5CFZA

Crystal structure of e. coli fabi in apo form
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
249
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic insights into the structure-activity relationships of diazaborine enoyl-ACP reductase inhibitors.
pubmed doi rcsb
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
molecule tags Oxidoreductase
source organism Escherichia coli (strain k12)
total genus 90
structure length 249
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5cfzA00
1NFQA 2RHRA 1ZJYA 3D4PA 4HY3A 1BG6A 3JQ6A 4OH1A 1VPDA 4NNJA 1N1EA 2CVZA 3AJRA 4E31A 3X2EA 3FSRA 3GFBA 1PJTA 1JQBA 4YJGB 4XYGA 1QYXA 5KJFA 3JQGB 1ONOA 4PFJA 5DCUA 1DFHA 3QVTA 4IMRA 1JLLA 3BYZA 3RKRA 1A5ZA 4FFPA 1PJ2A 1KVSA 1P1RA 1PJ3A 1ISHA 3SX2A 3U62A 4HXYA 4IUYA 3AM3A 4OHUA 3ZWWA 1IZ9A 2GN4A 3ZWYA 6LDHA 4BGVA 2OBYA 4CMAA 4RF3A 4CM7A 1RM4A 3F9IA 3NTOA 1ZJZA 4IXTA 1JA9A 4ID9A 3WLFA 1DB3A 2BRUA 1TT5B 3RFVA 3VDRA 2AXQA 3W8DA 1C0IA 2VCYA 1YXMA 2WYVA 1ID1A 4U0JA 4OQYA 3UXYA 3C3XA 1MC4A 2I9PA 3RUFA 3AU9A 3WBBA 3C8MA 4H7PA 4ZQHA 4LMRA 1QR6A 3JQ9C 4BO7A 3DTTA 3FRJA 1N8KA 3WQSB 5TQVA 4DLBA 1YS4A 1ZUD1 4E5PA 5A02A 1ZSNA 1LDGA 4IDDA 4E0BA 1YB5A 3ORFA 4CLOA 5KJ6A 5FI5A 4EEZA 4FDAA 2QYTA 4RVDA 4D42A 1JN0A 3PEFA 1BSVA 3AM5A 5GY7A 4BB6A 5A9SB 1UDCA 5CDTA 4WLVA 3OEYA 2W2KB 3D3WA 4XB1A 2VWPA 4EBFA 5JDCC 4B7XA 1W0CA 5L51A 1XWFA 3PVZA 1K6IA 1GU7A 2GCGA 1LSOA 3R3JA 1NWHA 4TVBA 4BGUA 2PH5A 4YJFA 1I30A 4AJOA 3S2IA 3IUSA 3ZW9A 1XGKA 2P68A 4CM9D 2DT5A 2W98A 4FPXA 1JWAB 2XXJA 1AHHA 1VJ1A 3ASUA 3HN2A 1UXKA 2CVOA 1W6UA 3G49A 2LDBA 5I9LA 1H94A 4CMKA 2HKIA 5L53A 1NXQA 4AG3A 4NG5A 3K92A 3I9JA 1BDBA 3FN4A 4WGGA 2JHFA 1P1IA 2ZYAA 2CF6A 2X6TA 3V1UA 4LSWA 3I83A 1E7WA 3SXPA 5A9SA 3GF4A 4TRMA 5T8KC 4QSMA 4B4UA 5JFOA 4TRNA 2D5AA 4FFRA 3UCEA 4MO2A 4MKZA 3TOXA 4ZRNA 3VVBA 7MDHA 3HFSA 4GVXA 4BNYA 3Q6IA 3ZWCA 2WYWA 5A9TA 4E21A 1DLIA 1QP8A 2BFMA 3SJUA 5DP1A 4DYDA 9LDTA 5KWEA 2BGMA 1T4DA 3OJ0A 1LEHA 3KVOA 2O2YA 4P8RA 4UAGA 5ER6A 4AJIA 4IQGA 1Y8RA 4FJ2A 2EJWA 2QQ5A 3ROPA 2PTGA 4P4LA 1MGOA 2C20A 1ISGA 3GNSA 2Y93A 3DAFA 4DUPA 1M66A 3OHSX 4CUKA 1RKXA 3H7AA 3LC1O 2B5VA 1SEPA 4W7IA 1PJ4A 3HJAA 4Y6SA 4DXHA 2ZTVA 1IHYA 1XSEA 2VYNA 1GD1O 2IXAA 3WWZA 2NNLD 5BQFA 3HQ4O 1A27A 3QQPA 4DQVA 4W6ZA 4JNKA 1GPJA 4I5DA 4WPGA 1HE4A 4XGNA 3WGIA 1T2CA 2UV8A 1SAYA 1XDWA 5F1PA 3U5TA 2JKVA 1Z75A 3GG2A 1B7GO 3KM0A 1QSGA 4PG4A 1BVRA 3UFXA 3BMQB 3P5SA 3DDNA 4RPLA 3HDQA 4W99A 1B8VA 2FR1A 1OFGA 1DEHA 2EF1A 2C5EA 2QG4A 3F4LA 1Z7EA 4IBOA 3UICA 2GASA 4LRSB 5IFLA 1NPYA 4WOKA 4AJHA 4BO4A 1PZGA 4D79A 4HV4A 1HT0A 1F06A 1VLLA 3EVTA 3Q2IA 4G5HA 1HZJA 5CG1A 3GEGA 4MPDA 5BSHA 1JTVA 4HFRA 1HEUA 1T2DA 2ZB8A 1PL8A 4Y6PA 3IQDB 2POQX 2DKNA 3PQFA 4GGOA 1AXEA 4BNHA 4PLCA 4Z0PA 4IDCA 1H2BA 1DDOA 1HDZA 2HAEA 1DHRA 1PTJA 1HE3A 2W2LA 3U4DA 5DCYA 2NVUB 4AFNA 4EITA 3GMDA 4RZHA 1V6AA 2E4AA 5BSGA 5H81A 3R6DA 4PZDA 1K89A 4RVSA 2C0CA 5EIOA 1RM0A 1B0AA 4TKMA 1CIVA 3IOYA 3NT5A 2G17A 1R66A 1T2EA 3OJFA 3S55A 1E7SA 3VTFA 3M1AA 4IDGA 4QEDA 3QWIA 5I7SA 4AVYA 3SEFA 1MA0A 2E82A 1MB4A 1ENPA 3WBFA 3KSDO 1PEDA 3FBGA 4RO0A 3O38A 1PJCA 1NAHA 4R69A 2RH4A 4HFMA 1H9BA 4IIVA 4A2CA 3WR5A 1IHXA 1ONNA 4JX8A 2IXBA 2OORA 2CF5A 4FR5A 3IUPA 1E6UA 1WZIA 3Q9UA 3BIOA 1WDKA 1GQ2A 2PA3A 4Z9YA 3VH3A 4E5MA 4CL3A 1BDMA 2FPIA 2CDBA 4WLFA 4XR4A 5HS4A 1JWBB 3RC7A 7ADHA 3MJ4A 4RV9A 3WG9A 4IPTA 3PGJA 5G0SA 3U09A 3RBZA 5A3VA 3OIDA 1Z6ZA 1ONPA 3S2EA 4DA9A 2P5YA 3WSVA 3AFNA 4O59O 3LYLA 4B4VA 4EYEA 4CQLB 5HS6A 2RIRA 4D43A 4JIGA 3ZW8A 2JD1A 2A35A 4UVHA 2P91A 2BLLA 4HNGA 2HMTA 2EERA 2VHVA 3FNFA 4GSLA 4J4HA 3DBHA 4OJNA 3KZVA 4INAA 4OAQA 3D4NA 5TGDA 2C7GA 5TS3A 1A4UA 2B4QA 3AOEA 3ZWOA 1ARZA 3BHMA 1KBZA 3MOIA 2DBVO 2O3RA 4IM7A 5DP2A 1NYTA 2Y1EA 4PRKA 4W9NA 1SNYA 1UDAA 4DC0A 5COQA 2QYSA 5TT1A 3AY6A 2ZTMA 5AVOA 1E77A 3DTYA 3DEYX 3VKVA 3LU1A 5JDIC 1QYWA 2OHXA 2VRBA 3O4RA 3VPHA 3WGYA 2ZCVA 4IIUA 5C7LO 3LVFO 1ISMA 2PGDA 1Y9EA 3HZZA 2VUTA 2Z5LA 4J7XA 1ADGA 5I9MA 2O3JA 3LDHA 5GZ3A 3BHIA 1C0KA 3MCVA 4NFHA 1EBUA 1LSSA 1Q7BA 3WJAA 5A3JA 5BNTA 2AG8A 5IDWA 2I66A 2BI8A 1M6WA 1NQTA 3QLJA 1WDLA 3L4BA 9LDBA 4DWVA 2Y1FA 1QYVA 4FIZA 5KJ1A 2Q1TA 3FPLA 1B3BA 3KV3O 3OJLA 3QWHA 3SBOA 4JGBA 1H5QA 3TZ6A 4GX5A 5G4KA 2WM3A 4Q3CA 3O8QB 3PI7A 4QXMA 3N74A 4JBIA 4PLZA 2VTEA 5LDGA 2UUOA 5TT0A 3WLEA 3JQEA 5GMOA 5L3ZA 1PU2A 5EJ2A 3JQDA 3TZCA 5BNIA 5KCZA 5DOVA 3K96A 5JAIA 4R16A 5T64A 4DC1A 3LT0A 3OA0A 4XDZA 2ZB7A 2X9GA 4BVAA 4HFJA 1PWZA 1DOHA 1U28A 5JC1A 3OETA 3AY7A 1J5PA 3RROA 1XCBA 3FD8A 2Q3EA 3BHJA 4N5MA 4QO8A 3KRTA 5G0VA 1NASA 2I5PO 3V1TC 2PZKA 4GKBA 4ALMA 1KIFA 1CQIA 1LU9A 2VT2A 3Q11A 3ZV4A 1MFZA 1ENZA 3GG9A 4BOYA 2E48A 3QP9A 1HYGA 4OKIA 4WLNA 3D4OA 2G82A 1E3IA 2FY8A 2YY7A 4PVCA 3HNPA 3IL2A 3MTGA 2FZWA 3H9UA 3LQFA 4B79A 4YAKA 3Q3CA 1FMCA 3GVCA 1NHWA 4DPKA 2Q1SA 1YQGA 2BKAA 4QUKA 8ADHA 4CM1A 2VRCD 3JQBC 5LCXA 3FR7A 5EN4A 4N54A 2JCYA 4D41A 2Y1DA 2EXXA 1BTOA 3ON5A 3IC5A 2Q4EA 3ONFA 4MVJG 3DHNA 3GA0A 2JD0A 3QSGA 4YAJA 3UF0A 4PG7A 4XR9A 4RLHA 3GGGA 3A14A 4Q3EA 4HKTA 5DN9A 2HCTA 3ZHYA 3ETDA 3VPFA 4JN6B 