5CFPA

Crystal structure of anemone sting (nematostella vectensis) 'humanized' f276k in complex with 3', 3' c-di-gmp, c[g(3', 5')pg(3', 5')p]'
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
181
structure length
181
Chain Sequence
b'KNVADGLAWSYYFGYLKFVLPELEKQIEKTSKFRSKEKFVKKMFILIPSNCFWDDKIPGSDYDPQNRITFEGNTEPLEKTRGGVKLRHYKHSVYEIKDGENEPWFCIMEYATPLLTLYDMSVAQPGELSREERDAQVVVFLRKLQDILEGDRACQGKYELVTFSPDRDLADVMLRKLKDSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Stimulator of Interferon Genes
publication title Ancient Origin of cGAS-STING Reveals Mechanism of Universal 2',3' cGAMP Signaling.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Immune system
total genus 51
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cfpA02
5CFNA 4F9GA 4JC5A 4YP1A 4KC0A 4KSYA 4F5YA 4LOKA 5CFMA 4QXOA 4EF4A 4EMTA 5CFPA 4KBYA 4EF5A 4QXRA 4F9EA 5CFQA 5CFLA 4LOJA 4F5WA 4QXQA 4LOLA 4F5EA 4LOIA 5BQXA 5CFRA 4QXPA 4F5DA 4LOHA 5CFOA 4EMUA
chains in the Genus database with same CATH superfamily
2RH5A 3WLQA 2QVCA 2VDJA 3I5AA 3RF7A 1DOAA 2P6UA 3TOZA 3BXZA 1R12A 1ZA2A 3GCXA 3ICWA 3M9XA 1YKGA 3SSMA 1V16A 2F8SA 2RGNA 2X1LA 3IAM1 1EVYA 1ZONA 3B51X 3DKRA 1VI5A 2B8TA 1W85B 3EG5A 4OREX 4QEKA 3ROMA 3UWPA 5IG2A 3AVTA 2JIRA 1U8ZA 3JQGA 4YJFB 1SB8A 2HZ7A 1H8HD 1XTVA 4J0CA 3QVGA 1ILEA 3PJRA 2HCBA 1KMCA 2WIAA 2YWGA 3FPGA 1F4VA 4KQEA 2YKGA 1EINA 4RGVA 4WOPA 2FUKA 3S8EA 2P2NA 1JSLA 2YASA 4FXOA 3UMMA 4QPDA 5BXQC 5BVGA 3MZ0A 2X0IA 1UQRA 1A9RA 2RG7A 2XUZA 3QWAA 1H23A 4IGIA 5AVRA 2ZYGA 2C97A 3BIFA 3DCJA 2DWUA 1KC3A 2NO4A 1MHPA 3FGNA 4PHHA 4QGBA 4RHYA 3NG1A 2B69A 2GK7A 3QM1A 4RM3A 1RCFA 1SIUA 1YQEA 1AX9A 1G7CA 4J9UE 2JJQA 2FMKA 1P80A 1U2GC 1U7PA 1WMAA 3V2IA 3IVCA 1UP4A 3BORA 2QQGA 4BJHB 2JBWA 2D7CA 1F0KA 3WOVA 1TFRA 3JQ7A 3S27A 5DTEA 1A96A 1A04A 2TMKA 1W59A 4NVRA 2JH3A 1OBFO 3EGEA 3P7MA 5AVUA 1CQJB 1PL0A 2Z30A 1K4KA 3H1GA 4FWIB 1UZAA 4IH4A 1HNZB 2B5OA 5G4KB 3RSGA 2XA1A 3IV7A 2F8MA 2C8JA 3NH9A 4UUNA 2ECQA 2AFHA 2RGEA 4BMDA 3ROGA 4YIKA 4YV1A 3H9BA 3G2IA 1MNAA 2GYWA 4U3JB 4KYTA 1YB5A 1B00A 3E4DA 4J1TA 3RCBA 3F74A 5D51S 2Y1LA 2QUJA 3LY7A 3SXPA 1PZGA 1C1DB 1O97C 4QDTA 2BUAA 2C3OA 5JH7F 4IAOA 1ORDA 1T34A 4HXYA 2MT9A 3K7EA 3OT5A 4F9EA 1QGOA 3OJOA 4I0WB 3IJEB 2KHZA 4GMKA 3R6LA 2QVYX 1E6EA 4LSWA 4X7BA 4A6XA 3RUCA 4BNIA 4DUGD 3TEMA 4XE5A 3U31A 2HPZA 2LDBA 4UARA 2JD2A 4CF5A 2QS9A 2BR3A 1IZ8A 2BE7A 1OYOA 1CFZA 2WJYA 3VDRA 1ZFNA 5D84A 2W2NA 1YZ3A 1W4LA 1AT1A 1QTIA 1S02A 1TK2A 2GPWA 2V7TA 2HU7A 3BQ9A 3X0DA 5GINE 1WETA 4WESB 5CTJA 4RTNA 5AVJA 4TMFA 1YR6A 2WYUA 4Z0TA 1B8OA 1J7KA 3GFOA 1QPZA 2D4AA 1ZUIA 1VI2A 4OD0A 1PYGA 4P5EA 4CCYB 2VTBA 3FZGA 3DVRX 1OILA 2JDIA 3ZV3A 1J2RA 2AOVA 3X43A 1RU3A 2XY4A 1PCXA 1SQSA 1T36A 3DVSX 4YRDA 3TLCA 2KWIA 3CJRA 4OXXA 4E0BA 3BCRA 3BGOS 1ZOOA 3D8TA 3MA0A 5CEFA 4Y2GA 4MYUA 1TB4A 4EYOA 4N3NA 3ZHBA 5JAOA 2BGGA 4TYPA 1X6VA 2Z1NA 2BI8A 2WINI 5DLDA 5KTNA 5HE9A 4BP1A 1A8UA 1XMIA 4QYIA 5FA6A 2Z9BA 1UMCA 3L0DA 1E6CA 4YCMA 5I7VA 5IJWA 2BM8A 1JJAA 3QY0A 3OIWA 3KJIA 5B1EA 3L79A 3PWKA 3QP9A 4O0MA 1OTHA 1TM1E 3PDCA 2HDOA 4L3WA 2JKYA 2PS9A 4UQPA 1HFEL 2X13A 4JI4B 1ZK3A 2JAQA 5K8JB 1LRKA 1JJVA 4V1CA 5FORA 2IWHA 3T34A 1X3SA 3CUSA 4BFTA 3CM0A 4FNGA 2ZQZA 3KVVA 5IBCA 3V6LA 4F11A 5CD1A 4ND1A 1NNSA 2KPOA 5TSDA 4LJ8A 3RK1A 2IUTA 2ZBRA 2C1EA 3FHOA 1R18A 2ID4A 3LW8A 3QHPA 4NE7A 6GPBA 5DN6D 2KE5A 4YRBA 1USVA 5CHEA 3T3GA 3VO1A 4RABA 4TSRA 2I6SA 3UK7A 3SY8A 4R0NA 4ARZB 2CD9A 3EGWA 1DOHA 1ZIOA 4C43A 4CNBA 1QM5A 1Q20A 3QH4A 4BJ5A 4C6HA 3IE0A 2IV3A 5P8WA 3RAEC 3NPAA 5I4BA 4ZI7A 1EBFA 3PIIA 2X4IA 1U02A 5DFAA 1HRKA 1DAGA 2JLQA 2YXLA 3BWDD 4Q4JA 4UTRA 1GZUA 5K20A 1PT7A 2FFBA 2FMTA 4B6OA 2Q6VA 2IEIA 3RO7A 2NZXA 1UWKA 2I3DA 2OZPA 2WF8A 5ECGC 4TWZA 1W0JD 4ZVOA 2MINA 1YS7A 4Q47A 4FHEA 2BGNA 1H8HA 2FQYA 2J33A 3FE2A 3EZYA 3PFHA 3HUFA 3IQXA 4NCXA 1J97A 4WZBB 4B74A 5K0NA 4DV7B 1XXHA 1TYBE 3JQCA 3NIBA 1NVBA 3QA3E 1PTKA 4HRXA 4HVAA 4F4FA 3LK6A 4KXYA 2WSYB 8OHMA 1VSBA 2X1VA 4LYHA 3VZPA 3R0XA 5LXTB 3AL3A 1KVSA 3DEKA 2OG1A 3WB0A 1VXRA 5IWCA 1C7ZA 2WWIA 4IIGA 1LDNA 4N5NA 1VJGA 1ZZEA 4PFJA 4PR0A 4GMDA 3CR3C 5AXCA 4ZCIA 2Y0CA 2ZZKA 5BP7A 1BGWA 3DT6A 3PUWA 2ZITA 2AKEA 2H6EA 1Y82A 2CNOA 3OFJA 3WGKA 1R0XA 1UKYA 3WDKA 4AP6A 1XEWX 3UGTA 3WSVA 1KEPA 2PT7A 5ES4B 1IEWA 3AGQA 1C1HA 3EAGA 2C5HA 2OM2A 1V48A 4Z2YA 3PQ8A 4EX7A 2HCJB 3OLVA 2HYIC 2BV3A 2GLUA 3MIIA 1E8DA 3L1IA 3OOWA 3RUPA 4C4XA 4DLBA 4ERNA 5ICGA 1JHQA 4AJPA 2ZFUA 4N8DA 3TG2A 1YJAA 2XKJE 2B37A 3EEOA 4G4IA 4XIFA 4B3XA 1VHDA 1S3GA 1BAPA 1VE3A 4R1NA 5ITVA 1LSOA 1T0IA 3C3MA 1W34A 2BF4A 5GIPE 4D4MA 1IOVA 1Y5NA 2NP6A 4FNMA 3DEJA 4Z4IA 3PDJA 4AYTA 2W7TA 4NV3A 2X8LA 4RMHA 5CG2A 1N3BA 3MT9A 1HYQA 1TUEA 1ZK1A 2MYUA 2PO7A 4L9AA 4AECA 1I1QB 3DVLA 3DWIA 5A03A 2HZBA 2W2TA 2VPPA 1UPAA 2XOEA 4RKYA 1A9TA 4EG5A 2NZ2A 3PKZA 4CYMA 4RGQA 5BN5A 2GBCA 5KKNB 1HETA 1TQ2A 5INTA 4F72A 3NDPA 3WMFA 1EB9A 4NZPA 4GSKA 1X1CA 1O4WA 1WW3A 3WNBA 2YINC 1IAVA 3NOQA 5CDGA 2Q3HA 1ODIA 3HY3A 3R5TA 4HVTA 3W6OA 4DR7B 3H9CA 4G5GA 5HS4A 3N6XA 5UKDA 2HM7A 4FFOA 3ZD9A 2NNLD 1Y9JA 3ER6A 4JJEA 4YS6A 5BUSA 3LPCA 1VLMA 3QLEA 3RIGA 3HN7A 