5CG9A

Ngtet1 in complex with 5mc dna in space group p3221
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
267
structure length
267
Chain Sequence
HMINKKSLLQNLLSKCKTTFQQSFTNANITLKDEKWLKNVRTAYFVCDHDGSVELAYLPNVLPKELVEEFTEKFESIQTGRKKDTGYSGILDNSMPFNYVTADLSQELGQYLSEIVNPQINYYISKLLTCVSSRTINYLVSLNDSYYALNNCLYPSTAFNSLKPSNDGHRIRKPHKDNLDITPSSLFYFGNFQNTEGYLELTDKNCKVFVQPGDVLFFKGNEYKHVVANITSGWRIGLVYFAHKGSKTKPYYEDTQKNSLKIHKETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Naegleria Tet-like dioxygenase (NgTet1) in complexes with a reaction intermediate 5-hydroxymethylcytosine DNA.
pubmed doi rcsb
source organism Naegleria gruberi
molecule tags Oxidoreductase/dna
molecule keywords Tet-like dioxygenase
total genus 87
structure length 267
sequence length 267
chains with identical sequence D
ec nomenclature ec 1.14.11.n2: Methylcytosine dioxygenase.
pdb deposition date 2015-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1640 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cg9A00
4LT5A 5CG9A 5CG8A
chains in the Genus database with same CATH superfamily
3O1PA 2CGNA 3TYJA 5JOZA 1QKQA 2VC9A 1WMXA 4BCUA 1MPXA 5LB6A 2WR9A 3HQXA 1COV3 4INDA 5GJ6A 5A3TA 3A7QA 4PLMA 4BB3A 2CAVA 3K77A 4WVZA 3WCSA 5F32A 1OA3A 4DPNA 4KWJA 3R05A 5FZ8A 4CUCA 2XVLA 1F4HA 4P14A 3MHZA 3POJA 4QDQA 1QJY3 2HYXA 4U36A 1KEXA 1RUJ1 2DCTA 2ZGSA 1RUE2 3OPZA 4FVVA 3ZKUA 5A3LA 3O1TA 1G9BA 1CX1A 1J3PA 5FMOS 3PIJA 1OOPA 4LULA 2K2SA 3I3DA 4CEWA 5ACA2 4Q4Y1 1OA2A 1VBB2 4ZZ8A 5FXVA 4D7YA 5J09A 5F9TA 1KS4A 4YW1A 1POV1 3AKQA 4GA9A 3QBQA 4L92A 3GDBA 2VW1A 2WABA 4Y1YA 4ASKA 2P2KA 3DXTA 4COVA 4CP9B 5KHIA 3TEWA 4LBJA 1CVNA 1ENXA 1OH3A 3OY8A 3UT0A 3C2UA 2JX9A 2EXJA 2L9LA 4BQ5A 4ARYA 5FXXA 1JYVA 4U2AA 3EB7A 3L2YA 4Q4Y3 1HN1A 1X82A 3VBUC 4OI4A 3LB9A 2E7AA 2VZUA 3KLSA 5AFEA 2EAAA 4XJ8A 1J58A 1VRH1 2A73B 2C24A 4LQRA 4YM3A 1VRH2 2ZGKA 4NVPA 2WINB 4XQDA 1RMU2 1RHI2 2XLGA 3VBFB 3ZN6A 2PHTA 1K5MB 4MGYE 2PAMA 4MSVA 2V5DA 4YGCA 4EWEA 1FOD3 2WZEA 5J7MA 1XXNA 3SXWA 1Z7S3 5C8CA 3LOIA 3KV5A 5DPNA 5I0UA 1CIWA 1COV1 1UY0A 1LOEA 3B94A 4NIGA 2E31A 1LCLA 3HAGA 3KGLA 3BTAA 2AACA 1BEV2 3ENRA 1PO23 3OD4A 5CFCA 1G9DA 4XAEA 3JUUA 5LRSA 5JXIA 3POEA 2GH2A 2QQOA 1CAVA 