3FHLA 1PZEA 3D64A 3QW2A 5ITVA 4J0EA 5DBFA 1NQOA 5EQFA 3OEWA 3WX0A 1LLUA 1PJSA 3C1AA 4ALJA 1P45A 3BZUA 3GQVA 3KHUA 1YDWA 1QORA 2B83A 3CSDA 4IS2A 3KYDA 5JAQA 5IG2A 3KYBA 1HE5A 3L6OO 2FSSA 3LZ6A 4ZU3A 4CUZA 3H8VA 5KOIA 4MVJP 1XKQA 4J9VA 1NPTO 2ZIZA 1XYGA 4KWHA 2PD6A 3BMNB 1I5RA 4OKNA 5FI3A 3H5NA 3T7CA 1D1TA 1UJMA 2V65A 4M55A 1CYDA 2QRKA 1SMKA 1SZJG 2EW8A 1SOVA 2OP1A 3H2ZA 4L9RA 1KVRA 1UAYA 2NVBA 2WE7A 1YWGO 3C1TA 4ZA2A 3T4XA 5IDQA 3H2SA 1U4SA 1ZNQO 3WYCA 3QA9A 3VH4A 2DFDA 1I33A 3LK7A 1AUPA 1CQJA 4I5GA 4FFLA 4TROA 3PYMA 3VOSA 3ZHXA 4IMPA 4HADA 1QG6A 4YWJA 5TC4A 4AJLA 3IKVA 2CDCA 3GGPA 3TWOA 4BGIA 1GYRA 1RWBA 2WMDA 4ND1A 4CMGA 3PPIA 4YTEA 2DUUA 3H9GA 4L74A 4PRLA 3ZGYA 1X1TA 1OZAA 2YDYA 3K6JA 3BXXA 5C7OO 1PGOA 1YDEA 5I7VA 1LA2A 1XU7A 3DBLB 3E8XA 5CFZA 4CQMA 1LRLA 3DONA 4RZIA 3UUWA 2WJPA 3B20A 4CLRB 1N5DA 4CMHA 3I52A 1EUCA 2GSDA 3C7AA 4UVIA 1PQUA 2VHZA 4L75A 4I5FA 3WGZA 2IE0A 3MJEA 3KEOA 5HA5A 1KEVA 1KC3A 5CDGA 1I32A 1BXGA 3B1JA 2GR9A 3BAZA 4W7HA 4JJFA 3F6YA 4RF5A 4JJGA 3GLQA 4U6SA 2X9NA 1DIBA 4BO1A 1HWYA 1LSJA 4ALIA 4DYVA 3I9OA 1KVQA 1Y9AA 2ZYGA 4WLOA 1G1AA 3EDMA 2B4TO 2O2SA 5JAMA 5JNLA 2PWZA 4GWKA 3CZRA 1FDSA 3DZBA 1LRKA 4CM8A 2YHUA 5EL0A 4XYMA 3FBTA 5ENVA 4MP8A 3U3XA 1Y5RA 4DBZA 4HBGA 4IINA 3JD1A 1I3LA 3N58A 4G81A 5A1TA 3MWEB 4NBRA 2CY0A 2GYYA 4PLTA 1I8TA 1FF9A 4EDFA 5DNAA 5LC1A 2G0TA 4FD3A 4A5OA 4MVJM 3ONDA 1YKFA 1C3VA 3PLRA 5FWNA 3AUSA 2JAHA 3ZU2A 1YB1A 2I65A 5IXYA 4CODB 3OM9A 3S1LA 1B2LA 4ESOA 1NWCA 2IEDA 2X23A 2DC1A 2P4HX 1PX0A 4GPD1 1CRWG 4A26A 4AL4A 4TRJA 3GPDG 4A27A 4XQ9A 1KYQA 1VSVA 1ISIA 3RQSA 2BI7A 1DRWA 1ZIDA 3VPXA 4IGEA 1CDOA 1HYHA 3KTDA 5BNFA 5K9ZA 3V1YA 4J0FA 3DR3A 1S6YA 5B4TA 1R4NA 1WAMA 1DBVO 1R4MB 2CVQA 4L73A 3MJVA 3EY4A 3JYNA 1P31A 4WEQA 2Y1OA 1PZHA 3QVWA 4NBVA 1KS9A 4GMGA 4UUMA 3TQHA 4HWKA 2Z1NA 4J1SA 1ZEMA 2PV7A 2EJVA 2WTBA 4FQ8A 3DHEA 5B37A 1LJ8A 1MXFA 3OECA 1Z73A 3NT2A 5CG2A 4YRBA 4OXKA 1TXGA 1DLJA 3BMOA 5EESA 1TVEA 4C7KA 4FB5A 5GZ1A 1NTOA 1W8DA 5EINA 1NVTA 4Q3DA 3AOGA 5JW6A 5AOVA 2X8LA 4XRRA 2AQIA 1ZH8A 2VT3A 4GX2A 3QIVA 4L76A 2Z1MA 4YAEA 1U2GA 4ZJUA 1VJTA 1JW9B 1T25A 4ZQBA 2BMAA 4I8XA 5J23A 2YFQA 2X5OA 4CM9A 1IUKA 2R6JA 4DPLA 2HQ1A 5F1KA 3I9NA 4YQZA 4BO8A 4CM5A 4CM4A 3C7CB 4GLOA 5KTKA 4EJ0A 2Y0DA 3O03A 4L0QA 3WSWA 2B35A 2PZMA 3EMKA 1HDGO 1I2ZA 3TSCA 3DXFA 2NTJA 1GZ3A 1GV0A 1V9LA 3EYWA 4NQZA 3ZV6A 4QFCA 1PR9A 3ROKA 1OBFO 4MINA 1L7DA 3D5QA 1UXIA 3PFFA 1JAYA 4G2NA 4XEHA 4KQXA 3DWFA 3V8BA 4Z3KA 4L4XA 3DZGA 1E3EA 1MV8A 3Q0EA 1A4IA 2VHYA 4R1UA 2GUGA 2Q46A 2IEBA 3RVDA 4CLOB 5KNLA 3AUAA 2C5AA 5B4VA 3W1VA 5KIAA 4R41A 1A9YA 1OI7A 2PZLA 2QIOA 5DULA 4B8ZA 3RUDA 4R54A 4II3A 1F8FA 4F6LA 3D3WB 3DAPA 3RUHA 3UGKA 4D7AA 3IP1A 2WEKA 3ICPA 1YQXA 3A4VA 3HWRA 3L4SO 4LSMA 2DPGA 4FS3A 4Q3NA 5DOZA 1DSSG 3GVXA 1SO8A 2X0IA 4WNIA 1UP6A 3H9EO 4YJFB 3G1TA 4KDFA 3NDRA 5JMPA 2VNSA 4DLLA 1LQTA 1MXHA 2FOIA 3I6IA 1P33A 1IULA 2X1HA 2HRBA 1GYPA 1P1FA 1E7QA 5IZCC 3K31A 4BNFA 3DMTA 3DZFA 5CDSA 1IYZA 4IDFA 2GZ2A 4NPCA 2AE2A 1UXJA 4BNJA 4NK5A 5B4UA 3EAGA 2CFCA 4ZQEA 2ILTA 2TMDA 4RJTA 4E30A 2Q50A 3D3EA 2DFVA 2W4QA 1XR3A 2Q99A 1HF3A 1NPDA 3KLPX 1X7HA 3ETEA 3ZWVA 1YL5A 4CLXA 5H83A 4GQAA 2GZ1A 2PNFA 2V6GA 2Y0CA 1Q2XA 1EK6A 4R9RA 3MWDB 4RF2A 3I4CA 1Y8RB 4NJOA 1KEPA 4ZVVA 3V5NA 4YACA 1PGNA 4RVHA 1ZK0A 3SLGA 4FC6A 2FR0A 1N2SA 1NHGA 5K6AC 4XYLA 4J4TA 3DAGA 4CL8A 3NUGA 2RHCA 4K9DA 4IJVA 3IMFA 1VL8A 4OIMA 5U4QA 4CR8A 1WNTA 3B1FA 4ND5A 3OSUA 3PQEA 3NJ4A 1B26A 4TSKA 3LT1A 2D2IA 2UUPA 3PTZA 1D4FA 3F5QA 3GDOA 1KC1A 1H9AA 1PJLA 1H6AA 2NU7A 3QWAA 3ZV3A 5G4LA 3R1IA 4EUEA 5TF4A 1LNQA 4ND3A 3HADA 3L9XA 3NKLA 4HNHA 4XYEA 1B16A 5JCJD 2BFPA 1JKIA 2IZ0A 5JO0A 5JPIA 3K9QO 3WNQA 1TI7A 1WPQA 3KUXA 4IJWA 1HTBA 3OQ1A 1SCUA 3NDJA 4LN1A 3K2EA 3UCFA 4P22A 1U1IA 1JKJA 1P0CA 2AA3A 3X2FA 2D8AA 1UZMA 1LQUA 4U6QA 5CEJA 3GZNA 3PHLA 1Y8QA 4R01A 4R4JA 4PZCA 1LDEA 2D5CA 3Q2KA 4LVUA 3STHA 4L8VA 2VOJA 1UH5A 3F5SA 4OO3A 3ZNPA 3OQ6A 2XPCA 4B3JA 2IODA 1R12A 3S2FA 2JD2A 1O0SA 4CMEA 4ZHSA 1ZXBA 3TFQA 3KETA 1LC3A 1NNUA 1KVUA 3OIGA 2X22A 4A03A 3CPSA 5THQA 3JQFA 5ADHA 3GH3A 2YV2A 3JD2A 3M2PA 2AQ8A 1Q7CA 3JSAA 3B1KA 2VYVD 3K5PA 3M1LA 4BQRA 3RBVA 5CEEA 3H6KA 4FOSA 3TZKA 2NQ8A 2NV6A 4MJLA 4YB8A 5ER9A 2PY6A 4J3FA 2OGUA 1DAPA 3S8MA 2D0IA 2IRWA 3I4FA 2PGJA 2WWRA 1U8XX 5AXBA 1JDJA 3ZN2A 4JROA 5A03A 3IJPA 2IZ1A 1E3JA 1V35A 3GMSA 3R3SA 4AJEA 4B3HA 2J3JA 2H1SA 4RORA 5COAA 4LMPA 4E2XA 4E4YA 3TFOA 2QX7A 1FK8A 4WNCA 5JY1A 3FI9A 4NFSA 2QRLA 1PZFA 3WNVA 2B5WA 3D7LA 4FOOA 1UAGA 3U0BA 4PZEA 5A04A 4J7UA 4I9NA 2JCVA 2Q2QA 5TLSA 3ROMA 1QXSA 4D3SA 4NK4A 1VL0A 4WEOA 3WGOA 3JQAA 3Q1LA 4BB5A 1OC2A 2XOXA 4ZQGA 3NT4A 1QV7A 2WSBA 4I9HA 2YHIA 3DBHB 4H15A 3D0OA 2RCYA 3WB9A 3OH8A 4GMFA 1IE3A 1WMBA 2YFHA 4ALLA 3ANNA 3EHEA 5A9RA 4BNVA 1PS9A 2SCUA 4CLDA 1O6ZA 4GBJA 3C7DB 4BNZA 3PYXA 3WFIA 3DBVO 1K5HA 4IXWA 4BNIA 2D1YA 2Q1UA 2HK7A 1GY8A 5ENDA 2HRZA 1X14A 4CR6A 1LUAA 1V3TA 4NJMB 3KB6A 1D7OA 4D45A 2FZEA 4HP8A 4YAIA 5COBA 2BHLA 5A5EA 4MVJA 2XF8A 4MVJH 3VVCA 4CJXA 4L4SA 3RCBA 4TMFA 1T4BA 3E9NA 2GD1O 4Y8VA 4QECA 3JQ7A 1H2HA 3I9LA 