5CFZA

Crystal structure of e. coli fabi in apo form
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
249
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
publication title Crystallographic insights into the structure-activity relationships of diazaborine enoyl-ACP reductase inhibitors.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Oxidoreductase
total genus 90
structure length 249
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5cfzA00
3G1UA 4XB1A 2NLOA 2VNAA 1HYHA 2PY6A 4Y8VA 4AL4A 4DWVA 3BMCB 3INGA 9LDTA 1EVIA 2W4QA 5TNXA 1J5PA 3VOSA 4CV0A 2IXBA 5HS6A 1P3DA 3COSA 3DOOA 3OP4A 1XCBA 5KWEA 3QA9A 3KEQA 3K30A 1YE3A 2B4RO 4BMVA 2BLLA 4FFRA 3GGGA 5BSFA 3D0OA 1LSJA 5JO0A 3D3WB 1ZJYA 1YL7A 2B4QA 3WGGA 4CJXA 3ONEA 1DRVA 3RUFA 4J1NA 3ZV4A 3ANLA 2YQ4A 4HNHA 3ZCXA 1AXEA 1GPDG 5EQFA 3WGYA 2VRCA 3NJ4A 2NNLD 5JDCA 2I66A 1NP3A 1I33A 3PHGA 4BO5A 4LISA 4TZTA 2SCUA 1WZIA 4W7IA 4Z9FA 2YHUA 1E7QA 1O94A 3F4LA 3JQBA 4J9UE 1EK5A 2ZJ0A 2QYSA 1VPDA 2DT5A 3GEMA 3S2EA 4FFOA 1H0KA 4MVJM 2EW2A 1I3NA 2NVUA 2X9GA 3FRJA 5A9SA 1XGKA 2H63A 2IDZA 4PLYA 3DMYA 3DQPA 3IOYA 4L0QA 2PD6A 3K2BA 4XIJA 1O9BA 3O38A 1TT5B 3DXFA 2HUNA 2IEBA 3DL2A 3DWFA 4WCFA 1ZMTA 4CV1A 1H6DA 1HLDA 3VZPA 3W6ZA 4XWYA 1PJ2A 1A27A 4FSHA 4E2YA 4P22A 1S7CA 2UUOA 5IG2A 4D42A 2D0IA 5AXBA 3TZHA 1HZJA 4MVJI 2VOJA 4XD2A 4CODB 3CPSA 4R01A 2ZYGA 1JTVA 1GR0A 1PZHA 3QQPA 5CHEA 3K5PA 3MWDB 3A28A 4ZICA 1M67A 3KYCA 1K6XA 1EFLA 1U8FO 4WE3A 3WGQA 4WOJA 4AJNA 4M87A 3FR7A 4CUKA 1VJ1A 3AUSA 1ZK1A 3MOIA 2FPIA 3QW2A 4OO3A 4PG5A 4BNKA 5KKAA 5C7OO 2VWGA 3LZ6A 4GSKA 2G0TA 1YXMA 1T2EA 2WWRA 1XHLA 2EW8A 1KYQA 1U8XX 2HRBA 3AY6A 3T4EA 4TWRA 1C1DB 2V6FA 4QX6A 4YBZA 3AFMA 3M1AA 3OFSA 5GZ1A 4DA9A 1GQ2A 5CDGA 1LX6A 2ZYAA 4FFMA 4F3YA 1JWAB 4OQYA 3U4CA 3JQFA 4CMEA 1H93A 3PYLA 1DBVO 4CM9D 4BL5A 1MV8A 3PJFA 2VOEA 2YV2A 4NFYA 2QZ9A 2D5AA 5CDTA 3WTBA 1DRWA 1PL7A 1ULUA 2DM6A 4ESOA 3QHAA 3DBLB 4QFDA 5JBIA 2YV1A 2PA3A 4IM7A 4IBOA 2D4AA 2HMTA 4CLOA 2EIHA 4IDEA 1E1KA 4BO0A 3B1FA 1GD1O 1K0UA 4UEJA 1DIHA 1B8VA 2YJZA 2CDAA 1Y8RB 2HSDA 3GZ4A 2HKIA 2ZTUA 3N7UA 4NPCA 1BDBA 2GCGA 5L7WA 4YJGB 1XU7A 2JKVA 3PFFA 4BQRA 1LA2A 4HNGA 4Q39A 2VZ0A 5BR7A 4D7AA 2AG5A 3I52A 1NM5A 3R1IA 1P74A 2JHGA 3GT0A 2Q4EA 2YHIA 1N1GA 5I7FA 4R1NA 3IS3A 4BO8A 3ICPA 4FJ2A 4W82A 4KWHA 1XWFA 1X15A 2Q1UA 1VRWA 1UXKA 3GRPA 3HDJA 3PQFA 3ZGYA 3UKOA 1HDCA 1T4DA 3GVPA 5JY1A 5I9LA 1VLLA 1ML3A 1U9JA 2DBQA 4FS3A 3CH6A 1MXFA 1HE5A 3DMTA 2P2SA 1BXGB 5BNIA 1WWKA 4BVAA 2Q46A 2C0CA 3NEPX 1YS4A 3F9IA 5I8WA 1R4MA 2HJRA 2WD7A 3EC7A 3WWZA 1A7AA 2ZIZA 4QECA 2GF2A 3VKUA 1A72A 2WYVA 1EDOA 4NIMA 4M89A 3OEWA 1F12A 4J6FA 2V65A 2NQ8A 1DAOA 2PR2A 1O8CA 2ZKLA 3VH2A 5HS4A 1AHHA 1B15A 2O3JA 2GR9A 4KP7A 1F0YA 4MIOA 2BI8A 4NBWA 2UDPA 2VT3A 3D4OA 4B7UA 4BIIA 8LDHA 1YQDA 5AVOA 3G0OA 3WR5A 5EL0A 4LGVA 4LK3A 4RVGA 1YOVB 2HMVA 4XB2A 4ND3A 5JCJA 1CRWG 1SEPA 2DTXA 3D4PA 3JTMA 4FC6A 2Y1FA 4FCCA 4OXNA 1P31A 1EVYA 3R0IA 3SJUA 3WBFA 2Y68A 1V0JA 2C20A 1HXHA 1DRUA 4BNGA 3WG9A 3PHLA 4OSOA 1PJ3A 4TSKA 1ENPA 5BSEA 3BMNB 1EE2A 1G0NA 1XU9A 3JQ9C 1N5DA 2HO5A 2P4HX 1LSUA 4YRBA 2WDZA 3UH1A 4B3IA 3C7CB 3DDNA 1F14A 1CERA 1RM0A 1GUZA 3ITDA 2FPGA 4JK3A 4MO2A 2NUAA 3EDMA 4ZN6A 2QHXA 4XJTA 1E7YA 1YKFA 3F46A 3L77A 5ILGA 4FB5A 1P1KA 3IL2A 1V8BA 1T25A 1GL3A 2Y66A 2IYPA 3BTSA 4X54A 4D0RA 5FEUA 4YAIA 4I5DA 5I9MA 2RIRA 3LVFO 1E3IA 3PQDA 3QWBA 9LDBA 5JC8A 4GKVA 3NJ8A 4Y67A 5KJFA 3PHHA 1U5CA 3M2PA 4HY3A 5KVVA 2VTEA 2NV6A 5LC1A 3WGTA 1M75A 5BT9A 1ZEJA 2O7SA 4L4XA 3E5RA 2D3TA 4E3ZA 1ZZEA 2J5KA 1JVBA 3O9ZA 3ON5A 1D3AA 5IAAA 1GYQA 4B3HA 3KYDA 3PK0A 2J3IA 4R5MA 3RC7A 5FFFA 3AM4A 2Q2VA 4L76A 3D5TA 1LLCA 3IP3A 1OOEA 4FW8A 4OOFA 4CL3A 1U7HA 2D2IA 5G0SA 4RZIA 1F8GA 1WNTA 1TVEA 4GAEA 5ICMA 3RI3A 5A03A 1HDZA 2WTBA 3UXYA 3DAGA 4BO2A 3GLQA 4DIOA 3INRA 5KVCA 1U4SA 4FJ0A 4IJKA 4RPHA 3ZHBA 1JVSA 5DCWA 4KQWA 4ZA2A 4JJGA 3WGZA 4CR6A 1ADFA 3ITKA 2Z5LA 5AYVA 1H2BA 2AG8A 4JJFA 4IMRA 4C4OA 4CMGA 1EVJA 3BAZA 3O03A 1O6ZA 3DZGA 1SB8A 2HK9A 3FCOA 3Q1LA 3ZV6A 5DBIA 2HU2A 3GH3A 1ISFA 1SMKA 3GRKA 3RUDA 3ZWVA 3AUAA 5U9CA 1KBZA 1KC1A 3H3FA 4NZ9A 4XQGA 1GV1A 3E18A 5G0TA 2JCVA 3RC9A 4YT4A 1ZUD1 4AJPA 4OYRA 2P5YA 1VSVA 2ZB8A 3EW7A 2PKQP 3QSGA 4EBFA 4YYZA 4Q3CA 4WLFA 3FNFA 2RCYA 4NBTA 4RV9A 1U7TA 5A9SB 2BKAA 2NVUB 1F06A 2BMAA 4IMPA 3UHAA 3WQRA 1LRLA 1Q7CA 1ZO8A 3WYEA 1DEHA 1KC3A 3H2ZA 3I6QA 5I9NA 4BMNA 3EMKA 5COBA 4Z9XA 5TT0A 2CSUA 3TPCA 3WNVA 1FDWA 3RVDA 5DBFA 4Q3BA 4E4YA 3IKTA 3ZI0A 2XOXA 1GUFA 4TRMA 1E7WA 4TRRA 2EKQA 3WJ7A 4NU5A 3WQQA 3RSHA 1A4IA 4UEOA 3KUXA 4ZRMA 3MTJA 4OSPA 1LQTA 5IDWA 4CM3A 3RROA 1KS9A 2WE8A 1ISHA 4ZQGA 4LCJA 3VAZA 3KHUA 3L6EA 3BMOA 3U49A 1BMDA 4HUJA 4MVJD 1I01A 1K5HA 3DO5A 3DZHA 1NBOA 3KYCB 3NV9A 2X0IA 2W2KA 2VYVD 2FR0A 1Q0QA 3WNQA 4CV3A 5KJCA 4KDEA 1ARZA 3WICA 4E21A 1J0XO 3FTNA 2C54A 4BNMA 1IUKA 1G0OA 1N92A 2JD1A 1A9YA 2X5KO 4QSMA 4LRSB 1YDWA 5B4UA 1U3UA 4Y9DA 3T7CA 1LUAA 3CTMA 2X1HA 1QLHA 3VPXA 3KSUA 4Q3AA 1P9LA 1ID1A 3L4BC 1LDEA 2YDYA 3FTPA 4EJMA 1TT5A 2VHVA 1EUZA 1YQXA 4C7KA 3Q2IA 2NTJA 4RPJA 4UAGA 3K31A 1Z75A 