4YCCA 1M83A 4HQKA 3AK4A 5HKLA 1IUOA 2MIIA 5I3ZA 3NAMA 3P9QA 3GQVA 4UNQA 2D5IA 2G9VA 4X1YB 4X92A 1XTUA 2OY0A 5EMJA 4ZYWA 5DGIA 2BEUA 5AUNB 2EW1A 3ND9A 2QRNA 4JYBA 1L4HA 2JEZA 2KSQA 1H3FA 4OGLA 2ZYRA 2DQ4A 4QDXA 5AHXA 5BSTA 4AJEA 3C5CA 3UUGA 2RHWA 2WFMA 1D9ZA 2ZUWA 1FFAA 2FSSA 1KKUA 2FPRA 4M37A 1XK6A 1CR6A 4URUR 3T9EA 4CFSA 1J9EA 4OSOA 1P9LA 2ODTX 3QXJA 4RIHA 4EB3A 1DKRA 2XZTA 4DMRA 4JV5B 1BDHA 4YGYA 2LNDA 4GL2A 5EY5B 2VZ0A 4US1R 1RI2A 2V7BA 3F5MA 1WF3A 1JQEA 2NSLA 1RADA 1SGWA 4UZSA 2E2WA 4TL9A 1YNOA 3VDXA 4CRWB 2H1VA 1WXDA 4KWHA 3KFLA 3KYDA 3FTEA 4P54A 4Q4CA 2EJBA 1FQKA 3E5MA 2IBSA 1II8B 2G25A 5J2TF 2IDMA 1BRMA 2GWRA 1M1YA 3KVYA 5F7JA 4BV2A 5CB6A 3F49S 4NSNA 5COAA 1SR8A 2VBGA 4LX0A 5TMPA 3C3EA 1QP0A 1ZJYA 5DN6A 1KDVA 3AU8A 3SKVA 3AEKB 4F1WA 5B4VA 3H97A 5ULLA 3HA5A 1C3LA 5JXWA 1K8RA 2AQIA 1EFLA 1CRWG 1I2MA 1TZBA 1FP6A 2ODBA 3IQIX 4ZN6A 4LNUB 3FYUC 4Q1BA 3UTDA 3PUKA 2FFJA 4DR4B 4R3UC 5GOTA 4AMZA 3MCZA 4QNMA 4YBRA 3ASVA 1R0LA 1K97A 3ECCA 4AL4A 2RJ3A 1CHNA 1RPAA 3GOQA 1Q44A 4DDTA 2PK3A 2GHIA 3BT7A 3IB3A 3C7DB 5IZCA 2VQFB 4M0EA 1NWCA 4UE3S 2LPMA 3TQCA 3JQFA 3Q3GE 1S1MA 1XLUA 1DDIA 2ZTUA 3C7KA 5B3JA 5LOVB 3ZY4A 4RPCA 3H65A 1B43A 1PKXA 4EHFA 1W0JA 3VR5D 1NTOA 4EJFA 3W5DA 3WO1A 5K8UA 2INGX 2R7MA 1QDEA 2AEJA 2YN2A 1QFSA 3EBLA 3NUQA 4OHZA 2BY4A 2FX2A 5FBLB 4D5EA 5JAMA 3I5UA 4DCTA 1XRSB 4H4EA 1TD1A 1M2EA 1Y5LA 2JH8A 3TB4A 3TRHA 1UF9A 4KMRA 2B1IA 4P7GA 3B85A 3GN2A 4IOMA 4Y2TA 5AVSA 3N8DA 3GLHA 1AMOA 5LWHA 4YR9A 3TQQA 2OGSA 3FUWA 1FP2A 1ZNZA 2XE8A 1A0OA 3QUQA 4GOLD 5K6AC 1YDMA 2QP4A 1G8MA 1F2UB 1GKKA 2V6BA 2VTEA 4G07A 5DYGA 3ZC3A 4GM1A 4QBFA 4TTAA 3TNFA 1U3TA 2QXTA 1SHTX 3D9QX 3GDOA 2PRZA 2NTEA 1Q11A 3DUFB 4N47A 2MU1A 3AR8A 1Z4MA 2ZXFA 2ZYDA 3GDFA 1V3VA 5AXDA 3LVFO 3MXOA 2CDNA 1N2XA 2R751 3BTUA 3A1CA 4Q48A 4QHYA 2AR0A 1TD9A 2JFOA 4O08A 1L5GB 3DJFA 2A0UA 1AN0A 3A06A 1ZRHA 2QTNA 5SY6A 3ZXIA 3HUTA 1Z0KA 3ICVA 4ZALA 2H4JA 2J9YB 4B83A 2W98A 3TM5A 1OWOA 2C7VA 2BHLA 4FN5A 1YVPA 3O8DA 4RYLA 4MUMA 4EJMA 5AJXA 2HCRA 1HEIA 2WD9A 4WJLA 4P53A 5AJVB 1QQ7A 1YIOA 1KL7A 3RYTC 1LVUA 4K7JA 4IJQA 5CTAA 4Z0NA 4PX9A 1BDMA 4R9UC 4KHZA 1U28C 3TZBA 1QBKC 3TBFA 3OT1B 2BTQB 3NI2A 4UDNA 2QX7A 2PPVA 2HXSA 1GCUA 3QVSA 1VP9A 3GFGA 2QT0A 4GPAA 2VTDA 3BE5A 1I5RA 3DMYA 3FYCA 1RT9A 3B48A 1ONBA 2FGKA 2WJIA 3IP6A 4PX2A 2PWAA 1U8YA 4Y3UA 4BKUA 2XA9A 2R2GA 2XLCA 2X0DA 2D3TA 5FAXA 3P97A 2QRJA 4L72A 1ENOA 2FTKE 4ZVLA 4KK3A 1J9GA 5E6UA 4MDHA 4HQFA 4BCDA 2A5YB 4ZMSA 4E14A 2HO5A 5EJ8A 3QVWA 3GVXA 3TX2A 1FYWA 4JYZA 4P31A 4Q16A 3RE1A 2WF9A 5DN9A 2X0RA 3OLCX 5DSXA 2DSTA 4C0QC 1TT5B 4IS2A 3OF2A 4R71A 2NU9A 1GRRA 1LZKA 3THXB 2ROQA 2HNBA 4J07A 3CYFA 3HKCA 2OZKA 2RH4A 3L46A 4EKIA 1XZKA 2DWQA 3A1TA 3DMHA 1DZIA 4FZJA 3KSBC 1YT5A 1GZ7A 1Z4PX 3PPYA 1VYUA 1I6KA 1L9XA 3LFHA 4BAUA 3GJSA 1UQUA 1FP7A 3RRNA 3ZOZA 5F35A 1N3IA 4ZVQA 1IY9A 4WZBE 3ENNA 3IMFA 4UUPA 4KYUA 1Z0SA 2ZWPA 3PQ7A 1HDGO 2FPXA 2BBOA 2PJUA 1CNFA 3HR4A 4FJ2A 2E18A 3MUNA 1GZ6A 1DX6A 3A3YA 1SOUA 4EY7A 2GAJA 2GZSA 4RZ3A 2EJWA 3VAZA 5BV2P 1AGPA 4BVLA 5FH9A 2WE7A 4XXHA 2WU4A 5K3FB 3EVZA 3LT5A 4QUKA 4PG5A 5JRJA 5L6MB 1UBJS 1BXRA 5LNK1 1JHOA 2G9QA 3N58A 2K7ZA 3QG5A 5CM2Z 3STTA 3UB4A 5HQ3B 4P1ZA 3OFKA 1DFHA 4JZYA 5LA6B 4HTFA 3BXEA 4A15A 3ELUA 4GWGA 3KUDA 3DYVA 3FLBA 1Q19A 2G82A 4NCIA 4L02A 3HGMA 1UUFA 3O8BA 2GZ2A 2O3JA 5BNTA 2GEKA 4ILEA 1X3LA 2O54A 3AJRA 4C05A 2AHRA 3OIVA 1OIXA 5IK2D 3RW9A 5KOJB 2J09A 1TE2A 3QBEA 2GPNA 4GOXA 1OH7A 3J80A 4UM9D 4GWLA 4LYEA 4XIJA 1B8VA 4ARAA 2AS0A 5AHKA 4AUKA 1V9LA 5HFAA 3SBOA 4YJHA 4Q9KA 1AK2A 4DXHA 4WIAA 1EHCA 1VHQA 4NI5A 4XPIB 5FX2A 4B6FA 3UFXA 3CUYA 4RQAA 1J8DA 5FOWA 3MELA 3S8MA 3T7TA 4O29A 3FB4A 3IEPA 4WZ6A 4GKKB 2Q6LA 3CVOA 3OZXA 2OFOA 2D1RA 4FQ5A 4YAOA 2TS1A 5AKXA 4ZDKA 3INYA 4WINA 3VR5A 5BSGA 4ITVA 3ILSA 1DEAA 4DLKA 1KY3A 1ENYA 3AFHA 1ETHA 1YGPA 4K8OA 1HNXB 1A7JA 2YV1A 1GQ2A 4ND6A 3WBBA 2LV8A 2WP0A 3K9LA 3U4AA 3PUIA 2ZUEA 3I32A 1U65A 5KTTA 1AKMA 1FRNA 2DE0X 3VTFA 1XDSA 3RNOA 4AJ2A 2O8DB 1A9XA 1NBHA 1RWQA 5IT5A 2ECOA 3K3PA 2G4CA 1GUYA 3AVWA 1UKZA 3F9CA 2MSKA 4OP3A 2FU5C 4KQWA 2JRLA 5GVRA 4DRZA 1UPTA 5LLDA 1FZTA 3LC7O 3RHZA 3X1WA 3BA1A 3AOEA 4DLVA 1RBQA 1N9ZA 4C3UA 2IE0A 3BJZA 4INOA 4LHZA 5KYGA 2O4UX 2YHAA 3IQEA 3AL2A 3FPLA 4JBNA 5ALQA 1IBRA 2HU5A 2JK1A 3IPRA 4D9JA 4ESOA 2PZGA 2CJYA 3H19A 2IHBA 1D1QA 3OU2A 4IEIA 2N46A 1ID8A 4HKTA 1G4HA 3K1TA 5PGMA 5B30A 2Q4OA 2Q28A 3LECA 1P3JA 1VA4A 4RACA 1R6UA 1UOQA 1ZN8A 4RIIA 3Q85A 4DSTA 5CR9A 1P2DA 5HEKA 1KS9A 3P9RA 3RAJA 3BWEA 1L1EA 2FSVC 2KLBA 2VT7A 4G0YA 4K6KA 4AZ0A 1X9HA 2PKEA 4D3XA 4F7DA 1QU2A 3T7JA 5AP9A 1VL6A 3ELDA 4YMVA 1K9SA 1QGUB 3LF2A 4M46A 3CEAA 2E3JA 4BGDA 4FDTA 1UOOA 1EGAA 1WMSA 3IDQA 2BFWA 4LBWA 1KO4A 1U7TA 2EX4A 3C6KA 4DSOA 5JNVA 4FWBA 4DLPA 5KUTA 1LH0A 4KN9S 3RD5A 4EW1A 1UDCA 3EXFA 1ZXXA 1PI3A 1XQ6A 4HEA6 3D6MA 1UIRA 2E6KA 5HDBB 1CY1A 3WZ2A 3CQ9A 4GRDA 5EP3A 3C15C 2YOFA 4V0SA 3VBCA 3DAFA 1DRUA 2X7XA 2ZSAA 4ETIA 1PE0A 1E1RD 2YZKA 3KKNA 1ACMA 1RIIA 4LWQA 5A3SA 1XJWA 4JCCA 3JD3A 5TXGA 3ZWKA 2Q3JA 5T6MA 1Z38A 3KE8A 2Q21A 1H5NA 4GX1A 5D85A 1ZKDA 2VOJA 3GVCA 3FTPA 3MMSA 1OZ0A 1WB5A 2K87A 3F98A 