5CFZA

Crystal structure of e. coli fabi in apo form
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
249
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
publication title Crystallographic insights into the structure-activity relationships of diazaborine enoyl-ACP reductase inhibitors.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Oxidoreductase
total genus 90
structure length 249
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5cfzA00
2I99A 3GGPA 2XAAA 4I5FA 1UZNA 3VH1A 1NWCA 2VOJA 3F1LA 2QQ5A 4P22A 1E7WA 4XYMA 1AHHA 3D4PA 1DIGA 1HKUA 4NIMA 3SC6A 1DIHA 4TKLA 2Q49A 1P33A 4RPKA 4BHTA 1NASA 2PD4A 2BF7A 2QIOA 4FJ1A 4LISA 3EVTA 4ZQEA 1HT0A 4J4TA 3DXFA 5DT9A 3PLNA 4CL3A 2EXXA 3KXDA 3JYLA 1NM5A 4DMLA 4CUKA 2C59A 3L07A 5G4KA 4IMPA 1GZ3A 1ISMA 1BG6A 2DBZA 4J49A 2Z5LA 2O3SA 4KWIA 1O8CA 3NEPX 2HKIA 2CDBA 1HRDA 4D46A 4DPKA 5L51A 1FJHA 4IGFA 1T2AA 2WE8A 3GZNB 1LJ8A 3RC1A 3OFSA 3ZWMA 1G0NA 1GZ4A 3R1IA 4IY1A 1PS0A 4WLUA 3RAJA 4BMVA 1KVQA 4XQEA 1Q7BA 2E82A 2O23A 1OC4A 1UR5A 2WM3A 4N54A 4WCDA 5HWSA 2D5AA 3UHAA 2RCYA 2LDBA 3MJSA 4CR7A 4RVUA 1EUCA 1R12A 2O7QA 2Z1NA 4CLRB 1CDOA 1U2DA 5A9SB 1BRMA 5L4SA 3DFZA 4JXKA 5DN9A 4BL5A 3GAZA 4WCFC 4LRSB 4JJFA 5F1PA 4L4RA 1BHSA 4G5HA 1X7DA 4AICA 2O7SA 2NV6A 3BXXA 1RWBA 4D79A 3Q2IA 1UP6A 2HK8A 3LT2A 3MJ4A 4CQMB 1IE3A 1AXEA 4XB2A 4WNCA 2TMGA 3U62A 4RPHA 1U7HA 1ZK0A 2QYSA 3D3WB 4FFOA 1JKJA 1UAGA 3ZHYA 5BT9A 4JQCA 4CMBA 4L76A 3PJDA 4XQCA 1XWFA 3TZHA 4R01A 4WK6A 1IHXA 1PJ3A 4R3WA 1BW9B 1RM0A 2VYVA 2A94A 4A10A 5C5IA 1J0XO 1WAMA 2D59A 1ZVMA 2JHGA 3L0DA 3AUAA 2B5VA 3GMSA 3EUWA 3F47A 4R16A 4XDZA 4R54A 5T57A 4EITA 4BV9A 2DFDA 3P2OA 3K92A 4IDGA 4FGWA 2W4QA 1P77A 3WS7A 3QWFA 4HUJA 4OSOA 5A4DA 1B8VA 3DMYA 2NVWA 1W0CA 3JYOA 1DHTA 2CF6A 1RYDA 3OP4A 3PRJA 4A7PA 3QV1A 5DP1A 2UUPA 1NVMB 3NGLA 2D5CA 3H65A 3FPLA 1GFSA 1KEUA 5A9TA 1PZHA 2B5WA 1B7GO 3QVWA 3WR5A 1IZ9A 2CD9A 2IXBA 5TX7A 1H9AA 3A1NA 4R1NA 4UULA 5AOVA 3D4NA 1V3TA 1XHLA 5A3JA 4XIYA 3ZWOA 2D4AA 4Y6PA 3D5QA 3NUGA 2JJYA 4RDHA 1V9LA 1I36A 2VRBA 4DVJA 1MV8A 1Z7EA 2QG4A 3EDMA 2HSDA 3UN1A 2W2KB 2W90A 3K9QO 3KRTA 3I6QA 5THKA 2D2IA 2Y0CA 5ENDA 3PHIA 4FC6A 3PYMA 1SB8A 1WWKA 1KIFA 4FIZA 1ID1A 2CDCA 3B1KA 4ZN6A 2RBEA 4DC1A 3V2GA 2P4HX 5ICMA 1DOHA 3WJAA 4E2ZA 2P9GA 4E12A 4B79A 1J6UA 1YDWA 3R0IA 3PXXA 4HFMA 4YPOA 5L40A 2PWZA 4IS3A 3NGXA 4WLFA 3T7CA 1KVTA 3TZQA 2PFGA 3ASVA 4ZQGA 3FBGA 4JK3A 2CVZA 3C8MA 5JSFA 2P9EA 4QECA 5KKCA 1BGVA 4DTIA 3NT2A 3HHPA 4JBHA 1KVSA 4J91A 3KLMX 1ZZEA 3L6DA 1DC3A 1LXCA 4YJFB 4XR4A 3VZPA 4ZQHA 1IPEA 2E49A 1IULA 4Q39A 2ZTMA 1ULUA 3S2GA 1ZO8A 3GN1A 3I4FA 3DQPA 1JKIA 1UJMA 3BA1A 1B26A 5MGBA 5CG1A 4W9NA 3ETEA 3MTGA 4XA8A 3SXPA 1ONNA 3HB4X 5K6AA 2GZ3A 4JP3A 3V8BA 4BNMA 4A27A 4YVFA 3PHLA 3JQ7A 1QG6A 2R6JA 3WB9A 4DC0A 4XRRA 4EEXA 1YWGO 1JQBA 3G1UA 5CG2A 1DAPA 5FI5A 5CFZA 1LLCA 4MVJD 3GFGA 2VZ9A 3VPXA 4QEDA 3PJEA 2RAFA 4HFRA 4BKUA 4Q3NA 1R37A 3DONA 3NDRA 5TJ9A 3KYBA 2NWQA 1JU9A 3ONFA 5L3ZA 4BGUA 3S1LA 5A04A 3DHEA 4QFCA 5CDTA 5EJ2A 4Y6RA 4MO2A 1ZMTA 2W2LA 4LSWA 1YS4A 3W1VA 2Y1GA 4NBTA 1DFHA 1KBZA 2AEFA 3DZJA 4UVDA 4BNUA 4DQXA 1HE4A 4D0SA 3OQ6A 1A7AA 4HY3A 3FPCA 3RUAA 3ITDA 1A27A 3EZYA 3RUFA 5T64A 1H94A 3JYPA 1DLIA 4TVBA 3QY9A 5F3RA 1SEPA 5HBRA 2OXIA 2R2GA 4MVJF 4PLGA 4GMFA 2Q4BA 1NP3A 4BB6A 1XIVA 4R3NA 4BMNA 1WMAA 5J23A 1E3WA 1YL7A 4Q3CA 4DREA 3QP9A 4NG5A 2VWQA 3VAZA 3DB2A 4EEZA 1V35A 4JJGA 4P4GA 3SVTA 4M49A 3AY7A 4YWJA 1P74A 5TC4A 4E30A 2VYNA 4W7HA 1PQPA 3JQBA 1SZJG 1QMGA 4OQYA 1FDVA 4WJZA 1ZFNA 3PQEA 1GL3A 2GGSA 5K0ZA 2YW9A 1VJ1A 1UDBA 1CRWG 5EN4A 6ADHA 4L8VA 4NI5A 2VUUA 5IXSA 5JDIA 1ZK3A 5LCXA 3I3OA 1LSOA 2O4UX 4CV1A 4IIVA 3OJEA 2IEBA 1TT7A 4ZQBA 9LDBA 2I76A 2HRBA 1U4SA 4NR0A 2G82A 3U4HA 4PLPA 1F12A 4NBRA 4UVEA 5AXAA 4NJOA 1QR6A 1DJNA 2Z1MA 3C85A 4XGIA 4FD3A 3E03A 3E9QA 3V1YA 4CMIB 5DCYA 4ALJA 4IPTA 4KDEA 4OXKA 1J49A 4L75A 2HUNA 3QW2A 4WLNA 3B70A 1H6AA 1F17A 3QVOA 3UGKA 1LLQA 1Q1NA 2YFQA 3JD2A 3I83A 2B69A 4LRTB 2WMDA 3AOEC 3ZV6A 4ND1A 1ENZA 1SOVA 4MPDA 3ZWXA 4KUHA 3BTOA 1P44A 4B4OA 3CZMA 4P4NA 1PJ2A 4R4JA 5IZCA 3TRIA 4GMGA 1HXHA 1U5CA 2VTEA 4DLAA 2JHFA 5CEJA 5JFOA 3DZIA 4BKQA 2XPCA 5C7OO 1UXIA 1HWYA 1ZUD1 3U3XA 3ROPA 3M2PA 3F46A 4XGKA 4ZRMA 4F6CA 3KBOA 4PZDA 3PZBA 2OMEA 4ND3A 5DCWA 1LDEA 4EUEA 1YDEA 2QRJA 4F46A 2BGLA 1KY5A 3HZZA 3A06A 1MG0A 3UICA 2FR8A 1RKXA 4ZRNA 4ND5A 3OJOA 3H9JA 4C7KA 2IZ0A 1DFGA 3GHHA 4S3MA 1BVUA 2AQIA 3BMOB 4IUYA 4XYGA 1LBEA 2YDXA 3CMMA 3S8MA 3Q11A 3AM3A 4KP7A 4U6SA 4CMJA 4IDBA 4DLLA 1C14A 4IQGA 4RGBA 2X9NA 2PGLA 4TRRA 2WYVA 4RZIA 4YB8A 3E8XA 5CEEA 3AOGA 3GDGA 5KJ1A 1W4ZA 4YT2A 2Q2QA 4WEQA 1XU9A 3R3SA 3BMQA 4WCFA 1QP8A 5GY7A 3WGHA 3GZ4A 1X0XA 3H2ZA 4IDDA 2VOEA 3DO5A 2GN4A 3KV3O 1EFLA 2Q99A 1GDHA 4R9SA 2OBYA 1TI7A 4J0EA 1LSJA 4TRNA 1JN0A 4FN4A 4CLOA 2O3QA 3ZU3A 4BQPA 3EY4A 4O5OA 1YRLA 2DPHA 3I4CA 4XYLA 3OJ0A 3FWZA 4R41A 3PVZA 5DZSA 1CWUA 4DGSA 1ZKMA 3OM9A 1AN9A 3CIFA 3EAGA 1TVEA 5I7FA 2FPGA 1HDOA 5EINA 1GYRA 4MINA 1PJBA 1NPDA 2CMDA 4YACA 3U9LA 2HMTA 3KB6A 2Q45A 4CMCA 4XJSA 5F5NA 5DP2A 4UVGA 4RPLA 3HNPA 3WQRA 