1ZKMA 1PQPA 3TL3A 1QRRA 4OXNA 5A5FA 4GX0A 3IIEA 2H63A 3OBBA 5CP8A 5G4KB 4XQCA 3OF2A 3MTJA 4LCJA 3F46A 3PWKA 5ILGA 3L9WA 3UHAA 2C2XA 1WP4A 1R0KA 2QHXA 1ORRA 4N5NA 5IN5A 3P2OA 1BMDA 1X0XA 2BH9A 2NU6A 2VYND 4I9UA 2EGHA 4BL5A 1DPGA 1GEGA 5JAZA 1HLDA 2R00A 2X0NA 2X86A 5A4DA 3DOCA 4NJMA 1N9GA 4GH5A 1ZSYA 1B8PA 4ZQFA 2BFAA 3CEAA 3ENKA 3NTQA 4NZ9A 2IYPA 1FDWA 4YT5A 3VTZA 5I7EA 5I7FA 2WD8A 1QLHA 3ZWNA 4DTIA 1TEHA 2AMFA 2RH8A 5L9AA 1U4OA 5F5LA 2QZ9A 3E5MA 4W4TA 3KSUA 3A9WA 1NP3A 3ABIA 1UP4A 1TLTA 3PFWO 4HUJA 4FN4A 1A72A 2P4QA 4AJNA 3PZBA 4RLSA 3NTRA 1U7HA 1EVIA 4Q9NA 2ZQZA 4EZBA 2W2LD 3TOZA 8LDHA 4CMIA 2B37A 4Z0TA 3DOOA 4YCAA 1F0YA 2DM6A 1F17A 4D3DA 1T26A 1O5IA 4MVJF 3V2HA 2VZ8A 1NX6A 3E48A 1AGNA 2VUUA 1WLYA 3ITKA 1EVYA 3E03A 3H3FA 3VH1A 1F14A 3ANMA 1BHSA 2DLDA 3P7MA 1J4AA 3MEQA 4OOEA 1BW9A 1X7DA 1DIGA 1PSDA 2PR2A 2YZ7A 4DLAA 1GQYA 1C14A 3EUWA 3U49A 4KWIA 1HZZA 3KYDB 1EE2A 3WGQA 3SVTA 4Z3DA 4YPOA 5L40A 2O4CA 1DC4A 4FC7A 4EUFA 4BO5A 3EZYA 2GGSA 3AI3A 3GRKA 4FGWA 1ZFNA 2G76A 2PLAA 2DBQA 3EZLA 4RF4A 5ILOA 1LSUA 2V6FA 3LLVA 4DREA 1JKFA 1SEVA 1YBAA 3OJOA 4YT8A 5MGBA 1NQAO 5AYVA 2A94A 4RCVA 1NFFA 3ZZNA 2JFHA 1F12A 4BHTA 1I3MA 3V2UA 1SPXA 4B8WA 3ZHBA 2Y05A 4XJTA 3ONEA 5HWSA 1H0KA 2GDZA 2VQ3A 3CUKA 5L7YA 4XQGA 3LSYA 2D4AA 2PKRA 4FW8A 4JP2A 2WD7A 1MLDA 1FJHA 3ZWMA 1KVTA 2O50A 1Q0HA 3L6EA 4HFNA 4PLFA 4YEDA 4BMVA 3UKOA 2NADA 2J5QA 4PN3A 2PKQP 4ALNA 3CKYA 3B6ZA 1QYDA 1NQ5A 3PWSA 3KYCA 3ZCXA 1O8CA 3TJRA 1IOLA 4BNLA 3WMXA 2AQKA 1AHIA 5IJZA 4CQMB 1ZCJA 1NFRA 4DMMA 3NYWA 2B36A 1EZ4A 2GRAA 4Y67A 1LDNA 2O3TA 4GL4A 2X0JA 3GK3A 1T24A 2I3GA 3JQ9A 4U5QA 5EQDA 1ADFA 1HL3A 1HLPA 1DJNA 1EVJA 1LLCA 1U5AA 2GNAA 2WYUA 1FDTA 2FR8A 3FNHA 3JQFC 2CMDA 4GWGA 2C82A 2BELA 3JQ8A 2HMSA 1PR3A 4PG6A 1BXGB 1C1DA 3PXXA 5KVVA 3G3EA 3L0DA 1N7GA 5AXDA 2X4GA 2Y99A 3EVNA 1SC6A 3BTSA 2AEMA 2EGGA 1QMGA 5EERA 2PFGA 5L95A 1XIVA 4BV8A 5JDCA 4E13A 3I1JA 3GUYA 5FEUA 4KTTE 5KVSA 2I67A 3MZ0A 1B8UA 4TKLA 4W82A 1GUZA 1VL6A 3GVIA 4JQCA 1H6BA 4BNXA 1TA4A 1JU9A 4AJ1A 1NR1A 1ZK2A 4CM8B 2HK8A 2BF7A 3GPIA 4YR9A 4BNTA 1KOLA 4N5LA 4BKUA 3BMCA 4JXKA 2V6BA 2C59A 3H3JA 3KXDA 2YV3A 1GCUA 3OJEA 1DFIA 2X7HA 4RQUA 1RM3A 3DC2A 3VHRA 5TRTA 4BQPA 3OFSA 3JV7A 5B1YA 4JK3A 5AXAA 3JTMA 1E6EA 2HLPA 2AEJA 2W90A 5TNXA 5T57A 1CWUA 4OMUA 3TZHA 2ZATA 1SBYA 4WJZA 1EK5A 3PHHA 3CMCO 5G0WA 3RUCA 4BIIA 1GEEA 3WYBA 4BNGA 4EEXA 1ZBQA 1KEWA 4BO3A 4IDEA 2NU9A 2OP0A 1VSUA 3G79A 1E3SA 2P2SA 2VWHA 1R15A 3WOHA 3MJSA 1K0UA 4MOWA 2EP5A 4GLLA 2X9VA 4D0RA 4RDIA 1Z74A 2C54A 4IQ8A 4BMNA 2HO5A 4JBHA 2GERA 1R4NB 4GI2A 4WCDA 4XYBA 1WZEA 4K1LA 3RIHA 3ZHZA 3RU9A 4AICA 3PJDA 4LGVA 3UCXA 1BXZA 1K6JA 3JYPA 4Y6RA 1A7KA 2OBNA 3QWFA 3PIDA 3WTBA 1K2WA 2CD9A 2E37A 2OL4A 3F3SA 2PK3A 2ZJ0A 3WFJA 3EC7A 3QHAA 1XQ6A 1I2CA 2ET6A 3AI1A 1E0DA 1UZNA 3QV1A 1U9JA 1YQDA 1PIWA 1PS8A 1XA0A 1WDMA 3BMOB 3CIFA 1WVGA 3H4VA 5HRUA 3T4EA 1PGQA 3OQBA 1B14A 4GKVA 5L7WA 3PHJA 1YO6A 3JYOA 3AK4A 5F5NA 3VZRA 4YAGA 3PP8A 5KVQA 3RWBA 1MUUA 4E12A 2QZZA 3PYLA 1OOEA 2GN9A 3WGGA 5K0ZA 1VE9A 2A92A 3NGLA 1XELA 1E1KA 4NH4A 1P74A 3AY3A 4KOAA 2J5RA 1P1KA 3PHGA 5IZ4A 3GUCA 5IDXA 5U9CA 1PGPA 4UREA 1PWXA 3JYLA 4J6FA 2GO1A 4BUCA 1RJWA 4DGSA 4MIYA 3AOEC 4A10A 4E33A 2FPGA 4YA6A 4QO7A 3AFMA 3P19A 4R1NA 4R5HA 4YJHA 4CV3A 1J49A 2ZK7A 4W9NC 4CM4B 1EBFA 2ZCUA 1EQ2A 3RUAA 4C7JA 2QW8A 1YJ8A 3RKUA 2A4KA 3DL2A 3DQPA 3RC2A 5C5IA 3LC7O 1NBOA 1YJQA 4CMCA 1E5QA 3L6DA 5I8ZA 4F6CA 5G2OA 3GAZA 4XKJA 2HMUA 5ICSA 1DIAA 1EQUA 2D3TA 3PDJA 5JLAA 3INRA 2HK9A 4OQZA 2FHSA 1DC6A 2AW5A 5JCXA 3TL2A 2O3UA 1LX6A 1ZEJA 3CH6A 4NU6A 3L4BC 2DTXA 1U7TA 4YBZA 4RPGA 4IS3A 4KUHA 4GAEA 3WJ7A 4IJUA 4OYRA 3GOHA 2AHRA 4CQMD 3T7EA 4BO9A 4XIYA 4UVEA 4J1QA 3AU8A 4E5KA 5DBIA 2DU8A 3AUTA 3DBRB 2YQ5A 3BTVA 4XX0A 5T5QA 1Q0LA 5DT9A 3HSKA 4RVUA 2DQ4A 3O26A 4Z6KA 2FPPA 1MFPA 1XU9A 3PDUA 4J91A 4MIEA 4PLYA 5CPFA 1ADBA 2X5JO 4M49A 4IQ0A 3GY0A 3KLMX 4JJIA 1EDOA 1ZVMA 2J8ZA 4FCCA 4NIMA 3W4IA 2HJSA 1HYEA 3F47A 5B12A 3H9QA 4LISA 4OOFA 3RUEA 3ZWPA 4Y98A 1ENOA 3U4IA 3B70A 3IDSA 3QWBA 2OO5A 3GAFA 4F45A 3K8ZA 5JCJA 4AJ4A 2HMWA 2ZYDA 4TWRA 3QVSA 4YT4A 4PGFA 4DQUA 2O48X 1IPEA 4XWYA 1F8GA 4XJSA 2CUKA 3VAZA 1GUFA 1EFKA 2GLXA 1XEAA 5CEFA 1GR0A 2BFOA 2H6EA 2OMEA 1YBVA 3WDSA 1A71A 2PGLA 1A9ZA 2O4UX 4DPMA 4X54A 2FP4A 1YOVA 3HFGA 4FBGA 2X0RA 4R5MA 3FNEA 4U0KA 4P4GA 3WIDA 3DBRA 1U8FO 2FRDA 2Y0EA 4O63O 5DZSA 1ZSVA 2Y66A 3MJTA 1GV1A 3HN7A 4BKOA 1E92A 2F1KA 1BXKA 2XXBA 4LVCA 5JS6A 4PLVA 3JD0A 1GAEO 4YRAA 3ZH2A 4UULA 4UUPA 4MVJE 3RFXA 2VZ0A 3DZJA 4L4RA 5JDIA 2X5KO 1DAOA 1GZ6A 5KVCA 2I3AA 4KDEA 3KO8A 2C7VA 4ND4A 2B4RO 1U3WA 4WLUA 1VM6A 3JD3A 4BKRA 5IF3A 2VYVA 2ZB3A 2VOEA 3DO5A 3ZV5A 1E6WA 4LCEA 2OXIA 5TIIA 1OC4A 4II2A 1Y81A 3IAHA 3G17A 4KQWA 1DRVA 3GDGA 4DL9A 4FJ0A 5BSEA 3I6QA 4ZD6A 4LW8A 2GF2A 1ZXLA 4Q3AA 5HTOA 4E5NA 1ZMOA 3HDYA 4QQRA 4KP7A 1WWKA 3COSA 1ZK4A 2HJRA 4MKXA 1D3AA 4YJGA 2C07A 2Q49A 4YJDA 2O7SA 3JQGA 4BV9A 2DTDA 2AE1A 1LLQA 2OZPA 3ICCA 4IDBA 3NAQA 3GZNB 1YRLA 2YDXA 1PL7A 1Y8QB 3AUUA 1E1LA 3EK2A 5DDIP 3OICA 1VJ0A 1G6KA 4R9SA 1P9LA 2JFFA 5CHEA 2DPHA 5THKA 