3GG9A 3LH5A 2A57A 2Z83A 1DKNA 4GZMA 4JLAA 3ZHTA 4R3WA 4PX3A 3UT5A 4ZVKA 3O4JA 4GPD1 3H1PA 3AKYA 4W6QA 1ZK4A 3DDSA 3RLIA 2LUOA 3ASZA 4QOGA 4W63A 5K51A 3GMIA 1H0RA 3T9BA 1JYFA 2P7HA 3PT5A 5B12A 3S1LA 4U7WA 1T8WA 3T5PA 1G66A 5AK4A 3ZWAA 2H7YA 5EIAA 4DZTA 2OECA 3TSOA 3L8DA 3N28A 2NU6B 5EQDA 3RTBA 1RLIA 3AXTA 4EG6A 1DEOA 3GJQA 4HWOA 5JAQA 2C88A 3PPWA 5ENVA 2R4QA 4P92A 1JEDA 1NLZA 5LDDC 4XTRA 1OIWA 3SC2B 3BFJA 4TLBA 4KLZA 4DJAA 1QF6A 1TJ4A 2OVBA 4DLXA 2AUNA 1PZHA 3Q8WA 4QUGA 3GP5A 3KQYA 2W2PA 2PXHA 5BNWA 2REXB 1QFZA 3HS3A 4FZ5A 2O59A 4GR4A 6CHYA 3KXKA 3QITA 2Z6UA 1DXYA 3PFFA 2V54A 3K1AB 1V8ZA 1NP6A 4FUQA 3T7RA 5HR5A 3FNFA 3W5SA 4F4DA 1PFGA 5AM2A 2B3TA 5IK2A 2XZOA 1RXVA 4UFPA 4XUDA 2ZQYA 1UC4B 2AK3A 2OOKA 3H8WA 4UREA 5H5JA 5T6BA 1KY5A 2ZI9A 3RKUA 2JIMA 3B3JA 3DKKA 3UJ9A 2XRFA 1DJMA 3ITDA 1UANA 3SQLA 1W29A 4A8JA 4CL2A 1XD2B 1GGJA 3O47A 1N7IA 5ALTA 4Z86A 5BR1A 1TQDA 1YR2A 3LFTA 3UWSA 4B6EA 3CE6A 5DM0A 5BVHA 1Z7WA 4BWYA 5JE8A 1YJQA 1S8AA 3BMCA 3X3HA 4HP8A 4KSYA 2D06A 4RZHA 4WUVA 3LGAA 2OL4A 3BIOA 3I6IA 1TVEA 4JL6A 3O9VA 1LNQA 1TM2A 2XJ9A 4PHTA 4Q6BA 3G2PA 1KNXA 3GFTA 4Y0VA 1W36D 2EHJA 2FCAA 3GJ0A 5F9FA 1P29A 2F48A 4ZIRB 7ADHA 3ZX5A 3DGEC 1XTPA 4N8SA 5AJHA 2O14A 5HTKA 1K6EA 2IU4A 1L8AA 2QJTA 1F5SA 3FROA 4FDMA 5ALWA 1KU6A 1ZWKA 4QXPA 4QYMA 1C30A 1ZLXA 3N05A 4R2MA 2J30A 4Q3BA 1PD1A 3FDZA 1ZNWA 5K9ZA 5TGZA 2BH2A 2ZBPA 4M9UA 3SXUA 4RLHA 5L3SB 2FR1A 3ORSA 2WAOA 5F21A 3RGGA 3RADC 4KP7A 1IFXA 1DJPA 1DAMA 1LSJA 3VZCA 1YASA 2VJMB 2BELA 4TXJA 1FVXA 2QPOA 3VGJA 2OCIA 4G2NA 1ZG3A 3FAKA 1V7PC 2EZ8A 5GGYA 3D4LA 3ROKA 1E2PA 3I2JA 2DPMA 3MC1A 4B47A 4QU9A 4QYSA 1CY2A 1Y7PA 2C4KA 2D00A 3IUNA 5CH5A 2KB0A 3TVDA 4MS1B 1RXIA 4R9VA 5K8VA 4Y1FA 1M2JA 2II6A 3K53A 3H8JA 5KS2A 2QP9X 5TPWB 4Q4HB 3JAWB 1GQSA 1J07A 3VNVA 5EJ7A 5DCUA 5B6PA 3TLBA 3RVJA 2EW8A 3RRJA 3C1OA 3ACDA 4JH0A 1I0LA 4EYGA 4L4RA 1NJ1A 2PGXA 4Y2VA 1E2KA 1VC2A 2CUKA 1E7WA 4HDQB 4A0HA 1O03A 2F3SA 5ITZB 3BTSA 1TK9A 3O3CA 3MFQA 3K8QA 1ECFA 2C5LA 2UV8A 5E3IA 4KN8A 2QYSA 1O87A 3LYHA 1BW9A 1N7GA 1FVFA 2L42A 3PFNA 3OQ1A 4RF4A 3ETLA 2O8CA 1E1RA 1EG2A 2P5UA 2HOQA 1PU2A 2I65A 1L4BA 2QDKA 3FUXA 4IRMA 3H2IA 4RD2A 1SNYA 3HVJA 2E1PA 1RC0A 3SFTA 3G9ZA 3OOYA 3R41A 5EN4A 4Y2HA 2FR8C 4IV0A 4F9GA 1QFXA 1O94D 1WVGA 4G63A 5FWYA 5IJ9A 4I6EA 3QKRB 1MVNA 1Q0UA 5I6DA 1AY0A 3E7DA 4BX2A 4L9WA 4INJA 1FUYB 2B83A 2YMLA 1ULAA 5FIUA 3AI1A 3ZDBA 2GJ9A 2QN2A 3TSAA 1CY8A 1TW2A 4RTRA 3PQ2A 3HG7A 3P5SA 2Z8ZA 4ZKEA 3TBHA 1V1RB 1Y63A 2AB0A 3H2ZA 3WLAA 2AI3A 3FNQA 3LO5A 4X1KB 3GUZA 1HA3A 4JLPA 4WZAA 5IJZA 3AG5A 1KEKA 4GGMX 3CONA 4EZIA 2OFWA 2PPLA 2J0EA 3MWDB 4F86A 3BBLA 3PDIA 1VLJA 1EA5A 1L5YA 2LVBA 2YVLA 1SC1A 1VMIA 1VG0B 2J32A 3H2BA 1MA0A 1XLTC 2VJOA 3OM1A 4GYJA 4DQLA 1JG4A 2VNAA 4UU8A 1AF4A 3WFIA 1BEEA 1QYRA 2C77A 2O2YA 3W8FA 3DTVB 2QMYA 1ZC3A 1C0EA 2QM3A 2WTUA 1E6MA 2XQKA 1UK9A 3IBCA 5FOXA 2P9BA 4QTXA 2A1TS 5C5IA 2OCYC 3ZE7A 3OKCA 3CY6A 1N78A 3F8WA 5TT1A 1F8FA 2PKXA 5IS2A 1PX0A 3CF4A 1LPMA 1W2WB 1AS2A 3DBRB 3EGDA 3TO5A 1UH5A 1FXUA 4EB8A 5B55A 2JIPA 4NG5A 3VJMA 5I8WA 4CEHA 1FQJA 2J0QA 2CUNA 3TUZC 1IYZA 2VDQB 1XA0A 1P3DA 3NWJA 4QAQA 3TXAA 3FBTA 3VR1A 4M89A 5GPBA 3Q1KA 3U1TA 1NF8A 5B5SA 1JP7A 1P0CA 1L7QA 2ZR9A 1Z68A 2DPLA 5ELLA 1GZVA 4GPBA 4YAGA 1PV4A 3PQEA 4L76A 2Q2OA 1ZNXA 2QGFA 4OGGA 4WNCA 4ZHQB 4BZXA 1Z07A 3DF7A 3FCAA 5BW5A 4D80A 2Q9BA 3L1JA 2EDAA 1VL5A 4BLPA 2Z2XA 1HT1E 2PUHA 1BE0A 3SI7A 4BYMA 2DUWA 4C03A 1SXGA 4DHWA 2VCHA 3AR4A 4JASB 3CWQA 3KPJA 1GSOA 3M33A 3H5RA 3ZW8A 2G4LA 1M76A 5E9QA 2A9FA 3EPLA 4CT0A 1Q0QA 1PFKA 1SZDA 1F5NA 1FZQA 3H5WA 4PAQA 3SQNA 4ITRC 1NZJA 3RTCA 3JYQA 1D4OA 2UVDA 5MFZA 4MRNA 1CZLA 2H8GA 4PLVA 1OF1A 4D9FA 1YHZA 2DSNA 3DC7A 3QOYA 4BPRA 4Q1AA 4Y9SA 5THQA 3ETDA 2GI4A 5LMZA 1SQFA 4WK4B 4IM7A 1T1JA 3R0VA 4QX6A 4RV5A 3BJMA 1FLVA 5J2UB 1JIUA 5BSWA 3OOEA 4E5YA 4C21A 2GXSA 3CPJB 4FKMA 1LS6A 1R0YA 3EH2A 4YCJA 3CBQA 3V4OA 2FSPA 3AX6A 3VISA 4QELA 3KQVA 2NU7B 1U8TA 1K7CA 2Y3IA 3NTOA 1O7JA 3CINA 2PIAA 4J0HA 1EK2A 3NYWA 4P32A 1GPJA 2VBCA 4KITB 4J1TC 1KKLA 4ZT3A 1AB5A 1EP1B 1R8QA 1VLZA 2ENUA 2IY8A 4I2VA 4H6PA 4DUZB 1VPWA 1NUSA 2Z5FA 3EHEA 5FBVB 3CURA 1ZHOA 3P4UA 2RJOA 1YMQA 3FYSA 1RWXA 3W78A 4QZVA 1E3TA 3KQWA 3P0EA 2ASVA 2IEBA 2VJQA 4TMVA 3TR6A 3SVLA 4X1IA 1RP1A 5EPOA 3TVTA 4U7JA 1Y6QA 4ENRA 3H5OA 3M81A 1GPH1 2WAXA 4JOQA 4GF5A 1EI9A 1N8KA 1S01A 4AF7A 3L7LA 4MW1A 3UWOA 2JCSA 2WDPA 3L7MA 5JCXA 2AJBA 4ZI5A 2J9FB 2WV9A 3AINA 4NCBA 3L0PA 3BVPA 3C45A 3FUCA 1JDJA 3M2PA 3O84A 5EJ2A 4QJ3A 3F4BA 4JLVA 4YRLA 4KU4A 5DBFA 5JC1A 1XZEA 4UAVA 2NO1A 3B8EA 4NFSA 5L95A 2FHSA 1CLEA 2Q7XA 3K8OE 1KDOA 1W35A 2JBHA 3WRYA 4BMPB 4Z7NB 2HRDA 5A3JA 3FH0A 5DYNA 4RPLA 1EFCA 3QA9A 1O94A 4OAOA 4C4ZA 1V5GA 2VEDA 1MW8X 1DC7A 2E49A 2HQRA 3EZGA 4IF4A 5BRJA 4CDRA 3TTSA 3LBIA 3KLOA 1E3WB 3BXXA 4CMCA 1EK0A 1UP7A 2V45A 4AY6A 3H5AA 4ROSA 5LZ8A 1WMDA 1NASA 4MS3A 5FUVA 2H2GA 4PAOA 1XJCA 1G8FA 3G79A 1KJZA 1UBKS 1FDSA 2RE8A 1M2OB 2Z98A 2ZPUA 1EZ1A 5EE9A 4M1EA 5EKXA 4NFLA 1KTIA 2C4MA 4HAWA 3UGKA 3U7GA 2FFRA 3GJZA 3T95A 3QTTA 5LDGA 5D2CA 3D43A 4M2LA 2I4TA 5J43A 3HU1A 4PQRA 1KYQA 3NP7A 1KJYA 1KP3A 1GL3A 2YY6A 3M7IA 