2BMAA 2Q1WA 1BXGA 4IZHA 3INGA 5JBIA 3BMCA 2P5UA 3F9IA 4R9RA 4XYEA 3HFSA 2GUGA 2O48X 2H6EA 4ALMA 3GGOA 1I2ZA 2GERA 4KUGA 5CDGA 3BYZA 3ZWNA 2CFCA 3H7AA 1GCUA 3VHRA 1GYPA 3N7UA 2YHIA 4DWVA 1ZK1A 1I24A 5IDQA 2F1KA 4C4OA 1I10A 4NU6A 2UAGA 3EMKA 1A72A 3QA9A 5G0WA 3JSAA 1U8FO 1N92A 1CIVA 1GPDG 2X9VA 4J1SA 3ZNOA 4MIYA 1UXGA 4CLXA 2VHXA 3RC9A 3VTZA 4E6PA 1E3WB 5ENVA 4FB5A 1E3EA 3RUIA 2AHRA 5H81A 3PGXA 2ZB8A 1YJ8A 4WKGA 1LU9A 3JQGB 3ZWAA 2CSUA 4NFYA 1E3SA 4CUZA 3FNHA 5C7IO 4O63O 1BVRA 2X58A 3GPIA 1XELA 2ZJ1A 2HMVA 1P1JA 3TJRA 4PZCA 1F8GA 2ZKLA 3C7CB 4FFMA 1PQUA 2PZMA 1ADBA 2RH8A 2YQ4A 1LRJA 1PSDA 3WMWA 5DNAA 1HTBA 2VZ0A 2Y66A 1PS9A 5CAEA 1WMBA 2H9IA 3O4RA 1L7DA 4EGFA 5L53A 3PWSA 3CMCO 4ALNA 1B15A 5G0VA 4M86A 4DQVA 3H5NA 4YAEA 3ROMA 4DPLA 2Y1DA 1HDCA 5EESA 4PLHA 3P2YA 4FSHA 1P3DA 4M87A 4NQZA 5HTOA 1LLUA 1GZ6A 4PLWA 4IIUA 2X6TA 4ZICA 1O94A 3A9WA 2OO5A 4U6QA 1T2DA 4GX2A 5IDXA 1R4MB 1YH3A 2PKRA 4RO0A 3GRPA 5JDCA 4OL9A 1YQGA 3GF4A 1UXJA 2OFPA 1T24A 1NAIA 2OORA 4IINA 1ONOA 4AJHA 5TS3A 2HLPA 1YQDA 3D64A 4YT8A 3C7DB 3WX0A 1U2GA 3HSKA 2I5PO 3FR7A 1B2LA 3BHIA 2PR2A 3DR3A 2IRWA 2AA3A 3W4JA 4HWKA 4E5MA 1ZW1A 3GLQA 2V65A 2VCYA 4YDRA 4NJMB 1CERA 1Z6ZA 4NBWA 4E0BA 4KDFA 3DMTA 1I3NA 4LMRA 1F14A 5CPBA 4E3ZA 2Q2WA 3HN2A 4OXNA 1HEUA 4FQ8A 4OXYA 4DYDA 4UEJA 5CDUA 1T2FA 3WTBA 5JNLA 1ONPA 2DLDA 2JD1A 5KVVA 3VH2A 4HNHA 3D1LA 1V3VA 1MG5A 2CVQA 3W4IA 4WPGA 2DBRA 3DZBA 3ZWVA 3W6ZA 4LVCA 3O9ZA 1Q7GA 2QYTA 4WECA 3WNQA 4BO0A 2C82A 3PI7A 3K2EA 1RM3A 3LYLA 3A14A 1IHYA 3WBFA 4M55A 1G6KA 2VRCD 4KOAA 4LN1A 1I3MA 2YFHA 2VWHA 3RVDA 3WYCA 3SEFA 1YBVA 2ZCUA 3G3EA 1O89A 1X7HA 2H63A 3BMQB 1UH5A 1LQUA 4YAGA 2BI7A 4DL9A 1C1DB 1KY4A 1I3LA 1SBYA 3MWDB 2Y93A 4IM7A 2VUTA 4IBOA 2WJPA 1DC6A 3LU1A 3DAPA 2Q4EA 4CM8A 2NU9A 3ADPA 1Y6JA 3TZ6A 3OIDA 4UEKA 1P1KA 5AYVA 4CLOB 3GHYA 3KZVA 4E2YA 1LTHR 1EVJA 5H82A 1V0JA 4M54A 1T1RA 3FN4A 3INTA 3NT4A 5F21A 3RROA 3CSDA 1SB9A 1X15A 3MZ0A 5IN4A 1OC2A 2B0JA 4GVXA 1VL0A 2IODA 4J16A 2EKPA 1EEHA 4IGEA 1DRVA 3E1KA 5ER9A 1LEHA 1CQJA 3H2SA 5JAZA 3HFGA 2GZ2A 3AK4A 5L4LA 4CLHA 1PGJA 1B8PA 1N8KA 1Y8QA 5L4NA 4XCVA 3PYLA 1SAYA 4YRDA 1FF9A 3W8DA 1Q0QA 4IZIA 1RM4A 3ANNA 3LK7A 1V8BA 3AUSA 4G81A 4OSPA 1Y7TA 5I7SA 3BMCB 1UP7A 3TN7A 1V3UA 4GWGA 3WMXA 3GMDA 3NYWA 2BD0A 3GR6A 4BO1A 3KEQA 5DOVA 5CP8A 1BMDA 3CKYA 1QYDA 3CZRA 3U49A 3RFXA 2YHIB 3Q9UA 4D7AA 5LC1A 3ZV5A 1LC0A 5G4LA 3JD4A 4XEHA 4E5KA 4GH5A 3AOEA 4MDHA 4BNVA 4BNFA 3W8EA 4R51A 1KOLA 4I1IA 1FMCA 2FSVA 1TXGA 5KWEA 4U7WA 1WNTA 4R69A 4QTZA 5JC8A 2YYYA 3UCFA 4U0KA 1GU7A 5C7LO 1GYQA 3SLKA 4Q3BA 1NR7A 2UVDA 4HADA 2X4GA 3BAZA 3GVPA 2WD7B 3JD0A 4ID9A 3EZLA 3SC4A 2Y1EA 4H7PA 4YJGB 4R1UA 1LQTA 1K3TA 1WLYA 4PLFA 3U09A 5JMPA 2B37A 2EG9A 2BFAA 2HMSA 4L73A 4AG3A 2Q1TA 2Q2VA 3MJTA 3GA0A 3KLPX 1LUAA 1P1HA 1S6YA 5EL0A 2E48A 4JLWA 4XQGA 2AQ8A 3D3EA 3OA0A 5EERA 3OETA 4CM9A 2VUSA 3WNVA 3INRA 4ROSA 5IN5A 5ER6A 4CLDA 2IZZA 4WLOA 3I9MA 4IDEA 1ADFA 4NBVA 4YT5A 4RF3A 5B12A 1CQIA 5U1PA 3QWHA 3LT4A 1N5DA 1GEEA 4PLYA 1R0KA 2RHRA 3HQ4O 4PVCA 3VDRA 1FDTA 3IAHA 1DB3A 3DWFA 1I2CA 3JQ6A 5JMWA 4L9RA 4YA6A 3L4BA 2GN9A 3AJRA 1AUPA 2HMWA 3F6YA 3WGIA 3CEAA 1LDGA 1JA9A 1ENOA 1U7TA 1D3AA 2EGHA 1U3UA 4RF2A 4BMSA 1TA4A 5FFFA 4J1QA 4BO5A 1T2CA 4MKZA 4OMUA 1T4BA 8LDHA 4CMEC 3V2UA 4EBFA 1C1XA 4K9DA 4EZBA 3AY6A 1QYXA 3KYCA 4PZEA 4E5YA 3PTZA 2FY8A 2HMUA 3BIOA 3DAFA 4Y9DA 4WGGA 3U4CA 3FD8A 4KMSA 3E9MA 4OKIA 3NTQA 1EBUA 1CEQA 2QRLA 3E48A 4TMFA 2G76A 3DBHB 2HCTA 1E1NA 1E1KA 3IMFA 3LC2O 2FR0A 2JCYA 3C1TA 3ZHZA 4J7XA 4RVDA 1HDYA 2VQ3A 3ENNA 1DBVO 1DXYA 2AG8A 3ADOA 4CQLA 1YB1A 3PIIA 3I9KA 3QSGA 4TSKA 2NTNA 1G1AA 4UUOA 2JD2A 3HADA 4D43A 2PY6A 4CM1A 4OHUA 3DZFA 3GEMA 8ADHA 2WEKA 3ETDA 4Q3EA 5DCUA 1HDGO 1PGOA 1M2WA 4A5OA 1WP4A 2H5LA 1U4OA 4AJPA 1FDUA 2DM6A 1MC4A 2NVUA 4PG5A 3UW3A 4MVJM 1B0AA 1E3IA 1O95A 2EF1A 2O50A 4YAIA 1MFZA 1KS9A 3QVSA 1R66A 1FDSA 3LZ6A 2VTDA 3DHYA 1ZIDA 5IFLA 2E6UX 2VHVA 3JYQA 2X5OA 1EUZA 4TZKA 3FNFA 1P0CA 1NPYA 1PTJA 3JQAA 4GI2A 4D45A 2Y0EA 2I67A 5ITWA 3MJCA 4J1NA 4DQUA 2O3JA 1T4DA 5CDYA 1LSSA 4FOOA 1AGNA 3L9WA 1H6DA 1SCUA 3AU8A 1DFIA 2DQ4A 2RIRA 3OECA 3WYBA 4D41A 1IL0A 1H2BA 3H8VA 4FW8A 1LRKA 1TT5A 2I3AA 2W8ZA 3ONEA 2YV1A 3L4SO 1ISJA 1WDKA 3O26A 3H3JA 4CM6A 4ESOA 5JYEA 1VC2A 2DKNA 3WWYA 4E4YA 1B3BA 2ZYGA 1K6XA 4CODB 4U0JA 4FOSA 4PLTA 3ST7A 1HDRA 4HV4A 1XYGA 4WE3A 3UFXA 2R00C 3DAGA 3RI3A 5L9AA 4MIEA 2GN8A 3LQFA 1PZGA 5A03A 3PYXA 5IAAA 3DBRA 3OA2A 3GDFA 3FNGA 2FWMX 4BNZA 1MP0A 1E6WA 3JQFA 3PIDA 1NQOA 1X13A 3CE6A 4D0RA 3HN7A 1EVZA 2GYYA 1YB4A 3OEYA 1B8UA 4BGIA 1KC1A 4YTEA 2Y1FA 4CM4A 3IQDB 2VT2A 1HDXA 1VL8A 1HYHA 1OMOA 5G4KB 3GAFA 4L0QA 1R15A 2OZPA 3B20A 4TVOA 1ZXBA 1B14A 3RBXA 1FK8A 2NM0A 4AJJA 3ABIA 2AEJA 5I9MA 4IQ0A 1WZIA 2JFFA 2FMUA 3GOHA 1PS8A 2AQKA 3LT1A 4FGSA 2ZTUA 3TNLA 3L9XA 3ZDFA 2EJVA 3L77A 1EVIA 4PLCA 3VKVA 3NTRA 3WTCA 5U9CA 1IZ0A 1GADO 2NLOA 4K28A 1CYDA 3ZWCA 1IUKA 1D4FA 4INAA 4TWRA 4BNNA 2JL1A 1ADGA 2CY0A 2ZTVA 3CTMA 4IXWA 4CLEA 5B4UA 3ZU2A 5KKAA 3IL2A 1SEVA 3DBLA 1HLPA 2B35A 2C29D 4GSLA 4KQXA 4NDNE 1I32A 2BGKA 4RPJA 5JCJD 