1HSOA 2JL1A 3WGHA 2YV1A 4PVDA 4BKQA 3UH1A 4FFOA 1UXGA 2O3SA 3I9KA 1G0NA 1ULSA 3RC9A 1ZMTA 2FSVA 4NFYA 3NX4A 3VPSA 1KERA 1Q7GA 4RPJA 1EFLA 1BGVA 1TT5A 2PZJA 4Z0HO 5JE8A 2Y1CA 3GN1A 5CPBA 3RJ5A 1R0SA 3RAJA 4Q39A 1E7RA 2EV9A 2P9EA 3CXRA 3HB5X 3FF4A 5FFFA 3ZI0A 4XIJA 3ENNA 1LXCA 3K73O 3INTA 1I24A 1K3TA 3I23A 3JQBA 5FF9A 4U8GA 2P9CA 4YRDA 2RBEA 1ADCA 3GEDA 3WS7A 2PD3A 1W73A 1VKOA 1EMDA 1LDMA 2ZTLA 4J49A 4O1MA 4BMSA 3C24A 1M2WA 4QT0A 3WICA 3ETGA 3TN7A 2W2KA 3SC4A 1HDOA 5L4LA 2Y68A 3VH2A 3H9JA 3O9ZA 4IY1A 3RUIA 3QVXA 4ALKA 2J6IA 1HSZA 1TT7A 4AJJA 3GN2A 4A0SA 2JFGA 4B4WA 1YBMA 3MJCA 1R0LA 4A73A 4R51A 3WYEA 4J43A 1Z7BA 2V7PA 4E6PA 1PJBA 2CNBA 1L1FA 4DMLA 3A06A 1UXHA 3NDIA 3WTCA 4NI5A 4BO0A 1Y5MA 1VI2A 1M6HA 1K6XA 2JHGA 1JVBA 1M76A 3ZDFA 1LDYA 2NM0A 1YL7A 3A28A 1E5LA 2HU2A 2I6TA 4HX5A 5IN4A 3RD5A 4RGBA 3N7UA 5KJCA 1P0FA 3JQAB 2VHWA 3UN1A 5H82A 3UW3A 5AXCA 3VZSA 3AW9A 4OSPA 3SJ7A 5T6BA 4S3MA 2ZQYA 3C85A 2YHIB 3HDJA 3U9LA 4YVFA 1EUZA 3PQDA 5JC8A 1MG0A 3PZRA 4MP3A 3I9MA 2Q1WA 4Z9XA 5KKCA 3GC6A 1GYQA 5L45A 1MP0A 3SC6A 1I0ZA 4O0LA 4OM8A 4AJKA 3FTPA 3M2TA 2PH3A 2Y1GA 4OGWA 5EPOA 3DFZA 1E1MA 3H5AA 3TRIA 4ZGWA 1AN9A 1XHLA 4D3FA 5JY6A 3E6AA 5A06A 3HB4X 1U3TA 3IP3A 5BR7A 4DIOA 3TNLA 1V8BA 2FWMX 4IDAA 4BNWA 2B0JA 1Z82A 1LI4A 1TB4A 2QRJA 3DFUA 4DIBA 1AE1A 2NQTA 1DIRA 3W4JA 1LLDA 1IZ0A 4NR0A 3ZU3A 4DVJA 4F3YA 2J3KA 1GFSA 4NU5A 1YONA 3NRCA 2VUSA 2EEZA 4JLWA 1LC0A 2EKQA 3JQCA 4K26A 4XGIA 5DBGA 3PRJA 2P5UA 5F21A 4XQEA 4XA8A 3JQ7B 4XRGA 1E1NA 5G0TA 3PJEA 3UVEA 4S1VA 3PGXA 1GQQA 3VDQA 2NSDA 1CF2O 4BNNA 1O95A 3IJRA 4WE3A 1I3NA 1O9BA 3GZ4A 4E5YA 4EJ6A 4XCVA 4FFMA 4EW6A 3WGTA 5CDYA 5A05A 3WWYA 3DB2A 2FN7A 4DIFA 5DCWA 4URFA 3FWZA 1V3UA 4J2OA 4NBWA 3W8EA 4BO6A 3I5MA 2EHDA 3BMQA 4UUNA 2IYOA 4R68A 4WOJA 2J3IA 3GRPA 4BS9A 4D0SA 2ZJ1A 4G65A 1DHTA 1N9GB 3HHPA 2HDHA 4RQTA 1O94A 1M75A 5TX7A 4ZICA 3FWNA 3WIEA 5JO9A 5TSDA 3V2GA 1MX3A 1CERA 2NACA 2JAPA 2VRCA 3H65A 1X7GA 4D44A 3GFGA 3FNGA 1O89A 3AI2A 3E1KA 1KETA 2DAPA 1PS0A 1T2AA 4CLHA 1B15A 3ZWAA 4LK3A 1DXYA 1H93A 3D1LA 3ZWBA 2RAFA 1UP7A 1QKIA 1YGYA 2NVUA 3TZQA 1E7MA 3BA1A 2EW2A 1GCOA 1RM5A 2JCXA 1HETA 3QRWA 4I08A 5ITWA 4FJ1A 2Z95A 1X1EA 5KKAA 1OMOA 4TVOA 1ML3A 3IS3A 2Q2VA 3DZHA 1MG5A 4BKPA 1R37A 4WCFB 4CMIB 3WXBA 1GUYA 1DO8A 3AWDA 1P77A 4WASA 5U1PA 3OIFA 2VTDA 3F1KA 3CINA 3E5RA 3CTMA 1U3UA 1KY4A 2I99A 1BW9B 4F46A 1NAIA 2CZCA 5TJHA 3UAGA 5JSFA 4K6FA 5DF1A 2LDXA 2E6UX 4RVFA 1YB4A 4Y9DA 1DJQA 2H5LA 5MDHA 1LRJA 1T1SA 1EE9A 3DMYA 2DBZA 2F00A 4ONEA 3DMTC 2EKPA 3GHHA 1KEUA 1I2BA 1XQ1A 5JYDA 1N92A 4UUOA 2VZ9A 3I3OA 4TZKA 3VZPA 4MP6A 3ST7A 3RBXA 1I10A 1HDCA 4J1TA 4PCVA 4CMBA 3ANLA 3GDFA 3OMLA 1NR7A 3A1NA 4CV0A 2D59A 2EKLA 2EP7A 2IZZA 3K2BA 3BTUA 2IDZA 3LF1A 4GVLA 4WCFA 4CQLA 1BVUA 4J7CA 1C1XB 4B4OA 1T2FA 1C0PA 1YVEI 3E18A 4Q3BA 1BWSA 4UVGA 4I1IA 2YUTA 3ZNOA 4DRYA 3E9MA 5JXWA 3HDHA 1PJQA 3OA2A 1Y7TA 4OSOA 3QE3A 2ZTUA 1JAXA 1T1RA 2BGLA 2I76A 2WD7B 4UEJA 5F1OA 2Q2WA 3GHYA 2YYYA 3L77A 4NBUA 1U2DA 3W8FA 1J0XO 3JQAD 4UEOA 1I01A 2J3HA 1QYCA 2PKQO 3GEMA 5TJ9A 2J5KA 1UR5A 4D46A 3KEQA 4BNUA 4QTZA 1NVMB 3KYCB 4B7CA 2X58A 1ISFA 2O3QA 5FYDA 3GNTA 1G0OA 4WUVA 4CM6A 1P1JA 2FMUA 4KTVE 3S2GA 4M1QA 3HE3A 1HRDA 3RJ9A 5KJEA 1CEQA 2UYYA 3JD4A 3LT4A 3LT2A 4RPHA 3RC1A 3D5TA 3ZNQA 4I5EA 4BNMA 1LDBA 3NV9A 2UVDA 3MOGA 3VZQA 1C1XA 4QX6A 3JQ8B 2E49A 4E2ZA 6ADHA 3LC2O 1P1HA 1C1DB 4M87A 2C2YA 2O23A 4MVJD 5ES3A 4YQYA 4J16A 4PLHA 4XB2A 3PIIA 5T67A 2GN8A 1D8AA 2OOSA 2VHXA 3ASVA 3O8QA 2OFPA 4BGEA 1SB8A 3VC7A 3L07A 1C0LA 3NJ8A 4J1NA 1KY5A 4IZIA 4IZHA 4AJPA 1VRWA 1IPFA 4KMSA 4J4BA 2GZ3A 1U3VA 3ULKA 5HM8A 5C7IO 5JYEA 5I9NA 4P4NA 3DZIA 3JCZA 4CMJA 3BMCB 1N7HA 1NVGA 3ZWXA 1J6UA 1HXHA 4NDNE 2VWQA 3W6ZA 1V3VA 4CMEC 5IZCA 4C4OA 2UAGA 3EW7A 1UZLA 4EJMA 4CV1A 2R2GA 1X13A 2PD4A 1HDXA 4ILKA 5L4SA 3DHYA 4KZPA 3QJ5A 4R3NA 3BTOA 3RSHA 4XDYA 1CETA 4XZ3A 1DC5A 5HBRA 4YT2A 1SOWA 4J2HA 4K6CA 4WK6A 5EMHA 4E2WA 2TMGA 2GN6A 3K30A 4UEKA 3ROQA 5JBIA 5JMWA 2NUAA 4WKGA 1FXSA 2HSDA 2YJZA 3PHIA 4OXYA 5F3RA 1FDVA 4M54A 4WECA 4GX1A 3UOGA 4PLPA 2G5CA 3CE6A 2W8ZA 1I36A 3GVHA 5GZ6A 3RFTA 1GADO 1ZK1A 3LF2A 1IB6A 1XG5A 1GDHA 5K6AA 2NVWA 1ZW1A 1BRMA 3PJFA 3H5RA 1JVSA 4TQGA 4R1TA 4N18A 4NHEA 1Y1PA 4MKRA 2EG9A 4K28A 1DC3A 2A9FA 1AXGA 3RASA 1DFGA 1EUDA 2YQ4A 4FSHA 3INGA 1W4ZA 2EIHA 4U7WA 4O5OA 1ULUA 3NEPX 3JYQA 3ZU4A 5T8KA 5L4NA 1GTMA 2C29D 2GPTA 3PJGA 3BMNA 1Q0QA 2AQHA 1YL6A 4PG5A 3CMMA 2AEFA 1CJCA 3DOJA 3GR6A 4WLEA 4CPDA 4CR7A 1L7EA 4A7PA 2DTEA 3CZMA 2HUNA 3KSZO 1X0VA 3WQQA 5BSFA 5CAEA 4E32A 3WQRA 2WDZA 3G0OA 4TRRA 4PIVA 4CLEA 1OAAA 4YJHB 3HG7A 2ZKLA 3OP4A 2WE8A 1B3RA 1PGJA 2P9GA 4UVDA 4NBTA 4ZRMA 1EEHA 3GNQA 2Q45A 4H3VA 4R3WA 1XLTA 4YDRA 2CSUA 5C3MA 1GL3A 2NTVA 3PWZA 2NU8A 4PLGA 3NGXA 1N1GA 1E3WB 4NMHA 3VPGA 2G1UA 2DUWA 2JJYA 4JBGA 3RI3A 3U4HA 5G0UA 3WMWA 3GGOA 3FR8A 1NM5A 1LTHR 3G1UA 4TZTA 5C37A 1IL0A 3E9QA 2H9IA 4YXFA 1WMAA 3M6IA 1HDYA 4P38A 1WW8A 3DBLA 4Z9FA 3E82A 2Q4BA 3TPCA 2VWGA 3GVPA 2CDAA 1D1SA 3KBOA 4KUEA 1RYEA 4CLRA 4GSKA 5IAAA 2V6MA 1Q1NA 3SLKA 4CM3A 2NWQA 5BT9A 1IY8A 2DVMA 4O6VA 