2B83A 1PGJA 3PP8A 4DGSA 3HB5X 5DZSA 1ENZA 3U9LA 2NADA 4IDBA 1MC4A 1N8KA 5LCXA 4J9VA 5T6BA 1HYEA 2BFMA 5B4TA 4RZHA 2FHSA 4NG5A 1VSUA 4NBVA 4IGFA 3RFTA 1XDWA 3OECA 2VWHA 2BF7A 1NASA 2JL1A 2GN4A 4WNCA 3MJTA 4A26A 2GN8A 1QSGA 3PHIA 1NPYA 4FN4A 3U4IA 1B0AA 3B1KA 4GPD1 3HB4X 4YAJA 3V2UA 4B7CA 4BKQA 3QVSA 2P9CA 4CLOB 3RUHA 3JQ8A 3TZ6A 4QTZA 4BB5A 3H65A 4DXHA 2JD0A 4GX1A 2VN8A 4WLNA 3GEGA 1SPXA 2CDCA 1N9GB 3E9MA 5IJZA 1NTOA 1N7HA 4DTIA 3SLGA 2HAEA 4Z0HO 2VNSA 3HNPA 2AE2A 3F1KA 1C0KA 3JSAA 4PZEA 1T2AA 2VT2A 4BNNA 3S2FA 3RC2A 1E3SA 1DAPA 3NTRA 2FZWA 2X23A 2GZ1A 3I6IA 3OEYA 4J0FA 4K1LA 3ZU4A 3LC2O 4ALMA 1ENYA 1RM3A 3PWSA 3GUCA 3NTQA 4KUEA 1XR3A 4UUMA 4O59O 2PWZA 2YHIB 3DHNA 3Q2KA 5DF1A 4J0EA 3KOUA 1ZH8A 2POQX 1QP8A 2FZEA 5TRTA 4IJUA 1T2CA 3KVOA 2YY7A 1VM6A 4U0KA 2Q1WA 5ES3A 4AJOA 3ZHYA 2VUTA 1V9LA 5DP1A 3TZQA 3RFVA 1NAIA 4NMHA 5G0VA 1VL8A 3RKUA 2B69A 4CLDA 4OMUA 1O89A 2GASA 3TL3A 2GPTA 1DIBA 4KUHA 4GX2A 1R4MB 1YB4A 1E7MA 2WD7B 3A14A 5L45A 1QYVA 3GN1A 2EGHA 1PQPA 4ZVVA 4PLVA 3WYCA 3ZWYA 2O3SA 5TC4A 1WP4A 3P5SA 4G81A 4MVJH 2NVBA 3GMDA 3I9NA 5L53A 3UCXA 1JAYA 4K28A 4EEXA 1DLJA 3VPHA 4CM8A 3ANNA 1YH3A 4GSLA 5C5IA 4HV4A 1Z73A 2WE7A 3RJ9A 3SBOA 4CUJA 4Z9YA 4JP2A 5LDGA 2Y93A 1XIVA 5JCXA 4RF3A 3VC7A 1SAYA 3C7AA 3TQHA 4E5PA 3UAGA 1KOLA 1D7OA 3JQEA 3RUAA 3GF4A 3C1OA 4U7WA 1I3MA 4BV8A 1LDNA 1Y5RA 3JD4A 4MINA 2Y0DA 3R3SA 1J49A 4TZKA 1PGOA 4XQEA 4DLBA 4XA8A 1Z7EA 5C7IO 4Z3DA 4B7XA 4KOAA 2C82A 2CF5A 1R15A 5ER6A 5L4SA 4LMRA 3HFGA 4GVLA 3KSZO 4PLHA 5KCZA 2I65A 3HZZA 3K92A 1TLTA 1OBFO 2VTDA 1JU9A 4M54A 3I4FA 3QWFA 1N2SA 4EZBA 3JD0A 3QVWA 3LQFA 4D79A 3QV1A 3OJLA 4IXTA 7MDHA 3R3JA 1XKQA 3STHA 3VH4A 2X5OA 2I6TA 1ZVMA 4QFCA 1D8AA 3WB9A 4FFNA 4WK6A 3KYDB 5ITVA 2H9IA 3H2SA 1T1RA 4J2HA 3FPCA 3RUEA 4A03A 4ALLA 7ADHA 3CE6A 1NFFA 2Y0CA 1BSVA 1G1AA 5JPIA 3RASA 3PI7A 4EUEA 4MP8A 2X0JA 1X13A 1BXKA 4N18A 1MP0A 1Y81A 4BQPA 2G17A 1KY4A 2FR8A 4M1QA 3NX4A 4MKXA 5MDHA 3GQVA 2GGSA 1TI7A 1YBVA 4L74A 3SC6A 2WYUA 2EG9A 2FWMX 5A5EA 2RHRA 1HDRA 3H3JA 4BNIA 3GVHA 4OJNA 1UXJA 4N5LA 2BH9A 5B37A 3EVTA 4XQCA 1QV6A 2PLAA 1IYZA 3LT0A 3KEOA 3WTCA 3F6YA 4A5OA 4KWIA 3A9WA 5L4LA 1I3LA 1Z45A 2C2XA 2R00C 5TS3A 2VUUA 3ZW8A 5CPFA 1T4BA 4IPTA 1HDGO 1KETA 1OC4A 3PEFA 1KVRA 1DOHA 2IODA 3RUIA 4CMKA 2R2GA 4PG7A 4JNKA 4YEDA 1X0VA 3NDJA 5TJ9A 4CQMA 1PZGA 1R0KA 2DQ4A 4RPGA 2UAGA 1X1EA 3H9GA 4QXMA 4YJFA 4CM1A 2O7QA 5B1YA 1WAMA 1JAXA 3H9UA 3GVCA 1GQQA 3C1AA 4BNWA 2VHWA 2VRCD 4RF4A 1LDMA 3AU8A 1KEUA 4KUGA 1BVUA 4I9NA 5DBGA 1LQUA 1S6YA 3I9OA 2A9FA 1R0LA 4RVFA 3MEQA 4QUKA 2AEMA 1V3VA 3H6KA 1H6BA 2CNBA 2JHFA 3ETDA 3IJRA 4B4OA 2CDBA 3Q11A 1IHXA 1DHTA 1ZK0A 5DP2A 1FDUA 1PJQA 4CMAA 4R9SA 4IINA 4Y6RA 5BSGA 4FGWA 3BMOB 1VKOA 1PS8A 1Z74A 1E7RA 4I5FA 1I2ZA 3DB2A 3OQ6A 3DZFA 4PLTA 4BB6A 1IULA 3E9NA 1KY5A 5FI3A 4CV2A 3QE3A 4GGPA 1UR5A 5ILOA 2W2KB 3HN2A 1V6AA 3ZWAA 3VTFA 1ORRA 1TXGA 4R3NA 4BHTA 1DLIA 2PD3A 1A71A 4BO7A 4NNJA 4DL9A 4G5HA 4H16A 1LSSA 4XCVA 4BNFA 5AXCA 2VUSA 1HTBA 2OO5A 4GKBA 3ONFA 3SC4A 3EGOA 3PPIA 1SO8A 4ND4A 4MIYA 2YW9A 5TJHA 1YONA 4GL4A 4N7RA 4UULA 3GVIA 3DZJA 2JCYA 1JWBB 4OH1A 4XYEA 2P91A 1E1LA 1QV7A 2AA3A 3JYQA 4R16A 2JCXA 2P5UA 3M1LA 4N5MA 4Y98A 3ZU5A 4DPMA 1IPFA 1BTOA 3GOHA 1E3LA 4J4HA 4OHUA 2BD0A 1IZ9A 2AQIA 4YRAA 3B70A 2EV9A 1WDKA 1RYDA 3VVBA 2PV7A 3JQ8B 4KQXA 1P44A 4R1SA 3ABIA 5ICSA 4M55A 3B6ZA 3WYBA 3TDKA 3I1JA 1UZNA 3JD2A 4YCAA 5F3RA 4PZCA 1L7DA 3L6DA 5TSDA 3H7AA 1O95A 3E82A 3DZKA 5CEFA 2HMUA 3JQAD 3G49A 3CZMA 4AJ2A 4RVDA 5EERA 3QVTA 1UP4A 4GLLA 4P4LA 4CMCA 3VKVA 1B3BA 1IY8A 2OGUA 4YAKA 4EUFA 2PNFA 1WMAA 1Q0LA 4ALJA 4EUHA 1NQAO 4CMJA 1Q0HA 8ADHA 3LC1O 3C8MA 4LSWA 5FF9A 2DAPA 2GLXA 1Y9AA 1EDZA 4XX0A 3H5NA 3RUCA 4KTTE 2J3HA 4IJVA 3G3EA 1AN9A 2DFVA 2V7PA 3F1LA 3KYBA 1K6JA 2BI7A 2H5LA 3HQ4O 1Y6JA 2O3TA 3UCEA 4D3SA 3AY7A 1B8PA 3OICA 1PQUA 5KNLA 3PWKA 1KEPA 2BFPA 2CMDA 2Y1GA 5T8KC 5KJ6A 3WJAA 1SB9A 1UXHA 1E3JA 2PFGA 3WIDA 1C0LA 4CLHA 4D43A 3F3SA 3UF0A 5C7LO 2EWMA 4XYLA 1SC6A 2O3RA 2OBNA 4CL8A 1N9GA 5T64A 5IZ4A 3H8VA 4BNYA 1GAEO 4YQYA 2O50A 5CAEA 1VL0A 2Y0EA 3GUYA 4W9NA 2OL4A 2G1UA 4BNUA 4E12A 1GDHA 2ZATA 3BTVA 3PYMA 3H5AA 3JYNA 5CDUA 3BTUA 3UGKA 4J7XA 4CM8B 2FR1A 5EPOA 4WEQA 3EYWA 5L3ZA 3BHIA 3ZWPA 4G65A 4RDIA 3TZCA 3ZWMA 1GU7A 1DIRA 1NHGA 3KRTA 4BO1A 2IZZA 3HWRA 3EY4A 1HEUA 1JKFA 2PKRA 5DOVA 4IJWA 1KEWA 3CZRA 5JS6A 3C7DB 4EJ6A 1ZSYA 4WUVA 4B8ZA 2CF6A 1GFSA 4F46A 1C1XA 3RCBA 1ZNQO 1LDBA 4LSMA 3X2EA 3X2FA 1KERA 4BV9A 1R66A 4YT2A 2J5QA 4P4NA 5JDCC 3C3XA 3IP1A 1I5RA 1KVSA 3DHYA 1GYRA 5JCJD 1QMGA 4E30A 2NVWA 1IHYA 1IPEA 2EJWA 1PZFA 3JQBC 2P9GA 4ID9A 4D3FA 4R5HA 2D5CA 3VVCA 2Y99A 2CFCA 2PZMA 3R6DA 3U4DA 3WS7A 4NI5A 3IKVA 3W1VA 3ETGA 3PZRA 2ZTLA 1OI7A 2ZTVA 1XYGA 1J4AA 1E7SA 5L40A 2FY8A 4YA6A 1QYCA 4FGSA 1NPTO 4IDFA 4L4SA 2EKPA 5A3JA 1VI2A 3I9JA 4WCFC 2OP0A 4TRNA 4U5QA 1YVEI 3K9QO 3O8QA 2GNAA 5F5NA 3OH8A 4EDFA 5CEJA 3ROPA 1PJLA 1UH5A 3VHRA 3WFJA 5T5QA 5ER9A 3SXPA 3WDSA 1E3WA 4XZ3A 4BO6A 4JCOA 3ASVA 4AFNA 3L6OO 1ZW1A 2OBYA 3ADOA 4WKGA 4DIFA 4ZQEA 1EUCA 5EN4A 3WLFA 3PLRA 3ENNA 1PGQA 1QYDA 2QQ5A 