2KXLA 2YFUA 4GH4C 5FIXA 3PJQA 5A33A 3GGLA 1SCRA 5GZFA 1IQDC 2YV8A 1SPPB 5SV5A 2ZAHA 5GLTA 2FDGA 1OUSA 5L19A 4ZXKA 3EO6A 1FV2A 3ZFEC 3WDXA 3AZXA 2QCSB 4GJZA 1JU4A 1RTVA 2XWJB 2Q4SA 3NO8A 1PK6B 4IE0A 4LO6B 4JGYB 1RUI3 3B69A 4LO8A 4MGKE 1RUE1 4O9EA 3LFIA 3ZPYA 2B45X 2A70A 3H3UA 5APAA 1N1TA 1RYYA 4RGGA 3SH4A 2YGMA 2ZGPA 3MFAA 4CXWA 2IC1A 4UYBA 4YZ2A 5C71A 1KXGA 4GB31 1D2QA 5JSPA 4MOAA 2JIGA 3ZM8A 3AYCA 3RSJA 1UO9A 2VVEA 1XRUA 2QQMA 1EP0A 2VJXA 3RNSA 2RJKA 3FWEA 2DVFA 3FUQA 2XWBB 1RUG3 2FMYA 3DYMA 4FFGA 4PHZA 1ND3C 5KXCA 2JKXA 3SEEA 4V1PA 1Y9QA 5FYZA 5IAVA 2W9XA 1UKGA 3FZ3A 3MLKA 1BVP1 4FI9A 4IERA 3ZFFB 3WNKA 1BJQA 4BIFA 3N9PA 5JSRA 3BOPA 5DZGA 1W9TA 3M3CA 1BLZA 3JBG2 1GWMA 3O0VA 3LIGA 2RS12 2JE8A 4UFMA 4YVSB 2PHLA 1O4TA 5FP3A 1QHDA 4IV3A 4QHZA 4XPVA 1LHNA 5K0UB 1Q8QA 2VBDA 3SCGA 2WS93 3PIGA 4WVVA 1X36A 1G8WA 1ULDA 3RRDA 4HXCA 1DQ4A 4XJWA 4ARXA 5B4XA 5IVEA 3RZLA 4AGVA 4V2VA 2ZCWA 2TNFA 1AF9A 1OC1A 2GSYA 3T2TA 3AYDA 1LU2A 3TN92 5GZCA 1GOFA 4R9CA 3N35A 4RQPC 2ZX1A 1DDLA 3LIHA 2DV9A 2VW0A 2WQ4A 3ST7A 4CEYA 3OG2A 4ZPIA 2WO7A 3GF6A 2F4PA 3F2ZA 1V9U3 3PNAA 2V09A 3OTFA 4CUBA 3BTYA 1C5IA 4FXGB 1ND2B 1LECA 4FFHA 1NLRA 5FPVA 2OZJA 1OMIA 1AR81 4RGAA 5JZGC 4D6RA 2RHPA 1AR83 5JPMB 1NQDA 4C8DA 1QJU3 2X5IB 3VBOB 2J1RA 1CPMA 1FOD1 2YBSA 2RMU2 3FFQA 2C6SA 1MEC1 2D7FA 4A41A 4IXLA 2NLRA 3CF6E 1OQ1A 1OT5A 2MEV2 1XNKA 1OPMA 2VNOA 1WCDJ 5LEKA 2BWCA 3O0XA 1JHJA 1GNYA 1MQTA 3CDZB 3VLBB 1FV3A 1VAVA 3DECA 4PBOA 1BZWA 1GWLA 1HIXA 3DKQA 5J1XA 4QX3A 3BODA 1H8TC 4JQRA 1C28A 5FRAA 1ND2A 3QD6A 1R1ZA 4WV8A 4CU8A 2XQRA 2C5DA 2BU9A 4PLNA 4QKBA 2QQPA 2VMGA 3THDA 3TOJA 5FZMA 2D6NA 3O1MA 1E5HA 4AI1A 4BA6A 4GMP1 1QH6A 1OLRA 1P8JA 3GBGA 3I2HA 1B35C 2J42A 5FPAA 2PAEA 1HLCA 1OKQA 4HZFA 5F6LB 4DUWA 3GJBA 4LO7A 1PZ7A 2A71A 3MIBA 2YU2A 4Q0QA 4X6RB 4YG3A 4XABA 5IK7A 1YI9A 1UOBA 4JGZA 4XDQA 1WWYA 3D3AA 1W8OA 3SC7X 1H2MA 4O9GA 1UIKA 1WBFA 1PX3A 3B3QE 3OY8B 3NL1A 2NPIA 2DCJA 1HV1A 4C0BA 3GM8A 4JHZA 4EN7B 1FT9A 3SEPA 3AKRA 4CVUA 4XUPA 1M4WA 4X8PA 5D8AA 3WZ1A 1RVF1 2BZDA 4A4AA 1CIYA 2ZTNA 4I0WB 4CCJA 2R32A 3J7HA 4OMDA 4AEDC 4JRLA 4F3JA 1N47A 2BEOA 5D21A 3MFCA 1QOOA 4GWMA 2UWBA 3ZYBA 5IATA 2HWC3 1AL21 4OUEA 4CDXC 3W5MA 1KJLA 2BRTA 1HW5A 3ACIA 