2JFGA 3PWZA 2IE0A 2POQX 4RL6A 5H83A 1M67A 4F3YA 2P2SA 3QRWA 1Y8RA 2X23A 2HK7A 4NFSA 2EJWA 3TSCA 2BFMA 4J2OA 4IJKA 4YRAA 4AJEA 3VH4A 3ZCXA 3FTPA 1S7CA 2OHXA 3ZV4A 4Q3AA 4JROA 3UKOA 1YKFA 4K6CA 4KTTE 3BHJA 5EQDA 4N18A 2OGUA 1EMDA 1T25A 4MKRA 3S2IA 2BFPA 1A9YA 1RM5A 3GC6A 1A4UA 1CF2O 1KERA 1D7OA 1T2EA 3AM4A 3KYDA 4CQMD 5I7VA 3EHEA 3O38A 5AXCA 5C37A 4AJ4A 2NQTA 3GNSA 4KTVE 3M1AA 4TQGA 3N74A 2BH9A 2Y05A 1JVSA 2EW2A 1XU7A 1JTVA 1LI4A 2JFHA 2WDZA 3P19A 1H6CA 4QQRA 2E37A 3AUTA 4JJIA 3HDHA 2Q50A 3IKTA 1FDWA 1MLDA 2C0CA 1HZJA 3GVIA 4AJLA 2X22A 3JQ9C 1Y5RA 1SOWA 1A9ZA 1C0PA 2C7GA 2Q1UA 5L45A 4IJWA 2NU7A 3RC2A 1GD1O 3NKLA 4OO3A 2DT5A 1YBAA 5IDYA 3WXBA 4F45A 4Q3DA 5DULA 1EBFA 4NPCA 4CQLB 3X2FA 4KWHA 3E18A 2PGJA 4D3SA 5THQA 3OBBA 1LDYA 4YRBA 2XXBA 4P8RA 4LCJA 1GQYA 4E33A 2E4AA 4Z0TA 3RIHA 1LDBA 3AFNA 1PIWA 2VHZA 2X9GA 5KVCA 1D8AA 4W7IA 4J7UA 1A4IA 3KSUA 3QJ5A 3FF4A 1VSVA 3HJAA 2QHXA 2NVUB 3C24A 4HP8A 3WGYA 1XKQA 2A92A 3VVBA 2C5EA 2J5RA 4J4BA 1BTOA 3GEDA 4GX0A 5BSGA 1DO8A 4CM5A 3UUWA 5IDWA 3SBOA 4BGVA 1ML3A 2ZYDA 4DPMA 3KM0A 4CMAA 4R5HA 1I3KA 1JKFA 1NXQA 4CV0A 2NTJA 5AVOA 1VI2A 3QQPA 2EV9A 4QSMA 4UAGA 4MVJI 3IKVA 3JV7A 1ZBQA 3D0OA 3WJ7A 2GO1A 1Z75A 2NACA 1L1FA 5KVSA 7MDHA 4OH1A 1MFPA 2IDZA 1UAYA 1E77A 1UDAA 2ZCVA 3LVFO 3RBVA 4RQUA 2PD3A 1XQ1A 2X0JA 3GRKA 2Y68A 4MP6A 3ZHXA 4E32A 1D1SA 3C1OA 3MJVA 4YJHA 4K1LA 2ZB3A 1QXSA 2CZCA 4HBGA 1NVTA 2I6TA 3WIEA 2SCUA 2Y67A 3AUUA 3WFIA 4BV8A 5TSDA 1I0ZA 4L74A 4DA9A 1NYTA 1YBMA 4MVJG 3EVNA 1QYCA 1XQ6A 4M89A 3ZU4A 1MB4A 3JQ7B 1GR0A 4CV3A 1DDOA 1YVEI 5L7TA 3WG9A 3F5SA 4Z9XA 1I33A 2HDHA 3PFFA 3PQDA 4MVJP 2QRKA 4Z9YA 3RKUA 5A02A 3PWKA 1GUFA 4R1SA 4E2XA 4P4LA 3ZWYA 3IIEA 4NFHA 5KCZA 5JCXA 1PR3A 2HQ1A 4BS9A 4XB1A 5KTKA 3EYWA 1RJWA 2D0IA 3I6IA 4UUMA 5U4QA 1LLDA 2ZTLA 1EE2A 3UOGA 1LA2A 3MWEB 4PFJA 2DTDA 3ONDA 4M8SA 2FZWA 4CMHA 5HRUA 1H9BA 2YY7A 2IYPA 3RSHA 4E5PA 4XRGA 2O2SA 1ENYA 4EJ6A 3AI2A 5HM8A 1DIBA 3K31A 1ZK4A 3PHGA 1HETA 2OP1A 4AJ2A 4XYBA 2HO5A 4MVJE 1ZSYA 1E92A 3FSRA 4DUPA 1KC3A 3TDKA 2EEZA 1C0IA 3H9UA 3VDQA 2HJSA 2FZEA 4DIFA 3WQSB 2JD0A 4NH4A 1O5IA 4Y8VA 3RFVA 2B36A 4MVJA 3PDUA 1G0OA 1IOLA 4N7RA 1GEGA 4PG7A 3RKRA 1XDWA 5GZ1A 3AU9A 3TZCA 1T1SA 3UCXA 1XG5A 3KO8A 1R16A 4AJNA 2P9CA 2PKQO 2EWMA 2UDPA 2X7HA 4FFRA 4BO6A 4TKMA 1Y8RB 3MJEA 4J7CA 4DXHA 2FPPA 4H16A 2D3TA 1MUUA 4BNKA 1LX6A 5A1TA 2CNBA 3NTOA 2HK9A 4DMMA 1YO6A 4I9UA 1NFQA 1RYEA 2AG5A 3ANMA 4I5GA 5TNXA 2BHLA 1DEHA 2BKAA 3VOSA 3ZW8A 3ON5A 4ITUA 4LCEA 3LLVA 2YQ5A 4K6FA 4BO3A 5A5FA 4EI2A 3PJFA 4BNTA 1H93A 1TLTA 3GZNA 1WW8A 1ULSA 2I3GA 1SO8A 2Y1CA 5FWNA 2AMFA 3AY3A 3RUCA 3W8FA 1MXHA 1P1IA 4NU5A 3LSYA 5TQVA 1N7GA 1E3LA 4CV2A 2ILTA 5EPOA 1JWBB 4Z0PA 1R6DA 4UUPA 2GCGA 3CUKA 4YR9A 5F1OA 1C3VA 4NK4A 2B4QA 3GUYA 1ZSNA 2VYVD 4CLRA 3H5AA 1ORRA 4AVYA 4WLEA 1J4AA 4RORA 4JGBA 3H5RA 4DIOA 1F8FA 1E0DA 1KYQA 3OJFA 4IJVA 4EDFA 2GN6A 2PH5A 4BNWA 4FPXA 5KJ6A 3FNEA 2VHYA 4OYRA 3I9JA 4CQMA 3GFBA 2YUTA 4O0LA 1E6EA 2P68A 3F4BA 1E1MA 1EK6A 2O3UA 3JD1A 4W9NC 4EJMA 4RF4A 2X86A 5G2OA 2IZ1A 5K6AC 1GQ2A 3B1FA 3LC7O 4ZGWA 3D3WA 2NUAA 3NRCA 4UUNA 2G5CA 3JQ8A 4BNGA 3UXYA 3COSA 2G17A 3PDJA 1NHWA 3LLSA 4O1MA 4NZ9A 4BKPA 1HYEA 1QYVA 2PA3A 3V5NA 3IP1A 3ICPA 2DUWA 3LDHA 1BW9A 4XWYA 4B4WA 4DRYA 3ZWBA 3DC2A 4J90A 1GUYA 1XLTA 1UZLA 3P7MA 1MC5A 2D1YA 3JQEA 1EK5A 3MTJA 5CPFA 4KZPA 1ISGA 3I9LA 3ZN2A 4PG4A 5BNIA 2ZQZA 1E1LA 2PGDA 4RCVA 4RZHA 1P1RA 2JKVA 3E5MA 1WXDA 3ZU5A 3RUHA 1IB6A 4ND4A 2WYWA 3G79A 3I23A 5KJCA 4BB5A 1PEDA 1W73A 1Z7BA 4TROA 4WCFB 4ALLA 3TF5A 4GLLA 3TWOA 9LDTA 2FHSA 1I30A 4KUEA 4WUVA 4BNYA 1FXSA 1DC4A 1OFGA 1DPGA 2NADA 2W2KA 3S2FA 1BWSA 1OBFO 3EC7A 5ILGA 4CUJA 4ZQFA 4RVSA 1MGOA 3L6EA 2B4RO 5DBGA 2GZ1A 4J1TA 4MJLA 5K9ZA 2FN7A 4GAEA 3T4XA 4M1QA 4XQ9A 1NAHA 3K2BA 1JDJA 2NSDA 2FRDA 2WTBA 1Q7CA 3HE3A 1E7SA 3PP8A 3KTDA 5JLAA 4IDCA 4P38A 3PFWO 1Q0LA 4RV9A 1E5QA 3WIDA 2PK3A 4IXTA 1X1EA 1PGNA 1BXGB 1YL5A 4QX6A 2WE7A 3QE3A 2GASA 5TLSA 2BI8A 2VZ8A 2YHUA 3OIFA 4WEOA 2AE1A 2A9FA 2AEMA 3GH3A 4L4XA 3NV9A 4D44A 3JQ9A 1ZCJA 1GTMA 3NJ4A 3Q2KA 3I9OA 4XR9A 2X5JO 5IF3A 4XIJA 4CR6A 4CMKA 2OP0A 4XZ3A 1SNYA 1H0KA 1YQXA 3F4LA 3GG9A 4YJFA 3RJ5A 3QIVA 1E5LA 1I01A 1P31A 1U8XX 1VKOA 2I9PA 5L7YA 4BO4A 3ZZNA 3MCVA 2YZ7A 2VWGA 3VPGA 1E6UA 1U3VA 5I9LA 5TGDA 2GRAA 3GGGA 4GLOA 2W2LD 1XCBA 5L7WA 2VT3A 3IUSA 4GSKA 4GGPA 3I52A 2OOSA 3Q0EA 1QV6A 4EYEA 1JWAB 3WGQA 5IZCC 5TJHA 5I8WA 1NNUA 4B3HA 1SPXA 4RJTA 3ZNPA 1U3WA 1X14A 3HDYA 3N58A 4HKTA 3R6DA 4RQTA 3RFTA 3TZKA 4S1VA 3I1JA 3BTSA 3DZKA 3JTMA 3ITKA 4GPD1 3AI1A 1BSVA 4JIGA 5TT1A 1ZK2A 4YXFA 1CJCA 4II2A 3DOCA 4BO8A 3KEOA 3DOOA 4LSMA 4WOJA 4FS3A 3TPCA 4BKRA 5L95A 6LDHA 2NQ8A 3LF1A 1WPQA 3VPSA 1SMKA 4BGEA 3UVEA 5A06A 4GX1A 5DDIP 4B7CA 3ZV3A 2VYND 3EK2A 4RLHA 2WWRA 3E6AA 3TFOA 5BSFA 2F00A 4U8GA 1HZZA 3RWBA 4B8ZA 1GV0A 2IEDA 3ZHBA 4B3JA 1NQ5A 3GNTA 3GUCA 3GG2A 3NAQA 4RDIA 3W4KA 4NMHA 4J2HA 1NTOA 2ZYAA 2NU8A 4QFDA 4TRMA 1MA0A 1WDLA 3TL3A 3Q6IA 4EJ0A 3ETGA 1PL8A 2YJZA 3BTUA 5JPIA 2CDAA 1P9LA 4H15A 3O03A 2ZB7A 1Q2XA 3DFUA 1KEWA 1N2SA 5A05A 3WLEA 5KIAA 1U3TA 3NDIA 3AW9A 