4MJLA 3RIHA 3ZU2A 1EBFA 4YTEA 3PRJA 3QY9A 4RL6A 1U1IA 1P1HA 3D7LA 1I3KA 2AQHA 4UVGA 1BGVA 1NHWA 2OMEA 4JBGA 4WLEA 2I67A 3EZLA 2CZCA 1ULSA 2RBEA 2Y1EA 3OIDA 4XR9A 4ZQFA 2O4CA 3KSDO 4E2ZA 5L9AA 3CINA 1LI4A 1R37A 2FSSA 1ONNA 3LSYA 1U2DA 4E6PA 4PVCA 4NK5A 2X7HA 4CMEC 3MZ0A 4AJLA 3ADPA 2VHZA 3AW9A 1D1TA 4BNZA 2A35A 3ORFA 5HWSA 3CKYA 3U3XA 2ZB7A 4IZHA 4CQMB 4PG8A 4ILKA 3RU7A 3HSKA 3LU1A 1NX6A 2P4QA 1T24A 4CMIA 2FRDA 1UDCA 1WXDA 4YJFB 2VZ9A 2B5VA 3K6JA 2AHRA 5A06A 1BW9A 3GDOA 4OXYA 1PJSA 1GPJA 3I9LA 5I7VA 3CMCO 2E6UX 1ZCJA 3DAPA 1BHSA 3HDQA 1WZEA 3P2OA 1MG0A 2C2YA 3VPSA 2QG4A 1U2GA 1ZBQA 4OM8A 4CLXA 5T57A 1DJQA 2I9PA 3RC1A 2GUGA 5A9TA 1I2CA 4CM5A 3MJEA 4NHEA 4R4JA 3Q9NA 3RU9A 5KIAA 1AHIA 3DR3A 3TRIA 3GDGA 2TMGA 4J1TA 2JFGA 2Z95A 1NXQA 5ITWA 4BOYA 4CUZA 3P2YA 4TKMA 4FR5A 3PHJA 4R69A 5IZCA 5KJ1A 4U0JA 3V1UA 2VYND 1YBMA 2IEDA 3V5NA 1A4UA 2VRBA 5I8ZA 1V3UA 4UVIA 5DCUA 4DMMA 4Z6KA 4J1QA 1B3RA 4U8GA 3PFWO 1GEEA 5TQVA 3KM0A 1ZK4A 1U28A 4H15A 1HYGA 3DMTC 4BNXA 3FI9A 5COAA 4W4TA 4I9UA 3I83A 2C5EA 1I32A 1M76A 3S1LA 1CDOA 1JKJA 4KDFA 2G5CA 5JLAA 4CM4A 3GFBA 5EINA 4RF5A 4E13A 2BFAA 1QKIA 2IYOA 4XJSA 2CY0A 3GVXA 5ENDA 1QLJA 4DYDA 2FOIA 5I7SA 4XGIA 3KTDA 3ZHZA 3D5QA 3ZNOA 3W4JA 2A92A 1KEVA 4P38A 4B4UA 1ISMA 1Y9EA 1ZK3A 3ROMA 3ZNQA 2NM0A 1NVMB 2ZYDA 2AEJA 4NDNE 1NQOA 4R1TA 1GCUA 2RAFA 1P1RA 2DLDA 4N5NA 4UVEA 4ALIA 4K6CA 5TLSA 4KTVE 1PJ4A 4PIVA 1UAYA 4ND2A 3RJ5A 4FDAA 4EEZA 4ND5A 1PQWA 4E5NA 1WLYA 1WW8A 4DBVO 4DIBA 4RLHA 2FPPA 3OJOA 3BYZA 3GGOA 4HWKA 4JBIA 3AU9A 3BHMA 1LNQA 4IY1A 3ZWCA 2RH4A 4WPGA 3E48A 3QIVA 3KBOA 2GN9A 3DZIA 3NAQA 3ROQA 4S1VA 4IDGA 5IDYA 4CR7A 4R1UA 1BVRA 5HM8A 3KB6A 2RHCA 3ZWWA 2I5PO 3QVOA 1ZXBA 1N7GA 4GI2A 4CMBA 2OHXA 2OORA 2Q45A 2WMDA 3GHYA 4GGOA 1EVZA 5LDHA 1H5QA 3DBHA 1GQYA 4NJMA 2YFQA 1YRLA 4PLZA 3GA0A 1DIGA 5G2OA 1W0CA 4YT5A 5K6AA 4E2WA 2VYVA 5G0WA 3VZQA 5A4DA 1PSDA 3WWYA 3K2EA 4MKRA 3ZNPA 4B8WA 3OHSX 1C0PA 4YACA 5HTOA 4R9RA 4DQUA 1IOLA 3F5QA 2HK7A 2Y05A 3D3EA 4LRTB 4BS9A 5GZ3A 5IDXA 4B3JA 4IQ0A 2JAPA 3PVZA 3I23A 4DQVA 3ENKA 4R51A 4JJIA 1CETA 1B2LA 3P7MA 1UZLA 1ZFNA 1NFRA 5JAZA 2GYYA 1U5AA 4F45A 5BNFA 3MOGA 3N74A 3QVXA 3RWBA 4CM7A 2PGLA 5TF4A 1A7KA 2EHDA 1GTMA 1M6WA 1X0XA 4XRGA 3Q3CA 1YGYA 4A73A 4RORA 1GEGA 2X4GA 1C1XB 3EZYA 3IDSA 4ALNA 5KVSA 2B0JA 1GV0A 4XYBA 4M49A 3E1KA 3EK2A 3DFUA 2G76A 1E6WA 3D64A 3RKRA 3GPDG 2R00A 1LC0A 1X7HA 2Q50A 1BG6A 1HRDA 4NJOA 2D8AA 4OL9A 2DBRA 1EE9A 1K2WA 1YDEA 3EVNA 4FBGA 3TL2A 2ZB4A 1BWSA 4GVXA 5A1TA 1E6UA 2DBVO 2WEKA 4UEKA 4DQXA 4E5YA 3HHPA 3JYLA 5CG1A 1YB1A 4A7PA 5JYDA 2NU8A 1KVTA 1IB6A 4B4WA 1ZSNA 4PLWA 2OUIA 3Q6IA 3JQCA 1DFGA 2HDHA 4FJ1A 3A1NA 4XYGA 3WGHA 3O8QB 3ZV5A 2BGKA 5L4NA 1PR3A 2EGGA 5JNLA 3U5TA 2DTDA 4OGWA 4U6QA 5F21A 2O48X 1VJ0A 3T7EA 1E3WB 1X7GA 2X58A 2Z1MA 1HETA 2NU6A 4CLEA 5A02A 1WDLA 1PS0A 3AY3A 3NUGA 4RLSA 4XR4A 4J7UA 4XQ9A 4AJIA 4BKUA 4UVHA 4RJTA 1P0CA 4RGBA 5JMWA 3BIOA 3U4HA 3GZNA 1WVGA 4RF2A 3L9XA 3GC6A 3WXBA 4AJJA 3ZDFA 1E77A 2PGDA 1DC4A 1MFPA 1CQJA 5F1OA 1H6AA 4M8SA 2X86A 3CEAA 4DUPA 3ETEA 1P1FA 1B16A 3AOGA 3BMQA 5CPBA 5THQA 1LLUA 3DZBA 5KKCA 3IJPA 1Z6ZA 2HMSA 1CEQA 1Z82A 2PK3A 4DPLA 1YB5A 4BGVA 1SEVA 5G4LA 1LBEA 4IQGA 4PGFA 5JSFA 2C29D 1NPDA 2O3QA 1HWYA 3CXRA 3OSUA 3H5RA 5T67A 2X8LA 3JQGA 4DBZA 2PGJA 3TOZA 4IXWA 2J6IA 3QWHA 5EJ2A 1E3EA 3BHJA 1OZAA 2VQ3A 1W6UA 1U3TA 1Y8QB 4HFMA 5G4KA 1A5ZA 4AJKA 4D41A 3PTZA 5KJEA 4PZDA 4DLAA 2VHYA 5JYEA 3GHHA 4MIEA 2W2LD 1DSSG 2A4KA 1EQ2A 1MG5A 2Y1OA 3PLNA 1FDSA 1BRMA 4ZU3A 2EP5A 4W99A 3FPLA 4CMIB 1LJ8A 3DOCA 2X9VA 1TA4A 1I36A 1ZXLA 1SZJG 1BW9B 2Q49A 3BXXA 3GGPA 3M6IA 1HT0A 2AMFA 4D0SA 3WOHA 3OIGA 1HF3A 1AXGA 2AEFA 2AQ8A 1L1FA 1VKNA 1BDMA 5GY7A 4AG3A 3G1TA 1DC6A 1RM4A 3FNEA 1T2DA 3FD8A 4FC7A 4IDCA 4AJEA 4CQMD 2O23A 4IZIA 3AOEC 1GZ6A 1HE4A 3FWNA 3H9QA 4MOWA 4M86A 4GWGA 2Q1TA 3VPGA 3TN7A 2DVMA 3O26A 4CR8A 2DFDA 2I3AA 3S8MA 3EUWA 4PG6A 1RPNA 2R6JA 3HUDA 1UP7A 3AM3A 2EERA 3KLMX 3UW3A 2E37A 2TMDA 3D4NA 4I9HA 1LDYA 3ST7A 3AI2A 2NACA 3UICA 3AWDA 2OFPA 4U6SA 3V1TC 3AJRA 3LYLA 3KZVA 1WMBA 1GYPA 1I24A 4UVDA 4DMLA 4YWJA 1X7DA 4LN1A 1SBYA 4O1MA 4KZPA 4L75A 4MVJE 5IN5A 1ADCA 1SOWA 4R3WA 1WPQA 1LU9A 4NFSA 3AUTA 3HN7A 3PQEA 4MVJP 1EBUA 4CM4B 5A3VA 3QJ5A 4CMHA 3MWEB 5K9ZA 3I9KA 1DPGA 3WLEA 2DC1A 2D1YA 1TB4A 4MPDA 4IQ8A 1FMCA 1PWXA 2LDBA 1Y7TA 3AK4A 4URFA 1V35A 5HBRA 2X22A 5JC1A 2X0RA 3NGXA 4NU6A 3ZWNA 4YDRA 1KIFA 5TX7A 3VDQA 1JN0A 3HADA 1K89A 4A10A 2EXXA 5GZ6A 3VH3A 2GSDA 4YJDA 1UJMA 4BMSA 3RBXA 2W98A 5C3MA 2GERA 1DC5A 2CUKA 4CPDA 3OA2A 4FFLA 1XQ1A 3RBVA 5B12A 3JQ7A 1V3TA 4QO8A 2V6BA 1PJCA 3TOXA 4DC1A 3KXDA 3E6AA 1MFZA 4ZD6A 1G6KA 2CVOA 3BTOA 1DFIA 2Q3EA 5DT9A 3PJDA 1HDYA 4JQCA 4ONEA 2DPHA 3I3OA 3IIEA 3GDFA 2J5RA 2IZ1A 3IUSA 2E4AA 2UUPA 3ASUA 2HQ1A 4Z3KA 3V2HA 4ZGWA 1VE9A 3TWOA 3NDIA 3OIFA 3TSCA 1P33A 5A5FA 1NR1A 1MA0A 2HRZA 3G79A 3F5SA 2Q2QA 5JO9A 1DDOA 1NR7A 1AGNA 4XKJA 5MGBA 1P1JA 2VWQA 2FP4A 4GX0A 2JAHA 4ND1A 4Q3NA 4W7HA 1P0FA 5DULA 3ZWOA 3FNHA 4IDDA 1UDAA 5CDYA 3DBHB 3WQSB 4IIUA 2B35A 4NJMB 3Q0EA 2VWPA 4OOEA 3DHEA 1ADGA 1H9BA 4QEDA 3DTTA 