1PL6A 2XAAA 3ZNNA 4M8SA 3TF5A 4J9UE 1ZZEA 4M86A 4DBVO 4GGPA 1GPDG 2UDPA 4YYZA 3R0IA 1VKNA 3QY9A 4MIOA 2HMVA 5L7TA 4ZN6A 4RL6A 4B3IA 2R00C 3FCOA 3ITDA 4MDHA 5IDYA 3FPCA 2O7QA 1YE3A 1WXDA 1ZK3A 3ADOA 4DQXA 5CDUA 3QVOA 3PLNA 4BO2A 3TDKA 1E3WA 3W6UA 3DZKA 1UUFA 3U4CA 1EVZA 1DRUA 1MC5A 1HKUA 3Q9NA 1LBEA 3ADPA 4QFDA 4EUHA 4PG8A 2DBRA 1E3LA 4KUGA 4CUJA 4ITUA 4ND2A 1RYDA 4XD2A 1SB9A 4XGKA 2Y67A 4CV2A 4B7UA 3F1LA 1RPNA 3EGOA 2VN8A 1ENYA 4E3ZA 3FTNA 1M67A 3W4KA 4JCOA 1QLJA 3LLSA 1Y6JA 3GT0A 4RVGA 4E2YA 1QV6A 4RPKA 4FGSA 1YH3A 1U5CA 4IGFA 3KOUA 4IJKA 4R1SA 1V0JA 1DIHA 1YOVB 1FDUA 3RU7A 4OL9A 4WCFC 2YW9A 1UDBA 4H16A 2BGKA 1VC2A 3AM4A 4PLWA 2B69A 3PK0A 3VKUA 5IXSA 3ZU5A 1R6DA 4BNKA 2BD0A 2NLOA 1P3DA 1HE2A 5AQ1A 4N7RA 5ICMA 4FFNA 4RDHA 4MVJI 4EI2A 2VNAA 1R4MA 1ISJA 1EDZA 3IKTA 1R16A 2NTNA 1X15A 1ZO8A 3C1OA 1E7YA 2OUIA 1P44A 2ZB4A 3F4BA 3P2YA 5I8WA 1HDRA 1A7AA 1I3KA 2AG5A 1Z45A 4ROSA 1PQWA 4LRTB 1S7CA 2EWMA 3HUDA 4JP3A 4M89A 1H6CA 1GZ4A 4EGFA 4J90A 4AJ2A 5LDHA 1H6DA
chains in the Genus database with same CATH superfamily
3DM9B 1ZJYA 3D4PA 5IJXA 1QGAA 1X1RA 4TX1A 1BG6A 3JQ6A 1GPMA 1UFOA 4OH1A 4RKWA 5EYPB 5A4FS 5DI9A 2GESA 2GPAA 1PJTA 1JQBA 1DNPA 4DLZA 1UPUA 3KOXA 3N07A 2V3VA 5KJFA 3V4LA 2XWJI 4IMRA 4K9OA 3AHEA 1A5ZA 4P34A 4QSHA 2ZYTX 4GP7A 4BKMA 4GFDA 1L8AA 3PC8A 4LWQA 2JGEA 5K3FA 3SIXA 2FWBA 1PJ3A 4OQDA 1X1QA 3U3DA 1ISHA 4AUKA 3U62A 3UJ7A 3FWKA 3ONVA 5IANA 1EWKA 3MWFA 2DZDA 1E98A 5DTJA 1JT9A 2D1QA 1IZ9A 1NUQA 1NXXA 1T15A 3ZWYA 2OBYA 2QV0A 3MWLA 4J3JA 1Q19A 4RF3A 4CM7A 2QS9A 1CD5A 1G18A 3K5HA 3LDFA 3H2GA 3NTOA 2OFFA 4C3ZA 4PICA 4EJSC 4MQ4A 1CE8B 4ID9A 5DYYA 3WLFA 3AGQA 2BDEA 3JASA 4G23A 5F2EA 3J81k 1L5KA 3VDRA 4J6EA 5C4MA 4KLAA 2WYVA 5TDHA 1YXMA 4OYYA 3UXYA 1MC4A 4Z7OB 4M9UA 2Q9CA 1ZNZA 2LBPA 2FV8A 2R1ZA 3G88A 4YONB 1MX5A 1AXRA 4RNDB 4CVNA 1I4WA 1TCUA 1W19A 1XEXA 2BW0A 2PXXA 2ZJ3A 3FRJA 3DE2X 3JRNA 1KMHB 2OB2A 3WQSB 2WUFA 1DTSA 1XQVA 1YS4A 4I6GA 3RAGA 1LDGA 2WB4A 2FF7A 2ZETA 1YB5A 3EWIA 2I7DA 5KJ6A 1JEDA 2A86A 4BC0A 4YH1A 2YNMD 3SFZA 1SOUA 1JN0A 1BSVA 4PZYA 3VJMA 4ENVA 2Q9AA 1YJAA 3OFVA 1M83A 5GY7A 3FWPA 1KWKA 1ZVKA 2RB4A 3CZQA 4Y18A 1EKXA 4F9GA 3IILA 1HQCA 3HWX1 2JZNA 4MQFA 4OU5A 4XB1A 4WT7A 3I01A 4BY9E 1XWFA 5IKPA 4RHYA 4ZWNA 3PVZA 1GU7A 5TS2A 1RI2A 1LSOA 3EFOA 4Q1DA 3V8MA 1NWHA 1UFRA 1O1YA 2VJLA 4TVBA 3NHYA 4ZTZB 1U63A 3MINA 3S2IA 4OFBA 1ZOPA 1KI3A 2HSJA 1XGKA 3PPVA 2FLVA 3RK4A 4CM9D 2MSKA 1NJGA 3MJRA 2YS6A 1JWAB 4OGLA 1VJ1A 2XX3A 4RTLA 1JG2A 4MRPA 3G0BA 4QVGA 2IYXA 3T1TA 2NZWA 5FOQA 3CO0S 1H94A 2H5EA 3IPRA 1UOQA 1M1XB 4QBTA 4BYGA 5HYVA 3FDZA 3B2QA 3V4PB 5EJ6A 1NXQA 1EHCA 1I7NA 1XK6A 3T7TA 3MCUA 1UFVA 2FJPA 2P6OA 3LY8A 3OO1A 2ZYAA 3EVFA 1E5XA 4RE5A 2PBRA 4YGYA 3V1UA 2AYYA 5EP3A 2UZ3A 2CFOA 5FIUA 1TEZA 5JFOA 2Q1XA 4TRMA 4GOKA 5IKMA 4NAVA 3EF3A 1HFJA 4EPXA 2A5LA 1T4CB 1JZSA 1EK1A 2PT9A 1XDUA 4MQMA 5JJIA 1MO5A 2JGRA 4G41A 1GGKA 4BNYA 4HVLA 3ZWCA 4EARA 1GN9A 4C6SA 2BFMA 5DP1A 2GCEA 2IW3A 1UBKS 3ZY2A 1UBMS 4UNNA 2J3DA 4DCSA 2QQFA 2CDRA 5ER6A 4UAGA 3H05A 4AJIA 1C9NA 1N2EA 1UBJS 4IQGA 3BREA 4G1BA 3GEEA 4FJ2A 3WKEA 4C0XA 3I3SR 4IJMA 2R97A 4UDNA 3VSCA 2PTGA 1X7WA 2X7XA 2Y93A 5IK2D 3HNOA 4UNSA 5FI0B 4N47A 2FTKE 4P0PB 3LYHA 5HW0A 4ER7A 3STVA 2B3TA 2WPNA 3LC1O 1GRQA 2J07A 4MS1A 5JSYA 2GARA 3PQ4A 3R5TA 4CEJA 1F48A 4NYMQ 1CJMA 1RD4A 3I28A 3H83A 3ADKA 3WK6A 2IXAA 1RYBA 2NNLD 3QQPA 1A27A 3TFWA 3FDFA 4K03A 4DQVA 2ORED 3ETHA 3UV6A 3AR8A 3MT9A 3CNLA 4MW7A 3UOAB 3O73A 2WJHA 1CC1S 1VRVA 3BH7A 4OEHA 5EP2A 2IXTA 3GIWA 2VPTA 2F4NA 1SAYA 2QA5A 3MMZA 5AW6A 4QRIA 3FKJA 2LIPA 2QVCA 4Z99A 2OCPA 3U5TA 1B7GO 2OCKA 1QSGA 1OUMA 3KM0A 4YRPA 3WBKA 3E3NA 4RPLA 3RODA 4JGIA 1EBBA 1B8VA 4N7BA 5IABA 3VPAA 1KAMA 1OFGA 1C50A 2C5EA 4YRZA 3LP6A 3UICA 1MJGM 4QU5A 3ZVRA 4X91A 1PZGA 1JECA 3QY0A 1XK7A 2A6PA 1Q21A 3AR6A 4QYMA 4X7MA 3T3DA 1TTQB 7ABPA 2AVNA 2SNIE 4G5HA 3GEGA 3U1VA 2ONYA 3S7ZA 1M8KA 1AJEA 1ZH2A 5BSHA 2ZB8A 1T2DA 1EAYA 1PL8A 5I48A 2O0HA 2XRMA 2DT8A 5CVVA 2EWWA 4GGOA 5ES4B 3VPCA 5B2EA 4M0LA 5CBPA 4IDCA 1H2BA 3MGAA 5AESA 2PKEA 4XGQA 4WK2B 1U0GA 2TMKA 1HA3A 1HDZA 2PSHA 2YWXA 3SC2B 2ZE6A 2C9ZA 2GHTA 1NXPA 3H2BA 4AU1A 1PV2A 5DCYA 2WAAA 5LZ9A 5AHXA 1BD3A 1UMBA 4AFNA 1YVDA 4EITA 5LMUB 4WKNA 1EM6A 3BWEA 1RCUA 1V6AA 3O4IA 1EM8B 4UDYX 3BF7A 3EVZA 1JVNA 3DTVA 3STWA 4PZDA 2HB6A 1GDTA 4RVSA 5EIOA 4PS0A 4N5DA 2J59A 2OBMA 4TL7A 1R66A 5AVTA 1BU5A 2IXFA 3ZZ0A 4QEDA 1TF2A 1VLHA 3HEMA 5I7SA 3A2KA 3SEFA 1RAGA 3OE4A 3BJRA 3ILSA 5MN4A 3D6UA 4YRSA 3USZA 1XVLA 2Z5VA 2IV3A 4N9WA 3WBFA 1TUGA 2ZS8A 4RO0A 5FWYA 3O38A 1PJCA 2C57A 4D4IA 2RJOA 3LL4A 4QG7A 4WY5A 3WR5A 5T4EA 4YRGA 3FSGD 1UXOA 1ZGCA 2Q4RA 4XLLA 4MB6A 2OORA 3S99A 2ZIXB 3RADC 2CF5A 4FR5A 3IUPA 3MCZA 1JYSA 1PVVA 4RIHA 5DX1A 1WZIA 3GJ6A 5EIFA 4YXWD 2RIPA 2KE5A 4RACA 4B6RA 1NRWA 2H57A 3CR8A 3I6BA 4WLFA 2R6CA 4XR4A 5HS4A 3U7HB 1Q95A 3AYZB 3RC7A 3OQNA 1X38A 2OO5C 4RV9A 4Y2TA 3UWKA 1U99A 2C9MA 1DCMA 3WG9A 3ZHCA 3N6VA 2BVNA 2XUKA 1ULHA 4WV3A 1YMUA 2JI8A 3LWZA 5G0SA 4F3RA 1WPGA 2WHYA 5BSKA 4TT3D 2I4RA 3AKYA 1ZNYA 3WSVA 5FBQB 4M38A 4O59O 2FN4A 