3AVRA 3GZAA 3HN1A 2LM3A 4YW5A 1HV0A 4D69A 4QM8A 3TEXA 2E32A 4XTMA 4GQ7A 4HANA 2ZPXA 5T3NA 1JYWA 2E51A 1HRV1 2A5ZA 3SKJE 1PO13 1ST8A 1CAUA 3O14A 4R9DA 4CA9A 3AXDA 3SITA 3WT3A 1FAYA 2RS53 4DQAA 3SNMA 1NA1B 2KM2A 1FX5A 4J6GA 4B7EA 4COUA 3IAQA 3LDKA 2VD7A 2RE9A 1I1EA 3J9SA 4W4ZA 3WD5A 1XYOA 1YHFA 2A3XA 1H0BA 5J37A 5LA0A 4CZSA 4CUGA 4HL0A 5CKNA 2UY8A 3HJRA 4CP0A 4EV0A 1RUF2 5BNPC 5GM0A 1UPSA 1Y3TA 2R062 2G9FA 2VXRA 2Y33A 2YXSA 3E6BA 4QPGA 3TAYA 5BNNB 5DN2A 3H7JA 1DP0A 1TNFA 3U4SA 2Q0AA 5FYUA 3E5QA 4M0NA 1SLLA 1N3OA 3O5SA 4X6QB 5FPBA 2C26A 4ORFA 5KR7A 1W0OA 2OUJA 5E89A 4XURA 4BK5A 2FCTA 1UOFA 1FNZA 2ZZQA 2HWC1 3ZSKA 1SFNA 1UY1A 1DLCA 1Z78A 3MIDA 1YWKA 2Y34A 3W58A 3TEYA 1EV13 3M1HA 2N7GA 2VCBA 5KXDA 1QDOA 1WLDA 3FLPA 3I3EA 4FQ4A 2D93A 4AHYA 3KB5A 3ZDVA 3HNMA 3OF1A 3VB9A 2VVFA 4NIAA 3DCQA 4PI2A 1L7LA 1US2A 4LK7A 2GN7A 4FQZA 4L2NA 1JHNA 2RS13 1GKBA 1OSGA 2YDEA 2HEWF 5BYNA 3M3OA 5BNNA 4I09A 1MS0A 2I74A 1PGSA 5J98B 2Q1ZB 4A2UA 1AL22 1HX6A 4NE9A 4AYUA 3BU0A 2Y26A 5FYTA 1ODNA 3C7EA 5DAVA 5F5QA 3ZMOA 4A6OA 4YZ1A 3RZHA 3DN7A 3WG1A 1R64A 2ET7A 4JZRA 2GMPA 1AL0G 3T0BA 1IS6A 2J7MA 2BOIA 3DL3A 3G7DA 1OQEA 4BH9A 1W03A 5F7UA 4H14A 1VBD1 4MH0E 2JDYA 4RYDA 2P17A 4XILA 3UYJA 3SLIA 1ZX5A 3OGJA 4B8EA 2ZGNA 2ZZJA 4AOCA 5FYBA 5FZ1A 1RUD1 2YC4A 1DF0A 3VKFC 2YU1A 2BNNA 2KD7A 3KHCA 1VBC2 4YVWB 1UU6A 3CJXA 4QKNA 4DS0A 3O12A 4YPJA 2WDBA 1PVC2 2NN8A 3KGZA 5FLHA 2WYFA 4QKFA 1UIJA 1VP6A 4K20A 1VAMA 1VE0A 2BDRA 2D3RA 1WW7A 2GN3A 4KBBA 4O65A 5FKBA 5FZKA 1UW8A 5A7WA 4OVEA 1CD3G 3BUCA 2VMHA 3HD8B 2ZMKA 4L9BA 4N53A 3BTZA 1O5UA 2BOJA 5HCBA 5ABJA 4QT6A 3FBMA 4A7YA 4BZ4A 3T0AA 4FPJA 1TME1 4AEDA 5DDJ3 1OHFA 2BFUL 3I49A 3NSTA 1OH4A 1S4CA 4QPIC 3A22A 1K5JA 4Y22B 2WQ8A 4ZU5A 1PNGA 1PZ9A 1V9U1 1G9CA 5GLVA 3J4UH 3QH6A 4L8QA 4W6WA 1W05A 5E8AA 4XBLA 3WY6A 3C7HA 3ZO0B 3HWJA 3KQ4B 1JU3A 5LCWL 4HKWA 4N7UA 3RI9A 1XSQA 2R30A 4MGZE 4BISA 2Q8CA 1QJEA 1TQ5A 1WD4A 5A7WB 3VBHC 2ZOEB 3BIWE 1DGLA 3D0SA 5GZEA 4OI0A 3IMNA 2ZGQA 4JGYC 2Z2SB 3I59A 4V2WA 5H9RA 2WO3A 4QD2A 3SCFA 5IFTA 1HB1A 5IYYA 3UNPA 1RUNA 5ISLA 4BQWA 5A1LA 2YBKA 4LEJA 5FMOL 2XVGA 3RJ2X 2UURA 4CDWA 4OLLA 3I3MA 2I07B 3J7NA 4AHZA 5IFPA 5B2GB 3GYDA 4HMZA 4AEKA 4E8DA 1G9FA 3AZVA 4DINB 3M3IA 2JE7A 