3D5TA 3S2EA 1I8TA 1X0VA 2XF8A 1CETA 4J0FA 1YXMA 3V1TC 5JY1A 2AE2A 1YE3A 3JQ8B 3ZNNA 1M6HA 1E7QA 2NVBA 3PK0A 1X1TA 3ZWPA 3M2TA 4N5NA 4BO2A 5HS6A 2C20A 3CXRA 4IJUA 4GGOA 4J3FA 5BSEA 3H9QA 2DVMA 4FFPA 4BO9A 5HA5A 1R0SA 3IJRA 4R1TA 1D1TA 4W82A 4O59O 3U5TA 1PGQA 3P5SA 4LK3A 1A5ZA 2V7PA 2DTXA 2X0RA 1P0FA 1Z45A 1ZXLA 4Z3KA 5B37A 4ALIA 1E7RA 4Z3DA 5DBIA 2DBQA 3BZUA 4JN6B 4UEOA 2WSBA 2DC1A 2GR9A 2C2YA 1VLLA 3IUPA 4CMIA 1Z82A 3LT0A 4QO7A 4FFNA 4A73A 2FP4A 3HDQA 1HE3A 3DBVO 3BTVA 4GQAA 2V6MA 1Z73A 5ES3A 2GLXA 3RC7A 4PG8A 3RJ9A 1BXZA 4GBJA 4N5LA 3OHSX 4I5DA 3C3XA 4ONEA 5CHEA 1MX3A 4EUHA 1Z74A 1VL6A 2I66A 3GQVA 5JS6A 4OAQA 1H6BA 2B83A 3PJGA 1ISIA 2YV2A 1P45A 2J8ZA 7ADHA 4CM8B 3WLFA 5BNTA 3RCBA 1PQWA 1U5AA 2UV8A 3QWIA 4NHEA 2A35A 3H9GA 3TL2A 1ZSVA 3K6JA 2HAEA 5G0UA 1UP4A 3OH8A 4OM8A 4YYZA 3F3SA 4HXYA 1EFKA 3NX4A 4IQ8A 1KETA 3UAGA 1B3RA 4LVUA 3VH3A 3WSWA 5TT0A 1Y9AA 3H3FA 4FBGA 3SLGA 2P4QA 2J3HA 2VRCA 4A0SA 4PIVA 4II3A 1Y81A 2J3JA 4YAKA 4AJIA 1UZMA 3CINA 4C7JA 5B1YA 5JAIA 1Y8QB 1E7YA 1QLJA 1HSZA 4EW6A 4UVIA 4XDYA 3BMOA 4NK5A 3B1JA 4YCAA 4B4VA 1K6IA 1DRWA 1N9GA 2X0NA 2PH3A 5TRTA 1PZFA 1LNQA 1R4NA 3G17A 3TOXA 4UREA 1AHIA 4HX5A 4D42A 2EP5A 2C54A 1NQAO 5B4TA 4AJOA 5TF4A 5G0TA 5KJEA 4YQZA 2QZ9A 2C07A 4Q9NA 3WWZA 4ALKA 3UH1A 1KVRA 3GDOA 4HFNA 4BQRA 2HRZA 2QZZA 4GX5A 5JDCC 5A9RA 4IDAA 2OUIA 2BLLA 3KETA 4FJ0A 2EKLA 2GF2A 1J5PA 4QXMA 1ISFA 5COBA 3Q9NA 3SJUA 2J3KA 3AI3A 3B6ZA 1IYZA 2ZQYA 3K73O 5T8KC 3QLJA 3DOJA 5KVQA 3T4EA 1O6ZA 1HE2A 1ZJZA 2Y1OA 4A2CA 4L4SA 5ITVA 1O0SA 3HDJA 3C1AA 1ZNQO 5FYDA 3VC7A 4PCVA 4OOFA 4FCCA 1NQTA 2GDZA 2PNFA 4YJDA 1NHGA 1QORA 5TIIA 1HDZA 1PJ4A 2NU6A 5ADHA 1EQUA 1VJTA 3D7LA 4Z9FA 5I9NA 3DMTC 3CPSA 3JQDA 3WYEA 5JY6A 1LC3A 2GD1O 5FI3A 3KSDO 4YT4A 1ARZA 4MKXA 5AQ1A 2PZJA 4BNJA 4R5MA 1ZJYA 1O9BA 3OIGA 2BFOA 2BGMA 3VTFA 1AXGA 1PWXA 3STHA 4URFA 3TOZA 1XGKA 4E31A 1XR3A 1VE9A 1HLDA 2FR1A 2X1HA 2P5YA 1HYGA 2J5QA 4AJ1A 1OZAA 4GKBA 5JO0A 3K5PA 4PRLA 1KEVA 2JCXA 4RVGA 4OGWA 3FWNA 3MOIA 2EIHA 3QHAA 3H4VA 4NNJA 2Q46A 3LF2A 3WDSA 1NWHA 1RPNA 1DSSG 1QKIA 3ROQA 4GVLA 1I2BA 5JE8A 2O3RA 4YEDA 1YJQA 3QWAA 4F6LA 1OOEA 5COAA 3S55A 1GUZA 4FDAA 4YQYA 3O8QA 4I8XA 3DEYX 1C1XB 1JAXA 2ZJ0A 1PJSA 1GQQA 3FTNA 1WDMA 4D3FA 3JQGA 3KYCB 4J43A 3WOHA 3IDSA 1VSUA 4IMRA 4ZD6A 2J3IA 3PPIA 4MIOA 3DZHA 1YOVA 3PHJA 5LDGA 4B4UA 5JYDA 1JW9B 4OKNA 1ZH8A 1DJQA 2HU2A 2P91A 3GEGA 3ZNQA 4H3VA 1XSEA 4J9VA 5DBFA 4RPGA 3RUDA 2PZLA 4TRJA 3AM5A 4YBZA 4J6FA 3ORFA 4OOEA 4CJXA 2DAPA 4LMPA 1KVUA 3D4OA 3GY0A 3SX2A 4JP2A 5GZ3A 5T5QA 2WD8A 3SJ7A 3U4IA 4J9UE 5GZ6A 3BMNA 3OICA 1C0KA 4XX0A 1LRLA 3LC1O 4I9NA 1VM6A 4Z6KA 1K2WA 5DF1A 2VNAA 1R4MA 2YDYA 3ROKA 5A5EA 1EE9A 4DBZA 3DDNA 2C2XA 3FCOA 1PJCA 4BNLA 3HB5X 4TZTA 3WICA 4I9HA 2NTVA 1XA0A 3GVCA 1DAOA 1U28A 2VWPA 4MVJH 3U4DA 1VJ0A 1A7KA 3Q3CA 1AE1A 3F5QA 1TB4A 1E7MA 1NX6A 3JQAB 2A4KA 1GPJA 2HJRA 2TMDA 4FR5A 4JBIA 2LDXA 4FJ2A 4QT0A 3HWRA 1EQ2A 2IXAA 2OBNA 1VPDA 2UUOA 4BNIA 4E2WA 4NJMA 3PZRA 3FHLA 4JCOA 2Y0DA 4W6ZA 4I08A 5JAQA 3DZGA 4WASA 1QV7A 4PG6A 4FC7A 3GNQA 4HNGA 4D3DA 2PD6A 1TT5B 1ADCA 1PGPA 3ASUA 1GY8A 1PR9A 3MOGA 1PL7A 2Q3EA 3JQCA 4JNKA 4IS2A 5AXBA 4CMGA 1T26A 4EUFA 1MXFA 4I5EA 3KOUA 2O2YA 3X2EA 3ZGYA 2NNLD 3R3JA 4XJTA 1A71A 2V6BA 1YGYA 1N9GB 2DTEA 2QX7A 1IPFA 1R4NB 4RF5A 1GAEO 3DBRB 5MDHA 1DHRA 2AXQA 4RVFA 4R68A 1U9JA 3DTTA 5BR7A 4OJNA 3L4BC 3PGJA 3TQHA 3V2HA 1JLLA 3WGOA 3WFJA 5I7EA 1VKNA 3VVCA 2VN8A 4CM4B 4GKVA 2FPIA 4CR8A 1C1DA 3VZQA 3M1LA 1N1EA 1ZEMA 2J6IA 1V6AA 4IDFA 3I9NA 4B7XA 3OQBA 5JW6A 3IP3A 4PRKA 4Z0HO 3WGZA 4BUCA 4CMEA 5JO9A 1K6JA 5F5LA 4CL8A 4J4HA 5EIOA 1TEHA 1M76A 3G1TA 4QO8A 1K0UA 5A3VA 3PEFA 3RBZA 1OI7A 5HS4A 1PJLA 1YONA 1Y1PA 5AXDA 5IXYA 4W99A 2PTGA 1NBOA 5JC1A 3ICCA 5EMHA 3VZRA 2JAPA 2AW5A 4XKJA 4PN3A 4E21A 2V6FA 2DU8A 3FR8A 1I5RA 4MOWA 4CM7A 3DHNA 3OMLA 4DLBA 4ZA2A 2JCVA 3Q1LA 3PQFA 1W6UA 3TFQA 1ENPA 5KJFA 1IY8A 3GN2A 3RQSA 3NT5A 3DBLB 1BXKA 1N1GA 3OJLA 3OEWA 1P1FA 5JAMA 1M66A 2CF5A 3WGGA 2CUKA 4E5NA 2GNAA 1B16A 1NPTO 3C7AA 4XD2A 3FBTA 1H2HA 1HF3A 3RD5A 3KVOA 2B4TO 2X8LA 4PGFA 1UXKA 3GT0A 1W8DA 4QUKA 4ZVVA 3K96A 4AL4A 1JVBA 2CVOA 2V6GA 2YV3A 1KEPA 1SC6A 3OF2A 3M6IA 4CM9D 2EERA 1ZMOA 4CM3A 2X0IA 1PL6A 3QVXA 2Z95A 3HG7A 2Y99A 4ZU3A 2GSDA 1K89A 1PZEA 3RASA 3G49A 3VPHA 3KHUA 1E3JA 3AWDA 1R0LA 1XEAA 4OIMA 4BKOA 4ZJUA 3KSZO 1UDCA 3KYDB 3O8QB 4WNIA 5LDHA 1EUDA 2WD7A 3ZH2A 2UYYA 3G0OA 3DL2A 4AFNA 3PLRA 4YJGA 3A28A 1DIRA 2W98A 4B3IA 3VKUA 3E9NA 3FRJA 1VRWA 4G65A 2Q1SA 2D8AA 1JAYA 5JCJA 2ZB4A 1YOVB 4WLVA 3IS3A 3ZW9A 4BIIA 1HE5A 4PLVA 2EGGA 3OQ1A 2G1UA 4NBUA 1WVGA 4B7UA 3FI9A 5A9SA 2DPGA 1HL3A 3DTYA 4K26A 4JBGA 3CH6A 2RHCA 4PLZA 2PV7A 2EHDA 3ZWWA 2IYOA 2DUUA 4MP3A 2R00A 5B4VA 1DRUA 3BHMA 2EW8A 2BRUA 3H6KA 4DIBA 1YB5A 2FOIA 4E13A 3IOYA 4G2NA 3BMNB 4BOYA 3IJPA 4JX8A 2PKQP 5T67A 2C7VA 5EQFA 3WGTA 4LGVA 4W4TA 4GWKA 3WBBA 4X54A 3JQFC 3L6OO 3NJ8A 4Y67A 4Y98A 3E82A 3WQQA 5G0SA 1NVGA 2VNSA 3V1UA 2ZATA 4U5QA 3W6UA 2DBVO 3JYNA 5BSHA 1GV1A 4ND2A 5COQA 5ILOA 2OL4A 1LDNA 2FSSA 4BVAA 4HFJA 5KOIA 3QVTA 3MEQA 3ANLA 1DLJA 5T8KA 5FEUA 