA 4KHZA 4FWIB 4HLQB 3T1QA 3LVBA 2QVYX 1WHTA 3UGTA 5JY1A 2ZB8A 1DV2A 2EW8A 1EB8A 1LZKA 2GKOA 2H6EA 2IYXA 4RF5A 4ZYTA 5BNZA 1D0IA 3SXUB 1I36A 1OI3A 3IXMA 4J1NA 4BKMA 5B4TA 13PKA 4YMLA 5K7SA 1P9WA 5WRFA 1BJKA 3EASA 4YPVA 1XEXA 2FWNA 2ZXFA 3CX8A 4IO0A 4L57A 1WCIA 1I6WA 1BGVA 1JAHA 3MLAA 2WNIA 3E22B 4RD6A 1JLLA 4A8HA 2BMAA 1O3YA 3FVRA 2A9PA 5HKBA 3K09A 2UUOA 3NU1A 5JS6A 2AR9A 4YJ2B 1E7QA 4WFKA 5IBRA 3VH4A 2OXTA 1ISJA 1Y98A 4B47A 7AT1A 1H4VB 3G1UA 4UM9D 4LOIA 3RUCA 4CV1A 3H83A 3PUXA 3T35A 1G21E 4X7MA 2O6LA 3E48A 1U6IA 3GP5A 4N41A 3KQKA 3OJOA 3B9BA 3JARB 1W8DA 4MYCA 2WA2A 4V0MA 3CB4A 2GBLC 2BTEA 3MILA 1OXVA 3A06A 1I7LA 1KYTA 4BLWA 4BO2A 2A35A 4B0PA 1J00A 1T9GR 1PFGA 4IFTA 1UJMA 1DV1A 3A8TA 2AHOA 4JXJA 3T5BA 2AEJA 3ZIUA 1XN4A 1EQUA 3WHPA 4F97A 1G5QA 2H54A 1XL0A 3N2NA 4XI9A 1WSAA 3TLGA 3RRFA 3FROA 1IZ8A 3KQVA 1Y37A 3HBJA 4EMSA 2JS7A 4BFZA 1L8AA 2IT1A 4QFCA 3REOA 4BRUA 2GN1A 1YK1A 3V4FA 1T24A 2GM9A 3EDRA 1C9YA 5F2KA 5G0SA 4BIMA 4ZKDA 3L04A 4G1FA 3CRQA 3OETA 1H1LB 4J3FA 4TQAA 4WXEA 1JR3D 2OHVA 3LLVA 2VKQA 4OHZA 1K6IA 3SEAA 5BWOA 1AV6A 2YWFA 3P2OA 1JHYA 4PQFA 3TWOA 1JPVA 2IX9A 1NF2A 2C2YA 3W5CA 1T9HA 1IRXA 3HNRA 1IULA 1NHGA 1YZFA 2PNFA 4ZCRA 5KNBA 1P3JA 1UBOS 2O05A 2W2MA 5AUNB 3VR2D 2C2MA 4MI1A 1W96A 1YS7A 3LOQA 1NBWB 4QXRA 1OQAA 5T67A 2WTAA 3KLPX 3B38A 3JQAB 4Q1FA 4QICA 4DQKA 4BY9E 1O6CA 2GETA 3AKYA 1UPTA 5HE8A 2HK6A 1NL3A 2WJWA 3D0OA 1RZRD 4ZDWA 3AM3A 4B31A 3D6FA 3M2TA 3C7AA 1BXGB 1Z74A 2M6SA 3COYA 3W7VA 1PT6A 2WYOA 2HUPA 2F59A 1TUEA 2E5FA 4B4DA 4BUZA 1OLUB 2IOYA 3U26A 1I3OA 4NJOA 3G2OA 1UAGA 2ADOA 2HCJB 4BZXA 1NHWA 2XLBA 4I50A 5HW0A 2Z6VA 3ZI7A 3LLCA 3U1BA 4LXYA 2JKZA 1F48A 3DDCA 5M2QA 2Z30A 1N3LA 1XDDA 1XWWA 2GI4A 3HJCA 1KDZA 1RJGA 3T9AA 4LJ7A 3V42A 3ZVLA 2GNPA 4URVR 5IABA 2XUKA 3PGKA 1M6EX 4R3WA 2DPHA 4V3CA 4UTZA 4W7IA 5EIWA 3R9XA 5K09A 2A84A 2AQIA 5KQGA 1U04A 4UCFA 1T35A 2R6FA 1DELA 5KTTA 1Y1RA 2JD1A 1WQ3A 4LMAA 3TQTA 4DILA 3T3OA 4D3YA 1ZH0A 2F3UA