4P8RA 4W6ZA 1RWBA 3MCVA 1I2BA 3S55A 4AVYA 5U1PA 1VL6A 1PGNA 5JDIC 1HDOA 4MKZA 1QYWA 3JQ9A 3NGLA 3Q9UA 1MC5A 1R4NA 1JW9B 1N1EA 3MTGA 3PIDA 1XSEA 4GWKA 3WSVA 4OIMA 4A27A 2NU7A 5EIOA 3GY0A 3C24A 2AXQA 5A04A 1D1SA 4CM6A 3QP9A 4XDZA 4YB8A 4WJZA 1C14A 1FXSA 2W90A 5U4QA 1X1TA 1ZJZA 4J4TA 1F8FA 1PL8A 2P9EA 2X9NA 4H7PA 4EI2A 5IXYA 5CFZA 2Q4BA 3NT5A 1DO8A 4MP6A 1E1NA 3GAZA 4ROSA 2C7GA 3UOGA 1U4OA 1RKXA 3PWZA 3QWIA 1I0ZA 3EAGA 3B1JA 1IZ0A 2EF1A 4WEOA 2BFOA 4HXYA 2QZZA 3OJEA 1LRJA 4II3A 4S3MA 3MJSA 3HG7A 3NYWA 3SJ7A 4JIGA 1SOVA 2E48A 1UUFA 2X0NA 2DU8A 1O5IA 3I9MA 1VJTA 5L51A 1PS9A 2NSDA 3E03A 1HSOA 3JQAA 4HADA 5JMPA 2Q99A 1T26A 2IRWA 1UDBA 2GZ3A 4NH4A 1QXSA 1EQUA 4WLOA 5F5LA 1NWHA 1NQ5A 1FDVA 1E6EA 3JYOA 4DREA 4BKOA 3IQDB 3LLVA 1P1IA 3FHLA 3FR8A 4L9RA 3ZZNA 1PJBA 1UXGA 4RVUA 2D59A 3DBVO 3W8DA 5AQ1A 4J1SA 5AXDA 1C3VA 2WJPA 3AM5A 2ZJ1A 4CM9A 1HZZA 4MP3A 1NYTA 4OKIA 5IFLA 2I76A 2CVQA 5C37A 1QR6A 4QO7A 3FBGA 4I8XA 4NR0A 3QWAA 4RVHA 4TRJA 3V8BA 1LXCA 3CIFA 5JFOA 3PIIA 3NDRA 1MUUA 2ET6A 1PJTA 2G82A 3LC7O 2DBZA 3K8ZA 4Y6SA 1W8DA 4CLRB 4Q3DA 5JAMA 3GZNB 4PLGA 2BELA 5CEEA 1HE3A 3S2IA 4YPOA 4C7JA 1YO6A 2VHXA 3WMXA 2ILTA 3O4RA 4I1IA 2PD4A 3ZW9A 3OETA 2B36A 4GMFA 3A4VA 4PLCA 1ISIA 3NT2A 4R68A 4Z0PA 2ZQYA 3SVTA 4Q3EA 1SNYA 2EEZA 3DBRA 5CG2A 3HJAA 4Z0TA 2BRUA 3BMQB 3HFSA 5JY6A 3W6UA 4PG4A 1QORA 5IF3A 2FMUA 1CYDA 2XAAA 1R16A 3P19A 1VC2A 2C7VA 2HCTA 2O2YA 2Y1CA 5ADHA 3JQGB 4PLFA 4PFJA 1NWCA 1YQGA 2ZQZA 4EGFA 2PKQO 4GH5A 5G4KB 2Q1SA 2X5JO 3ZU3A 4GX5A 3ZV3A 5FYDA 1ZMOA 4IIVA 1IL0A 4XRRA 1ZEMA 1M66A 3OQBA 5GMOA 3GK3A 3CMMA 1CF2O 1HE2A 3KO8A 4RVSA 2EJVA 1DC3A 2VCYA 4HX5A 3U0BA 4Y6PA 1HDXA 1EMDA 4Q9NA 5HA5A 5CDSA 1C0IA 5HRUA 4BO4A 3ANMA 3WGOA 3A06A 3K73O 4OXKA 5TIIA 4II2A 1GADO 3TZKA 3UCFA 1PL6A 1YJQA 2XXJA 3RD5A 3ZHXA 3UN1A 4DVJA 1GZ3A 1IE3A 5H81A 4XEHA 1DHRA 5BQFA 1GUYA 4FIZA 1HL3A 2CVZA 2QIOA 3OF2A 3ULKA 1R6DA 4LW8A 4DLLA 3E9QA 1I8TA 3PJGA 4YXFA 2GRAA 3GEDA 3IUPA 3L4BA 3C1TA 4JLWA 4I5GA 4F6CA 4XGKA 1UXIA 5J23A 3JQFC 3ZWBA 1Y8QA 1EFKA 3GMSA 1H94A 1MX3A 2P68A 2W8ZA 4L8VA 5ENVA 3OJ0A 1E1MA 1OFGA 3FN4A 4OKNA 1YBAA 3GNQA 3PGJA 3PYXA 4JROA 4PCVA 4DPKA 4E31A 1LC3A 4QQRA 4KMSA 5KOIA 1ZSVA 5EQDA 3CUKA 1XG5A 2PZJA 4LVCA 4J3FA 4E2XA 4BNHA 2H6EA 1AUPA 1CQIA 1DIAA 3JD3A 4BNLA 3AI3A 4UUPA 2B37A 3NT4A 3RBZA 4ZJUA 5IXSA 5JAQA 2YUTA 1MB4A 1HKUA 1PIWA 2FN7A 3GNTA 3NRCA 1E0DA 2QRLA 4GQAA 4YJHA 2IZ0A 2BGMA 3C85A 4I08A 4RPKA 4ZRNA 1U3WA 1ZKMA 3OQ1A 4BGEA 1XEAA 3JV7A 1JQBA 2OXIA 3ZN2A 2HK8A 2DUWA 3F4BA 1EZ4A 2QYTA 4MVJG 4RQTA 4K6FA 4P4GA 4W9NC 2C07A 3MJCA 1WDMA 1FK8A 2DPGA 4FD3A 5FWNA 4G2NA 2AE1A 4BGIA 3JQDA 4BO3A 4YAEA 2O2SA 2HJSA 5EMHA 4BKRA 2PH3A 3FWZA 3TFQA 3IMFA 3H9EO 4QT0A 2ZK7A 3HDHA 1PTJA 1B26A 5DDIP 2I3GA 3ICCA 1UZMA 3JQ7B 1I10A 4J7CA 4DYVA 1L7EA 1XA0A 2LDXA 4ALKA 4YR9A 3LT1A 3JD1A 1LEHA 2YYYA 2BGLA 3RAJA 1DB3A 1RYEA 4CQLA 4EYEA 1R0SA 4JP3A 1LSOA 3H4VA 4HFJA 2PH5A 1EEHA 4PRLA 1ONOA 1Y1PA 4N54A 4YAGA 1B7GO 3VH1A 1EK6A 3VZRA 3FBTA 2IE0A 1CIVA 2ZCVA 4EJ0A 2J8ZA 2OP1A 2X6TA 2Y1DA 2Z1NA 1AE1A 3NKLA 1PGPA 2WYWA 5F1PA 5L7YA 3BMCA 2YDXA 5TGDA 2C5AA 3AFNA 3LT4A 3WGIA 2JFHA 3L4SO 2ZCUA 4WCFB 1DJNA 1GCOA 3GNSA 4WNIA 1KVUA 4ZQHA 4YVFA 4UREA 1UAGA 2AW5A 2PTGA 5THKA 2VYNA 3K96A 4R54A 3LLSA 1K6IA 5K0ZA 3LF1A 3ZNNA 3D3WA 3W8FA 3INTA 1FDTA 5DNAA 1SCUA 4JXKA 4JN6B 4PVDA 1CWUA 4MDHA 4YT8A 2V6MA 4YQZA 1R4NB 2PZKA 2HLPA 3ONDA 5A9RA 4FFPA 5JE8A 3L07A 3WFIA 4E5MA 3CSDA 5H83A 3VPFA 4IDAA 4GLOA 1J6UA 4HFNA 1A9ZA 1B14A 1RM5A 3AUUA 1JLLA 1GY8A 3L9WA 3I4CA 1PEDA 2JD2A 3G17A 1GZ4A 3PJEA 3PZBA 4PN3A 1XLTA 1E5QA 2XF8A 2GD1O 3HDYA 1H6CA 1Q7BA 1OMOA 3IAHA 4WCDA 2WSBA 5COQA 4BGUA 2YQ5A 3W4IA 4B79A 2FSVA 4MVJA 2XPCA 4HP8A 2B5WA 2ZB3A 2PZLA 1UP6A 1MGOA 3EHEA 2YFHA 1P77A 4AICA 1LDGA 1LRKA 3WBBA 2CD9A 3M2TA 3ZH2A 4AJ4A 4ZQBA 1OC2A 1ISJA 4AJHA 4BNJA 3JQAB 1F17A 2EP7A 3GAFA 2OOSA 4ITUA 4WASA 4E0BA 1PWZA 1Q1NA 3DFZA 3OMLA 3SLKA 1ISGA 4TVOA 1ADBA 5A05A 1JKIA 2NTNA 3DEYX 2VZ8A 2Q2WA 4IGEA 5DOZA 5B4VA 3OA0A 4J16A 3LK7A 1NFQA 2WM3A 4DRYA 4JX8A 1QRRA 4O63O 4TQGA 3DTYA 2O4UX 1M6HA 2JJYA 1C1DA 3W4KA 5IN4A 2GDZA 1YWGO 5DCYA 5JW6A 4GMGA 4PRKA 3TF5A 3AOEA 3FNGA 4MVJF 3TFOA 2QW8A 4BUCA 4FPXA 3GG2A 2NTVA 4J90A 5FI5A 3RQSA 2IXAA 4L73A 4PLPA 3BA1A 3OJFA 4XIYA 4ZHSA 4RCVA 1ZIDA 5KVQA 4UUOA 3RFXA 1E5LA 5IZCC 3DONA 4J91A 3IC5A 3LF2A 3N58A 4O0LA 4D45A 1M2WA 2UV8A 3LT2A 1Z7BA 4J43A 2NU9A 1T1SA 3DBRB 2WD8A 3GPIA 3DBLA 2NWQA 3PDUA 4WOKA 3WIEA 4E5KA 4LVUA 3BZUA 1NVTA 1H2HA 1K3TA 4TKLA 4TROA 3UFXA 3OBBA 5F1KA 4D44A 3OM9A 2J3KA 1P45A 3ROKA 1QG6A 4D3DA 1Y5MA 3AI1A 4NBUA 1Y8RA 4FOSA 4YRDA 5CP8A 2QRKA 5BNTA 3UUWA 2GO1A 1LLDA 4JGBA 1MXHA 4GBJA 4RPLA 1FJHA 4HFRA 1I30A 1DFHA 4YJGA 3QLJA 4WLUA 3PDJA 1EUDA 4HKTA 1B8UA 2BHLA 2NQTA 1PX0A 3GG9A 4I5EA 4RDHA 1Q2XA 1XQ6A 3GN2A 4CLRA 4WGGA 1LLQA 2AQKA 1ONPA 4BKPA 1W4ZA 2Y67A 2DUUA 2O3UA 3T4XA 3PXXA 1NNUA 1YL6A 4RQUA 5I7EA 5BSHA 4NBRA 4J4BA 5IDQA 1Q7GA 4NK4A 3E5MA 2E82A 4EITA 5L7TA 3DAFA 3JYPA 4RO0A 4BO9A 4R41A 2V6GA 1PU2A 4LMPA 3GR6A 5AOVA 3SX2A 1D4FA 2J3JA 3KETA 1BXGA 2H1SA 4EW6A 1DXYA 