3OSUA 4RLSA 1EVYA 2GPTA 3I5MA 4GL4A 2X5KO 1K5HA 4O6VA 1F06A 2XXJA 3VZSA 3F1KA 1M75A 3U0BA 3UF0A 5CEFA 3NDJA 1C0LA 2I65A 5BQFA 2ZIZA 3DBHA 5IZ4A 1LSUA 4CPDA 1PJTA 1PWZA 5F1KA 4Y6SA 3AFMA 3EGOA 1BDMA 3IC5A 1NFFA 5FF9A 3HUDA 4WOKA 3A4VA 3JQAD 1UXHA 2C5AA 4A03A 4N5MA 1Y5MA 3PHHA 3RUEA 1WZEA 1NFRA 3H9EO 4YJHB 4ILKA 5I8ZA 1N7HA 1QLHA 2BELA 2EKQA 1Y9EA 4XGNA 1ISHA 1EDOA 2VHWA 2XOXA 2ET6A 1M6WA 3EW7A 4PVDA 1OAAA 5IJZA 1DC5A 1EZ4A 2ZK7A 1U1IA 4LW8A 3K8ZA 2PZKA 4RVHA 2WYUA 4BO7A 1YL6A 2PLAA 3T7EA 5C3MA 1LDMA 1GCOA 1H5QA 4A26A 2DFVA 3JQBC 1QYWA 1UUFA 2O4CA 2H1SA 2RH4A 4BNXA 3RU9A 2J5KA 1QRRA 1DIAA 2G0TA 4OQZA 4DBVO 1L7EA 1PJQA 3ZI0A 5CDSA 3KUXA 5ICSA 1QSGA 5JDIC 3GPDG 1EDZA 2AQHA 3RU7A 4BNHA 3UCEA 5T6BA 3JCZA 5JXWA 4UVHA 3VPFA 4FFLA 1ZEJA 1F0YA 4YAJA 1PX0A 4B8WA 4DYVA 5KNLA 3GVXA 5BNFA 2JAHA 1HSOA 3GVHA 2QW8A 1NR1A 3WSVA 2EP7A 4ZHSA 3GK3A 1Q0HA 3E5RA 3K30A 3ENKA 1PU2A 5DOZA 5GMOA 4KQWA 2O3TA 3JD3A 1BDBA 1X7GA 3QWBA 4AJKA 5IG2A 4MP8A 3ULKA
chains in the Genus database with same CATH superfamily
3RHTA 3R3UA 1XCGB 2SKCA 4P7BA 1Z13A 4YH1A 4M21A 1LBIA 1AQNA 3LKBA 1F51E 3VH1A 4TT3A 3FDZB 4RY2A 5D5QA 4AMZA 3MB5A 4P22A 1N3YA 1VSBA 2JLBA 3K1AA 3S29A 2HV8A 2IYYA 2DERA 2QVBA 4MA0A 3D4PA 2CEAA 3II6X 2X8WA 1VL5A 2Q49A 1YUMA 4ZMSA 1NUUA 2C7OA 1BX1A 1Z8FA 2YHSA 1Z63A 1ND6A 2YH2A 3EVTA 1A0OA 3FJ1A 3DXFA 3IPLA 2QYHA 3PLNA 1FC0A 5DYTA 4JOBA 1WBJB 4DMLA 1H8HD 2RHBA 4CFSA 3MOSA 1W2WB 2FSHA 1CJUC 3L07A 4K9LA 4ZVLA 5G4KA 3U7JA 3G2OA 1BG6A 4PONA 5KQRA 1WDWB 1K8XB 4J49A 4JUDX 2HA6A 1Z4QA 4KWIA 4Y7DA 3HB1A 3NEPX 3OIWA 5I4KA 2ATVA 4EK9A 2HKIA 3Q6MA 5MN5A 2CDBA 3R40A 5L51A 5J4VA 4P7FA 2H3HA 1E1YA 1ZD5A 1GUBA 3KG2A 4FQ7A 1A1VA 3H6GA 3S27A 5GOZA 1LJ8A 4EQZA 4RK1A 3OFSA 3ZWMA 4UBLA 4IY1A 4WLUA 2PCJA 3QU7A 3RAJA 3T5AA 1FYVA 2B1QA 1Z2CA 5KNCA 3BWMA 1KI9A 1Q7BA 2E82A 3F5DA 1K3FA 5KC9A 1RQLA 3AEQA 4ER3A 1M1XB 4CG3A 2IGTA 1WLSA 2ZJAA 4KJZA 2D5AA 4P3YA 5AOAA 1WZ2A 4F9EA 5JSHA 4DV7B 1AS2A 5EJIA 5B2ZA 3QLEA 1V8DA 1EUCA 1EWRA 1R12A 2R4TA 2LRHA 1CDOA 1U2DA 1ZIOA 3DMNA 1X2BA 2ERYA 4CLRB 5A9SB 5L4SA 3DFZA 3AKCA 1QF9A 4IL5A 4E5DA 3CLUC 4WCFC 3I6MA 1R74A 3I2YX 4JBXA 3EH1A 2RD2A 1PEAA 1BHSA 2JJ2A 2J0UA 1X7DA 3T5MA 2GEUA 1N4DA 3KUCA 2O7SA 5K0JA 2FWBA 4CXMA 4D79A 3USZA 3GT7A 3FTDA 4PINA 4G5GA 2CJWA 2AJBA 4ZOEA 2OCPA 1WB4A 2NUBA 2WFMA 3BXGA 1KPHA 2CL5A 2Z98A 4R0VA 1SRRA 1DEXA 2O1SA 4WNCA 2II6A 5CYFA 5AICA 3HNOA 1QDUA 1ZK0A 5CT5A 4Q3KA 2RGUA 1YT5A 3SF0A 4I36A 2FZ4A 2NUAB 1K66A 1UAGA 4BCDA 3FGPA 3CRVA 5FI1B 3ZHYA 3TG8A 1A9OA 2I2XB 3E15A 3FZYA 1PDOA 2DF8A 1U3FA 3OAAA 4MYCA 1Y5NA 3UK1A 1T3ZA 1WL8A 2MSKA 4R01A 1OGYA 1TAQA 4QUBA 2ZJOA 1BW9B 3H2BA 3QVKA 2I22A 1F1BA 1XAGA 2TMKA 5JJCA 3AVXA 5CYGA 1J0XO 1WAMA 4UHHA 1TW3A 2D59A 2QUBA 2Z58A 4HSEA 4TS4A 4Z7NB 3GMSA 1ORVA 3G82C 3TRJA 3X2SA 1NSTA 3QELA 3P2OA 3EH2A 5ALLA 2W4QA 2WLTA 4QG7A 3QWFA 4BE7B 2C1XA 4C2AA 2PRZA 1CZLA 2ZTHA 1B8VA 3E2IA 1XAHA 2YMLA 3JYOA 3MVEA 4OGGA 2ISCA 1DHTA 2WLSA 1OILA 3KQTA 3N8NA 4GOMD 4A7PA 3OP4A 4F4JA 5EJ5A 4RJ2A 4DT1B 2XEDA 2GBPA 4OQ4A 4RD0A 3BMXA 4TGLA 3UOWA 5DP1A 1SBHA 4QVKA 5DSZA 2RE8A 3AF3A 1SCDA 3NTVA 2E5WA 1CUDA 4GR4A 1UDWA 4PNPA 4M0FA 2E5FA 2ZS7A 2NSYA 2XVMA 5C1DA 4DCMA 5F78A 2QZ4A 1KEUA 5LKRA 5A9TA 1WXIA 3HCFA 2VDKB 3ZY2A 5DFAA 5CLJA 3KXIA 5TX7A 4ZTBA 3HA2A 1DAKA 4IEFB 2IITA 1P39A 4HATA 1XHLA 3ZE9A 1RPJA 4II7A 4TUYA 1WSWA 1SVLA 3EJWA 3ZWOA 2VA8A 4Y6PA 4CUKA 3NUGA 2JJYA 4RDHA 3L8MA 3USCS 4MB0A 4DVJA 3KDPA 1Q3TA 1QQ6A 2H4FA 3OKPA 5ALFA 3UN1A 2W90A 5FPTA 4AKHA 1IXZA 3KRTA 3QOXA 1PN3A 5THKA 1Z0FA 3EPLA 2FSFA 1Z36A 4RIHA 3T5GA 2AD1A 3TTUA 5KNCH 2PMWB 4CU5A 5J5CA 2FG7C 3AETB 1FTWA 5LMZA 2ODWA 4CIDA 3NHAA 4EL5A 3MRTA 4YUZA 1XNQB 3F3YA 1Z39A 2PS9A 1Z06A 3O3OB 2CDCA 4O2AA 3DKKA 1CEYA 5BT8A 3F8WA 2XNHA 1D1PA 3NW9A 3VUFA 4ZI7F 4G0NA 3GFVA 4R7ZA 5FX2A 2G36A 1UK8A 1KA9H 5HM6A 1ZA1A 3ICEA 2BI4A 4JL8A 4MS1A 4B79A 1B0ZA 1LK7A 1T91A 3R0IA 3DDHA 3ZVNA 4UDNA 2FZKA 1BU5A 2WWFA 3WHPA 1N3IA 4DIMA 4W6QA 2O5EA 2W2XA 1B1AA 2JK0A 1R0XA 1OXBB 2M98A 1ZIXA 4OFZA 2LW7A 2QROA 1UWVA 3SZ3A 4ZQGA 1Z0IA 1Z29A 2CVZA 3C8MA 3Q1KA 1G4AE 3K1YA 5KKCA 1BGVA 4DTIA 1NBEA 3WJ1A 4QLAA 1JTEA 4RS4A 4Z4HA 3FTCA 1KVSA 3LX5A 1RXSA 2E7ZA 3DLTA 1LXCA 4MUXA 2XNSA 1JVNA 2CMFA 1IOWA 3N8GA 2V8BA 1XKTA 3OCUA 4Y2YA 3VZPA 2E49A 4DZZA 1IULA 5JUWA 1BA3A 2ZTMA 1FX0A 2V3WA 1D5WA 5KSYA 1PF7E 1GPAA 1ZO8A 4MEBA 1EGAA 4R9UC 3DQPA 1D5CA 4ZCRA 4GP7A 2HJWA 4NARA 1DAMA 2MSDB 1J2EA 2FOXA 1YVPA 3MTGA 4XA8A 2GN0A 3SEAA 1ONNA 3HB4X 5E9JA 1EIZA 2GZ3A 2LCQA 4ZMBA 5K6AA 4RTRA 4JI2B 1PYOA 1U2GC 2C5BA 1VE5A 2AKAB 4EY4A 4TN5A 2AWOA 1U0FA 4YVFA 3OTOB 3QIAA 1Y9ZA 4N9QA 2AN3A 4G4GA 1T8TA 4DC0A 4EEXA 1YWGO 3HA5A 3CPJB 1BOFA 3G1UA 5CFZA 1DAPA 5FI5A 1LLCA 3NYIA 4M76B 3CB2A 3OFJA 2BCJQ 1CF9A 3EODA 1UDRA 1QVRA 1WD7A 2VDVE 2RHJA 3RVNA 2WJ6A 2GZMA 1RCFA 3FKSA 4HWSA 1KRXA 3UGQA 4TS1A 1G8PA 3DH0A 1QIDA 4GDMA 2O2XA 3PNBA 3IQHX 4C14A 4DC9A 4EVSA 1NXVA 2YJ5A 4W1SA 2FEKA 3NONA 2MT9A 1T35A 3SIRA 3M4NA 1JQDA 5IU6A 3M6WA 3NMUF 3DHEA 5JZVA 1Z5VA 4IHAA 5CDTA 5EJ2A 1W85B 5K0CA 2W2LA 5D01A 2H2DA 3SYRA 