2Y0IA 4NUBA 1C3HA 3BCWA 5FUNA 3S5QA 1UL9A 1YRZA 3J26N 3D8CA 2YPDA 3PUSA 2VZOA 5FZCA 2WWJA 2GP5A 2WKKA 3I8TA 4GWJA 3NAPB 3CIHA 1XNTA 4UBHA 4PBPA 1ZZBA 3ORJA 2Z79A 1W2UA 4BPZA 1OQDA 4L11A 4F7ZA 5AC93 1RHI1 1VMJA 2MEV3 1LGNA 3RMXA 2FDIA 2XL7A 2D40A 2VQ0A 4UFKA 4YVSC 3PU3A 4AL9A 4DIQA 4TLGA 4XJAA 3WDVA 2DCYA 1SBDA 2WNVB 1AR63 5D8AB 3U07A 2FMDA 5FP7A 4X8NA 4HN0A 1QXRA 3PL0A 3ZYIB 4M3CE 1G86A 3MLJA 1HB3A 2NP0A 3ROUA 1NCQC 3BGAA 4N7IA 1KITA 1IGOA 2Y38A 3USUB 2VPVA 2Y60A 4C90A 4MG2A 5KBFA 3FMGA 4O7XA 4E2QA 3M4FA 5FOJB 2HWD3 1JI6A 4RQPA 1NCQA 2V4AA 1L7RA 3USUA 4AFCA 4BQ4A 3T4HB 4ES8A 4C1XA 2RJ2A 4QM9A 4XUOA 1MS1A 1CQ9A 1QU0A 2WT1A 2UYBA 4G9SB 4YFWA 1O3TA 1YIFA 3MEPA 1ZRFA 4QPGB 1W2OA 3OCPA 1JUIA 1TVGA 5DAPA 4BJ0A 1J84A 3I7DA 5JXJA 5A7NA 5EWSA 2CHHA 3NKTA 1V6IA 4DB5A 5A32B 1GQGA 1UYXA 1GR3A 2W1WA 5HCAA 1TMF2 2JKBA 2QQKA 2EIDA 3MLLA 3S5AA 1ASJ3 5GLWA 1DGRA 1NA1A 1LOAA 3ACLA 3WF2A 2RDQA 3N9OA 1HXS2 2VOWA 3NJXA 3TRSB 5BNOA 4FXKB 3OYWB 4XTPA 1I5ZA 1KFUL 3WNLA 1ZBE3 4MX3A 4YG6A 4DO0A 4XJ9A 2VOTA 3T3YA 1WA4A 1REFA 2RV9A 1ZRCA 3RQ0A 2JG8A 4D94A 5L7OC 1G9AA 1ULGA 4CP1A 4CTEA 3N4MA 2XJSA 1X8EA 4LUMA 1WCKA 2K0GA 1LAJA 4Y26A 1C57A 2YG0A 3OSDA 3HNBM 1W9SA 3N7KA 3VDDA 4AHWA 4QMAA 4M0HA 1LHWA 1XE7A 4NRMA 3WP4A 4ONUA 2W87A 4WM7C 3OUIA 2IXKA 4AFMA 2OT7A 2XJPA 3KD4A 1UMZA 1JODA 5IHRA 3ZDSA 4XF9A 4UW4A 1E5IA 2I2SA 2D98A 4Y22A 5LASA 4A42A 4ZZ5A 2X29A 1WUVA 1SBFA 5JIUA 4DMIA 3I3BA 3ZR6A 3P1IA 1GICA 1UCXA 1AR73 3VL9A 3D6EA 5FV3A 4E4ZA 3D0JA 1LU1A 3I2GA 1ALYA 3HBKA 1W3XA 4IV3B 2OX0A 4JGZB 3CQOA 1PMIA 3VKMA 1W28A 2R071 4DUXA 1W6NA 4K7JA 1LRHA 1GYKA 5A7QA 3TWIA 4E9KA 4YFZA 3VV1A 1FPN1 1XNCA 5F39A 4IEPA 5C8CC 3NNJA 2Q1MA 4MYEA 5IUQA 4Q2FA 1IOAA 1QDCA 4N90A 3O1VA 2A1XA 5C4WA 4BXFA 1CZVA 4XW3A 3I4IA 3GHMA 1OVPA 4LHNA 5LY1A 1HB2A 3PU8A 1LJ7A 2HWE2 3WQ7A 4AZZA 5FYCA 2XOMA 3WXPA 4E8CA 3LA3A 4A7ZA 3LA7A 1D4VB 2JG9B 3ZFGB 1ULPA 1W9FA 1MQTB 1ODMA 2R0FA 3I2JA 4K8FA 5D1IA 3UK9A 3B01A 4G3YC 4FPFA 4JX0A 5A3WA 3PVBB 5A6XA 4YGEA 1H2KA 2ORZA 4N8MA 4FPEA 3VD5A 4YZ5A 3VBOA 5FYIA 4AFDA 1GZTA 1LNSA 5L73A 3JZVA 1GBGA 2JDNA 5L9RA 2AEYA 1OOPC 3V64A 3B9IA 4QAWA 3ZSMA 3E6CC 1ZRDA 1H6XA 3POGA 3DUIA 1I6XA 2VNVA 1MS5A 4UXAA 4YZ4A 3J7LA 3M70A 3UV9A 