2C99A 4M1OA 4P4TA 2Z2KA 4XJVA 5FO1A 3HHPA 3SOPA 4ZQGA 3NFRA 3WRWA 2PR7A 3KT3A 3EIQA 2BMJA 1R66A 2BUCA 4ECEA 4YAJA 521PA 4MVCA 4HAVA 4C14A 2SCUB 1JPJA 2QAGB 4A0RA 2AVNA 4EP1A 4H27A 1TUBB 2WT4A 4U4AA 1EUCA 2XUJA 3U4QA 3ZLUA 3EDOA 3EXAA 3T5AA 1YS9A 2GAAA 2BGTA 3AVVA 5E1DA 2V9ZA 2A88A 3IIMA 4W8GA 5K1ZA 4JUAA 4J9VA 4TUYB 4YV2A 2XBMA 2A9OA 3HDJA 2BEVA 2GBFA 3L7JA 2IZ7A 1SUBA 1BNCA 3WMWA 5NULA 1Z5PA 3ZTWA 2JLWA 4H3HB 5D3MA 2UVQA 4KX3A 4IXNA 1KVUA 1PR4A 2BP7B 4IZOA 1VYHA 4AW9A 5I7SA 5KJ1A 1K3UB 1EQAA 3A9CA 4R8KA 1N2CA 2ZSUA 1JXQA 1JKJA 1SCKA 4IDQA 4IBOA 2B94A 2PLRA 4V0KA 1WO8A 1E1MA 1DZ3A 4BVJA 4EY6A 1U90A 4UQOA 3PZBA 2PA0A 5AW9A 1ZM9A 2Z56A 5C31A 2OCGA 5FO0A 1OWLA 3I9NA 3IAS6 4YHBA 1ULHA 3WXMA 1MV5A 3L8HA 2R00A 2JJ2D 4X7PA 4X24A 1DAOA 5CUQA 1SEPA 4AKGA 1ISPA 1MRNA 2ZPAA 2J8ZA 4LMPA 1YS4A 3AEZA 4RENA 1K63A 3TMAA 3VPGA 4LCEA 5LYJB 4GVLA 1NVAA 5ADWA 5L8VA 2D6FA 2PL1A 3OLWA 4PRKA 1NM5C 5TDHA 3RUFA 1LLFA 2PBLA 3O8QB 2FN9A 2OBLA 5JHHB 2P40A 2FHPA 3H5NA 3IUYA 1C8VB 4EITA 1I36A 1RM4A 2D0OB 2PBZA 2PG3A 4KYIB 1AGXA 3OVMA 1WXHA 3DPSA 4BFSA 5LJLA 1A50B 2GQ0A 2BJHA 2XQIA 5CJ2A 2CBXA 1IJEA 2D5AA 1N33B 1PSDA 1FLNA 5AHWA 1FFBA 3F9IA 3QOFA 3MJSA 5A5EA 1C81A 2DBRA 1QHGA 3REQA 1A5BB 1NC3A 1T8RA 4UBMA 3N6VA 3NHFA 3QPVA 1VBFA 3KJNA 2A78A 2YDYA 4D8WA 5IWAB 2ZWMA 3MJVA 2D5CA 3I8OA 1ZM3A 2BKEA 3V6MA 3ZWMA 1QGAA 1XCBA 2COKA 2MSCB 4HLQB 1SXJC 6ABPA 3N2GB 3MWEB 4MKRA 2X2OA 3EWNA 1E94E 2RBKA 2WJWA 1LF0A 4KXXA 4CE6A 2J85A 4A26A 3DE4X 4F8YA 2QJRA 5FLYA 2QY6A 4OGFA 4AZTA 4BNUA 4K86A 2OHGA 1XCLA 5CITA 4Z7QB 1BD3A 2ILVA 5IDQA 3VO2A 1OROA 2PDAA 2Z2ZA 3LX4A 2AC2A 3IR7A 3PLRA 4MLCA 4MS4B 4REQA 4WK2B 4FX5A 5KVAA 3J81k 1GXSA 1OFVA 1E64A 1WDTA 4RNCA 3EQ2A 1V2GA 1TDJA 2DXIA 5BQ5A 3AF5A 3VKHA 2RI0A 1KZ4A 1NW7A 4G24A 4KRXA 4TSKA 5FUYA 5BRNA 2OBFA 4DAEA 4P5DA 3NXKA 4W4TA 4BATA 4D0RA 5K01A 1AHPA 3ADBA 4HYEA 4E2XA 1ATZA 2XCTB 4M38A 3S2YA 1YB2A 3CNQS 4JLBA 2RHDA 5IMBA 3D31A 4QPPA 3L7YA 3G2NA 4QOHA 1U3CA 5D01A 3ESAA 3OQNA 4HGZA 1P7YA 3HJNA 3PNVA 2AKYA 4DMGA 1FNNA 1L7VC 4OQZA 3F2IA 3M1YA 1XMJA 1CQIB 1NKSA 2G1KA 4V3BA 1RJFA 2UUBB 1ISHA 1JQLB 2BF7A 5FHQA 3UAOA 4EW6A 5CLJA 1IXRC 2A7QA 3NEAA 4OJTA 1LWNA 5IM4A 3V4PB 2YWRA 5E8JA 4WKCA 3X2FA 3TQTA 3A1FA 2QTVA 1X2EA 2WJJA 4EHIA 1H2WA 3U7QB 8GPBA 4NHEA 1PTJC 4MUAA 3BMQA 1G63A 2FETA 3I2GA 5SZIA 3ZI7A 1Y3BE 1AS3A 3KZ1E 4RKEA 1U1IA 1CE8B 3I2KA 3MAGA 4LV6A 5E6SA 4CQMB 2HC9A 2ATXA 2F1KA 1M1XB 1P7WA 1OX5A 5HKBA 4BO6A 3ZK7A 4D44A 1HG1A 4B7UA 4KE9A 3SVZA 4W9NC 5EUBA 3T35A 5KQSA 4AG5A 3QKWA 3NW9A 3UXYA 2JCVA 4M8IA 1O5OA 1V5IA 2V7UA 1QTNA 2YFHA 4GZ5A 4YRPA 3W04A 1Y9ZA 4DMHA 1J8QA 1R0BA 3FWYA 3OX3A 2XE4A 4IDGA 4Z3DA 3ZV6A 2LIVA 2R6AA 1SRQA 3TLZA 3QEAZ 3U60B 1G59A 5CCEA 2QN3A 5E9WA 4URVR 3UG7A 3GFFA 4B3JA 3ABZA 5KOHB 2WFZA 4R05A 4BMXA 1MKYA 4HGRA 4NU5A 3T0IA 4CV3A 5LL6P 3HCCA 2WICA 1ZH4A 4YT5A 1G0OA 2HSGA 5TRTA 3AWDA 2B4YA 2GD1O 3GELA 2DR0A 4NZYA 2OA0A 2R6HA 4F71A 2I2WA 2BEWA 1FDWA 4FPXA 2X77A 3B20A 3H2GA 3O7WA 4WXRA 2WDZA 4YRMA 2DFDA 5EJGA 1I9CA 4MVJI 3TDNA 4AURA 5IZCC 4DG5A 4KRFA 4L8VA 3S0JA 1BFDA 4YJFA 5EQFA 3SZOA 4EO4A 4YCLA 1V9SA 3UATA 1J21A 1FUIA 1X42A 2ZPTX 5CAEB 1K8ZB 2H4ZA 3KDAA 4URZR 4XX1A 5F77A 1T5DX 2EP8A 3B7GA 4O25A 1WHTA 1SPXA 5EIBD 1YB4A 2NT4A 1HDCA 3DOOA 4ODIA 1ISSA 2HTEA 5FQOA 3RFUA 1WLYA 3U7RA 1Q6ZA 1Y3HA 2HUNA 4Q6WA 5G1NA 3MRTA 3I58A 2UYYA 2CEAA 3H4TA 1OH5A 1B2RA 1PJ8A 1G3MA 4FDVA 4KAFA 1O6CA 4MIOA 5DX1A 2GBLC 3V8QA 4DMCA 5IKOA 3N8GA 3IB6A 4ISCA 3H4VA 4N8EA 2XGMA 3IEMA 1O96B 2X8BA 2VTVA 4EIWA 2RGUA 3KSRA 4OQ4A 5I3CA 2HDWA 1Y8RA 4J0DA 1DFIA 3ANXA 2G9RA 4Y98A 1RABA 4CKEB 4DNQA 2Q4DA 1H1TA 3LPMA 3OO1A 5FTJA 1CQJA 5BN4B 3KT8A 1E20A 1R3UA 2I2DA 5CFOA 1CUHA 2P77A 4Q02A 5AT1A 2IU3A 3OZDA 2PEYA 5G4KA 1GD1O 3TTXA 3I34X 3HCPA 1L1QA 3K1YA 5FI0B 2EQBA 1Z15A 1PVOA 4KN5A 1GZ4A 3K2EA 1V1MB 3DQPA 3I05A 3OE1A 1BHO1 1CRQA 1PHRA 1SOVA 3FPKA 3PRKE 4U3JA 3HY4A 1CZRA 4X41A 5DYIA 3MJCA 1X9GA 4PG7A 4FFBB 2O2CA 1MC4A 5IHPA 1TU3A 3D1LA 5SYMA 1JU4A 1E7MA 3IP1A 1C1DA 1YA6A 2AWOA 4H7KA 3ORHA 5KKCA 3T1TA 1NBOA 3KD3A 3NIFB 2C7QA 4IOJA 2OBXA 4R1PA 3E7WA 4L27A 3IUSA 5A62A 1WXFA 2CXXA 2AZTA 3RU7A 2JLXA 1CR1A 4P3PA 3W4IA 4EHHA 3GGGA 2X3YA 3KZMA 1CUCA 3M6LA 2A4KA 2BRUC 2DBYA 4WESA 4ZOCA 1QHSA 4B31A 4FFVA 4CKXA 1S4MA 4DNFA 4I99A 3HEMA 1Z2EA 3MPOA 2AC7A 1GNRA 2HREA 3T1NA 3ZWNA 4CCYA 1EXDA 3OY7A 4MPPA 4GOKA 4P22A 3VSBA 1FFDA 3PEUA 2O06A 3O03A 4K1LA 1WDLA 3LDAA 2DU8A 4LJ4A 2FR0A 2I71A 1ZH8A 4IDAA 2VHXA 2BJVA 4MHOA 2IXDA 5AM4A 2K6GA 3S99A 1DG9A 3OWXA 1XRJA 3W3AA 4YRKA 1JAZA 3W77A 1RXEA 1T13A 3GO4A 4DGSA 3HBJA 1JKXA 3O2NA 4D6XA 1LUAA 3EODA 2BTOA 3ZTTA 2VHCA 4UOEA 1R4ZA 2CF6A 1UAGA 4BE7B 2C8KA 1P9NA 1KTVA 2PVCA 2BGIA 3NHPA 4JB3A 3KK0A 2EJTA 4ENUA 1TQ6A 4LXQA 3LRXA 4EG0A 2CLIB 2UXBB 4Q3CA 2GA9A 3GJ6A 2PL9A 5H4HA 3JVVA 1A2OA 2JFXA 2OO7A 1LEHA 1STOA 4LS3A 3A9TA 2FPGB 2IOQA 1XYVA 2LTAA 1RE1A 2OMEA 2W2VA 1KQGA 4L78A 4BNHA 4WECA 4IDFA 3X1MA 4K9OA 2XRMA 1E1KA 3TGLA 4KXQA 1J0DA 5ALIA 4H3KB 3H13A 1UPXA 1EXVA 3L7IA 2AFVA 4QFMA 3B1YA 2AZMA 2I80A 5DRTA 5KVSA 3PEFA 4UDOA 4GZLA 2WVGA 2LWIA 4Y2PA 4ARZA 5FLEX 1J56A 3IE2A 4RZXA 