3W1VA 4NBTA 5IC4A 4HI0E 1L4NA 1OTYA 2IOHA 1ZLXA 2ZDQA 3VHLB 4W8OA 4BNUA 2EP8A 2J46A 3LX6A 3OQ6A 3HBAA 5DYGA 3PEVA 2DHEA 3H75A 3TS1A 4HY3A 1TVMA 4HPJB 4OI4A 5IJ0B 3RUAA 1EB9A 3ITDA 4JP8A 1A27A 2WYIA 3HDVA 4FLMA 3RUFA 1DBRA 2NU8B 1H94A 3AFHA 3KKPA 4H1TA 2IUSA 5FFMA 1X8LA 5F3RA 3V8VA 5FJIA 2UVPA 2IV7A 1OU0A 3TLMA 1U6JA 2A59A 1EVEA 1VYHA 2IXGA 2R2GA 5BSRA 3QX3A 3MJDA 4CHTA 1GPMA 1LCIA 3IA2A 3AONB 1J90A 1DZ3A 1KZ7B 2ZJ2A 4JLBA 3OZBA 3L0OA 2GCOB 1E3WA 1EFVA 4R2MA 1KAOA 4PSCA 2SKEA 3QP9A 2CJXA 3P2JA 4JD5A 2VWQA 3GU3A 1ODTC 4YWJA 5TR9A 2XUAA 2O8DA 2QAGB 3NOVA 4EUSA 3JQBA 4PQEA 4KREA 4OQYA 4AJ9A 3FFBA 4J1TC 1NBMD 3INNA 3PQEA 4BQNA 1GL3A 4WN9A 5K0ZA 2F3UA 1BE0A 4S1NA 2YW9A 5K0SA 4D4JA 2OV8A 2HRDA 2YQZA 4WKOA 4HB3A 5EN4A 3K9FC 2CFTA 3ZVMA 1FFXA 1G21E 2VUUA 3SJAA 1BS2A 2DWQA 4BBZA 4C78A 4L08A 4AN1A 4M9UA 4RCYA 4D8WA 3BCUA 5HRCA 1DKMA 2A9RA 4IIVA 2OBLA 2V6IA 3I92A 1CPYA 1Z25A 2C31A 3WVNA 4NR0A 2OXRA 4ZK2A 1JI3A 1TD1A 4KN8A 2BKLA 1F12A 4RABA 4PCAA 2ORYA 1DBQA 1X2EA 3A6JA 3DKPA 5FPSA 3OE5A 1VIDA 3HEMA 5K01A 1CY2A 3KR9A 3TUZC 1L4LA 4XGIA 1LX7A 1RR6A 2YIDA 3P0EA 2ZJ3A 2IH5A 1N4AA 4J0CA 4TXMA 3VOTA 4C4ZA 4E5SA 3V7WA 2C00A 2BMDA 3H2GA 4OXKA 1J49A 5EEHA 1LBSA 5HIMA 2HUNA 4XJXA 1EE1A 3WP0A 3B70A 4I55F 4K6OA 3PD7A 4LNUA 3UGKA 3IKTA 1SD1A 1BCSA 1GSIA 1NXOA 3T99A 3I83A 2VDLB 3GQBB 2WJGA 3ZV6A 4LZNA 1RWXA 1Y33E 1ZIPA 4QBIA 5DGHA 4C76A 1NG9A 5D3MA 2XZLA 3BD6A 3HFJA 4P83A 3CZMA 3NTXA 5ETJA 2CBZA 3TRIA 2PUWA 3IIMA 5CEJA 4DLAA 2JHFA 1MX5A 3WMRA 3DZIA 3I01M 1P7YA 4JLAA 4MR7A 1H1LB 4XUCA 5AI8A 1PFVA 1MO3A 3T5TA 1OY1A 5CM9C 4Y1EA 4DJDC 2ZXFA 1U65A 2RH5A 3EC2A 1TF5A 4PZDA 1KDYA 4V24A 2R7LA 3FWYA 4GC5A 3SC2B 2A3RA 3L1UA 3VSDA 3TNDA 4EUEA 3O95A 3TAHA 1KGSA 4LCBA 5HXAA 4Z4FA 2P9ZA 5C4GB 4F38A 3TCNA 3QPVA 3UJ6A 4EHKA 3A06A 2IHVA 2P2YA 1EXNA 2BHTA 1FYXA 4ZRNA 3FPFA 2W93A 1KYTA 2IZ0A 4EB0A 1R5JA 3NBUA 3M4XA 4MQBA 2AQIA 3BMOB 5BORA 1EFHA 4ZO6A 4XLTA 4KXNA 4OHYA 3Q11A 3AM3A 4OXXA 4WW0A 4L5YA 4U6SA 5LQKA 4DLLA 1UZAA 2L69A 5K3SA 2DKOA 4CBVA 2PGLA 3FRHA 3TNYA 5CEEA 2ZIUB 1QTRA 4J94A 4IF6A 3K71B 2QWXA 3NHMA 2PUTA 1XZAA 3HLKA 2JRCA 3S1AB 1M2VB 2Q2QA 4WEQA 3ESZA 2R6CA 3OO1A 2AK2A 1QP8A 4C1BA 2HHJA 5DLYA 2BBWA 3EE6A 3N2ZB 2XYHA 3FUUA 4EVRA 2YMPA 1YIOA 3QBDA 2G9UA 2OBBA 2OZEA 3DO5A 3KVRA 3JRWA 1EM8A 4JLVA 5CLLA 3EXIA 5AM0A 3BWDD 4R9SA 1G98A 4B9EA 5EUCA 1SHTX 1ECCA 1YVDA 3C0KA 3RG2A 3DAHA 4JV5B 1ZBDA 1LSJA 4FN4A 2WQ6A 1YHYA 3K2QA 3ZU3A 2NT3A 3OZCA 5LP6C 1GXSB 2A84A 3AESA 3EY4A 5DWQA 5FV7A 3NQ41 3RS2A 4I4TF 4RTQA 3S70A 4RJIA 1T8SA 4F6RA 5KHLB 2IUFA 3NEJA 3U2QA 3PVZA 3DYIA 1CWUA 1XDZA 1EZ1A 2I6SA 4CU2A 1BWQA 4EGJA 3CEJA 2JHAA 2A5GA 4NABA 1TVEA 3IBGA 1XNRB 5L3QA 1HDOA 2PZGA 2NU6B 2PWPA 3PX3A 1CZRA 1GYRA 5BN4B 3FHJA 4YACA 5A7HA 4PZLA 3OPVA 3EJ6A 4ZXFA 3TECE 1QFXA 2O20A 2WWHA 4KE7A 4I4NA 2BMAA 2Q1WA 2AMLA 2I2BA 2O1XA 3INGA 3TJZA 2KMLA 3G02A 5IWAB 1FUYB 2NIPA 2P40A 4MJ7A 4YLEA 3V33A 4XYEA 2QM7A 2O48X 4JKOA 1O57A 1I6KA 2VDOB 3LVRE 4FCTA 4H4DA 1I2ZA 2GERA 3OT4A 4KUGA 1G9TA 2LE0A 5CDGA 4D9GA 4ZOQI 4YXWD 3BYZA 3IT3A 4IFIA 5CB4B 1FCJA 1NYLA 1JG1A 4X8MA 1GCUA 4YQEA 4WAUA 5EJ8A 4MV3A 3N7UA 2PH1A 3CO5A 3EGEA 1ZK1A 4DZTA 4HLDA 5IBPA 1IXRC 4HN2A 2F1KA 3AR8A 3DFKA 1XD2B 5ALQA 3O8CA 4M0CA 1USUA 3PENA 2UAGA 3EF1A 3URKA 1O95C 2BM0A 2CYBA 4MDEA 3STUA 2EDCA 3JSAA 3G5LA 1N92A 1CIVA 2I2CA 3KLNA 4F9TA 1X94A 4IOLA 1GPDG 5AJXA 4IDPA 4J1SA 4G0QA 4KKXB 4OKSA 4KWCA 1UXGA 3DNPA 4MIYA 5EJ7A 1UBKS 3RC9A 2QTNA 5J5VA 1TU4A 1Z38A 4JDUA 4YHHB 5A5GA 1PTJC 4ZXPA 4BZPA 4DA4A 3C6YA 4X8LA 4MZXA 1ZHHA 4WKGA 1Z7YA 4J8PA 3EIUA 2W6MA 3ZE6A 3ZWAA 1QO0A 2CSUA 2RARA 4CF3A 4L0DA 1Z37A 3FNHA 4GZLA 1GP2A 4O02B 4E2FA 1BVRA 3HZHA 3LCUA 4C3UA 5B3JC 1XELA 5EVJA 1QHXA 4AZ3B 4Y6GB 3SAJA 1SCIA 3O8NA 3EGVA 2BGTA 1F8GA 2FPWA 4JI1B 4H4EA 4FI3C 3C7CB 3K0FA 2EL9A 4FFMA 2PZMA 5HCUA 2PDAA 4OI1A 2BF4A 1TQ6A 2YQ4A 3L1KA 3UIEA 1PSDA 3TAUA 3A9CA 1HTBA 2I7CA 4FMCB 1M2OA 1AZTA 2JVKA 3UOAB 4KNYA 4K9SA 1AJEA 4UXJA 2J45A 4RHTA 1UC4B 3CMCO 1VIYA 4JFRA 3AILA 4LXTA 1XA3A 4M86A 2YHBA 4P32A 2PGOA 4LTDA 3QFCA 5EXPA 3ROMA 4DPLA 1HDCA 5EESA 4PLHA 3P2YA 4FSHA 4YV2A 4M87A 4NQZA 2XW6A 2OPHA 2O2ZA 1GZ6A 4Z7JA 1RLOA 1TIKA 3I62A 2XCIA 2EW1A 1RKUA 3R3VA 4GX2A 2WFZA 1D6MA 1N2EA 2PKRA 1YH3A 4NMWA 4TMWA 1W96A 2OO3A 4ZAGA 4YAWA 4L8LA 1I6LA 2C8LA 2WIJA 3WB1A 1XNHA 1Y1SA 3RVRA 1VCMA 2D3WA 3DWIA 4NULA 3T3DA 3ND9A 4IJ5A 1UXJA 1W4RA 4IIHA 4Q7MB 2BOVA 3NBFA 3N2GB 5KX5B 1N5OX 5TS3A 2A1IA 3A4NA 2HLPA 3E9CA 3UMVA 1YQDA 1F48A 3KOZA 4M83A 5CT4A 4BCBA 1USVA 4G1CA 1B2LA 2IX3A 3N9IA 3UM9A 2PR2A 3DR3A 1RIFA 1EINA 3W4JA 1P1CA 1EH5A 1YQUA 1F0PA 3LUGA 3OOSA 1ZW1A 3GLQA 1RBZA 2VCYA 4YDRA 1HPLA 5B3AA 1P80A 1Z6ZA 3U1BA 3RYHB 5KTOA 3S0JA 3U60B 2AI1A 2BT4A 3OLXA 1I3NA 3CPHA 5CFQA 2IPLA 3GFFA 4NONA 5CPBA 3L4KA 1Z18A 4RHXA 3U80A 1HEUA 2D13A 3L49A 3RK4A 2HBQA 4DYDA 1W9HA 5EUQB 4X1KA 1Y6QA 1CUWA 1R6XA 5E1OA 3THWA 1GGKA 5IABA 3TX2A 5JNLA 2NN3C 2PUHA 2GJAA 2JANA 3D1LA 3K1JA 4HNHA 4MTCA 1JEOA 1ESMA 1UMDA 3AEUA 5FWYA 3ZWVA 3DZBA 3TG2A 1YQWA 1YR1A 2O2HA 3O9ZA 5E2BA 3F7OA 4ZODA 3ZOKA 4BVEA 