4LHSA 1STMA 3MV11 4RFT0 1H9WA 3WF0A 3MZHA 2HWE1 5I0SA 2J1TA 4P5HA 4N43B 2K46A 4KMQA 3VZLA 1Q8PA 2VMDA 2VZVA 3FL7A 2B46X 1B09A 1N1SA 2ZX0A 4RN5A 4UW3A 3ZIXA 2JXAA 5CADA 1FMD2 4IUGA 3VBSC 4NHXA 2ENRA 4HK8A 4AWDA 1GP4A 3MW3A 1VBD2 3H8UA 4Q4W1 1K45A 4MGIE 4BWOA 4GB33 1UX7A 1BEV3 1I9RA 5K0UA 4LORA 2WT2A 2D6LX 4LBQA 1W0NA 2ETEA 1N1VA 5I0TA 1COV2 4I3GA 2WNUA 4JC1A 5FZFA 1LTEA 1CN1A 2HWB3 5FK7A 3P6BA 2J22A 2WO1A 4LUKA 1TNRA 1YNAA 1RINA 4UAPA 4MLOA 5F3IA 2PELA 2VQUA 4NMIA 3MUZ1 2Q8OA 2DU1A 2ZX2A 1RUI2 2WFF2 1EPZA 1PO22 4W8JA 4ATEA 5HV4A 4LIUA 3W20A 1PM7A 4NROA 1FATA 1NE6A 3IZOA 1PNFA 3H3ZA 4S2HA 4CRQA 5IT6A 2JICA 1ZBE2 3VZMA 4BYYA 3Q9OA 1POV3 2DVAA 1ZZCA 2ZGUA 3OGGA 3UKVA 2YBPA 5DZFA 3G6JB 4IESA 4XBNA 2JDKA 3U78A 4HVOA 1KDMA 3OGRA 2D3PA 4WVMB 1AXZA 5FYHA 1QQP2 1SLCA 1PGW1 1UY4A 3UJOA 5C4WB 4TTGA 2YMZA 4Y3OA 4QX7A 2IXCA 3KCCA 1EYBA 1AR72 1PM4A 3CO2A 3AYAA 5E6HA 4P08A 1W6NB 3AMQA 2HKXA 5B4NA 1UKRA 1UOJA 2IVJA 4J25A 2P6HA 1V6JA 2PYTA 3F95A 3WSOA 2W46A 5JMOA 2V72A 2RG4A 1BKZA 3E5UA 3FLTA 4KGQA 3K3OA 4CP2A 1JYCA 2ZX3A 5F5CA 2ZBJA 3VDCA 3JB8A 1JZ2A 1RVF3 4ISRA 1BHGA 3SCHA 2V5YA 3JB4C 3LDBA 2W94A 4IL7A 5EPAA 2P3JA 2RM22 4PDWB 5DG2A 2H6BA 2WS92 3OEBA 2FZ2A 2EAKA 4S2FA 3ZXLA 2XKPA 4HK9A 4CDUC 4AE2A 4RS5B 3AP7A 2AZ5A 2XKOA 3ZXAC 5IK8A 1C8M2 5JIAA 2WRAA 5A3UA 4EWAA 1APNA 1ZYBA 2ZJCA 3AMHA 2GNMA 1ASJ2 4LE4A 3LZZA 4JDMA 4HONA 5ANNA 4KU8A 1IPSA 4XVHA 1NX9A 1RUE3 2GMEA 3T08A 1RUC1 3OYWA 3VD3A 4GJYA 1NY72 3ZYJB 1EAH2 1UZYA 3ILRA 4XC9A 2YGLA 5I0RA 5EYYA 1JN2P 4OULA 3V0BB 4EN6B 3OGVA 2QDNA 2EICA 2VU9A 2GC3A 4QHBA 3AP9A 1QJX2 5FO9B 1IG3A 5HV0A 3IT8A 1UYYA 5KHHA 1UF2C 1Q8SA 2F4LA 1UY2A 2QQLA 4Q29A 3KT4A 4RS5A 3WP3A 3K46A 1SLIA 2BVBA 3KSCA 1DGRN 4XIKA 4AVCA 4Y33A 1KD7A 1JBCA 4ZY9A 3OOXA 1K5MC 2BJSA 2E33A 4MGSA 4KG8A 1Z7S1 4YG0A 1W6PB 1AYN2 4PDWA 1UD1A 4CSWA 4HETA 5A6QA 1NCRB 4A45A 3WINE 2OW4A 3ZN4A 5A7PA 4UW6A 5H9QA 5LA9A 3PJYA 3FHIB 3MW2A 5FBJA 1H1MA 1RUD3 4R4XA 3WF1A 4CEYC 2ARCA 1XNDA 4IEQA 4AR2A 4COZA 1W06A 2B5HA 4W50A 2DWRA 4B4QA 2HWD2 2QQJA 4LKEA 3RYRA 4UT5A 2BPA2 3V0AB 2ID4A 3TN93 1DFQA 1J1TA 5JAXA 1L3JA 3LKJA 4PF5A 2OA2A 3AZZA 3KWVA 1MEC2 3WDWA 2Q5TA 2AEZA 2A6ZA 4FPHA 4E4HA 1FOD2 4LPLA 2IZWA 4WZCA 4XQWA 4JKMA 