2Q7OE 3FI9A 4CM6A 5IAJA 5KYWB 2GXAA 4E09A 3GRCA 4S2EA 4D41A 4RX1A 2C1XA 1FY2A 1NKVA 1IUPA 1IG0A 3LUAA 3DM5A 2ZW9A 1E77A 1JHVA 1VGRA 3HV2A 3MCTA 1S2NA 2PGAA 1R5JA 4H35A 4IFTA 4L8GA 4IUDS 4RJ2A 4ANFA 4AKSA 2XZPA 4JYMA 5NLLA 4EG7A 5BWNA 5KSWB 5LQKA 5GJBA 4M1YA 4Z9XA 1O58A 2WWHA 1UP6A 3EY4A 1IHUA 1O8BA 4QULA 4HWTA 2APJA 4UEOA 4YAUA 1IBMB 4YRIA 4LN1A 1ADJA 3LCVB 4WZBA 3W2FA 4RF5A 4BU1A 1DBWA 5DT9A 1GQQA 4ZVNA 3UMFA 4TZ0A 2ECFA 1M2VB 3RAPR 1MTOA 4NS4A 4P7JA 5DPMA 2AOTB 2HJHA 2BDUA 4AJJA 5FL7D 2G6TA 4JT2A 3L93A 1JIIA 1ZSNA 3EGOA 4X63A 1QKJA 5A7GA 2VPXA 2NTVA 1CY6A 2D2EA 1NLMA 2Z2JA 3EEYA 3GAMA 1R5NA 4LMAA 1ORVA 4MINA 5P21A 2GD0A 1EXMA 3Q7EA 4BN5A 1JFRA 4EELA 5I9IA 2EFJA 2J7PD 2I66A 1ZO8A 2VUIB 3HLKA 3NHJA 3I3OA 3NHWA 3R7LA 1GSHA 2R8ZA 3HNRA 4H3VA 1HQYE 2WSMA 1DELA 1RJEA 1ZXBA 3BERA 3JD2A 4ONEA 3H86A 4A0GA 2A5LA 3S2SA 2CY0A 4JR2A 5GVSA 3T1HB 4A10A 2V1UA 1T15A 4OQDA 3DEAA 3GLGB 1JLLB 1WY5A 4O33A 3IOMA 1DI0A 1XYYA 4JUFA 3WJ1A 5ADVA 2WMDA 2H59A 1V8DA 1AZWA 4LKOA 5HZKA 2AI1A 1P4HA 2UXDB 3RU3A 1MR3F 1TAQA 1W1WA 3I9MA 4IWNA 4LQLA 4PBTA 4RSMA 4B1FA 1Z2CA 1CQXA 2QUAA 2XUHA 4MRMB 3V3KA 4BQFA 4RHUA 3TZHA 4CG1A 2R7KA 3JWJA 2BM0A 4W1QA 3L9WA 2M1ZA 2W6QA 1KSHA 4CM9D 3F6SA 4DR5B 2MSNA 3RS2A 4Y9UA 1JHZA 1KZ9A 5DLQC 3U3KA 3WMXA 5EKSA 3M89A 3OQHA 3LRTA 4UJ5A 4B40A 4M83A 1YAHA 4JK3A 1LQUA 4EKGA 1OJLA 2PSHA 2XGOA 4IFBA 1DUVG 2JVKA 1KDTA 3AFGA 4OHXA 1N8TA 1FTNA 3D3JA 4X8MA 5K0SA 4H1TA 1OLOA 3BYZA 4IR7A 4LUCA 4MV3A 3E53A 4XZ3A 4XVHA 3RSFA 3E22B 2X6RA 3QUBA 1LA2A 1E2JA 3BWYA 1LI7A 1ZH0A 3FCYA 4BZPA 1COWD 1SHUX 2LKDA 1SG6A 2CW5A 1KJNA 2PVPA 4Y6RA 4I1IA 3M49A 4PHGA 1YDEA 3BEDA 3HM2A 4X1YA 1KP2A 1RYFA 4GMGA 5DXAA 1OWPA 1NUHA 5TNXA 1OC2A 3UF0A 4L8YA 1ZD3A 2X8JB 1RHJA 5DHFA 2DPGA 3DZGA 4R9SA 4X00A 4TS9A 1GITA 3WIVA 3RYHB 1UBHS 1XC7A 3AV0B 5ITWA 5A3VA 1KEEB 2GCIA 3EPJA 2UYHA 1K5HA 3G2KA 5BWMA 2ID9A 3VOSA 3A6LA 2ERCA 3HCFA 2WSSA 5FRDA 1YI1A 5HMMA 2JZOA 4KBFA 4G8JA 1RRCA 2LCFA 2ZRAA 2O1WA 1BN6A 1CCWA 1E9VA 3ACCA 3H1EA 4JIGA 3KNZA 4Y6LA 4ZXFA 5T5QA 1GTJ1 3O9MA 4V0LA 3GGJA 1XP5A 5IASA 1HYBA 2AE2A 1I94B 1II8A 4K9PA 2Q5OA 3RVLA 3VVMA 2Z5GA 4RJKA 1BX1A 2PV0A 4A2CA 3KZXA 3PNQA 3R09A 2JJ1D 3TG8A 3L84A 1AXRA 3AEKA 1XAIA 3W8NA 3DHYA 1PGPA 1B3RA 3DOJA 1N2ZA 1NZDA 2YBDA 1DWUA 4MI3A 5ER9A 2Z43A 1V4VA 1K8QA 3MUEA 1QGDA 3PENA 4MPJA 4OAQA 1CZHA 3UMJA 3WQRA 1H69A 4LNUA 4BQIA 4B79A 3PA8A 2P9EA 1VPTA 4J91A 4PHFA 3VJKA 5B64A 2A67A 2YXNA 5KNBD 5L40A 1XNRB 2FW8A 2G63A 4FT4A 2ZAIA 3AF4A 1H6DA 3FTCA 4OQEA 4Q7MB 3T7DA 1I4EB 4B8WA 5CLGA 1L5VA 4O02B 2C9OA 1E1NA 3T7CA 1OSNA 5HFJA 1S2GA 1W52X 4YT4A 5KWIA 4KR3A 5KAPA 1FYVA 3GWGA 2YHUA 3DOFA 3OJXA 3SQDA 3ZNPA 5LOVA 5DJ5A 1YKFA 4Y1RB 3H84A 4BS9A 2XCLA 3D8BA 4TT3D 5FOQA 1EWRA 3WBFA 4DYVA 1P1BA 1IUKA 2WHXA 5B1HA 3FHCB 1DIBA 2QTWB 3URMA 1EBUA 3HB1A 4JJIA 4BNTA 4IMRA 1NN0A 1DV1A 1T43A 1VL1A 1LC0A 4S24A 5FL7A 4B3HA 1HC7A 5J4KA 1LBTA 5JO9A 2P75A 3M4XA 5KNCD 3VNAA 2JGDB 2WF5A 4HX5A 5TIIA 3ZLJA 1L7AA 1HURA 2FV8A 3DL7A 5C4GB 3WL6A 3C8ZA 4QQRA 4F46A 1F2UA 9GPBA 2AQKA 2J7PA 3WKCA 4BB5A 3QHAA 2FPMA 2FWRA 4XYEA 2VRNA 1R10A 1XQYA 2O2XA 4Q9IA 2YYSA 3B1ZA 3DUFA 2J6IA 4UE6A 4EZBA 1G6KA 4KH1A 3O4IA 5U4QA 2ETVA 5F1OA 4EA6A 4RORA 4ENVA 1FP1D 3OZSA 4MI6A 1YR9A 3RYIB 4URXR 4CL0A 2XE6A 1CERA 4CKCB 2H3EA 3QEMB 1XROA 4KUHA 3CVJA 4E21A 4TYYA 1RI3A 2AZDA 2ESRA 3B12A 1XF1A 2HB6A 2TMDA 4KAAA 4MPDA 3RBAA 4CI0B 2PLWA 2N1BA 1LCIA 1DTEA 1I4LD 1W93A 2NAPA 2PZJA 3I0MA 3PXXA 4GL4A 3RTEA 3ZDDA 4KKVA 5KWEA 1S8FA 2K7FA 3TI9A 2JFUA 3RR2A 2NO6A 3P9SA 2QTBA 2PX0A 1E0DA 2Y0DA 1RKBA 1SVWA 2HX1A 4TSFD 1GRNA 2ODWA 3OT1A 2CXPA 2BTQA 5B1YA 1YI8A 3ANNA 4UU7A 1MEJA 3M1AA 1T2FA 4OK3A 5JFGA 4Y6PA 4BFUA 5IDXA 1KIFA 4TWJA 2WT8A 4RVHA 4MRSA 1KAEA 4FT2A 2F6RA 1YQXA 1MAHA 1THMA 1Z6YA 3OY2A 4MKGA 3WS7A 4DV5B 3O8OB 2VHTA 1VRWA 2P1RA 3PYMA 2D8MA 4R5HA 3S55A 1P1HA 2RK6A 1ACJA 1N0HA 2XZDA 3EXEB 2JD1A 2GF9A 2KYRA 3C5VA 3G82C 5DI3B 4G0PA 2XIJA 4AWBA 1Y4ZA 2QMUA 3QY9A 2GF2A 3O7MA 3MCAA 3LOUA 5L4SA 5ABPA 3WI7A 1VHTA 1N9GB 5IM4F 1ZBDA 3YASA 3HJUA 3GMDA 4U6QA 2WLTA 1ADYA 3ZK9A 3UAGA 4M49A 3C5HA 4D3FA 3P52A 5EZSA 4DL9A 3NXSA 2K2QB 4AX4A 4C04A 1FSSA 2I2BA 2RKOA 4QBGB 4DADA 1KFEB 3UMYA 3MTQA 1NBIA 1PNQA 1HFJA 2FPUA 4QGHA 4LF8B 3COZA 3T4PA 3STWA 1BKDR 1HRDA 2BT4A 3L49A 1W581 2B36A 2GMWA 3TH5A 1VMEA 1SKAA 4OMFG 1GGFA 1GG8A 3UPDA 4MJ7A 4DYDA 2C7PA 2HQ1A 1SAYA 4JEIA 1P5RA 2RB5A 3ES9A 4RXTA 4XYMA 1Z6GA 5EC8A 5K3FA 2RG1A 3ZBUA 4ALIA 5C8YB 4XQ0A 2QVLA 4PYQA 1DUSA 4OA5A 3UUEA 2GPYA 4NNOA 4A9AA 2BHRA 3NTRA 5HQ3A 4X66B 3ZZTA 2IW3A 5LA6A 2NUPB 5MGBA 5L6LB 1GFWA 1M0TA 4TYWA 4RF2A 4J6FA 1C7IA 5THXA 1Y80A 2DT5A 4DB2A 3LDUA 5JBQA 1YBHA 4GYWA 2B9EA 2IW1A 3ZHZA 4PXYA 2FEAA 2XRYA 4DCSA 3KQTA 4FEEA 2JJ1A 1U5BA 3GLGE 2QDXA 1SY7A 5G3ZA 1Q0SA 3L43A 3ZLVA 4D7AA 2JANA 5IN5A 3TQFA 3C7CB 2ANBA 3E8XA 1GZDA 3IJRA 4L7QA 2DG2A 5KOJA 1NXQA 3DEZA 3EPRA 2ZUCA 5H3LA 2ZE7A 2R7NA 4PXSA 1WPXA 4CIVA 1WNTA 4CF3A 3AM3A 4HNAB 4WMLA 1PR6A 3P9YA 3VPDA 1GGVA 3U4CA 1G5QA 1BKSB 2QTGA 3OCZA 2VT2A 2JFZA 2PRJA 3CT4A 4F2HA 2RAVA 2M1XA 4XPIA 3CLRD 3QI2A 4YRNA 2O6HA 1L4MA 2EFEB 1YACA 2WIDA 3AM4A 3SC3A 5EE0A 