1L3CA 4BO0A 5EC8A 3PI7A 1TYAE 4H7KA 5FJJA 4C6HA 2VKTA 3DYBA 1VLQA 5M2QA 1IHYA 4LPSA 1P9OA 3X1YA 1G6KA 3RVPA 4X62B 4UUAA 4WZBA 2QTAA 3ONNA 3HV0A 1GZDA 3TE7A 3PR1A 3WSTA 1X7WB 2N75A 2GJ8A 2VWHA 4GP9A 1F0KA 2QG6A 3RVDA 4QDTA 3WYCA 4GNRA 3SEFA 5DNUA 3IIKA 4C7VA 3HJBA 3KOWA 1VYTA 4BRZA 4EFLA 4EYSA 5KOHB 1FMFA 1UH5A 4I66A 4ZQCB 4PNEA 3AF4A 2BI7A 3NANA 1L6RA 1ZH2A 3I8OA 3KQVA 1C1DB 1PK8A 1SBYA 3LVBA 3LY8A 3OPQA 2IYWA 4NVRA 4IM7A 3PTLA 3RYFA 1OROA 5SZHB 2I87A 3DAPA 4CM8A 3ADPA 3R9IA 3JU3A 3N0RA 1E0JA 2R6AA 4OLHA 5D6OA 4EABA 1UOOA 4Q4CA 1GTRA 2HLHA 1V0JA 4M54A 1NU8A 3C1UA 1LFAA 3STVA 3PXUA 4LYJA 3PLAE 4YRRA 4P34A 421PA 2Q3DA 3UJ8A 4EG7A 2R96A 1ECJA 3R5JA 4I9GA 3RVKA 4QOFA 1YB2A 4QDXA 3ANYB 1P4GA 4IGAA 1LJLA 1ZN7A 3NBAA 1UPAA 2CJPA 3UUFA 3N07A 2V5VA 3D6NB 4J16A 3BE6A 4L07A 2J5BA 1YDMA 1DRVA 3KOMA 4J0KA 1CQJA 5ER9A 4YP9A 4QG3A 3P1JA 3H1GA 2O06A 3U7RA 4CLHA 1PGJA 1B8PA 5L4NA 1PHPA 4E15A 3DUWA 1HC7A 1FF9A 4URHA 3W8DA 4IZIA 1EAYA 3LK7A 3CC8A 3K53A 3M0EA 3D31A 3TN7A 2YWHA 4R7GA 2C5SA 2W71A 4UDOA 3WMXA 2AI2A 3A3YA 1G16A 3GMDA 4O2RA 2ZWAA 5D85A 1T1GA 3NYWA 5A71A 4FGUA 3FWHA 4DDTA 1FTGA 4H6PA 3QVGA 3OJCA 2QTLA 4PO3X 3RRXA 1CEXA 5IVPA 3DF9A 4QYXA 2BZGA 3IR6A 2CVPA 4ETIA 2OWEA 1UPBA 3MPUA 1NKVA 1XZKA 1O08A 3CA8A 5KYVA 4D7AA 1BWPA 2JPDA 5JRZA 3LI2A 3I01A 1UPTA 1WQ4A 3B3FA 3GB9A 1I13A 4Y9TA 3K1ZA 2I71A 3AOEA 3B2QA 5EJAA 4MDHA 4XH9B 2BR5A 3P9NA 4BNFA 3IRVA 4FTWA 3TDMA 4X44A 4I1IA 2FSVA 4C6TB 3LDAA 4I14A 4R69A 1U28C 4EB3A 1EG2A 4U0KA 5C7LO 3SLKA 1Z8NA 2X4GA 1ZOPA 3GVPA 3S8EA 3WLJA 1MABB 4PYMA 3MWYW 3K70B 2IW3A 2XD4A 1I7QB 5J4LA 3OEHD 3G0IA 2LCIA 5K0NA 2IPOA 4Q02A 4TYPA 2W4MA 2NYUA 1WLYA 3CG0A 4PLFA 1W581 5PGMA 3NHFA 1FP4A 3CUWA 6AT1A 1BMFA 2HCRA 3HH8A 4ZI5A 5BUZA 3SJBA 4HLUC 10MHA 2G71A 2YXDA 4L73A 4YXWA 2Q1TA 2XMPA 1ICIA 3KLPX 1LUAA 4U8HA 2EIXA 3PB3A 4FYXA 2E48A 4JLWA 4BLWA 2R60A 3GI1A 3H16A 4K46A 2DWPA 4CM9A 3U61B 2VF5X 1BN6A 3U3OA 4LAFA 2Z3VA 4CLDA 4DCGA 1PW5A 4EZIA 1ADFA 3T7AA 1DUIA 4DR2B 5IM4A 1AY0A 2FPKA 4YT5A 4RF3A 5EMMA 5B12A 3GRVA 4WOCA 2IUYA 1VCIA 4YJ3A 1SQSA 3QOWA 3QWHA 3GLTA 3LT4A 4LJSA 5EGNA 3DLPX 3BIFA 1N5DA 3RKSA 1GEEA 1XVTA 4OLAA 2QXUA 2PEZA 5DNVA 2RHRA 5J2TB 4ZO7A 4Y2GA 1PTKA 3H87A 3C98A 3PD1A 4I1OA 1DB3A 2C92A 4K81B 3JQ6A 4TLEA 4WXHA 4L9RA 3IV7A 2UYGA 3L4BA 4YA6A 3AJRA 4ENQA 3EPJA 1TO6A 3WGIA 1LDGA 4IKPA 5DV9A 1WUYA 1D3AA 2WUGA 4R98A 2P3OA 2P9HA 1TCUA 2HHLA 5C8VA 1D0SA 1HTTA 5I01A 1N2GA 3Q7QA 3JXEA 1GKIA 1NN5A 2BR4A 3MCZA 1YOBA 1ZY2A 4TTJA 3TTVA 3OOJA 4BKMA 1UOPA 1T2CA 5IKXA 5LBTA 3KR2A 3DVAB 4MKZA 5A5VA 3U44A 4OMUA 1SXIA 4RK5A 1SUPA 1NVWQ 5DLPA 4F5ZA 3LO5A 8LDHA 3GWZA 4ZYVA 5CM2Z 2N46A 2CLCX 2D2EA 3EIWA 4LNHA 4REQA 1G66A 3HA3A 5IP5A 4D5EA 3DCJA 2HMUA 3DAFA 4Y9DA 3SHOA 2Q29A 5JPCA 4KMSA 3E9MA 3GUVA 2XWQA 1EBUA 3E48A 3ED1A 5SY6A 1HNZB 2IEZA 2RJ3A 2CLLB 1E1NA 4L1KA 5FDFA 2C2KA 2QVXX 1T9GR 1CFJA 1NI4B 1ZM3A 2MINB 2VATA 3LP5A 3PS9A 3BD8A 2GAJA 4RVDA 2PBZA 1DBVO 1DXYA 3PIIA 1QIMA 3UJPA 5BVGB 3WKEA 4UUOA 3TTSA 2C7BA 3ISTA 3VR5A 4TXLA 4M1EA 4D43A 2OKCA 4DGQA 2FQWA 3KDSE 3BE8A 3G0GA 3WMEA 4NE2A 1PGOA 4KAAA 3P9XA 1WP4A 2GPBA 2XVZA 4TLAA 3ZD7A 1K4KA 3Q7SA 3QUCA 2DKFA 1GNSA 4FVTA 2OYRA 5FBRB 1XZLA 2DHQA 2EF1A 4DSNA 1KMHB 2ZUCA 2QTGA 3AVTA 4ARVA 3LZ6A 1TYZA 1E5VA 4KQCA 1KDTA 2FWIA 2VDWA 2PRSA 8GPBA 2COEA 1C2TA 2I55A 3JYQA 2VEOA 1EUZA 4TZKA 3LZDA 4V39A 5IAKA 2CD7A 2O6HA 2QY9A 4D45A 3L1IA 3WGMA 3IQFA 3O3NB 1TFRA 3MJCA 4J1NA 1S1MA 1H4VB 2PFKA 1T4DA 5CDYA 1G60A 1LSSA 2R62A 1M6YA 1HLFA 1Z5OA 2AG1A 1C8LA 2AUNA 2VPXA 1QBKC 1H6DA 1T1IA 2NO1A 4ZV7A 4N40A 1IL0A 1TT5A 2O8FA 3KEFA 1J2JA 2NUPB 2WIFA 3AY0A 3GLFA 1JNYA 3H3JA 3CLSC 2FSIA 4ESOA 2FX3A 2M1ZA 3NHWA 5JYEA 3K8OE 3FFTA 1U9CA 4E4YA 3M4YA 3AW8A 2IXFA 3F78A 3SEZA 1K6XA 4D56A 1TD9A 3EDOA 3ILVA 3PNYA 4S0XA 3KQNA 4PLTA 1K7YA 4R2WA 1J00A 4ZVTA 3UGJA 2H4ZA 2YXLA 3TLEA 3UFXA 1T9GS 4WE3A 4IIJF 3RI3A 1RP1A 1ZRHA 2XBMA 2GN8A 1Z6YA 4I6EA 3LQFA 1UBFA 1T0IA 2GPSA 2R5FA 5I4BA 2O8CB 1F9AA 1JG7A 1EFUA 3HJUA 5A03A 6YASA 1DWPA 5IAAA 2RDMA 2YVLA 3AG6A 3DBRA 3RODA 5FLXA 3W5AA 1E0KA 3FNGA 2FWMX 3PQ7A 1RJDA 1MP0A 3QI2A 3HO8A 5LA6A 3PIDA 1X13A 3LKDA 5EJMA 1VYVA 3JX9A 1E69A 4HH1A 1FFCA 4KITB 2XMCA 4BGIA 1AK2A 1KC1A 2Y1FA 4CM4A 5TMDA 1L4BA 5LZ9A 3CVJA 3RTDA 3BOSA 1HDXA 1VL8A 1HYHA 1OMOA 1TFUA 4J03A 3QE4A 1RTTA 3GAFA 2QTMA 3VHQA 1R15A 2XGGA 3H9CA 5B2FA 2PKXA 2VS1A 1M1UA 1ZXBA 3GJQA 1I2MA 5JSZB 1R0CA 3RJZA 4M9RA 3IBFA 1F20A 4X3CA 2ZI5A 1VPEA 3AP3A 1DJPA 1E4EA 3MW8A 1DG9A 4GYKA 5EPUA 3WO1A 2G8NA 4Z2YA 2AOUB 2JFFA 3GOHA 2ZRLA 1PS8A 5L3RA 5A2GA 3VC1A 1D4OA 3RIEA 3ZDFA 1RNLA 1EVIA 3A9UA 1U63A 3ICQB 4W5JA 3NTRA 1IZ0A 1THGA 4K28A 1CYDA 1GU1A 4FHZA 4X1IA 2BFCB 1KFCB 1PRYA 4QTUB 3RPEA 4D02A 1SU4A 3D4LA 2WYOA 1JXAA 1DOZA 2ZJ4A 2EC5A 3CTMA 3WRXA 2KI5A 1WW3A 1PAUA 1DQYA 1RJFA 3BRWD 3FCUB 4HSGA 4X92A 3WLLA 2J0QA 2Y9PB 1QF6A 4BFXA 1W75A 1TAUA 1VXRA 1YRYE 4KQGA 3PX2A 5DTEA 1VECA 2FWRA 1QNFA 2PYDA 4KQXA 5ALNA 1IQRA 4FGKA 4O4IB 4FHEA 1CS0A 5GOTA 3WLNA 1CQWA 2BGKA 1Q44A 2E1RA 3JVVA 2RHTA 3PWZA 4AD8A 1SIBE 4P1ZA 4HNVA 2RMKA 4IH9A 1M67A 