5A3RA 3LPDA 3DWGA 4KXNA 4RY9A 5B2ZA 3T3EA 4Z5XA 1H65A 1XLUA 3PUXA 3QLVA 1RP7A 4LHZA 5KWIA 2GD0A 3ZJYA 3ZW8A 1AQ6A 3HVJA 3RRNA 1PT7A 2JA1A 8ATCA 4L2IB 4YN3A 4EHBA 4EY7A 4MX8A 1CB7A 2AUMA 2VHVA 3BQ9A 3CWQA 1ORWA 2VPQA 3DBHA 5AJHA 1AZLA 1OI2A 5SZIA 1IWOA 2V0GA 5AOCA 1NXOA 3THYA 2FRDC 3ESYA 4NZYA 4YJ3B 4QWMA 4S1WA 4MW4A 4UW9A 1Z7WA 3BHMA 3MOIA 1YGPA 4W8GA 3O92A 2IWHA 4IM7A 5DP2A 1JFRA 3BGSA 3IJEB 4MA4A 1B41A 3IO5A 3HV0A 2BMDA 4OU4A 1WKVA 1VYVA 3L06A 4RD0A 4X95A 3MMXA 1ZPDA 4RH1A 4BFXA 4KR2A 4LDNA 3QXXA 3LU1A 4KSCA 4AIIA 5LLDA 1K06A 1I3OA 5C7LO 2ZCVA 3F6PA 4IIUA 3QXJA 4JR2A 4JWKA 4CRWB 3HZZA 1TK3A 2WZBA 3QFRA 4LK2A 4UMVA 4HC4A 3ICEA 1TKBA 3AXTA 1JHUA 3CF4G 3CH7A 1NF9A 3LDHA 5I9MA 2PSFA 3WJ2A 3WRYA 3KHTA 1UKCA 2VLBA 3LQ4A 3FGNA 1TKAA 2LZ0A 3C98A 1Q7BA 3OZAA 4TVSA 5A3JA 4H1WA 3W6NA 2O0KA 2YINC 9LDBA 1RZRD 1E6LA 2BZSA 2CK3D 4FIZA 4IJ5A 1AKVA 3DFKA 3KV3O 1SK9A 5DWDA 5DSTA 4CT0A 3SBOA 4QLBA 4AP9A 1H5QA 2XT9A 3TZ6A 4R1PA 4Q3CA 1SC1A 3OE7D 4HWPA 4L8GA 4L85A 4QXMA 2JASA 1DKOA 2VTEA 1Z5UA 2UUOA 5LDGA 3WLEA 3OBIA 3T4UA 2P41A 1JAHA 1OFUA 4CDMA 1ND6A 1RYNA 2HJ9A 4NZZA 1Q44A 4PC2A 3I76A 1OD6A 3QGMA 1MQAA 1J25A 2E3JA 3D0QA 3LT0A 3QU4A 5AUQA 3QA3E 4ZZ2A 5BMOA 4HFJA 1PWZA 1DOHA 4DIEA 3JQPA 3QUTA 1L4KA 2PWBA 3OETA 3SR4A 4IUBS 1BWRA 1XCBA 2AK2A 2AWOA 4GPAA 5ADWA 4S24A 1AQUA 3OEEA 5B3KA 4YUVA 4GI5A 3W5SA 1T6NA 3BHJA 4HBZA 4N5MA 4ZCQA 1CIPA 2QL9A 3AETA 4RU1A 2DJIA 1DXOA 1ZCZA 2YMQA 3HCWA 1LU9A 2JJ2D 1ZM7A 1YACA 3ZV4A 3SCZA 5BUQA 2L69A 1TECE 3QP9A 2R62A 1ORDA 3QQ5A 1W1UA 5ALWA 5IJWA 2G82A 2FY8A 2DKFA 4C7OB 1UWVA 3OFNA 4MV6A 2FZWA 4B79A 1TQDA 4DTCA 6NULA 3Q3CA 4QC2A 1FMCA 3GVCA 5CUQA 5ALIA 5AKGA 3L4EA 2Q1SA 1YQGA 5JMOA 2ADMA 3ROZA 1S3GA 2G04A 2VRCD 3DJYA 2OM6A 3JQBC 5LCXA 1MBZA 5EN4A 4YALA 2WB2A 4HR7A 3LCJA 4EGJA 1SUDA 5JNSA 4RVOA 3V3KA 3UT6A 2ECKA 1NXSA 1IN5A 4FYYA 1OA1A 3ONFA 2FSHA 2W58A 3GA0A 4XSHA 2JD0A 2DG2A 3MWYW 4DCTA 4HTFB 2P69A 1N3YA 1GNSA 4F4JA 4DCCA 5F52A 5JXGA 1NI4A 2HMYB 3GV0A 1S89A 4HKTA 4WXRA 4DDUA 1W93A 4US1R 1EP3B 3ETDA 2IZOA 1LLFA 4EGSA 4M1EA 3H2JA 3ZBUA 1MB0A 1PZEA 2PMCA 2PX2A 3CRNA 5GWXA 5LWHA 3D64A 5DYTA 2EZ4A 1IOZA 3PEUA 3K1YA 1TTPB 4FSXA 4J0EA 4U7TB 4DNPA 1Q91A 3OEWA 4B0OA 4D25A 1VG0B 5EJ9A 1IHUA 1DBPA 4MCJA 4GG1A 3HA2A 4BE9A 2OGSA 2Y2UA 4LOJA 4Q3LA 2X0FA 2FEPA 3DOUA 2Z3VA 4J76A 4I1RA 4F3KA 2IY7A 3Q10A 3GLGE 2O57A 2QVBA 1CNEA 4QAQA 4X8LA 3KZCA 1C3XA 1P39A 2H2AA 4HAZA 2WVJA 4RHFA 2WQ7A 3AP2A 4CUZA 1YRAA 2YMPA 2R84A 1AS3A 1Z18A 2XMPA 2IQ5A 2A0WA 1NPTO 3R7BA 1XYGA 4KWHA 1HG0A 1IEVA 2OBLA 1EVKA 2O9JA 3FOFC 1ZUIA 5AW9A 2D54A 1WUTA 4CTMA 3EVGA 2I0FA 621PA 2Z6UA 1GUDA 2C3PA 4FYVA 1UJMA 2XQVA 3W05A 4M55A 3L7CA 1T9GS 1SMKA 1SZJG 2C4WA 3OLXA 4H18A 3EZXA 3DE3X 3H2ZA 1KVRA 1QRDA 1XTKA 2NVBA 3C1TA 4ZI7A 3PEYA 2WPDA 3T4XA 2RHDA 1Z6AA 2QNRA 1N6LA 1RBQA 2Z3WA 4RW0A 3WI7A 2Y1LA 5JHHB 5H3HA 3URKA 3W8NA 3UMYA 2JJ1D 3LK7A 1G16A 3NIFB 3QE2A 3WRVA 4QPPA 3A9VA 3MLEA 4GKKB 1CSEE 4FFLA 3EF1A 1ZVVA 1V95A 5J9FA 2V7TA 3OT1B 4YWJA 2CLFB 2IHKA 3T7JA 3IKVA 4AJLA 4CDNA 3PC2A 3NR2A 4C87A 3NPMA 2QJFA 3WRXC 3T5GA 2X3YA 2RSLA 2CWWA 4QDUA 1RZUA 3E2PA 4ND1A 1EX1A 2SBTA 3MPUA 4WY2A 4XDGA 5CDFA 4CMGA 2P78A 2BFCB 4UU0A 2BF4A 5JARA 3FTFA 1YBFA 4XWOA 1PGOA 1AUVA 2HWYA 3DVRX 3KZKA 4LGMA 1XU7A 1YRQA 4J0GA 3RYTC 5AHOA 4CIBA 3S8YA 3WL8A 3K6SB 5CLQA 4CQMA 4GR5A 3LA8A 1RTKA 2VSYA 3UUWA 1GTRA 3B20A 2BGIA 4DXDA 1N32B 1PTJC 1R50A 1O95C 1YRHA 3T9BA 2BSQA 1MTZA 4B6GA 3FPKA 1H2EA 3WGZA 4Q6WA 4K8OA 1Z5PA 1JIVA 3MJEA 4N3AA 2XUQA 4XB6B 1N2OA 5HA5A 1GHTA 2V4UA 1K8ZB 1KEVA 3DE6X 2GK6A 1EUYA 1TCAA 1OROA 3RB8A 4ZAVA 4K9PA 4G67A 2DPLA 1BXGA 2I4MA 3KBBA 4B85A 2OV3A 3L43A 2B98A 4HL6A 3DLPX 4W7HA 3PQ3A 2ORIA 2I87A 4X85A 4NZOA 4M8NE 3GLQA 4U6SA 3HLYA 1JR3D 1DG9A 1H3NA 2X9NA 4QBKA 2A0KA 4RSRA 4TN1A 3T35A 3U80A 1PV4A 1M33A 1YJ5A 3F7MA 2QRZA 2RD2A 1XTTA 1KRHA 1US8B 4ALIA 2J4DA 1Y9AA 3HKEB 4B2YA 2WJWA 2B4TO 2O2SA 1Z33A 1KGSA 4BJ3A 5JNLA 2YTZA 4EQ6A 4B82A 1LPOA 2B1RA 1LRKA 4A2PA 2H4YA 4KQCA 3WNBA 5EL0A 4LGCA 5B1HA 3CRQA 4MP8A 1USUA 4O4HB 1Y5RA 3AR4A 3LZCA 4M7PA 4DBZA 4ZI7F 4MUYA 3ZXXA 1U7ZA 2FN8A 2C2ZA 4IINA 5D3QA 3A3KA 4LVOA 1E0AA 1GA1A 5EWMB 2R48A 3IDFA 3ND8A 4PLTA 1TU0A 5DGXA 4HAXA 2BAGA 4EDFA 2G0TA 3WK8A 1JIQA 1WHSA 3S1AA 4A5OA 4E6EA 3NBXX 3W5CA 1RPZA 1F3LA 1RWWA 5FWNA 3AUSA 2JAHA 2NYRA 2UVPB 4KPGA 2D5IA 4EF5A 4JJKA 1YB1A 1PT8A 4RS3A 4BGDA 1T3ZA 3N75A 1B2LA 1W0KD 4OJQA 1SC4A 3I0ZA 4BBAA 4XIIA 2ZBGA 1C4KA 2F1IA 1MJGA 3EQ6A 1SZCA 2C4VA 3BRWA 4AL4A 1Z4KA 2WWFA 3K9GA 3Q1KA 4TRJA 5EZYB 4A27A 4XQ9A 1KYQA 4UOEA 3EGWA 4C2AA 4D4KA 1ZIDA 4UOZA 1E5TA 4BLTA 2ZITA 5BNFA 1Z6QA 1WCXA 1CJSA 3AWIA 5B4TA 2ID4A 2XEXA 2I4TA 1TZKA 1OFUX 1U6KA 1WAMA 4KODA 1OBHA 1WQ3A 3U7IA 4I8DA 4L73A 3NEJA 3OP1A 3CY6A 5I7WA 2O5CA 2I2DA 4I4NA 2RAUA 2GRUA 1WKCA 2WNSA 1TYBE 1FSFA 4NBVA 3QVWA 2GEDA 1KS9A 1LK0A 3U6BA 3TQHA 2ATIA 2DEUA 1JJAA 4HLDA 4JYCA 3A1VA 3QXHA 4FQ8A 4MRAA 4UPVA 4KAAA 5CG2A 1JMYA 3KLNA 3W2HA 4YRBA 3EGEA 4Y2YA 4FB5A 2YNMA 3LRPA 5BRAA 1FFAA 3SIWA 1UPTA 3T52A 5J4VA 5CU7A 3KS9A 5DI3A 5EINA 2CBGA 4Q3DA 5FYQA 2PUTA 4LZOA 