5FPQA 4Z4FA 1U2DC 1CZKA 2XUOA 1FXSA 3GI1A 3RS4A 3CLSD 4E5DA 3AR6A 1EEHA 3JR3A 2V65A 4LJYA 1GPKA 4I55B 3WMEA 4OHWA 3KLNA 2QR2A 2VDMB 4TT3A 2ZWVA 1I3NA 1MEOA 1X1DA 4J2OA 4LVNA 3QU5A 3IV9A 4K6OA 3ONVA 1M67A 4I46A 5G2OA 3G5TA 5D3ZA 3PNKA 2O8DA 3FF4A 4LOLA 4MSUA 3O9ZA 1QO0D 2CMFA 1MX3A 1V25A 2ZB2A 1NA5A 3EYWA 4FINA 3RV3A 3WX0A 2QV0A 1I7SB 4B3GA 1SIBE 3IUPA 1U3GA 4Q1FA 3UXMA 5DW0A 2CL7X 1T9DA 3FSEA 2ZZMA 2YNMD 4JQSA 2F17A 2IDZA 4I4LA 3VOTA 2AOUB 1L7PA 2XYGA 1ADBA 3FPHA 1QHYA 3MQ2A 4PLWA 2HWKA 3GLTA 4RTOA 1N2HA 5K99A 1I3CA 2JKVA 1NMQA 3MYRA 4LJ7A 4I5DA 3K4HA 3D0OA 1L4UA 1S3IA 4Z7JA 1Z12A 1VSQA 4OM7A 1JT2A 1FMCA 1RD4A 2LKCA 1NGSA 4WKNA 2FPLA 1JRLA 4E2YA 3EAQA 4XTCS 3CW9A 5K0JA 5FWAA 4JLDA 2ZRJA 2NACA 3ZGYA 3LX5A 2C31A 3G0CA 1TFUA 1N6LA 5EZ6B 5TE9A 2J31A 3KQSA 3R3ZA 1PZEA 3MEQA 3IT3A 2IITA 1SCAA 3WLRA 2QRGA 1X15A 5K2OA 5AM0A 3EDYA 1P4SA 3SEAA 1QGUA 4WH0A 3B3FA 4G6ZA 4X9XA 1QANA 2R62A 3OOJA 2EHDA 4EJ6A 4KFCA 4MMZB 4LGMA 1VECA 1LTHR 1NY6A 1ZIYA 2V4ZA 4FS3A 4N7RA 5AKYA 5EJIA 3F7TA 1U7XA 2VPQA 2R65A 3V8BA 1DVRA 2VZ9A 4AX8A 2AFRA 2IYVA 1D8TA 1GZ3A 2FW7A 3M4NA 4JSYA 4ZOLB 1RRGA 1T2DA 2YWCA 2VRWA 4TTSA 2TRSB 5IRCD 4IIVA 2MSLA 1T2UA 4QKQA 3EC7A 1T3TA 4L9SA 4LFAB 1GZHB 1RLOA 2H5JA 3BE4A 1TF5A 2PH1A 3L06A 4QFBA 1RWMA 2Q49A 3KE9A 2HHLA 2Q8QA 3LUHA 4IJUA 5A5DA 1U0HC 2FG7C 2ALJA 3NNNA 3MUOA 2O3TA 1O1YA 2P79A 1D4AA 2GKOA 4OHBA 4F38A 2OHOA 1G9TA 1XO1A 1RYMA 1YCHA 3E9MA 4YRRA 4WXEA 2ZUFA 2DFVA 1OFUA 5BUQA 2WTAA 5E1OA 5JZSA 1YQDA 3PJGA 1XRQA 5J5VA 4BTEA 4C7XA 4E5VA 4NAVA 4NMXB 1USIA 4TKMA 1GG9A 1CF9A 1HLDA 1WA5A 2H0QA 2XHZA 2NU6A 4M76B 4S0ZA 4YUWA 1QYIA 1YZFA 4X7RA 4QFCA 4I9UA 4JDUA 1JL3A 4Z4HA 4GLBA 4ND4A 1L6IA 3U7HB 4BGUA 4K03A 3SC2A 3D6TB 2I78A 3WGJA 4A0FA 1HMYA 1I6WA 4GG1A 2H5IA 3NQ41 1NJ2A 5AOBA 4OF4A 3DTVD 1DWOA 3NBKA 4CT5A 3TQSA 5ALYA 1LPSA 3JQ9C 3SX4A 5JZOA 3N2YA 1SZJG 1NN5A 2AG6A 2IUUA 2A1IA 3K1AA 1JAXA 1EFDN 4Z8YA 5BSUA 2HH9A 4ZAXA 2F7SA 3QEOA 1ZR4A 1Y6JA 5TMEA 1O0BA 1GY8A 2PFGA 3EWIA 1ZYUA 4G8BA 3MJEA 2P9TA 1AUVA 2X42A 2P65A 3R5XA 1OY1A 4HWKA 5E3JA 9LDTA 4F9TA 3V4LA 3HJFA 1M72A 3NPMA 4FMCB 1XD2A 3IA7A 3O31A 4GR5A 3TEFA 4BKMA 5E3HA 1XRRA 3GVPA 1OTYA 2H16A 3BICA 1RZRD 2XKBA 3FI0A 1M34B 2QJFA 3TXXA 3N1UA 2YOGA 1IH8A 3NC4A 3SEZA 5FHRA 3A10A 4UDXX 1E5DA 4XLTA 5DV9A 5LSAA 4B44A 3VUEA 1Q1NA 4RDCA 4CIDA 1DC6A 3FY4A 5A05A 3UJCA 4QGSA 3FLMA 1ULSA 4ZIRA 5F51A 2H7XA 3ONDA 3ZWPA 1NT4A 1T6XA 5K0EA 1JV2B 2JIOA 5C35A 1QO0A 1CFJA 4H7HA 5EWLB 4JFAA 4ZVMA 1JILA 1MTZA 2E1RA 3GVIA 4BUJA 5AI0A 1GILA 3N87A 1KE2A 2NQ8A 1H6CA 2PKQO 5T4FA 5KWJA 2FOLA 2AZ4A 2YNMA 3T4UA 1R1DA 4Q7LA 1GPYA 4MHTA 4YHHB 4C0WA 3OSUA 3ZE1B 2E5LB 1A95A 3CLUD 3WAKA 1LK0A 5I9SA 3ZU5A 1AU9A 2PLNA 2ZJ0A 2VJMA 3MINB 5COQA 3VUFA 2I9PA 4G84A 5C53B 3G02A 3HFSA 4CTMA 4JP8A 2O07A 3E7PA 1JA9A 1NI3A 2XCRB 5HIAA 5LWQA 1NXVA 3A0RB 1ANKA 3PE4A 3UNXA 5AHRA 1IVNA 2YY5A 3QU2A 3CFYA 3UA3A 4LYYA 5TPWA 4Q4HA 3JAWA 1XTKA 4QASA 1MIOB 4NJMB 1IXYA 4TKUB 2JGIA 1Y3FE 3MOGA 3E3OA 1V6SA 2CKDA 3V4ZA 2HR1A 3AETB 2ILTA 4YJ3B 4WADA 2NSHA 3RNLA 3VA7A 1IZYA 2PR2A 4HLNA 4HAYA 1F51E 4LWZA 3NONA 2ZRDA 5BOSB 2B7LA 3TE6A 4PLHA 1TJNA 4AF6A 1BIFA 1ZINA 2OV6A 1ZMXA 4JU8A 5B7GA 1JG6A 3HVHA 2DY1A 3RIHA 2I7CA 4RMNA 2AFIA 1MOSA 5LP6B 1Y0BA 5ED4A 2Y9PB 3CO5A 4L0QA 3FCEA 2H7VA 2QSYA 4K9DA 3RBZA 2QN6A 4R0MA 2JIZD 1PN3A 2C04A 3DLPX 3QMVA 3QE0A 4OIFA 3W5IA 4LMRA 1TAHA 5FR1A 1H4SA 3GWZA 2GXQA 4IRXA 4ZO8A 2Y76A 4LXTA 4F2PA 3BRQA 5FI1B 1NVVQ 2B1JA 3KZCA 2PRIA 2Q3CA 4FB4A 3EPHA 3OLYA 3QKRA 2LE0A 3GLKA 3NVDA 1M8JA 1L2TA 1Z6AA 2AN1A 4CTJA 5G0TA 1U2ZA 1ZI6A 3D3WB 4Z99A 5BPHA 1VOTA 4OQFA 2O5CA 3G0HA 4L9RA 3DXFA 2XV1A 3U0VA 2AA3A 1L4KA 2VHQA 1FDTA 3WXBA 5KNLA 1G3QA 2AEFA 3H9JA 4UEWA 1V1RA 2VS1A 1VFNA 4AMUA 4BX9A 2C5AA 3IEIA 4LYAA 2WUGA 4X1KA 3VJLA 4BE9A 1J8FA 1ODCA 2XODA 2LZ0A 4MVJG 5DGHA 2J6BA 4FU0A 4IQ8A 1RR6A 3MWDA 2DECA 5JJLA 2ZR8A 2W6CX 3GPDG 4KGDA 1L5SA 4LXUA 3O1IC 1YFLA 3PSHA 4TLLB 1OB2A 2C0CA 1M6VB 4QLOA 1KIAA 3ETCA 1VLQA 1XD8A 4PIPA 5BWCA 2PJRA 4OXKA 1YTUA 1HZZA 2VHJA 4UUMA 1AO3A 3DTVA 4HEJA 1KK3A 2CHVA 3EIEA 3C8UA 1VCOA 2VT6A 3HBLA 3NBZC 4JS0A 4EGSA 3A28A 3SNHA 3VPXA 4TTTS 1YONA 1R37A 1T8UA 2QZ9A 1QUEA 4WD3A 2NV6A 1AGYA 2ZK7A 3D6JA 4JAVC 3EGXB 3ESBA 4LTNA 4Y18A 1T5SA 2ONJA 3T3PB 3W3ZB 3DBRA 1KYWA 1SZCA 4MP8A 1Z4LA 3VU3A 4EGJA 4DMUB 5HCNA 2B4QA 3V9PA 5LOVF 1PL7A 3HCRA 5GJVC 3RVOA 3V97A 3QFTA 4D2IA 2H2DA 2JI8A 1H2AS 1E92A 3K6KA 1G8AA 4IJVA 1JHXA 4BC0A 3PGMA 4CTOA 4UNRA 4MEBA 4O6VA 2QL6A 2VJAA 3HB9A 4QE3A 1FX0B 3AIMA 5BQPA 4JCOA 4DCJA 2WWGA 3L9XA 4M0KA 1RZRA 1NXWA 3MB5A 2OP0A 1EK5A 1RM3A 4B6QA 5IN4A 4OGWA 3S2GA 5CDTA 1YZHA 4NICA 1C3VA 1VPEA 4MUEA 4ZHQA 3JYPA 2WB4A 3C6XA 1XZAA 1DO0A 3LDHA 4IX9A 4XCQA 5IFKA 3IUMA 2J0UB 4U9UA 1TK3A 3DYBA 3T6KA 3ZXSA 2ZBQA 1IHPA 4JEHA 1ZP6A 3GJTA 4QLBA 2CV0A 3OZCA 4H1HA 3NBUA 5CFZA 4YY3B 1EFHA 1DJLA 4WOBA 1Q12A 5A5GA 2HFKA 1O5TA 1T9HA 2XR1A 4DM7A 2X5JO 4JITA 5KQGA 3A2LA 3TXYA 5EJEA 3H99A 1D1SA 4KVZA 2NYUA 1TQ4A 1QIFA 3BMNB 3EDQA 1X14A 3GPCA 4ZPXA 1AHIA 1N92A 2HMSA 3ESRA 1UFRA 4M0CA 4LSZA 2ACWA 3DNPA 5LP1A 1YS2X 4M1MA 4U2FA 4PO9A 1CJCA 3UJHA 3ZV4A 1E2GA 