3UVEA 4A0SA 4XYMA 1ENOA 4B4VA 1XELA 3LDHA 5TT1A 1BXZA 2JFFA 4BNVA 4D46A 2XXBA 1NVGA 3FSRA 4UUNA 1YJ8A 3E8XA 2GZ2A 4O5OA 2UVDA 3ZWXA 3B20A 5EESA 1H9AA 4JBHA 4NQZA 3VZSA 1E92A 3DOJA 2OZPA 2F00A 4INAA 3QRWA 1PR9A 3JCZA 5L95A 4HBGA 3SEFA 1YOVA 3MJ4A 1T2FA 1ZK2A 5K6AC 4YJHB 1U3VA 3WMWA 4XGNA 4E33A 6ADHA 1HLPA 1W73A 5H82A 4H3VA 3U62A 5JAIA 1TT7A 2GN6A 2I99A 2ZTMA 2DTEA 3BMNA 3KLPX 1QYXA 3I5MA 3D1LA 3F47A 4FQ8A 2YZ7A 3DC2A 5AXAA 5JDIA 4NFHA 5G0UA 2UYYA 1OAAA 3TJRA 4O6VA 1PZEA 3H9JA 2A94A 3VTZA 3PGXA 2QRJA 4J2OA 4OQZA 1JDJA 1JA9A 4OAQA 4TVBA 3TNLA 2QX7A 2HMWA 1LTHR 1YL5A 4WLVA 5DN9A 2W2LA 4A2CA 1KVQA 2DKNA 1CJCA 4LCEA 1R12A 3V2GA 4BNTA 3WSWA 4E32A 4J49A 3KV3O 2C59A 3MJVA 4AJ1A 6LDHA 1FF9A 2B4TO 1X14A 4WECA 5T8KA 4CQLB 3HE3A 5JXWA 3U09A 3S2GA 2YV3A 4L4RA 3FF4A 2E49A 2RH8A 1MLDA 3W8EA 2EKLA 3L0DA 3WX0A 3GFGA 1TEHA 4IS2A 4K9DA 1NAHA 4DC0A 3JQ6A 5KTKA 3V1YA 3NTOA 1RJWA 3VDRA 1HSZA 1NQTA 4K26A 4FOOA 4IUYA 4XDYA 4TMFA 2F1KA 4F6LA 4IS3A 1O0SA
chains in the Genus database with same CATH superfamily
2WHEA 2CBXA 2QSJA 3GLGA 2FZGA 2JBAA 1X9IA 1OXTA 1TE2A 2PY6A 1JHZA 4AL4A 4DWVA 4DANA 5K1ZA 3K70C 2WKRA 1EVIA 5TNXA 3VOSA 3WA6A 2IXBA 3IP5A 1Z0JA 3LOQA 3V1NA 4NS1A 1P3DA 1H3EA 4FMPA 1KMCA 1SZCA 2HY7A 3QA9A 5CM9C 1Y63A 2N9UA 3MS7A 2I6UA 3IUMA 4D9GA 2H1WA 4QU5A 5BSFA 3D0OA 4IP0A 3LGXA 5EMMA 3D3WB 4CJXA 3WGGA 2OHJA 1RYMA 3RUFA 4W5WA 1B1AA 4J1NA 1I9CA 5DFAA 5EFOA 3ANLA 2YQ4A 3D2LA 3D6HA 2ACEA 5FOXA 2F43B 4QELA 5B1SA 4TTRA 3QGMA 3PHGA 4B6SA 2NXCA 3HKBB 4E5SA 2EQAA 4TGLA 4W7IA 3U3ZA 4AY6A 2PQ2A 1E7QA 4E5VA 5EUCA 3TD9A 1USUA 2PX4A 3ED5A 1NMYA 4BCCA 1IEWA 1VPDA 1ZCZA 2YUIA 3OMXA 3A1WA 4MVJM 4JGGA 2EW2A 4OBEA 4OV6B 4E11A 5EY5B 5E7QA 5FV7A 5A9SA 1JG7A 4S24A 2V5AA 4PLYA 3SC3A 5HSGA 3ZVRA 1CJBA 1P3JA 4O4JA 1UDWA 4I4CA 1O9BA 2Q6LA 5AT1A 1B6RA 1SC1A 4TTSA 5AHXA 1REQA 1TT5B 4GLJA 3T7IA 3DL2A 2PUGA 2R8BA 4QQKA 3RS0A 1NV8A 2E4ZA 4RFSA 3W6ZA 4XWYA 4ZHQF 3LCRA 5EJ9A 2D62A 3L1VA 2PJRA 2YZGA 4JC4A 4E2YA 4C43A 1O9GA 2OC4A 4P22A 5IG2A 3MWKA 4LF9B 5E1BA 2D0IA 1DUSA 2ZRAA 5ALVA 1I2AA 4OMDA 3TZHA 3IPLA 4XUCA 5FR2A 1QNFA 3OWHA 1TJ5A 1NF2A 2ERCA 5GGYA 1PK7A 2DHQA 1G63A 4NMWA 1CY1A 4R01A 3IAM1 1JTVA 5CGZA 5AI4A 4BATA 3VSBA 4L16A 3C3DA 2EKZA 4UM7A 3MWDB 2NZUG 1Z0FA 1WSDA 2H00A 4ZICA 4XE5A 1GN9A 2OHVA 4RK7A 3RWMB 1KI9A 3SF8A 4TLEA 2P3LA 4WE3A 3WGQA 2PUJA 3KKNA 3FR7A 3KJIA 3KB2A 2YXNA 4CUKA 1VJ1A 1ZK1A 1MO2A 2OM2A 1MW8X 3M82A 5C7OO 3P9IA 1Z7WA 2B8JA 1RLJA 2G0TA 1YXMA 4M53A 1XMIA 1T2EA 2XXAB 1KYQA 1PKEA 2CUNA 2VDQB 3RC8A 3E7DA 5LM3A 3AJAA 2XCOA 1GKYA 1MJHA 3DD1A 5GZ1A 2W71A 5HK8A 1W4RA 4LJKA 2CFIA 3L93A 2C5HA 3OQJA 5DYIA 4QPNA 1KP2A 1KJJA 3BH7A 4GPIB 3T61A 4XH9B 5CFNA 3GMIA 4OQYA 4KRXA 1F2UB 4CMEA 1T34A 1XTPA 4HN4B 3PYLA 2JRLA 4OHWA 5BXQC 1R00A 4M6WB 1BAPA 4CM9D 4BL5A 5JVDF 3LAWA 4ZVLA 2A0WA 1MV8A 2IOFK 3FGNA 3PJFA 3SR0A 1VPLA 3Q6MA 4NFYA 2QZ9A 4QDOA 1YVPA 1YOBA 2FWIA 1IN6A 4NJEA 2VNKA 2AIRA 1VE7A 3SFVA 3PNSA 3PFNA 1N2OA 2WF8A 3HGTA 2ADMA 2NU9B 4C4ZA 4E2FA 3NEYA 1F8UA 4F3CA 2KB0A 4AZ3B 4IM7A 2PA3A 4FYWA 3ORSA 4IBOA 3BQMB 1NJ5A 4MUMA 2V7XA 3X1YA 2X7JA 4IDEA 1POWA 1DO0A 2F64A 1WKCA 2ZJ3A 4IV0A 1J1ZA 1GD1O 4KMRA 4QUIA 1JDVA 3SNKA 4D4MA 4KR2A 2O8CA 2HDWA 3M6XA 2QLLA 1NE2A 4DCOA 5JQWA 1B8VA 1JEAA 1T9KA 1M34A 2CDAA 1INLA 1ECLA 1FFCA 2PLFA 2TS1A 4LWOA 5AVQA 1AQLA 4KVAA 2ZP1A 3VPAA 5KQSA 1N1MA 1WZCA 1D4AA 1T0HB 2HA5A 4GEKA 4LV8B 3LFUA 4NPCA 4UE2A 1AVTA 2DJ5A 3UH0A 3W3AD 4FK8A 2WUDA 1DO2A 2PR7A 2FB9A 2QTTA 1IZ8A 5IJ9A 3I52A 4C06A 4M8LA 2F1RA 4UHEA 2WHRA 4R1OA 2G83A 2JHGA 4EHAA 1U0BB 2J46A 3LNCA 1KZ6A 1NXSA 1ZA2A 2B82A 1N1GA 5DI3B 4RADA 2JK1A 1CHDA 3ZLTA 4L3WA 3PUJA 4ZV4A 1PYOA 3H1EA 1NURA 3ICPA 1Z6AA 3QI7A 3VC3A 4CFSA 3WLPA 1X15A 2IUEA 2IUFA 2QN3A 2GXSA 6GPBA 1XA3A 1KTVA 5JXHA 1ABEA 1ZRMA 4L08A 5DHQA 5NLLA 4E4RA 2P6UA 4HWGA 3SC2B 4DB2A 1O5OA 1R64A 3L5KA 1TECE 4I4LA 2FE4A 1DV1A 3LWZA 2RIPA 2ORYA 5JY1A 4C6SA 1AQYA 3SQDA 3FYTA 3VMFA 5I7RA 4IHJF 2P2SA 3A6HA 3FAKA 3HEMA 1BXGB 4EB0A 4EKEA 3ROEA 3HV2A 3JVDA 4BVAA 1L5LA 2J4FA 1YS4A 5CCDA 3EC7A 3WWZA 2H1RA 4KYTA 4QECA 2ISSD 4UHDA 1A72A 1NRWA 3KQPA 1EDOA 3DZDA 2JJ1A 4NIMA 4LS3A 1TUBA 2Z04A 3UV6A 4B31A 2VNIA 2X8JA 3RT9A 3L6RA 2G40A 2VJBA 3SQOA 1DAOA 1ZGGA 2ZKLA 2H7XA 3KQQA 4PZAA 5K8JB 1YT5A 2QWXA 2WF7A 2ZXEA 4LK2A 2D7DA 4UD6A 4KFRA 3SS7X 2XCLA 2VT3A 5CH5A 1MJGM 3VNAA 3AONB 1YQDA 4C4RA 1RVV1 1CLUA 2R5NA 3BB4A 3U3DA 4RVGA 3K9GA 4US0R 5DRTA 3UVEA 3D4PA 2DTXA 2UUCB 4FC6A 4HLNA 1P8JA 3WWDA 2Y68A 1V0JA 2C20A 4WXPA 4B9EA 4DILA 4JASB 5T3UA 2HNAA 5K51A 1LF5A 2AUTA 3DHVA 1O95C 5BSEA 1LX7A 2PUDA 1EE2A 1G0NA 2NUTB 1K97A 2G4CA 1XU9A 3DL0A 3O93A 3F2IA 4AZVA 1UK8A 2ZI5A 1Y33E 2P4HX 2OGWA 5BQXA 5EIBC 1NI4B 4X5OA 3BXGA 3U7EB 2CHUA 3RVOA 4JK3A 1F14A 1KSJA 4QBTA 2YQZA 1I1QB 1QGYA 2AOXA 3EDMA 5DBOA 1N2CB 4I0WB 4ZN6A 3LX5A 1MQAA 3KTOA 4KJZA 3AP1A 1P1KA 3IL2A 3BTSA 5LQJA 2XGSA 2APJA 4FGKA 3SG0A 4ARBA 3NHKA 4K2HA 4BEVA 4I5DA 4E5UA 1XWIA 4UUAA 1IRIA 4U9HS 1E3IA 1WB9A 4G84A 3RVQA 3VHXB 4S1PA 2WRZA 2PVPA 9LDBA 2RKWA 4GKVA 3C3JA 1Y7LA 5K09A 4PO1A 2LE0A 4EYOA 4W5OA 