3HA7A 4D2IA 5JSUA 2P2SA 2W8BB 3DVSX 3B2EA 3BKXA 4HVCA 1F4LA 1Z5GA 2EJWA 2R47A 3KK0A 3IEXA 3LBFA 4EGQA 4IJKA 1VMKA 2YIVX 3C4JA 3G0DA 1VSQA 5DHFA 5SZKB 1GN9A 4JI3B 3ZCXA 3ZV4A 1P2SA 1P2BA 4JROA 1ECLA 2OXFA 1CZOA 2CCJA 5C5EA 4URZR 4QASA 5IH3A 1GIAA 2NXNA 4BLQA 1T25A 3K5HA 4MKRA 1NDUA 2C2BA 4IXMA 2JBWA 2DHDA 2Z57A 4YO7A 1A9YA 2FAXA 3R5HA 1CF2O 1KERA 2QRPA 3A0UA 4YRIA 1T2EA 5HK9A 1O54A 5AHOA 4MYHA 1XCPA 3D3JA 2HJGA 2WPDA 3VR2A 2PX0A 4AJ4A 4AZ0A 5C37A 5JNTA 2M1XA 2ICAA 3HB0A 5AJUA 4GIBA 3ZH9B 1JHXA 4TQGA 4U9HS 5F35A 2Q5OA 2W2VA 1PZNA 1MRSA 2EW2A 3ZJYA 4PSKA 3A04A 1LI4A 2JFHA 3OUUA 1ZIYA 1YDHA 4XEUA 2RK6A 2QENA 3PCRB 2XSZA 3REOA 2Q8NA 1FLNA 2DQSA 2D0OB 2VP3A 2PANA 2RIPA 8OHMA 4LV5B 1T4CB 2X22A 4QQNA 1A9SA 1KZYC 1WZNA 1A9ZA 1Y5RA 2B4AA 3EN0A 5H8WA 2NU7A 1SULA 2CYAA 1Z62A 2EFGA 3E7FA 4JEIA 4D0LB 4OO3A 1UADA 1VG1A 2DT5A 4WT7A 1CB0A 1NW3A 4X85A 3EXG1 4Q3DA 3SI7A 3VV3A 3HACA 4C6RA 1KHHA 3KS9A 3ZQKA 4J07A 3KXPA 1BVHA 3HR4A 4WNYA 1KP3A 3OBBA 1QO9A 3FSGD 1GQYA 1HKHA 2P8SA 1QS0A 1XUOA 4BB0A 4RK6A 2YINC 1MVOA 1PIWA 3AHCA 1FP6A 1RAFA 4IO0A 4U2BA 5KVCA 2PQ6A 4W7IA 4ZVRA 1L5SA 4J7UA 3CWQA 5KDDA 3AL2A 4JBLA 2Y6UA 4HQNA 4L7VA 3V7FA 3ROXA 1M1YB 1UPFA 4H77A 2XIJA 1JHDA 2GTHA 3UAXA 1VSVA 3HJAA 4JODA 7AT1A 2ZU6A 1NM5C 5EAIA 5HYVA 3DE4X 1P7CA 4QRDA 2C5EA 3PRKE 2NO0A 2VA9A 1YS1X 1CLEA 2A0YA 1BTOA 2HCBA 2J5RA 2JB9A 2Z2JA 3MQ2A 3OTHA 4TLCA 2HEIA 5IEBA 4GE3A 3ZDQA 3ZCRA 4NNOA 4KFCA 1SKUA 4OX9Y 1ODSA 3THXA 1E1DA 3UUWA 3A1SA 4CM5A 4EW3A 1OKKA 1AT1A 1B6RA 1J97A 2Z1DA 2B6HA 4FLFA 5FOSA 5FEMA 1FX1A 5IANA 1DPFA 4Y1RA 1ZHOA 1OXKB 1ULZA 2BEWB 4L6IA 2BP7A 5CM8B 1MVNA 5AFSA 4N7JA 4CV0A 3QEOA 3KZCA 1MEJA 5FTWA 5AVOA 1JG6A 2GXQA 3QQPA 4QSMA 1AZWA 1RMQA 3KIPA 4I3GA 4MVJI 3IKVA 4R31A 2BM1A 2YHAA 1H42A 2ISQA 1KMMA 3D0OA 4WVFA 5G3YA 3WJ7A 5K6TA 4KG7A 2NACA 5KVSA 4RV5A 4UQOA 4C1NA 1XEWY 4RKRA 3FSEA 4HDSA 3HR7A 2IDZA 3HYCA 4DIDA 1UAYA 1LS6A 5HGJA 3LVFO 2VAXA 4D57A 4DA8A 5BN5A 4ESVA 1A7JA 4RQUA 2KPOA 3PQ2A 4ZHQB 2BVNA 5I45A 2QBYA 3NPAA 5CB0A 2WHXA 3C1OA 2PTHA 1PR6A 3AV3A 2ZB3A 1YI8A 3IPXA 4UKDA 5EY5B 4CKWA 2N47A 1ULBA 4H7FA 4IHQA 3GRRA 4IIEA 4G85A 5JFTA 3Q3GE 5E6RA 5GONB 3WFIA 2B94A 4KPGA 4BWYA 1P81A 1WABA 4EYKA 2FGJA 1DO0A 5AQEA 3GBVA 1YBMA 2G1PA 4MVJG 3H86A 1RC1A 4G0VA 5IUJC 4M89A 1SOAA 5ALZA 3ZU4A 1OD6A 1EIWA 5LLSA 5L7TA 5J3JA 3F5SA 3KWJA 1E79A 2HDHA 3EXHA 3PFFA 4QYTA 1M0SA 3I42A 4B6EA 5A02A 1DMRA 1ZAYA 2CUZA 1YJXA 3NCTA 3E3AA 1AQYA 4ZALA 4Y2HA 2C8KA 3EMDA 2AFRA 3KLOA 3HKDB 3RT1A 3S8MA 1YR7A 1FNSA 1PR3A 2HJHA 5KTKA 2ZROA 2FG6C 2ZSUA 3EYWA 4NU8X 2D0IA 3QUQA 1N33B 1LLDA 2ZTLA 1EE2A 4OJKA 3UOGA 4KSYA 1XWIA 3MWEB 2F6RA 3B7PA 4MS4A 3E9RA 3DLHA 2FZWA 3TNJA 1XJWA 3FOFC 1QHHB 5BWMA 1V5IA 1GZ5A 2VKQA 5T3UA 1GRRA 2N1MA 3RGGA 2B8WA 4MUYA 2FXVA 1GG8A 1QKJA 3HYRA 3W77A 1AKTA 3B6EA 4XRGA 1DIBA 2X8AA 3UT5B 2FW6A 4KV7A 1OPXA 3PL5A 4XYBA 2B99A 1E92A 3FSRA 1PKXA 3H9UA 4JU8A 5CLIA 3VDQA 2GJSA 3O31A 5FLYA 4DIFA 3OE7D 4LY3A 3NUZA 1E2MA 4Y8VA 3RFVA 1NONA 3NHYA 5E9QA 3C6BA 5KSPA 2ZSBA 2VSNA 1G0OA 3PDUA 2Z9BA 1GEGA 2P1ZA 4FUTA 4HXFB 4PG7A 1RRGA 1XDWA 2ISSD 3RKRA 3UJDA 3OZDA 3G8CA 5GZ1A 3Q3EA 5CIQA 2CL6X 3MC1A 5FUBA 5LZ4A 3UC9A 1XALA 4URWR 1R16A 1N7IA 3SQNA 2NZWA 1G5QA 2YX1A 5LOVB 3MJEA 5AP9A 2A30A 2FPPA 3AR3A 4RENA 1MUUA 3O94A 1RI4A 4HAXA 4PSDA 3T5CA 2R5NA 3VR0A 1T0HB 3IUJA 4JLNA 1S8OA 3MN1A 4AULA 3SQXA 4I9UA 1CZNA 1JIQA 1NFQA 3ANMA 4FW9A 4KQHA 4X93A 2QZJA 4Q9JA 3T38A 3B3GA 5LU9A 1JJFA 1RAIA 2BHLA 1EPUA 2I1WA 2JA1A 2BFBA 2PVPA 3ELUA 3MLEA 3NHRA 4KDCA 1FP2A 2JIBA 2QD3A 3F90A 4ITUA 1Q2UA 5PNTA 2Q7OE 4H6WA 4K6FA 5D1HA 3FGOA 1T2UA 2Q5JA 1T0PA 4HN9A 3VPDA 3FDIA 3K9CA 3QXHA 5A5FA 3DO6A 1N6KA 4CG1A 1FNMA 3P9PA 3Q5EA 5MFPA 1NLFA 1TLTA 2ONCA 1BE1A 3R8XA 2A14A 1YQEA 1SO8A 1TO2E 5C4MA 2AMFA 1IN8A 3VMMA 5J2UA 3M5WA 1YE8A 5EXSA 1N6LA 1Q6ZA 3RUCA 1B00A 5CVJA 1N7GA 3T3IA 5EPOA 3GEPA 2P8JA 2DGDA 2GVNA 1QG2A 3HBNA 1YDGA 2YOGA 3EGWA 3VAYA 1GPKA 2RGYA 1PWHA 2XJ9A 2FSPA 5G02A 5IAJA 3GUYA 3R7FA 2Y0BA 2QUHA 2CBGA 1ORRA 1C81A 3NIDB 4MWDA 1I7PA 5EJEA 1J4AA 1NA5A 3H42B 3D02A 2HC9A 4QRIA 4DIOA 2WV7A 3E22B 5I48A 1XX6A 4R2KA 4LYGA 5CXXA 3BFJA 1L5HB 2MYNA 2DSNA 3QG1A 4FZRA 3ZE8A 3AR2A 2O19A 3EPHA 3HXMA 4KHPB 2QRVA 2YUTA 3JD1A 2WHPA 4J3NA 2I29A 4MWSA 3W5SA 4EJMA 2REBA 2Z43A 3LQQA 3RS0A 1BJKA 4Q48A 3ZGXA 2ZUEA 1GQ2A 5F4ZA 1KKLA 3B1FA 4ZGWA 1MNQA 4ENRA 4HEQA 5DU2A 2B9VA 3N7TA 3W78A 1UMBA 2P0AA 1NIPA 2WPNA 2G17A 2PG3A 3COSA 3AX6A 4I0WB 2OVFA 4O1MA 3SM3A 4NZ9A 1J1IA 5LZ2A 5LXTA 1GSHA 1TTHA 3EPPA 4E09A 3DTVB 2Q5HA 3ICPA 1L7RA 2XCLA 1EGMB 3HVIA 3LDHA 1YI1A 4Z53A 2QNBA 5LQMA 1HYQA 4U5XA 4GM0A 4L8FA 1AQLA 3WL5A 1V96A 3A36A 3AUXA 3M81A 5CCXA 1OB2A 3GLKA 1ODJA 1ZH0A 2DH5A 3DP7A 3GOQA 3P7MA 1MC5A 3U17A 4G5FA 1SU7A 2D1YA 3GIDA 1Z6AA 3RYIA 2YMQA 1EK5A 3EDCA 4KZPA 3E58A 3FSGA 3QUTA 3ZN2A 4V3CA 2GHTA 4PG4A 5BNIA 3KQWA 4DMHA 4PHTA 2BC9A 4O4JA 1P1RA 2JKVA 3U31A 3JAWB 3PC7A 2ID9A 2IYTA 3RUHA 1UBTS 2YWJA 4RHYA 3G79A 3I23A 4WV3A 4BB5A 1XTSA 2EU8A 3SF8B 4RTKA 1WNFA 1W73A 3FCXA 3HCCA 5JAUA 4V1CB 4F72A 4TROA 2JIDA 2FYTA 4WCFB 5CURA 3TF5A