2HIGA 3CZ5A 4ZJPA 4ZYLA 2V5AA 4CG3A 3AESB 4W5RA 3AVXA 1Z6ZA 5J2UA 5LQMA 2R1ZA 4HH0A 4ZU3A 1WZIA 3DE1X 1QGED 4DCMA 4UNNA 2WNSA 3VH1A 1GTVA 2L17A 3Q2IA 5EHGA 2WE8A 2HMTA 3JVUA 3DR3A 1U8CB 2NU7A 1U0GA 3PQCA 4HI0E 3P71T 4OUDB 1VPVA 4MQFB 3PFGA 3WYEA 3B5IA 3DFMA 4FQ7A 4GM4A 5C3UA 3UT6A 2QQ5A 3P9CA 2E48A 3GLVA 3N75A 4EVRA 3RUIA 1IPEA 1BROA 3W5UA 4C01A 2YUIA 4GI7A 5EIFA 1TVMA 3K96A 2X1HA 2OLEA 1Q22A 3V7NA 2SKCA 2BC9A 3G49A 3NAZA 4ZZ1A 4MWOA 1U9YA 1I32A 3ZOKA 4YUXA 3GH3A 4F4IA 3NC0C 2O2SA 1NATA 1CIJA 3ZCVA 2EKDA 3GARA 3PPXA 4L1KA 4PYMA 3H1TA 1QR2A 5JXGA 3PUXA 2DPYA 1GA4A 4XSVA 5EHXA 1DJNA 1M5TA 2I3AA 1SD1A 2FLVA 3D8HA 1L0BA 2JGKA 2X1MA 3RHSA 1VE7A 4PICA 3QTBA 5TMBA 2J9FA 4ETNA 1MZPA 4Z0PA 3A4TA 3G5AA 2JIZA 2ZU0C 2QMEA 3MLBA 3OG9A 4GSLA 4XSHA 4B0OA 4D98A 2C7OA 2I2CA 2PGNA 1M8FA 2QMOA 3AI2A 3QX9A 5EVJA 3OQVA 2Y0BA 1FTWA 3TKAA 4X71A 1HPLA 3HGQA 5DMXA 1LW6E 2C2BA 5DDIP 4NH0A 4HRAA 1M34E 2I6TA 1RZUA 2Q9AA 1UK8A 1S7CA 3V34A 1A2KC 1V5WA 4OK6A 4U7GA 3LPAA 4UUQA 4R31A 4ZC8A 1E3WA 3DQZA 2OHXA 3PZRA 2I4IA 2GK6A 2O2HA 1MENA 3WR5A 1ZD8A 4AJ4A 5U4XA 5LA6F 2OXCA 5C2JB 3CC8A 3A1NA 1K06A 3Q98A 4ZCPA 5E1BA 1N5LA 1PFUA 1BMQA 1CP2A 1E2MA 2P9FA 4R2IA 4BC1A 3D7NA 5AM3A 3PWTA 3ZDRA 5ILOA 1UL1X 3D3NA 4JT9A 1UXOA 1Q1GA 3IIEA 1MQ8B 4R9RA 2IU6A 3B1KA 1CT9A 5HSGA 3SQMA 1T9GR 4P0PB 4J1NA 3IDFA 4DMLA 4CQMD 4MGYR 4WAUA 4UTPA 2NLOA 4E6EA 1J5PA 3R6DA 5AWFC 3ZDXB 1AG9A 3IOBA 2V7GA 3HXTA 5KYVA 1RQGA 2B8JA 2VUUA 1G7RA 4AP9A 1KP9A 2V7QA 2OILA 3BXOA 2CCKA 2SCUA 2ZS8A 4OH7A 1ZWLA 2QAGA 4FYVA 5G53C 4OM8A 4B32A 4YT8A 1EAYA 1RJWA 1TUBA 1EB8A 4F3CA 2OK7A 5TPZA 4RXMA 3TLGB 1Q1BA 2NQTA 4N7JA 3FWHA 3VSAA 4Y2RA 5FOVA 4KYVA 5IT9A 4G89A 3AR5A 4GQIA 4UM7A 2VPIA 5EKTA 4HAOA 2PMKA 5DVZA 4UD2A 4QYWA 4TUYA 5AK3A 5AK5A 5FJIA 2NUTB 4RKRA 3TYXA 3BGWA 4G81A 3OPQA 3KJGA 3AO0B 3C8MA 4IIYA 1Z4JA 1UBRS 1E63A 1QE3A 3H9UA 3MIZA 1BDJA 3E81A 3NATA 1CXZA 2ZUVA 4CCWA 1B8UA 4MYHA 2I7TA 5K8TA 4KI0A 2REOA 2BP7A 3LWDA 2X9QA 3VR3D 4Z4QA 2EP5A 3PX2A 1SUAA 1U0RA 2QYTA 4NH4A 5AKIA 1KR5A 1U7HA 2GM5A 2GM9A 3DEYX 1JYSA 3E9CA 4QTYA 2JZNA 4QJBA 3UAVA 3BDIA 2BI4A 4CZ2A 3SIWA 4PPYA 3EK2A 3PQ3A 5EXXA 4W7SA 3TF5A 1JN0A 2VH1A 4PAMA 2XXBA 2IKSA 3AFIA 1XDZA 2IHYA 3HDGA 3QPDA 2FUCA 4WCFC 3BMXA 1H5UA 1WDMA 2RARA 3ER8A 2DQSA 4EB0A 3UJ6A 3OKFA 5IVPA 4JJGA 4YREA 5BURA 3II6X 2DLCX 1KK0A 2C29D 1KRXA 3NHZA 5LYJA 1G8SA 1LBQA 2P0EA 2ZIFA 2AMYA 3CX8A 1YHYA 3LT1A 4RE5A 4DJEC 2HBQA 4JWTA 3LTEA 3O8QA 5K09A 1MJ5A 1M74A 1FSPA 2R47A 4X65B 2PZBA 3ENQA 4MKHA 3IH5A 4ZYTA 3TIXB 3PJDA 2OM6A 2DQZA 4H4DA 3LWBA 4N4AA 4US2R 1JSXA 1UK7A 1ZHHA 5FF9A 2OGTA 2PJZA 2BMVA 1IN5A 2QX8A 2O23A 2WD7B 3GAFA 3HCNA 2XB4A 3JQQA 4OA8A 4Y6SA 4YO7A 2E5FA 1L3CA 2ASEA 1OFTA 5JHGB 1IMOA 1YS6A 3ONFA 1YOBA 1J09A 2Y68A 1VB3A 2QOEA 2OB1A 3C3PA 4B87A 2OBYA 4ZZ0A 3VH3A 1T2AA 1OXTA 2ZBEA 4JU9A 4AS1A 3PNMA 3Q3EA 3Q10A 5IX8A 2ORYA 2FMUA 4LF5B 4QEDA 3A25A 1R0WA 2ZRLA 3MWEA 3N2GA 1ULBA 4NENB 4BNWA 4G5YA 3A4IA 4OO3A 2X4GA 4G5RA 4RELA 1ZVMA 5FPTA 4YWHA 4E5NA 1Z5WA 1ZL2A 4RY9A 1NIJA 3CVXA 4TV9B 3BH7A 2NX2A 1JU9A 5CX4A 1DMRA 5AJWA 2OXIA 1PKEA 3KVRA 3S3TA 3I4FA 2AJCA 2D3WA 4MS4A 5AJTA 4JI8B 3IJPA 4C5BA 4IZ6A 2OYCA 3G5UA 3PHIA 2QG4A 1YB6A 1K66A 5BUCA 1ZSVA 2V3CC 4J90A 4BO8A 3JSXA 5FOTA 3JPWA 3L82B 4NNJA 1K7EB 4HWPA 5H68A 2WMNB 4FYWA 3RWOA 1S8OA 4CI9A 3A1EA 9ABPA 1RC8A 1I5EA 3NTUA 3G17A 4BVFA 2J48A 5DI9A 3K70B 3SIXA 3G9TA 1ST2A 4AYWA 2Y92A 4AQ7A 1K1EA 4KXLA 4ZJZA 3WJ7A 2AF3C 1KO5A 4MMXB 3UAWA 5HE8A 5BMOA 1I7DA 1H3EA 1WTAA 3NM5A 3KVNA 5FP0A 1CQIA 4FOOA 1DBVO 2IZZA 3K9QO 3HH8A 3OFVA 5JIBA 2FJ0A 3H8VA 3KQKA 3OOSA 3DBVO 1OI3A 4JIMA 1Y8AA 3U6BA 4I8IA 1K7XB 2DT8A 1D09A 2WZDA 3I6QA 4MV8A 4D4JA 3A36A 1RMQA 4M1QA 5G0SA 1U3WA 3U7QA 3WGLA 5KPJA 3CUVA 1OZGA 4KXNA 4PO3X 4ZRDA 4FFRA 4J16C 1YFJA 1CE8A 2B35A 3HB0A 3HFGA 1KOLA 3J7AC 3CCFA 1B26A 1KE1A 3VR6D 1XTQA 3L7OA 3KWMA 4CQMA 3DE0X 1T2NA 1VMAA 2B25A 3IUJA 3BD8A 2CL0X 4GPEA 3JQBC 1PWYE 1QIHA 4MARA 2I29A 3FMIA 4BNXA 1S2IA 1IHDA 4GS5A 3OURA 4KC0A 2G8NA 1WD7A 3AT1A 1ZISA 2NADA 5AKLA 1R6XA 2B4TO 3G7SA 3LQFA 1URPA 1N4DA 3ZHRA 1QU3A 3SEQA 2FZ5A 3P0HA 1YR7A 1MW9X 4N7MA 1B14A 4FCCA 2AG5A 4Q1VA 1IN6A 1OI4A 3T3DA 1I14A 2J07A 5BSHA 5KOHA 1CULC 4WXYB 1LJLA 1OQAA 5DIFA 4C1NA 4S12A 5ENZA 2IZ0A 1KVTA 4A1FA 4QC2A 4L74A 5AVYA 4RCVA 1N32B 5LMCA 4DY4A 1AM4D 5G0WA 5B36A 3GRPA 1XZBA 2HJVA 4CMEC 1U7DA 3VR3A 5E1MA 3B6ZA 2H4YA 2QVZX 4BE4A 1Q0RA 3PD0A 4XRGA 4OVKA 1IZ9A 5CAEA 3D8RA 1X0XA 2QTFA 3MMPA 3K30A 4L0MA 1N34B 4H18A 1G17A 4PTYA 3A8TA 3SM3A 1M5RA 3JV7A 1Y8ZA 5BQFA 3QVKA 2PXCA 2WKQA 2XMZA 4I9NA 2QL7A 1NG1A 1J24A 1OWNA 1K8XB 2JIDA 4OQLA 3RSOA 5DNWA 3EH1A 3JVDA 1O4VA 3ICCA 4DIBA 2OKGA 1YE3A 3B3QA 3HO8A 2IKQA 1L8OA 2O9JA 3NORA 4L5CA 1ZOSA 1EGHA 2BGUA 4G65A 4ZAWA 4EAAA 1A8IA 1O96A 3G5LA 3HYCA 2VAWA 3LMKA 1TZ2A 2QENA 3NWBA 5JV5A 5FDFA 4A8JB 1XMPA 4K9QA 4CKEA 1IQPA 1E4EB 2HWXA 3FMFA 4HQOA 4UAJA 3CWZA 3FX2A 5BN4A 4UVEA 2ZULA 5JXJA 4C9BA 4B3SB 4JVLA 5SZHB 4K9MA 4HLUC 1QGYA 2OAQ1 2WY2D 4O4LB 5A0TA 4N5DA 4RIGA 4XWGA 4DN6A 4U6SA 1WW2A 3VSEA 1LVHA 3LQ1A 3WQQA 5K0BA 1H0KA 3FAZA 4A0SA 4ZVSA 1AQLA 2WZQA 4X62B 3H9EO 5CB4B 