4K3UA 5DHUA 5TE9A 5KJFA 2QVGA 4X6UA 1A8QA 5KVVA 1CJVC 3D0RA 4ZKDA 1KY3A 2VTEA 1ICEA 2YBDA 3ORYA 2BCJQ 5BT9A 4NYJQ 2C83A 4F2GA 4HRXA 1WBJB 1AK9A 2UVPB 3BIFA 4GUDA 2IZ7A 2ZYSA 3KYIB 1VBMA 5BRAA 2D3TA 2ZWMA 3LD9A 1ZZEA 4E3ZA 3IOMA 1WSWA 2D7CA 1JEOA 1AK2A 2I7XA 3ON5A 4UD2A 4Z7NB 4URUR 4WT7A 4LSZA 1EK0A 3TW8A 1BIFA 1GYQA 2INGX 1SCBA 1VL2A 1BROA 2J3IA 3JRWA 3PK0A 3UUFA 4BQQA 3RC7A 3AHFA 1R10A 1U8YA 5FFFA 5DW0A 4L76A 4XI9A 4JC5A 2XT6A 1OOEA 2C98A 3EA4A 4FW8A 4OOFA 3EPHA 4G5SA 4TT3A 1I4OA 1J8FA 5G0SA 2C42A 1JJVA 4E22A 4MZDA 2N46A 3WY9A 5SYNA 3AUJB 4HGPA 4RZIA 1I0LA 4NE2A 1AZSC 1UBKS 3U1VA 4UBLA 4D81A 3OZWA 5JISA 3OF5A 4K88A 3C3KA 1IEXA 2UYGA 5JFGA 5JZOA 1FYVA 2WTBA 2WWYA 1BE1A 4KAAA 3A9VA 3IIKA 4MV1A 4BO2A 3UM9A 4L1KA 4DIOA 5PNTA 1M2OB 1U4SA 1CB0A 1XAIA 4PYMA 1CUHA 4KQWA 4ZA2A 2JJ8A 2VP6A 1E9DA 2QORA 1CR2A 2BFFB 3S8YA 3ZIAD 3ZCRA 1ILWA 2Z5LA 3EXHB 1ZOPA 4D6YA 3ZPXA 3P0IA 4QD3A 4DSUA 1SM4A 5CBPB 4JJFA 1ISRA 1EVJA 3R77A 3O03A 4KSBA 1O6ZA 3G85A 3G82C 4TKVA 2VRNA 3ZV6A 5AIAA 2HU2A 2ZBDA 1LH0A 3K9NA 3GH3A 3OAAD 2FP3A 4YLYA 2WV9A 2YIDA 3FOEC 2BYTA 2I6SA 5CIWA 3WWCA 5U9CA 3TTVA 4CQJA 2ZT7A 2EAUA 1LFDB 1P6UA 1SKYB 3ESAA 3NOOA 3ORQA 3Q87B 2R4UA 3Q0IA 4JBLA 4D25A 1E1YA 1BGXT 3E18A 3QFTA 2J0EA 3HCOA 5G0TA 4YT4A 3ZWKA 1ZUD1 3ISVA 4AF6A 4AJPA 2AX4A 2SCUB 4IIFA 2P5YA 1KDOA 1M0WA 3G2QA 5ISMA 3DVQX 3BL6A 1JDPA 4HGRA 1E2PA 4KEAA 3ZZMA 4DCVA 3IQZA 5HUHA 3NIGB 5M7EA 2Z6AA 4JV5B 4NBTA 2WSSA 4RV9A 5JHGB 4P53A 2AR0A 4QBKA 1W0KD 3B48A 2IS6A 4KIFA 3V8QA 2JEOA 2NVUB 3WYEA 1JJ7A 1NKTA 3UHAA 3LC0A 4DLSA 2K2WA 1GTJ1 3IVCA 3OZAA 1DEHA 2BZ0A 4LEIA 5FNVF 2AI1A 1QHHB 2XVMA 3G2LA 1AZLA 3QBVA 4R8MA 3ZY5A 1YQUA 1S9DA 4BVGA 1PK8A 1YZGA 3PPYA 2D0DA 2YS7A 3EWIA 3KHTA 2OQRA 4Q4LA 5BMVF 5FWDA 5LMCA 3E7FA 3WL5A 4MICA 1FDWA 4UHBA 3USCS 2XQFA 2BFCA 3CURA 3HJCA 3RVDA 2QMHA 4OHFA 4D5GA 3QLEA 4GZ5A 3ZI0A 3PR3A 3RTDA 4KIGA 1QCZA 2HL6A 3RV4A 4V24A 5EHXA 2R8RA 3RSHA 2YIJA 4LBYA 4DAEA 1JR3D 3AG6A 1DINA 2WPNA 4PV7A 1Q91A 4UZSA 3RROA 2ZCJA 1ISHA 2BM9A 4ZQGA 4R2MA 3U49A 2A30A 2FGJA 5ELXA 3FOCA 5ALYA 2COUA 4ZI7B 5LN1A 2WU4A 4RHUA 4O1IA 1SN7A 1I01A 4L07A 1G2PA 1E9RA 1K5HA 3MWLA 1WBBA 1EP9A 3BD8A 3KYCB 1P72A 2JATA 3M4XA 3O4FA 4G9EA 2X9LA 3EEBA 2XVYA 4E21A 2I4LA 2XYRA 1C30B 3O75A 2HQRA 1FRQA 2C54A 1G5RA 3TFWA 2GBLA 3DEAA 4NNOA 3F9RA 3F8WA 3O1IC 4LRSB 3UB3A 1YDWA 5B4UA 1Q1QA 2TYSB 4JL5A 4Y9DA 1HPLA 2GF9A 4AP5A 2Z2YA 2AMLA 1P9LA 1F0NA 2WHPB 3EE6A 3MK31 1AB6A 3WWPA 5GJBA 1EFDN 1RRFA 4Y2RA 1EUZA 5CA1B 5FTLA 4EKYA 4GOXA 3Q2IA 3ZI7A 1D04A 1XKTA 1M8KA 2NZYA 3O92A 2WTUA 2R8OA 4MDFA 2ODNA 3QF4A 1PGJA 4M76B 2QRGA 4K40A 1L8AA 2CCKA 2IYUA 3OLWA 5A6SB 5K6RA 5DZSA 1DPFA 4GKKB 3U9LA 1GPMA 5LCXA 2P4EA 1MC4A 3GYBA 3DE5X 1HYEA 2BFMA 1BMFD 3UOWA 3QEJA 3EUAA 4HRVA 4HJXA 4F7DA 2F3RA 4NG5A 4AI6A 3F7MA 2O52A 2A84A 5JG7A 1NASA 3UPTA 1A9SA 4HDMA 3N75A 4WNCA 2GN8A 1FNBA 3TZBA 4GPD1 3WNCA 2ORWA 1T4CA 4CLOB 3LECA 3D81A 3SKXA 4FB4A 2G28A 4WQMA 1YA8A 1G7TA 2PXCA 1XV5A 1YNOA 3VR4D 4WLNA 4LFAB 3R3VA 2W58A 3AFHA 5TMPA 1N9GB 5IJZA 4KXWA 3V7FA 3SIWA 3K9HA 3TGLA 1TZ2A 2BSAA 3EEFA 2FVXA 3MBOA 4DTIA 3SLGA 3SICE 1SQ6A 3VR6H 3HU2A 4NBSA 1OILA 2AF3C 3S27A 5L3SB 2AVDA 1U8UA 2ZUCA 1LK0A 3NORA 4BTEA 2HHLA 1KZYC 2Z8ZA 3JSAA 3UXHA 5HJ7A 3HY4A 1T2AA 2HCJB 2NTYC 4G9GA 3DEJA 4QXAA 1RBMA 2I87A 1E3SA 3ZDBA 1RC0A 1V5WA 1XJ0A 4HAOA 5B3JA 2AZTA 1U2EA 1ENYA 1E61A 3A31A 1O6BA 3NTQA 4U7FA 1F5SA 4UUMA 2QT1A 3KVVA 1QK3A 3DHNA 4L27A 3OY7A 3C97A 1OGYA 3I0ZA 3Q88A 4B0PA 3QU9A 2BAGA 3O9MA 1L5KA 1T10A 3KOUA 2DWCA 1YC2A 2POQX 4CGYA 3QNWA 3O5AA 3LJKA 3CXUA 4IJUA 5IYZB 5LL6P 3NC0C 3KPUA 5BVGB 1VM6A 2AJ8A 2Q1WA 5HCUA 4ZV9A 5ES3A 2AFIB 2EZUA 3QOXA 4D0NA 3EVBA 1EK1A 2O5EA 2OHGA 4EX6A 4QAQA 1NGSA 2PRZA 4KE7A 4NMHA 1EVKA 2VSXA 5G0VA 3CH5A 3SS8A 1GTRA 2ENUA 4OMUA 2GPTA 3RU2A 1RLTA 2TSYB 3I37X 1FRFS 3L0OA 4I6EA 3ZE8A 4FW9A 3VDMA 4I55A 1R4MB 1AQNA 2L0XA 1RIFA 2OZKA 5AIBA 5L45A 3ZJVA 1AKQA 2PZ8A 1PQPA 1LKZA 4MQFB 4ZVVA 1GAQA 3OLYA 1QQ5A 4PLVA 1IQPA 3U4GA 3TH5A 5TC4A 1J9GA 1OZ0A 3W7AA 2C4NA 4G81A 3FFXA 3TLEA 4V1CB 4XGRA 1SQGA 3SSMA 2C4MA 2XVZA 2CZQA 4ZEXA 2EJBA 4UZEA 4EEXA 1DLJA 3ABZA 1N3BA 1Q15A 4PXYA 3R7WB 5C5IA 3G13A 4FKBA 5ESRA 3DVSX 3IIMA 4WFJA 4HLUC 3RJ9A 2ACWA 4Z9YA 4NNPA 1QFXA 1RWKA 1Q7TA 5FFNA 1TTHA 2OESA 3UXMA 4A1OA 2ZANA 3TKLA 3VC7A 4UKDA 3WBJA 5K4HA 3JPYA 3GLHB 4JB8A 3VC1A 1M1NA 4WN9A 3AYZB 3K3PA 3PQ5A 1NXXA 1KU0A 3RUAA 5EQJB 4LI0A 4DR1B 3CUYA 1BQEA 3CKKA 1LDNA 4QXRA 2FFHA 4LECA 1E1QD 3JD4A 4N9WA 5LP6F 2Y0DA 3GLTA 5AW0A 3N5KA 1KBOA 1PGOA 4ZXFA 3WV5A 4XA8A 4B1FA 1G18A 3ND7A 3T3OA 2ZVDA 7REQA 5HQJA 1Y1LA 1UKBA 2XZDA 4N3CA 4QVIA 5AWFC 1FMLA 3M1YA 4Q1BA 3O3MB 1RABA 4RGVA 1VBFA 4CHGA 4EO4A 5ITZA 3HFGA 2A58A 3RSSA 4RQBA 4ZT5A 1EB9A 2K6GA 2I65A 2Q29A 2XJ9A 3K92A 4O4IB 4F97A 4K9RA 1TLTA 3FJ1A 3IBSA 5F64A 2DOKA 4EJ2A 1QFSA 1ABFA 1JU9A 1M8FA 4D9CA 4BUJA 1FFAA 3K4QA 4D4KA 3KAKA 1UINA 1CJKC 5EHIA 5KTTA 2VTBB 4DR6B 3CLVA 1N2SA 4EZBA 2GHIA 1NTRA 3R9KA 4DXDA 1JHDA 4GYJA 4D79A 4LZZA 3A25A 3Q8KA 4IXTA 1CUGA 4U02A 1XKQA 3V1KA 1NOJA 2Z5GA 2X5OA 2ZLBA 1P7VA 2I6TA 