1QKJA 4OMFG 4CCSA 5F9FA 1RJEA 1GKYA 3UUGA 1G7CA 1D07A 2IEIA 2ZT7A 5IP5A 4GX2A 4ECAA 3AF2A 1U2GA 1XZAA 1DJPA 3CGGA 4ZJUA 2Z8YM 1O77A 4R7ZA 4FW9A 3TD2A 3AONB 4ZKDA 2ATEA 2JDID 5FWDA 1UT5A 4DADA 1WB4A 2X5OA 4GM1A 4HXGA 1QFZA 3GYGA 4X93A 3ZXUB 1U2DC 4CM9A 4DPLA 5F1KA 3KR9A 1M6NA 1F8YA 4D9KA 1V1MB 3Q9LA 3I2FA 4CM4A 4GLOA 2BHTA 2WDPA 1G21E 4GXRA 4LY3A 1NOJA 1ID8A 2AV6A 1K7EB 3L0YA 5HMLA 2B35A 4QUIA 1I2ZA 2VNKA 3TSCA 3L5KA 4WFIA 1SN7A 1NF8A 3ZV6A 3UB3A 1BN7A 3D7KA 4QFCA 5CFLA 5CCXA 1VJDA 3RANA 4HRXA 4LYYA 4KPUA 3UHPA 1BX3A 3TUZC 2TSYB 1UXIA 3PFFA 1JAYA 5D6NA 1G5PA 1XCLA 2UUAB 2RK4A 1Q5PA 4XEHA 3DWFA 1RHKA 2G72A 3HYTA 1O57A 1KXZA 3V8BA 1CVIA 1MV8A 2C92A 2VH5R 3TSWA 3GJ8A 3NNNA 2COEA 1A4IA 3N2KB 3Q0EA 4Q19A 4R1UA 4YWHA 2GUGA 2Q46A 4B8YA 5BPHA 1H9CA 4NMXB 2IEBA 3SXJA 4CLOB 4LFAB 3AUAA 2GCNA 3AZOA 3M4XA 3PENA 5EPUA 1TTTA 5L6MB 2YH2A 3CZPA 2B20A 1ZESA 2QUAA 4R54A 4B6QA 5ARBA 1DP4A 3D6HA 4II3A 2IHBA 4F6LA 3VO1A 2HCRA 3RUHA 1E2BA 3VOTA 4BFLA 2WEKA 3ICPA 1YQXA 5IYZA 4LSMA 4UTVA 2WJIA 5IK2A 3UK0A 2BUBA 4CW7A 1L7PA 2QM0A 2YN2A 4ZFNA 4ZI3A 1DSSG 4TTAA 4KXXA 1A82A 3H9EO 4H35A 4KDFA 4FWIB 4HSEA 1OBVA 3LNTA 5CK4A 1IWBB 3A1SA 3ISJA 2QD3A 4L9AA 5BWCA 2GZAA 1OLUA 2FOIA 1P33A 1Z16A 4J49A 1J5XA 2X1HA 4C0KA 3K70B 1CY1A 1FLAA 1X87A 1THZA 3NC4A 3VKGA 1EG7A 3G7NA 5EA2A 3TNDA 5CDSA 3A9RA 1CUWA 2OO7A 3G2IA 3QX3A 2XGGA 3DMDA 3P0IA 2E4XA 3ZTTA 2AE2A 2IY8A 2OCLA 3IXLA 4BNJA 1VLQA 5ITZB 2CFCA 1JEYA 4LV5B 1JEOA 2TMDA 3CLHA 1W76A 3ZIAA 2HBQA 4EGAA 4RTOA 2WM2A 3GROA 1II8B 1J33A 4K5QA 1HQDA 5HF8A 3EGVA 1HF3A 1M2OA 2ZW9A 3GARA 4U1RA 2FQYA 1X7HA 4OUDB 2GYWA 3G89A 2H2WA 4QNRA 3M5CA 1GILA 3B6KA 1AKTA 3BK2A 3BA6A 2QLNA 3ETLA 2OO3A 2PNFA 2VDRB 2FKNA 2GPBA 3MCTA 3R4CA 3K9CA 5KMGB 1OB5A 1ML4A 1NLMA 1E4EA 2REQB 3V1NA 1VHDA 3EEYA 2FEWB 2VXCA 2XMBA 4R9RA 3I4CA 4PGHA 1E4VA 1V4NA 4JY7A 4ZVVA 1T6YA 3C16C 3LFHA 4XLTA 3V5NA 1ZMBA 3IP5A 4OHBA 1ZK0A 2AF4C 3HFRA 4KV9A 4JDUA 4FC6A 1PD0A 1YU9A 4L4ZA 4YCCA 1Z5WA 4J4TA 5ULLA 3NUGA 2X0EA 3G9QA 2F1JA 5ELMA 4CTOA 4X61A 3N2GA 2AUTA 4OHRA 5HFJA 4JLJA 2ZR7A 1D6MA 1KEEA 1E1DA 2HXGA 3QBJA 4F1WA 2JC3A 1VDMA 3OWXA 4FXOA 3LBNA 1PFYA 1D9ZA 4AD8A 5HP4A 1Z56C 2AJDA 3NJ4A 4Z8YA 3LXUX 3SQOA 1EK0A 4PYRA 3JVUA 1D4FA 3F5QA 3I73A 3MSCA 3RJTA 1KC1A 2JLQA 1PJLA 2NU7A 2VXYA 4FYHA 4OMDA 1PK7A 5K51A 3SJZA 3SNKA 3UATA 4OQ4A 3HKBB 4G09A 1ZRSA 4ZYZA 1XNRB 2WM9B 3GCGA 2XOKD 4HNHA 4XYEA 1B16A 3O3OB 5JVDA 1KRXA 3OCVA 4DEXA 1Z0IA 1JKIA 1FRQA 2IZ0A 3ELDA 3KB8A 3HFJA 3KTOA 4HPWA 4Y30A 4YPFA 3WIVA 3IBFA 5DLEA 2VUIB 1TI7A 1VBFA 3KUXA 2CJYA 4L7VA 4ROTA 5IW8A 4DAEA 4AMBA 3FSGA 3OQ1A 1V1RB 4YP0A 2CEKA 3OOWA 3RRMA 4RCYA 3NDJA 3QXSA 3FRIA 1ODFA 2H1OA 1WMFA 2VSNA 3B7PA 4XWKA 1JKJA 2QAGC 1FYXA 1THMA 4U6QA 1JQLB 2NO4A 3GZNA 1Y8QA 2V6JA 4PZCA 5CLFA 3KQKA 3K0FA 4RS4A 2X0DA 4QIHA 1GPAA 4LVUA 3QXCA 4L8VA 4GLFA 1UH5A 2XTNA 5B7QA 1IHPA 2HSGA 4TT3A 2D2XA 3IB6A 4B3JA 4U2GA 2FWRA 2ISQA 2IODA 2FW7A 4TMKA 5KTOA 3L4JA 4MZXA 1A5BB 5LMZA 1I6MA 1JAZA 1CF9A 1QMPA 3HGQA 3AHIA 3LX4A 1NM5C 4CMEA 2XCTB 3A1TA 5LB4A 2GZMA 4Y9SA 4QHTA 1ZHHA 2QAIA 2IHJA 2PVPA 4HNSA 2XUPA 2C98A 1A9TA 3TVYA 2AG0A 5E4YA 1NRIA 2I55A 4YRMA 4P7BA 1SWVA 4AQ7A 2OV8A 1Z12A 3KUDA 1Y3DE 3KJXA 3PQ6A 2PZAA 2YV2A 2PBZA 2B8WA 2P4EA 3SQNA 1PFQA 3JSAA 4XPIA 1SM4A 1RQXA 1XEWY 2H52A 2A67A 1OT3A 3B1KA 3M1LA 3NP7A 4H6XA 3P27A 4XUGB 4MZDA 4AZTA 4FOSA 5CX1B 5EUQB 2WFAA 1IVSA 3HZOA 1VCOA 4MJLA 4LY6A 5ER9A 1P5JA 1AD2A 4JH0A 1NW7A 4LMAA 2OZKA 2PY6A 4J3FA 4L78A 2WWHA 3SFTA 4CT4B 1K7YA 3S8MA 2Z57A 4LJKA 1OU0A 1PR4A 1Y3FE 2CEAA 3HYCA 3QF4B 4PYOA 3M1YA 1C3LA 3A4TA 3I4FA 3A1DA 2J9RA 4RZ3A 5ALXA 3E2MA 4URWR 1JDJA 5AXBA 1C7QA 3OZ7A 4QPDA 3HKDA 3LCMA 4R2IA 5A03A 1QHHB 5K0SA 1T3HA 4MKIA 2P5TB 4AJEA 3NVKI 4B3HA 4HG2A 1WJGA 2X0KA 2ZRMA 4UOQA 2R9VA 2V7WA 1SVLA 4TGLA 5F35A 4GRAA 4YP7A 4EF6A 2Y0BA 3TFOA 2GKOA 5JVDF 1FK8A 2H2FA 2L82A 5JZBA 3N8IA 2VK1A 4NFSA 3TUJC 1M34B 4Q3KA 1PZFA 3OTOB 2JAXA 3JPWA 3D7LA 5BVHA 4FOOA 4ASUD 4B47A 5A04A 3FNBA 4QUBA 4WACA 1G59A 2C7BA 2ZYIA 1P2FA 4KFSA 1DO2A 5C46F 1OXKB 1R6AA 1XQXA 2BFBA 2JCVA 4BX2A 4GDMA 3K09A 5K2OA 4D3SA 3OE7A 1H1TA 1PYOA 3EJWA 4HS9A 1KK2A 4NK4A 2ZBFA 4CTNA 4LC1A 3WZLA 3DH0A 3G2NA 4FWBA 1VYHA 3TI7A 4O2LA 5FULA 3SZGA 4ENRA 2Z4RA 1UKZA 2NV2B 2QR2A 3L84A 4OX9Y 4D4GA 1KMMA 4MGHA 4R7TA 1EFAA 3RRXA 3D0OA 2RCYA 5CLIA 1GU0A 1YASA 3WB9A 4ACAA 1BCSA 3SQWA 2Z4SA 1D5CA 4GGMX 1GPH1 1NUPA 3KTFA 4EI9A 2FJUA 4PCUA 1PS9A 1SCNE 3GO4A 3A11A 4GBJA 5CRIA 4MR7A 5T3UA 1YHYA 2OZLA 3RG2A 4NPHA 3W5DA 1Z39A 4BNIA 1K5HA 4IXWA 4CI0B 2Q1UA 1SA0A 2HK7A 1CP2A 4B4KA 3FH0A 3LYAA 4F6RB 1TCCA 1X14A 1JR2A 1LUAA 4O25A 4RH0A 3FCEA 4NJMB 2QR3A 1QRAA 1D7OA 5K3OA 5LQKA 1GAXA 1EEXB 3RRYA 1G17A 3RVLA 1OIXA 2FZEA 1MEEA 2C8LA 3DMHA 1OHHA 2IDJA 1YUNA 2XF8A 2VIIA 1TKCA 2OVFA 1JG4A 4PPQA 5DEIA 2PSEA 3RCBA 4CDRA 2O8BB 1UOPA 2GD1O 3CA8A 5JG7A 3GCXA 3JVIA 4HGZA 4PZ0A 4YCJA 4PNEA 1ETUA 4G84A 4CU2A 1M1NB 1GPBA 4YDSA 5CT5A 3OIUA 2ZSJA 3QFCA 1H2HA 2BEWB 1SXPA 4LX8A 1RQGA 2BDUA 2P75A 3REQA 2QPOA 1OJLA 3VYUB 1FP2A 4RPCA 2PUBA 1EFCA 1RHJA 2Q0HA 3IE2A 1IBKB 4AKEA 2CHFA 