3AKSA 3H50A 4I0AA 1S0BA 1QOTA 3S6PA 1RGSA 1AR82 3GZTB 4HKOA 2VTXA 3LGRA 5IW0A 2ZS6B 5FXZA 4LR4A 2PTMA 4M3CB 3AKTA 1GANA 1VBE3 1HQWA 2W1QA 5FZOA 4P9LA 3T1MA 4QX5A 5J3UA 2WFF3 2J1VA 1WA6X 2CY6A 5CKMA 1AUYA 4P9YA 2Z4FA 4GULA 1WKYA 2DBIA 2R061 4P9JA 5CVRA 2VTFA 2WNEA 3ME2A 3VKLA 4DRRA 5KHGA 2X10A 4RR3C 4B29A 1MZ5A 1BYHA 2CWSA 4WM8B 1UU5A 4IV1C 4EROA 2BGCA 3NQHA 4RHV1 5KWRA 1CZSA 2Z5WA 5FYMA 1YQ6A 3RGBA 3ZYHA 5L7OB 2E7TA 4NHLA 2GC1A 4TSVA 3JD71 3H8RA 1ULEA 2G9ZA 2R042 4LLOA 1QNWA 2HEVF 3RYPA 3VBUB 1W9WA 5FQ0A 2VUDA 4Y1ZA 4BK4A 3IDCB 5FWEA 2BW8A 3ZXGA 1JOJA 2B39A 2WBKA 3R4UA 2XQXA 3ZKYA 4LXLA 5FYSA 2R063 3VBFC 1W04A 3O1SA 2J1UA 3H3LA 5GLZA 1CJPA 4PJYA 5FP9A 3VBSA 3U75A 5A3NA 3AM2A 4OHXA 1FMD3 1YYNA 1Q5OA 5CFCC 3MIHA 1H4GA 4RQPB 3FHAA 3N7LA 1WMDA 1BK1A 4MZUA 1BBT3 4UW5A 4HFSA 4QQHA 5FY8A 3NWKA 5JCTA 4Q26A 1RUF1 4N43A 1VIWB 4GB32 1NZCA 4RFRB 1HB4A 3ELNA 1S0GA 5HXMA 1CAWA 1UZVA 1UNBA 2VQAA 4Q0VA 2RDRA 3RFRA 2FDJA 4QPWA 2RS33 1KDKA 5F3CA 3N7JA 2YC0A 1Y7BA 3ZXEA 3LA2A 4L97A 4NHMA 4FP3A 2HWC2 3FN9A 3M7AA 1QGLA 5DG1A 3VBOC 3T30A 1M06G 4Q0PA 5CAZA 2Q30A 1ACCA 2YB7A 1LENA 1H2NA 3ZXKA 4AHXA 1O8SA 4FBFA 2SBAA 3R6SA 2EIBA 3WW1A 3N3HA 3CKHA 4AI8A 3GCXA 5KC5A 1K42A 5FK8A 3USSA 2PAKA 1F5FA 3LAGA 4Q4X1 2V4VA 1E5SA 5T50A 4ATFA 3MPBA 1ND3B 1LHUA 4XDPA 5SV8A 3PMSA 4GMP0 4XCBA 4Z8BA 4Z07A 2XJUA 4H2AA 1AYN3 2G9GA 1QH7A 3HNYM 3ZLIA 1LOFC 4XF4A 1JYNA 1YFUA 2XLAA 1NAEA 4J1XA 1YXWA 2CGOA 1N3QA 1N1YA 4HSJA 1JZ6A 4EJRA 2TEPA 4P5YA 1SMVA 5KC6A 1DZRA 3HVDA 3M3QA 3NNLA 4QXKA 3FUOA 2ORXA 5GLUA 3VD7A 5FJHA 1K12A 3EXUA 2DCZA 3BU7A 4META 2VZQA 3RZZA 4ZS2A 1SZBA 1ZM1A 2WFF1 3ES1A 2WJSA 3HT1A 5A33B 3OUHA 4I0BA 4FTSA 4N43C 5T5LA 4FOQA 3LFMA 1CX4A 4JV4A 3ZX7A 1IS3A 1Y9GA 1LB2A 2AGSA 1A78A 3POFA 1AXYA 3K4ZA 1MVQA 3MIEA 2W68A 4DXRA 1S0EA 1XE8A 2BYVE 2QQNA 2D6PA 2H6CA 3CHXA 4XE9A 1W6MB 2EXKA 4XF1A 2E53A 1B35A 2J1SA 3W21A 3ZXDA 1AZDA 1XSRA 2A75A 4HLTA 1IQAA 1RVF2 4LBMA 2AUYA 1H2LA 1AR91 2BNOA 1TE1B 3ZPOA 5FR3A 1W8ZA 4L0PA 1JZ7A 4B4PA 3TN91 1SFYA 2WSVA 1F15A 2CL2A 2XB6C 5IVFA 1ND2C 5A1FA 4OHZA 2G4IA 5ACA1 1VB2A 4YW6A 1UQXA 2Q8DA 4EYUA 1PVXA 5JWPA 5K9YA 1NUKA 5AVPA 3B00A 5A1AA 5FO7B 4AF9A 2X5IC 4OQ8A 4YGBA 5JLVA 1DIWA 3IDEA 2JG8B 4MXWB 5BNOC 