2ZSFA 1ZVMA 3MMPA 3QXXA 1K2VN 1TM3E 1SOUA 3FKQA 3HR8A 4WK6A 4CDRA 5ITVA 4CFYA 2FRVA 2H9IA 3H2SA 4DCJA 1SXPA 3EQ9A 3FG9A 3V4LA 3RUEA 4R2HA 2ZYWX 4YMLA 2XOKD 1BCSA 2IT1A 2ADFA 1XZLA 5BP7A 4X94A 1PDVA 1W29A 4CT5A 1DXQA 1Z25A 2VBFA 2YWDA 2ZYVX 4X1KA 3RASA 3PI7A 2GK6A 5CCEA 5FH9A 3A1DA 3RAEC 1RACA 4N18A 3CPHA 4WA8A 2FR8A 3EPLA 1R18A 4M1QA 2F3PA 2OBBA 4MLPA 3GQVA 3LYHA 5A5EA 4DLUA 1L5HB 2FWMX 3KR9A 4IR7A 4HJRA 1HDRA 1SFRA 3PA6A 3GVHA 2W2VA 4P7BA 4EVIA 5EWMA 4H6VA 5I7WA 1AS2A 1H3FA 1Q57A 2BH9A 2PU5A 2CNOA 4G37A 5E7JA 5B37A 1M33A 2QJFA 4AWAA 3EVTA 4P3NA 3DLHA 3KYJB 2H4HA 1KAEA 4K9SA 2FG5A 1N8TA 2JFPA 5DXAA 4DLRA 3SM9A 4B0OA 4KLAA 3WTCA 3OCXA 5G1OA 1R8XA 3A9WA 5EPUA 1F0PA 3MMXA 1I3LA 1RD4A 1SVIA 2YY5A 4YMIA 5BN5B 3U60B 3GQBA 1TU0A 1OT3A 4K8RB 3KQSA 1Z5VA 4KRGA 2EFGA 1KETA 3PEFA 1I4TD 4HMOA 1C9KA 4AWXA 4DMFA 5BOSB 3WOVA 5KQGA 2WSLA 2VEDA 3GP5A 4KDRA 3RHFA 4HZUA 2QL7A 3TTYA 4HEHA 2IU3A 1RAGA 5ESDA 2CXNA 1PZGA 4URHA 4PNEA 3M81A 3BORA 3QVKA 5E1DA 1OREA 3I12A 3QYFA 4QXMA 4CM1A 2O7QA 4L9WA 4OTZA 3CKLA 1DJMA 4Y9TA 4PZYA 3H9UA 2O8DB 4JEMA 3GVCA 3QPWA 4BNWA 4D8VA 1TKAA 3DEKA 1U9YA 4GOLD 4H1WA 2VRCD 3W5AA 3ZD7A 1QK4A 1LDMA 3N8NA 4QJ3A 2W48A 1FU4A 1F51E 1QTRA 5DBGA 2O8BA 3T3EA 1LQUA 2BSXA 1XZ8A 4Z7QB 3MEQA 2WKQA 1E94E 4QUKA 1IQ0A 1G55A 4I1RA 2NZVG 1ZU5A 3G0BA 3T5GA 4KPYA 2CNBA 2P8SA 1Z16A 2PT7A 3ZJ4A 1P5HA 2EX1A 4X1YB 2PQ0A 2GPJA 3G2NA 1IHXA 1DHTA 3H7IA 4UATA 1QX3A 2IPAB 4MTLA 1J24A 1FFXB 2I03A 1Y1KE 4WCVA 5I47A 3FIJA 3FCCA 2RI6A 5HZGA 1RHJA 3LZCA 4OHCA 5BSGA 1T9CA 3CVJA 4QPPA 1VKOA 1PS8A 3GFOA 4PLTA 4M0KA 1I2ZA 3HA2A 3MRVA 4QASA 2BZGA 2R5FA 2JGJA 5IK2A 3ZS8A 3QUTA 5A3SA 3E9NA 1A2KC 1E9VA 1KY5A 3K8QA 5BWMA 2ZVPX 1ZAYA 3L8HA 1M0TA 4GGPA 4BFXA 3HGQA 1UR5A 3EVFA 4Q9HA 3M49A 1S89A 3OIWA 3HN2A 4A82A 2Q9AA 1CUZA 2XECA 3IRVA 2JEYA 1ORRA 3HKCA 5KWSA 2ZRIA 4JKOA 2QLNA 4Q34A 4ZC1A 3UTDA 4DWOA 2BGWA 2JFQA 1A71A 2GLUA 3UJPA 4G5HA 3UJBA 1YS2X 5BUZA 3HWWA 4C01A 1VHTA 2A1TS 2HREA 3D6VA 4JFRA 5DLPA 1T8YA 2NO6A 5LXTA 3P8ZA 4FBLA 2XBUA 1FJXA 2QJRA 2PSFA 2ZJBA 2ZVQX 4TKZA 3QMWA 1FFSA 4ND4A 5K0BA 3E8SA 2OYCA 4JLOA 4MIYA 2PSSA 3N87A 2YW9A 2QBYA 2XODA 1JYSA 4N7RA 1MBZA 4MRPA 2D2FA 2VPQA 4WKBA 3DZJA 2X0DA 3WKDA 4B09A 4OH1A 2FFJA 2CXTA 4M46A 5IMSA 1UFKA 3KDAA 4OLFA 3U4AA 4R16A 2QV0A 2JCXA 4L8WB 5DHSA 1D0IA 1QH8A 3DE7X 3OLCX 4BE7B 5JMOA 3GOHA 1E3LA 1S0UA 2QLMA 5BT8A 1BVHA 2J9RA 4O2AF 3ADKA 4DEXA 4YP1A 1QH0A 4RYDA 3CLRD 2GVNA 3PEYA 5KDOA 4MVWA 1E5DA 3FH0A 5IAGA 1M83A 2ZKIA 3I53A 3QKSA 4LRXA 4N8EA 2G9NA 3JVIA 2VA8A 1EIWA 4M55A 2W6QA 1PO7A 4IX9A 1NW8A 1BCRA 2H65A 3D7NA 4P0PB 1WHSB 4ARZA 4L3OA 4PZCA 5F3RA 4U2GA 1HI9A 4Y1FA 1S2OA 3E82A 3OESA 1M2VA 4XIGS 4X91A 3G49A 4FYJA 4BYGA 4G56A 2XUFA 3TLZA 2VP5A 3I6YA 4KQ1A 4AJ2A 2HWYA 4E14A 5EERA 4EENA 4Z54A 2JAOA 2PZAA 3TLMA 2WUGA 3PVSA 4WA7A 1J1IA 2OGUA 9MHTA 4YAKA 4BVFA 5K3SA 1A0OA 1W87A 2PNFA 2G1JA 2QIPA 4ALJA 2P9QA 4EUHA 5J47A 2NP7A 1NQAO 4XDZA 1S2MA 3JVVA 3IXQA 4CMJA 3L7CA 3VKGA 5KYYB 4KIUA 1QP4A 1S02A 3MCZA 3C8MA 5FF9A 3GLSA 3CLHA 2GLXA 1EDZA 1EM6A 2PXHA 3MTIA 1RWWA 4XX0A 2RD2A 3FHTA 1VP9A 3CT4A 3G3EA 5JNSA 2A1UA 2DFVA 1ORDA 3F1LA 1O2DA 3D6FA 1K6JA 4FMCB 4A36A 2BI7A 1VJDA 2H5LA 2ZSIA 4KCGA 1Y6JA 2HTEA 3V55A 5AKIA 4OB8A 2RK4A 5IJ0A 4JOCA 4B81A 3AY7A 4B3BA 1PQUA 2H2IA 1VE3A 2FUG6 4U2DA 3IB6A 2FZ5A 3IEXA 3OOEA 1XPUA 1C4WA 2V03A 3SHTA 1N25A 1UXHA 4QOSA 5C7LO 1C0LA 1RTTA 3DDOA 2WHYA 1IN8A 4NARA 4AB1A 4JR0A 4XYLA 2ISCA 5H1YA 1QBKC 2O14A 4RDCA 4CL8A 1Z17A 3NM5A 1GILA 4JI6B 1DAEA 5THXA 2RK6A 2RGAA 1QVAA 5EVJA 5J1TB 5MN5A 1W1IA 2O50A 1T91A 1WHTA 3ZQJA 5CAEA 1E6MA 1LZKA 4KQ6A 1A2QA 3HCRA 1E0KA 4RESA 2OL4A 4W9NA 4XX1A 2B2CA 2Z58A 4HB0A 3RKSA 4N8SA 4BNUA 5ULLA 3BTVA 3IB3A 3PYMA 1F7UA 2DPLA 2IPNA 3FPHA 5CDUA 1SKAA 3BTUA 4EA9A 2XMZA 3BRQA 3N2GB 4Q4HB 4CM8B 2YX1A 4M88A 4YPVA 2E9SA 3HDTA 4RZXA 4EY5A 1TM2A 1U2RA 4G65A 3TZCA 3QLUA 1Z2OX 3SXUB 3U17A 2K7ZA 3R44A 2XQIA 3HC7A 5KAPA 4UNRA 3H1GA 2A57A 4IGKA 1G20E 3IJEB 4WVLA 2C92A 2IOFA 5KTPA 4WUVA 4YK7A 1NZJA 4F46A 4DQKA 2GJAA 3RCBA 5KBYA 2ZR0A 2BTQA 1J0BA 3DXZA 2R7MA 4LSMA 2QR2A 2XD9A 1ZICA 3X2FA 3A4YA 3ETCA 2K5UA 3GUUA 4YT2A 2J5QA 4P4NA 3C3XA 3IP1A 1NLYA 4LGCA 1GYRA 1OAOA 4YO7A 4Q24A 4E30A 3U48A 1QHXA 2PPVA 2BEUA 2VZEA 4QYSA 2AK2A 3E4DA 3JASA 1XLVA 2FHPA 1ZU4A 2Z2KA 2RG7A 4INZA 2P35A 2XEXA 5M34A 4D3FA 2HBYA 1OWLA 4R5HA 3A3YA 1CQJB 2Z1DA 1JALA 2CFCA 3HCWA 3R6DA 3U4DA 3HB9A 3VVCA 2DKOA 1FUEA 1O4VA 3I32A 3PZRA 3T52A 1OI7A 1RADA 2ZTVA 3DG9A 5JAPA 1UT6A 1S3SA 3FSGD 1E7SA 4KKXB 1NN1A 2CJYA 5I4BA 4FI3C 5L40A 3MWFA 3BCHA 4RZ3A 4YA6A 4FGSA 1NPTO 3CPEA 3DMNA 4YUZA 4L4SA 2IU4A 2GJ8A 4P9NA 1P7ZA 2O1XA 2YFYA 3PGMA 4YCLA 2CHGA 3RF6A 4H3KB 4GQIA 1SBNE 5J2TA 3GNLA 2PL9A 1PD1A 3OH8A 4Q9JA 3C41J 2F2TA 5CEJA 1XDZA 4E6EA 1ISSA 2CL5A 2H1HA 1X74A 4YRTA 2C0PA 3H17A 5B1DA 1HX7A 4NU8X 4XZ3A 5E7IA 2YWBA 4BO6A 4BE9A 1R50A 2R7AA 3KOZA 4XD7A 4AFNA 5D3KA 1ZW1A 3W7VA 1IWPB 4D57A 4BP1A 1IMOA 3D4BA 1EUCA 1S2NA 2CLOB 2CLIB 3FYUB 4HD8A 5EXXA 4MITA 4W5JA 1OKKD 3AC0A 1TYAE 3REGA 5LKRA 3KT8A 5HXAA 1EWQA 3PRJA 3D8TA 1U0SY 5AOBA 