2VDUE 3ABQB 3OBBA 1BXRB 1KH2A 4XQCA 4MR9A 3OF2A 1DXHA 3EYAA 2QD5A 2QTFA 3ZUGA 2QQ0A 4YRTA 4ZOBA 2C2XA 1R0KA 4RJ2A 5DHTA 5ALFA 4I1SA 3QPUA 3RTEA 4GBED 1TOAA 4UTNA 1XCMA 3MUEA 3IB3A 2RONA 1HLDA 2ZSKA 5FUMA 1HUQA 1IHDA 2E1PA 3Q7PA 4LJRA 3ILXA 2ZVJA 4FVTA 5DE3A 3A7DA 3IA2A 4TTQA 1BZYA 4GKAA 2J6HA 2F9LA 1ECLA 1ZSYA 3KJZA 1B8PA 5J58A 1MZPA 5BSWA 5AK0A 1FL9A 2BFAA 3BH6A 3ENKA 3FWHA 3A3PA 3D7SA 4KBGA 4BWYA 3QX9A 4HJXA 2H29A 5I7EA 5AJWA 3ZHVA 2VJAA 1CQIB 2DWUA 3IUEA 2PWYA 3IT2A 1OPXA 3EA5A 1U4OA 3IAM1 5DFAA 4OJMX 5CB4B 3QLEA 3E5MA 3WB0A 5JDIA 1XMXA 1JLSA 1JRLA 3ABIA 4JEIA 4M60A 1YCHA 3CNQS 5BV8A 1UP4A 1TLTA 2KBFA 1H2RS 4K9SA 4RTKA 4H7IA 1LQ2A 2NVOA 4QHYA 1XFDA 4LF8B 5TQJA 2R8PA 3PZBA 2JFBA 1O8BA 4RLSA 3F49S 3ENVA 5J5AA 3ESCA 3ZUPA 4C2UA 2ZUBA 4PAQA 1XLVA 3PRYA 4WFKA 3Q8MA 1K7XB 1X7XA 2AXPA 2NNWB 1ZP6A 4I4LA 3X44A 5BMVA 2VFAA 2QL5A 3DT6A 4YCAA 2DM6A 1PTKA 4Q12A 3AR3A 2AGVA 2RC6A 3OWHA 2XMQA 1DS6A 1RLOA 1GNRA 2AN5A 3EH1A 3HYNA 3NHBA 4D6XA 4YUAA 2X8AA 2ZDQA 3H3FA 2CL7X 4I9FA 3ISVA 2HQBA 4HXFB 4MAMA 4NX2A 3C5EA 3P7MA 4PTLA 4DV4B 1UPCA 3MEQA 4OOEA 3SXUB 4C0HA 5BOSB 2AT1A 1J0AA 2EF0A 4A15A 2BZ0A 2CUTA 1PSDA 3W5AA 1YZQA 3LWDA 2ZB2A 3S7TA 4X6XA 1FQJA 4DLAA 4QU9A 4M76B 1C14A 5KDOA 3EUWA 3I0NA 2C2WA 1EP2B 3KYDB 3HA7A 4IUDS 2EATA 1EGAA 1T8TA 3BEDA 4ICIA 4UAUA 5L40A 3HCEA 1DC4A 1RAFA 2A9RA 2PX6A 1FYVA 4BWVA 4BO5A 5KWJA 4YLYA 4XTCS 3LDUA 3PL1A 3AI3A 1L8LA 2Y27A 4Q9KA 4E22A 2W0SA 1VLMA 4FGWA 2DBQA 4YCLA 5AT1A 5A6VA 5LU8A 4KRFA 4IDNA 2V6FA 1QGOA 4MMXB 4LE2A 2PANA 3LX6A 1NA5A 2V97A 4X63A 1Z4JA 2EQ5A 5AYVA 2BCJQ 2PLNA 5T4HA 2ERCA 1RRCA 2ZSDA 5ALHA 4IHQA 3MT8A 9MHTA 2QUHA 4RQAA 1JR3A 1TCVA 3WJ1A 4BHTA 1I3MA 3UC9A 1G8AA 5AM4A 1C29B 2MHCA 2ZT5A 2MDTA 4B1FA 4BFYA 3UMCA 2VCHA 2WWGA 4PSCA 4AZWA 4Q9HA 4ZGBA 4QTYA 1H0KA 5C52B 1U8ZA 2BGGA 1QVVA 1H0HA 3GUZA 3PUYA 4ENWA 5LXTA 2W71A 2YBEA 3V32A 1TL7C 1GDDA 2RGEA 4HJRA 3ZIUA 2WD7A 2GNOA 4JV5B 2ZRBA 1MLDA 1FJHA 4ZTBA 2C7QA 3ZWMA 4DC9A 1U65A 1AIPA 2DPYA 2GCOB 1EFPB 1OE0A 2O50A 3L6EA 3NIDB 3T0IA 4EW3A 2ZJ2A 2AMVA 3AFHA 1MC1A 2HF8A 2YJNA 4ALNA 4EJSA 1Z06A 4EVRA 1H8HA 4H7FA 5K0FA 1EWTA 4RTRA 3W6OA 5AW3A 1I1QB 5AVVA 4MDYA 2YY5A 1U7DA 5BMVF 3T7RA 4L15A 1ND5A 1D5WA 2FMXA 3UWSA 4KXLA 1ZCJA 2J87A 2ZRNA 4DMMA 3NYWA 1EZ4A 1W0KA 1D6NA 3T3IA 9ABPA 4TV9A 3EXEB 3OTWA 1OWLA 2VZEA 1HLPA 2C1ZA 4HX2A 3ZGZA 2J7KA 4PF1A 1NX9A 2WYUA 1FDTA 3LECA 5SYAA 2C82A 1NBMD 4IL5A 4OQLA 2VLIA 2HMSA 1PR3A 2QAGB 2Y4OA 4PG6A 4ZZ1A 3FDIA 3C3CA 3MYYA 1PWHA 2WLSA 1H1DA 1YV9A 3O5AA 1P3Y1 4FOPA 3OQIB 4JAVC 3S1SA 3ED1A 1SC6A 1AV7A 3CO5A 4QOSA 5DYWA 1NUUA 1QMGA 2XAUA 3DCJA 4GL2A 1NMYA 1Q16A 1XIVA 4HDMB 4W5RA 5KNCH 4E13A 1K27A 3I1JA 2PRYA 1YR8A 5FEUA 1G3MA 5ISMA 3VSDA 2V3WA 1GUZA 3GVIA 5CURA 3PA8A 1Z38A 1N8SA 4MWEA 4P1ZA 4FHFA 1TA4A 3I9FA 1SXIA 2AJBA 3EXFA 4LTDA 4WOPA 3L2OB 4EAQA 4LZWA 4CM8B 4YR9A 4TXJA 4BNTA 2MWMA 2WV9A 3O4FA 4BKUA 5I4CA 3HL4A 3PV0A 3H3JA 4JB3A 4JUFA 2YN4A 1GCUA 4C7XA 5CBKA 1CS0B 1RM3A 2OCAA 5IM4A 1DKRA 1W4RA 3IPLA 1KQ3A 1O6FA 3AIOA 1QP7A 1TU3A 1KIAA 1TC2A 1V8FA 2HLPA 3EVDA 3JTMA 3PX2A 5FOTA 5TNXA 1JH8A 2XWQA 1R9NA 5LXTF 3VI4B 4Q6BA 2FPOA 1KXJA 2SKCA 3KLOA 3TZHA 1B43A 2CYBA 4LJSA 3K8OE 2CZGA 3MIIA 4LZJA 1NR5A 2HH9A 5KSOA 5G41A 1DIOB 1JHVA 1J70A 3O2SB 2JDIA 1KEWA 2ZWVA 4PXYA 2GM4A 4RH3A 1T9CA 4XQ0A 3QPCA 4NYIR 4HTAA 2PEZA 3EIEA 4QREA 3WOHA 4X71A 5HZHA 3MJSA 1K0UA 3BSYA 1EFRA 1WHTA 4LXXA 1II0A 4MOWA 5IJ9A 4GLLA 2BFDB 2IP2A 5J1TB 2YBDA 4D0RA 4OCZA 4JOQA 4HMQA 3VR3D 3G5MA 2XB2A 1IJBA 2HO5A 2QN1A 4R9NA 4B32A 4WCDA 1U0JA 3RIHA 4Y6GB 4TV9F 2G88A 2QU7A 4MJ7A 3L4KA 3HH8A 5FEMA 1RPAA 1A7KA 3QWFA 2ZUSA 3PIDA 2NOAA 4PAMA 4QE3A 2DCMA 5KYYA 2QG9A 3FGPA 2OL4A 1X8JA 1NVBA 3OD1A 3QFFA 1F2UB 4HX9A 4AS3A 3WFJA 4QVIA 3EC7A 3AYXB 3KOYA 1DC7A 2AX3A 4HMPA 1TC1A 2AH5A 2XBUA 4RVNA 1E0DA 3QV1A 1AOXA 1U9JA 4KEAA 3N2YA 4Y2QA 1YQDA 3V8NA 3TSYA 3AJ9A 1KFBB 5EUBA 3BMOB 3CIFA 1K08A 3JQRA 3OCUA 3CQ9A 4UKDA 5HRUA 1WMDA 1M72A 3OQBA 3OQMA 3SR3A 1XPOA 2YWRA 3AK4A 2IUSA 5JADA 4YAGA 3OLQA 3RWBA 4H17A 1IZZA 3B6MA 3FPBA 4F72A 5KU1A 1FYWA 1M10A 1YT5A 1CY7A 2O8VA 3UB2A 1UT8A 2A92A 5FBRB 3L1KA 3NGLA 4FHZA 5CHYA 1I3CA 5HUQA 2EGUA 1S3SA 4PX3A 1N2CB 4EAAA 1FCJA 1P74A 3AY3A 2OFOA 2R4TA 3UYKA 3OAAD 4IKPA 4WOCA 5IZ4A 1A5SB 3DOIA 2B8EA 2AB0A 1LPBB 3S40A 4B74A 5C8ZA 4UREA 1UBHS 2RE8A 1QP4A 2WG2A 3P9YA 1WKBA 4DGSA 1J8VA 3ASZA 5IM4F 1MAVA 4L0DA 4NOKA 3DBIA 3QKTA 1KIMA 1WU8A 3O8DA 4HGYA 3KT6A 1ZVQA 4P7KA 1J49A 1USIA 1QGDA 1PFKA 4PYLA 1JLRA 2IEGA 5IX8A 4CKWA 1W36C 1PP4A 2YV5A 5EIAA 3ZQKA 3E2IA 3AI7A 5EJEA 5KX5A 3DL2A 5IT0A 1B6SA 1E1CA 1JJBA 3DQPA 3C6QA 2CVFA 3DDOA 4ZO7A 1NBOA 3TK1A 4LHVA 4RTMA 1QFJA 4YV7A 3L6DA 3U44B 3L1UA 3K05A 4B09A 3WIBA 1DIAA 3ZHOA 3PDJA 2DULA 2ZRGA 3DGEC 5EHXA 1I14A 1B6RA 2FHSA 4DMFA 3OVMA 1JQ3A 3JR7A 4B84A 1ZR4A 3D8UA 2D0DA 3IDOA 1WULS 2JEZA 2LWIA 5JEDA 4N9QA 2CNNA 4RLFA 3RS4A 3UH0A 5JANA 1L5WA 1W75A 3NRJA 4RPGA 1G5IA 3AIMA 3CCCA 4FE3A 3LM8A 1QBKC 3EGXA 2EDAA 3X1ZA 2C77A 1QF6A 3IUMA 1BHJA 3B7WA 3H87A 1PO7A 4GD3Q 3UEOA 5EG5A 2C0PA 2CMFA 5ESDA 1SVSA 1X7YB 1Q3TA 3THRA 5FBLB