4WM8A 1T6GC 5FZEA 1CGPA 2F17A 1QIQA 2ZAAA 4PQ9A 2KA3A 3ACGA 3LEGA 3V0BA 1L7QA 1LGCA 1NA1C 2VCAA 3A21A 4RR3A 2HJIA 4Z92B 1IG0A 2A6XA 4ITCA 2P3YA 2JECA 3VGIA 1O8PA 1AYN1 4Z1VA 3ATGA 2JG9A 3ZFGA 1OBNA 5CB7A 2QVSB 5FYYA 5G05L 4CDQA 3POWA 4CXYA 3OGSA 2DTYA 4D7TA 1DBNA 2B42B 3I3QA 2A6WA 3EHKA 4I2OA 5JPNB 5L9VA 4MUVA 4ZS3A 4B3NA 3M3EA 4B4RA 2XVKA 3KV9A 2RS52 4M00A 4AI0A 1GZ9A 2EIGA 3T2PA 2GC2A 3DXUA 3FE5A 3PMEA 2CDPA 4RGKA 1IS4A 1D7PM 3QOPA 5LK7B 1QF3A 2E26A 5FY5A 3LCPA 2ZEWA 5I8SA 1PGL2 3I97A 3MUY1 1ZBA3 1S0IA 1RUG1 4AVSA 2VY0A 1O7FA 1YIPA 1VBA1 2OS2A 5T5JA 1RUC2 3INAA 3M2MA 2ZX4A 5BY5A 5AC92 1S2KA 2RS51 2PQQA 1DZQA 5DABA 2VULA 3HPNA 2VBPA 3KM5A 1OUXA 2ZGLA 4IE4A 2RJLA 1BEV1 2VQTA 3KF3A 3P3PA 3DEMA 4PDWC 1LKNA 1D4M1 5F8PA 1BBT1 4LBKA 4AEDB 3QACA 4XAAA 1JZ3A 4IGOA 4S2DA 2HWB1 4YWAA 3ZSEA 1VLNA 3IDBB 1NLSA 4RD7A 3ZFFC 1KQRA 2VCMA 1G7YA 1YQ8A 1WGPA 3ZYRA 1U12A 5JR2A 2CAUA 2A3YA 3CJIA 4OI2A 2VMFA 1Q3EA 2JWPA 5A3OA 4AQ2A 4CUAA 3ZYFA 5CG9A 3LEIA 5FKCA 2DVBA 4FPCA 1YI7A 2Y8KA 2YY1A 3FHQA 3J8F3 1SLAA 3K75B 1J83A 1GWKA 5L7OA 3CNAA 2D6KA 2JDPA 3QLQA 4MHUA 4BQYA 1O3SA 1DYPA 4YVWC 4NAMA 3WVJA 5C6CA 3KV6A 2W52A 4XACA 1AX1A 2D44A 4Q4V2 3GBFA 3JQXA 3DYPA 3CZUA 4PIXA 5F3GA 5A80A 1HXS1 4JKLA 2R072 3ITQA 5BNPB 3VBHA 5HCFA 2P3KA 3Q8CA 3UESA 4GALA 2DFCA 1OFNA 1QXPA 3Q8FA 1PGW2 4YW4A 3KVBA 1UY3A 3P3NA 5EXOA 1EY2A 1RL3A 2VOXA 4DRVA 1WMEA 2XL9A 3PDQA 3LF7A 2R7EB 4IEVA 4Y5SA 5A6ZA 5BV6A 3ECQA 1G6NA 2GNTA 3VHNA 4Q4Y2 1V00A 4ZHNA 3E6DA 2B4KA 5T5PA 5EZWA 3KF5A 3WNOA 4XF0A 4PF1A 3B02A 5F37A 4Y4YA 5CG8A 1S0CA 4N53C 5FZBA 4W6YA 2G19A 3NMBA 5CIRA 4NJ4A 5FZ6A 2BGOA 2QNKA 5ABJB 4IETA 4XFCA 2ZEXA 2VMIA 1O5LA 2PA7A 2EVXA 2LUWA 1RHI3 1UWWA 2PXJA 2HWB2 1OVSA 3ES4A 4XBQA 5DDJ2 3GZUC 2Z42A 1CWPA 4QQLA 1AYM2 3BN6A 4XJUA 3RZJA 1BBT2 5FP8A 1BVVA 3B7MA 5C70A 3DYOA 2JDZA 1HRI2 3PURA 4OMCA 2VMEA 4D7SA 2DVDA 2Y6FA 4LMFA 2BWAA 3DF0A 3KT1A 1HKDA 2D97A 4WM8C 4FTBA 1QEXA 2XMLA 4LLFA 3NJZA 5FZIA 2ET1A 2RDSA 2JD9A 5LBEA 2W3JA 1Y4WA 5A7OA 5FLIA 1X9TA 1SACA 1H30A 2VZ3A 4MGQA 1MS3A 3RDIA 4FPKA 1JOBA 1Q43A 4JHTA 1TG7A 4Q5OA 2R0HA 2ZMNA 3ZMNA 3WG4A 2W92A 3IBMA 1KS5A 1PK6A 1HXS3 3CEWA 1WD3A 2WNUB 4Q4W3 2HEYF 1R093 4Y20A 1RXFA 4XCAA 1DHKB 2PHDA 3FC0A 