5J4YA 3V4OA 1JIJA 1KK0A 2JH9A 2SECE 4HR7A 4EJSB 2X15A 1R5BA 3A2MA 1GL7A 3LI2A 4ZPXA 1NHWA 3PFIA 2GPAA 5YASA 3IAEA 1MX9A 3VJKA 4UOQA 5AVYA 2GN1A 3LDAA 1NW7A 3OIDA 5CFRA 4DWWA 1R8YA 1Q16A 1YS6A 2QDKA 2WJ4A 3OEHA 5L9AA 3WISA 1G8MA 2W4IA 3GW8A 4Q3LA 4EM6A 1U2DA 2VHQA 3LUJA 4WI1A 5EJMA 3EVGA 2I62A 1X9GA 4E6PA 1KHHA 4JUFA 3WAJA 2X7HA 3GXOA 1V5EA 3O2NA 3QUCA 4CMEC 4IKPA 1KO1A 2HOQA 3RH0A 2QQGA 2H08A 1YDGA 4QUDA 5FBQB 1JLSA 1XBTA 1TPZA 2FW8A 4BP9A 3O3OB 3LSTA 2H8KA 3U3XA 4S1WA 4HVCA 1UT5A 1KNXA 2ZG6A 3Q4GA 4ILKA 4CETA 2Z83A 4N9QA 3RU7A 1UBHS 3KQLA 1J07A 2XRFA 4PZPA 1GN8A 5DM60 5JBQA 5LB2A 5AO9A 1CUEA 1FMJA 3KU4A 3C4JA 4CKXA 4EUSA 1RXIA 4QEZA 1GPJA 3HM2A 3KWJA 3PD7A 3W5CA 3A58B 2EJCA 4RBNA 4DMRA 5JH7F 1ZCJA 2IYYA 4U2EA 4DIKA 4JT9A 2FEWB 4PYRA 3DD5A 2ZUEA 3NNDA 3RSLA 2CLLB 3EGXB 3UWKA 4CLXA 2C2MA 2REQB 2BCEA 3RC1A 2GUGA 1BWRA 1ZVVA 4JJ4A 2JZCA 4G8DA 3SPXA 5CJJA 2OCBA 1I2CA 1IBCA 5A62A 1A04A 2NTEA 2H0RA 2O2IA 4M0DA 3CU5A 5G1NA 4RM2A 4NHEA 3QMVA 1PK9A 4R4JA 3Q9NA 4CRWB 1CRLA 1G7CA 1GPWB 1AHIA 2IDMA 3TRIA 2QGZA 1CNMA 1GPAA 4IVNA 1TTQB 1YZKA 2Q5QA 1UOPA 2ZR9A 3IDFA 3TW0A 4BX9A 1RC8A 3K0CC 2Z95A 3NQ41 1RLOA 1XD2B 3GJYA 3N2IA 3PDHA 4RX1A 2QRZA 4KR7A 3ZCSA 2JGNA 3P2YA 2NW6A 4YCDA 3PHJA 4A6EA 2HA6A 3R0ZA 1P0QA 1VPTA 1CUIA 4KNWA 3ZV7A 4C0KA 1TEXA 1T13A 5HF5A 1I6MA 1V3UA 5AW1A 3IHTA 4Z6KA 1B3RA 2XMPA 3VSCA 1AZTA 1GEEA 2RC6A 3QENA 5D01A 4WERA 4W5NA 1WPXA 5ALLA 4MLDA 1QRTA 1GQFA 3K05A 1Z18A 3L41A 1V5IA 4W4TA 1BOOA 1VXOA 4MWCA 2XZOA 1QO7A 1A69A 2CJFA 2V7QD 4N82A 3T3IA 1SCKA 2WF5A 1T8UA 1JKJA 1XJCA 1OBCA 2RH9B 3L05A 3QKWA 4CM4A 5HKAA 3GFBA 3MWEA 3W1WA 1OFUA 2BFAA 2QX9A 2W6OA 5ENDA 2O20A 4NZZA 4XGIA 3V3TA 2P9HA 2DFLA 2HPAA 4BN0A 1AKEA 4FFDA 3D5QA 4BX0A 2WWIA 3T3HA 4LDAA 2E87A 1V2HE 5HPYB 3QEAZ 2OAQ1 2GBPA 3NB0A 4NWIA 1ZK3A 3VR6A 4TQAA 1SVNA 3HCPA 3SOPA 2C2BA 1R1DA 2NM0A 1JRLA 3NASA 4RD2A 1QUEA 4TN5A 4JJEA 2Q0QA 1Q1GA 1W5BA 2VJAA 6CHYA 1QVRA 2B8TA 5JTUA 4D8UA 3VR3D 4IRMA 1CC1S 1W4BA 1NQOA 1Z0UA 2J85A 4R1TA 2RAFA 4NABA 4B3XA 1P1RA 1CUYA 4NV1A 4TMVA 2P2NA 3KX2A 5DTQA 2IEAA 1JE0A 1F8YA 5TLSA 1YJAA 2RHLA 3GJ6A 5EJGA 2QKYA 2JAUA 1OYYA 3OKFA 4PSCA 1ZUNA 3PHBE 3A9SA 1UAYA 3KR0A 3Q7PA 3TKAA 2UZ4A 1TM4E 1JHOA 5FADA 1UKCA 3G8AA 3RJ5A 3ES9A 5E6SB 2G88A 5J1SB 3B6KA 3K0AA 4OP1A 1C4KA 2KE5A 4LFBB 1I51A 4JQSA 4JBIA 4RMNA 4DMKA 1VHDA 3CJRA 4X00A 4X93A 5DGIA 3UT5B 3ZWCA 2DPMA 5A3RA 2PT6A 4RY0A 3E48A 4F4DA 2Q07A 5BW8A 2I6GA 2QQ0A 3O91A 1AA6A 1XRJA 2GJKA 3NAQA 1Z6TA 2QRHA 4IDGA 4MB0A 2IXTA 3TR6A 4YRKA 1VHLA 1BJKA 7YASA 5HM8A 1TJYA 4HTAA 3TLKA 1JPNA 4EPRA 3OFNA 4M0CA 4MH0R 2RHCA 4PYQA 4CEJA 2HSEA 1ZCAA 3NEJA 1C3EA 4WACA 2VTVA 1JEJA 1ZXBA 1E9BA 1N7GA 1QWSA 2WOJA 2X42A 4PQFA 4RWZA 3WLIA 4MUEA 3IGFA 2LW7A 2OORA 2V54A 4XPZA 4DY6A 5LDHA 4DV2B 3RFCA 1A8SA 2O0JA 1I4WA 2VFAA 3SXJA 1KTIA 1L5YA 3GA0A 3HCDA 3IE1A 3EXEA 1GL9B 1VIDA 3FCEA 1W0CA 3NBFA 3LY7A 5HZKA 1TQ4A 2IOYA 4YT5A 5K6AA 2E4WA 1PEYA 3VZQA 1PKXA 1PSDA 2JLRA 5A4DA 1KEEA 3LA8A 5L3QA 5CVCA 1YK1A 3EXAA 4AF8A 4MKRA 3SIXA 2OY0A 5EZYA 4UDYX 3W05A 1UBTS 3KALA 1G16A 5D1HA 4I1PA 1RI2A 1DS6A 4EPXA 2YASA 3T5CA 1U6KA 2HK7A 3IDQA 2Y05A 1H66A 5H3HA 5GONB 2QL6A 1V1RB 1BHQ1 4RVCA 1AGYA 4QAJA 1BXRB 1MTOA 4OHBA 2XA9A 2HU7A 5ICCA 2O8FA 1XC7A 4IFEA 1JNYA 4M9UA 1XAHA 4KL8S 3QSYA 3GLUA 3QJYA 1GKIA 2P65A 1PR4A 3WADA 5I9SA 3RG2A 3TE6A 2VK2A 1NFRA 1OUMA 1COZA 4Z53A 4F45A 1TQHA 3W6OA 3IALA 2V8BA 1EJ0A 1MO6A 4COOA 2MINA 5EG5A 1YKSA 1B76A 2IW1A 3H75A 4LDQA 4XAQA 2PGLA 3V3KA 4ENRA 2RGUA 2C2OA 2EHDA 2MYTA 4XRGA 1ZMXA 4DBLC 2R1TB 2VK4A 3FRHA 3Q3HA 4B48A 2X4GA 4RTKA 3ROFA 3ED1A 1T6ZA 2I1LA 2VHUA 2XEDA 4XYBA 3T7SA 5EYPB 2OD7A 4G4JA 2G76A 1E6WA 2WU8A 3A11A 1JQ5A 3P9XA 3VBCA 1Y1QA 2R00A 4N65A 1K06A 1WXGA 1DT3A 4K0RA 4N0QA 2I1QA 1Q1EA 2P4UA 3DOEA 1EE9A 1QMPA 3E9ZA 4FBGA 1T6NA 1VJ5A 4NCXA 4RV5A 3SGLA 1DKUA 1UJ2A 2BKVA 3TL2A 5I45A 3TG2A 4N6NA 5DKFA 5SY9A 1EUYA 2KM1A 1BWQA 1EM8A 4PHHA 3DFKA 2PL1A 5A2QA 2BKUA 4KWCA 1QIFA 1HM5A 2P2DA 2WI8A 3CE9A 3JYLA 4J94A 2OC9A 3N2EA 3JSXA 2ECFA 3WMEA 2CWDA 1GLVA 4IDNA 2RJOA 1YB1A 2AG6A 1KVTA 1IB6A 1M5RA 4KR0A 4C5CA 2XKBA 4B4WA 5CB6A 1ZSNA 5I5GA 3DPSA 4DMUB 1N5OX 5CTJA 3ZHOA 3L4JA 3LBFA 2GEVA 3IULA 3L8DA 5EP2A 2NYAA 3A1NA 3W77A 1ACJA 1B6SA 1RHQA 3D43A 4XYGA 3THRA 3O8QB 3EMVA 3IPAA 3WGHA 4EEKA 2H48A 1J97A 2EDAA 4MQMA 4OJKA 1XRQA 2DTDA 4OFZA 4K0KB 2BEVA 2KWIA 2PMDA 1E3WB 2X2EA 1IC6A 1HETA 1UBRS 2AF4C 2CLFB 2VAMA 3LW7A 3MTBA 4M21A 4CLEA 4KO8A 5A02A 5C46F 3DP7A 5JPCA 3H97A 5LQKA 4J7UA 5JALA 4XQ9A 1W35A 5JMWA 3IMEA 2IP1A 3IPCA 4OATA 2VH2A 4BP3A 4AY2A 3RSQA 4UQOA 1U1CA 4ZK6A 5AVZA 2BFDA 5CM2Z 2ORVA 3HP7A 2C7BA 3VAAA 4BJ1A 1Z6XA 2W6JA 2VHEA 3GC6A 3THWA 2HIHA 4LWPA 1XCPA 3U2QA 2PGDA 6AT1A 4DQLA 1K7CA 2GBLC 1A9QA 4DOMA 3PC3A 1H1LB 1PNTA 5D8DA 5JD5A 4DCMA 3QV2A 1XDUA 1HQKA 3DZBA 1QZZA 1RE0A 3CZ9A 2WVJA 1GRCA 3U7IA 1Z6ZA 3HBMA 5BYBA 1VMAA 2PK3A 2WZBA 4DPLA 1YJCA 1ZYUA 4G67A 2WPDA 1MJ5A 1SEVA 1XXLA 1LBEA 3VR4H 2H06A 2WTAA 3NMUF 3HSSA 1H1TA 3H5RA 1Z4LA 2X8LA 1U0OC 3C1UA 2PGJA 3K5IA 5KYUA 2OCLA 3DNFA 1V16B 2PKYX 3BHJA 2VJPA 3S2ZA