5JPIA 3VHRA 1Z2PX 1AV6A 1KH3A 1NQXA 1T8PA 1V1MA 1RMTA 3NHUA 2JCYA 3O1JC 4FOLA 4Y2UA 3UXEA 2JZCA 4B9EA 2FH5B 3ELWA 3EG9B 4FFBA 3RIXA 4I1SA 2B78A 1H2RS 1AZSC 2WTXA 4JN6B 2YW9A 4M7RA 1RAAA 1N6PA 2VBIA 1YMUA 4C7JA 1A7KA 1FPQA 3ZV7A 2F90A 3HJHA 4WSOA 5CT5A 4D56A 4BQSA 1U63A 2GJSA 3R76A 2X5KO 1GT6A 3IERA 3KJEA 4DUPA 2VSYA 5JQGB 1ISMA 3K20A 3HLYA 5CNJA 2WHYA 4J0FA 4MUGA 1PWXA 4PBSA 1YK1A 1G2IA 2Z5LA 4D4LA 3IOCA 2ZBFA 3UJ3X 1AA6A 5BT9A 4O2RA 1O95D 1RQLA 5BRAA 4P7FA 2I6FA 2VK8A 2WG0A 4N54A 3KKOA 2V6IA 3K0CA 3KHUA 4WFKA 1KSGA 3VPHA 3OX1A 4JJFA 3SS9X 2CHQA 4LECA 4WACA 1D6SA 3DTTA 1RPNA 3AL0C 4D82A 3GEDA 4A6EA 2JLRA 3OBBA 5D3KA 2V59A 1I1OA 3PXGA 4M9RA 3N59A 1EX6A 2QUBA 3CMCO 5DM2A 5E4JA 1DV2A 1R64A 3AIKA 4M3NA 5HK9A 4PZLA 5K3SA 1AHHA 1MDBA 4IIJB 1HDRA 1R74A 5FI3A 1JG1A 3L0OA 5EJMA 1QPBA 2XUFA 1LQTA 4AJOA 1Q7GA 4X6UA 3ZE9A 2XYRA 4MW0A 4TX1A 4IOKA 1EWQA 4KDEA 2BSXA 4KO4S 3TNLA 4NJEB 1XMXA 2DHCA 3HJRA 5JS1A 1KZ1A 1W5TA 2B99A 4FBMA 1YU9A 2C9DA 4E88A 1CJMA 2QL5A 4C3OB 2FVXA 2D7JA 3CZMA 4QUDA 2CDBA 3LT0A 1CP3A 3DZJA 3AR7A 3QF7A 4GI5A 2H1IA 5EMNA 1AKVA 4KGXA 1N77A 1KDZA 4KNYA 2FPGA 3OQPA 4V0QA 1A2QA 3VR6A 4F3TA 2WVJA 3F5SA 3J7TA 3K6SA 3QI7A 3IRUA 2CVHA 1X7GA 3BF8A 3EMKA 1F3LA 1T4MA 1WG8A 5SZKB 4DIKA 2J0SA 1I2DA 5AXBA 1WWKA 2OMKA 3RK4A 2OR3A 4E46A 3FZQA 4AROA 1KEUA 2C4TA 4IQFA 2XQGA 1LW7A 4ZHQF 2GR9A 5FUWA 5KYWA 2H4FA 4PYIA 1UBNA 3VC3A 3PXUA 1QHIA 2PGLA 3UHOA 2Y2UA 1BX0A 2GJ4A 2V58A 3LXUX 1R88A 1VKHA 4FOPA 4DIEA 4DEYA 4DLNA 4UPEA 4ZT4A 3NEJA 3ICQB 4EMSA 2C0QA 3ZCSA 3U4GA 1RAIA 1TF2A 3DZBA 1MO5A 2PX8A 3C7TA 3ZN2A 3R7SA 1D5WA 3R7WB 2YHBA 3TKYA 3JWEA 4AY2A 1WF6A 2ZSJA 1BQ3A 2C2XA 1OBCA 4AICA 1QQBA 1M2VA 3SR0A 4M1WA 4CTNA 4LJ9A 4KGVA 2A30A 1HWYA 2AOTA 1WPQA 4S04A 4JJ6A 2ADMA 2FQ1A 1LPPA 4M7WA 3I61A 3UOGA 1U6JA 1J2UA 2IP4A 3ZQ6A 4AUNA 5J2UF 4L5IA 3KHKA 2H1HA 1E98A 3O3OB 1MVLA 2F9FA 3UY4A 2CMGA 2IHNA 4N3AA 2ADOA 1Z36A 4L07A 2OENG 3EXG1 3GJ3A 2BTEA 4MWEA 4M53A 5SV2A 1TYEB 3CBGA 4BVGA 4FNOA 2P3SA 1CUJA 1UDWA 3S7TA 1B6GA 4N7BA 3GLGA 1JLLA 3VQTA 2JLBA 1GP2A 2NO0A 5CVVA 3MGAA 4MR8B 3V2HA 4D0SA 4REMA 3KKKA 2C9YA 1PJRA 1FTYA 1EFVB 2F3PA 1QVRA 2WAAA 5CK5A 5DBHX 3WIOA 1PV1A 2VHEA 2ZXEA 3LBHA 3H3XA 1XWIA 4PS0A 2GS9A 4IIDA 4LJKA 4MRMA 4CMAA 4CQLA 1IWBB 2LCIA 1RRVA 3IAXA 2R85A 1WV0A 1X7DA 5LPNA 2EJCA 4WLOA 5K6RA 4MGKR 1H85A 1P2TA 2CNWD 2OZLB 1PLLA 1HR0B 1JFTA 4PC1A 2CXOA 1AVTA 5A02A 4J7AA 4UNSA 4U8GA 1HE1C 2FMFA 1PRYA 1YBFA 3CKMA 1DCFA 2I8CA 1ZAYA 5CXXA 1VJ1A 2PN1A 1DEKA 2NZJA 3LU1A 3KO8A 1QKIA 2Q0SA 4MW4A 1NNLA 4MWSA 1AH2A 1QBGA 1PAUA 4PTZA 1OXSC 3PD7A 2RGXA 3BHNA 2R6CA 4OSPA 3L4JA 3E8SA 3V8RA 4Q4DA 3ZHXA 4JP1A 3VO8A 4P98A 3B82A 3NV7A 1T9KA 1CRZA 7REQB 4G1MB 3CB2A 1UJ6A 1G6Q1 1O95A 2VOEA 3R23A 4X54A 1RHQA 2XWJI 5FFNA 3L1UA 5LYYA 1SXQA 2FN3A 5C1DA 2ZYUX 3E22A 2KM1A 2QV7A 2FWIA 3ITEA 2ZAOA 4CFZA 4DQDA 3BTOA 1G1MA 3SJCA 3RBVA 1TEZA 1S3FA 2QRKA 2H18A 2PD6A 2W71A 1Z4OA 3AKEA 4MLDA 1K0UA 2Q3DA 3VMMA 1U0NA 1GIAA 2P62A 1BU5A 3G6WA 3K5WA 4RGYA 1KBQA 4D8VA 1GAXA 5KZMB 1M8KA 1NNI1 1JHPA 4YQYA 5E8RA 3EC1A 3N0XA 3Q9SA 4L51A 1F4LA 4HT3B 3EQ9A 3TZ6A 3WA7A 2RHTA 5G40A 1Z4NA 2X8JA 3JYNA 1E5VA 5AI4A 3ZBTA 1EUQA 3CPSA 1LLUA 3ZU2A 1E2QA 3HXPA 3ER9A 2ZYWX 3RYHA 3A4LA 4BO7A 2C92A 3DDNA 1RJ9B 1KEEA 4QAJA 1GV0A 1NI5A 2IGTA 5LLSA 3N0WA 3LQ4A 4DIDA 3SYMA 2NOAA 3CW8X 2XNKA 1E2LA 4PN7A 3GCZA 5IDWA 2AMFA 3CTPA 4EUSA 4YXWA 2CHEA 2HEIA 1RAEA 2Q3LA 2RHGB 3H2KA 4M7OA 3T5MA 4DUGA 3HEAA 4L73A 1XDDA 1RI5A 3D0KA 1NU8A 4UHFA 1RP7A 4TUYF 1IJFA 3E3AA 1EIWA 1TM4E 4WUTA 4Q7QA 1C3XA 3B6EA 1JZSA 2DJ5A 2O05A 3WYGA 1Q5PA 5J4YA 2VQ3A 4R1LA 2VF7A 3LVQE 2GH1A 1DGQA 3RAFC 1C9DB 4TVKA 1T24A 3IAEA 5CT8A 4N5HX 1XPUA 2PRSA 1JSZA 3AHFA 2GRUA 3R2JA 4H1UA 3GH1A 4D92A 5ECYA 5ETJA 1BRTA 4IICA 3JARB 1BDIA 1DBSA 1CUFA 3I0NA 3SN6A 2I6QA 1TO1E 1H22A 1K3FA 1YS1X 3FZYA 4HCJA 5JZVA 2H4WA 3LHKA 1R0RE 3KDPA 2B82A 5IJXA 3DKVA 3BGVA 3A1DA 2EEPA 1C29B 1VI6A 2GHQA 2Z5VA 4G1EB 2F1RA 3W06A 4BKRA 5HIKA 4BO4A 4GU5A 3DC2A 5AK6A 2UVPB 4X45A 5LYJF 1GGMA 4I14A 4XGKA 1AMUA 2HAEA 4LXGA 3HA2A 4Y1RA 3U3DA 1H2HA 1PQYA 4ZAGA 4J4HA 1L5HB 3HO6A 1GCIA 4TXNA 3WGVA 1Q7EA 1I4TD 2PU7A 4ZYXA 1UT6A 2JFHA 4L57A 3URKA 3I2IA 4C0BA 2WTMA 4BKOA 1DADA 1N75A 1A9SA 3AZPA 1D0IA 5M34A 4MOWA 3ABRB 4GM0A 4QSHA 4YCBA 1LQ2A 3F90A 2IYYA 2JGDA 3KC2A 3ZH9B 1MIHA 1M9NA 2FUG6 3HDVA 1O6BA 5F23A 4W1RA 4NPAA 2VP3A 4HDOB 1GTSA 4DJFC 1E60A 4DW8A 4ZO9A 3CNBA 3VYUB 1TRHA 4DLSA 1QZ3A 1SJ9A 1EK6A 2ZRHA 4IV5A 3T7SA 4AJ9A 3KQQA 1PJTA 3OFND 3FWZA 4YALA 1IWOA 3RYIA 4G1CA 2F2TA 2QR5A 4CKCA 3V42A 2E6UX 3QEMA 4HGPA 2X86A 5E7MA 3WGMA 2PBFA 4F1KA 1I33A 2QG6A 3L6OO 4QATA 1NUAA 1E2NA 1AOXA 2ZLBA 3LUBA 3F3MA 2FRVA 4KI7A 4Q7JB 5E7QA 2K2WA 3KFVA 4E4TA 1CDEA 1WW8A 1ZR2A 1ZJWA 2R6GA 1X0VA 2XQVA 3MCUA 2XSZD 4CM7A 4GEKA 4N9QA 2CNWA 3K32A 5DYTA 2P9GA 5KDDA 5C5CA 4Y8VA 1Q0HA 1AURA 1CUEA 2I1WA 4R84A 4Z9FA 3PPIA 4CDGA 3PA6A 3A7EA 2NZ8A 1Q1QA 1Q74A 1SUDA 5DHRA 2EC5A 2PXXA 4MYSA 3NT5A 4QRDA 4NYIQ 3OJLA 3D7KA 4GGPA 1VGQA 1C1XB 2QR3A 1DPGA 1ZJJA 5DM70 4KGZA 4YMUA 2OXRA 2I87A 3BRCA 1XEAA 3O8OA 3PHJA 4XYGA 3V8PA 1PR0A 3FWKA 2QVGA 3MAJA 4U9HS 3HJTA 4EZEA