2WNVC 4TLFA 1ZREA 1C5HA 2C0ZA 1XQNA 3KHBA 1XJAA 1V6KA 4DZGA 2WN2A 4QX8A 5IK4A 5BXXA 1XPWA 5T52A 3KCXA 4P00B 1VR3A 4COYA 3Q8AA 1HN0A 1SDDB 4FT8A 4P9WA 4A7KA 5A3MA 5LZ6A 4LHLA 1W8WA 1JZ5A 1W6MA 5LA1A 1Y43B 1W8FA 2UU8A 1R1A1 3AFKA 3JXSA 4LOTA 4YYOA 3ZR5A 1S0FA 2LRPA 2A6YA 1NXD1 1NLQA 4QGMA 4E2GA 2VO5A 1BK0A 5FYVA 1RUC3 2R1DA 5FY0A 1VBA2 2VNGA 1A8DA 2PHFA 2QJVA 1IZ3A 1R091 4LO4B 2LTNA 2ZHMA 4AGRA 1V9U2 1NT0A 3V65A 2OKXA 4HPKA 1PIV3 5CNAA 1PGL1 1C1FA 4E4SA 2QZ2A 3POIA 4RHV2 3LEMA 4LE3A 3MYXA 1LOGA 3NV3A 5FAXA 2WWUA 2B9VA 1MZFA 1AYM3 3RG0A 4FO9A 2AC1A 3GJAA 1W6QA 5FMCA 1JH5A 3SHRA 2CNAA 2UWAA 3FFZA 5JI9A 4DY3A 4KBZA 1REEA 4R4ZA 3VBUA 4C91A 4LBLA 3VD4A 1EUTA 3AMMA 1ZBA1 3RMYA 2ZGOA 3APBA 4MO3M 2X8KA 2A7AA 1V0AA 4FAGA 4B7KA 5F6KA 1SCSA 4NPLA 5FFOC 3KVAA 4IEOA 1VBC1 5EJZB 2HYKA 4QQOA 4RSUA 3O0WA 3VN4A 4GZ9A 3ILNA 2XUMA 2W0XA 4NOTA 4PIZA 5LEJA 4AVAA 5E1RA 4KWUA 5C33A 2DCKA 3EMRA 4Q4V3 5FZHA 4LKSA 5L36A 1GNHA 1OA4A 3WDYA 2HWF1 1ZRRA 1NOVA 2OQ6A 4R9BA 3DV8A 2W2IA 1DZTA 4DEQA 2OUHA 4FOWA 4CEWC 5CBLA 5I8YA 2XBO3 4XFAA 5CEHA 4UI9L 4MVTA 4EQVA 4PLOA 2AYHA 2XLFA 2QFEA 3WLUA 1W39A 4URTA 3WQBA 4AAXA 1NCQB 2R6QA 2IFRA 1W2TA 3K48A 3IB3A 3MF9A 4UFHA 3V56A 4D3WA 4Y5Z0 4JTOA 5FBZA 2E7QA 1A34A 1OURA 1AR92 4Q1RA 1K3IA 1EV12 1SLBA 1A3KA 1UU4A 1XB9A 1AXKA 5FPXA 4DY5A 3S57A 4JGZC 5HXVA 1FNYA 4QXHA 3VBFA 1VB4A 2W5FA 4IQPA 4AGGA 2CU5A 1ENSA 1TMF1 5H9PA 2CGPA 4GH4B 3AMNA 4MADA 3U37A 2C9AA 2JDUA 2OPWA 5K4LA 2O8OA 5C8CB 2QZ3A 4IGPA 5EYXA 1V6LA 5FPZA 4Z2AA 1ULOA 2WNVA 3WNPA 1QJX1 2RM23 4G4FA 3ZFEB 3T0DA 1BQPA 1W90A 1GFF2 2MPFA 1RUH1 2WC2A 2DF7A 2EXHA 2RR11 4KI5M 5IVVA 2QTWB 1QNYA 3SKVA 2IVIB 1LHOA 1EAH1 4Y20B 1VMHA 3POSA 4Y5TA 3VDDB 4K1YA 1J59A 3NV4A 2WL1A 3ABZA 3J8F1 2PLV1 3FX3A 5FMDA 3S7IA 3KZ4C 2WZR2 3NAPA 3PHMA 4LA2A 5DAWA 2ZKNA 3ALQA 4XOGA 1DQ0A 3E1F1 4QX2A 3AJZA 4WZFA 2ILMA 2P1BA 3BPSA 1W8UA 2GP3A 2VR4A 4XZPA 1YFWA 2OIIA 2P4EA 3MBWA 4Q4X2 3WW4A 4EE2A 2VZRA 2LS6A 3HMYA 1KJRA 3U10A 4Q8KA 2VM9A 1JW6A 3NNFA 2VGDA 1LOCA 2TUNA 3T2OA 1S0DA 5FZGA 5M0TA 2O14A 2B7YA 1PO12 3ZN5A 1RUF3 4IEWA 1RXGA 1WZXA 1CJDA 2VUCA 3DPRA 3AZWA 1QOSA 1X9PA 1DLLA 2SLIA 4EN9B 1UPIA 1ZZ9A 1PMJX 4SLIA 3PTYA 4UOJA 4GXLA 2NZ9A 1W8TA 4YZ3A 1RUH2 1R081 4AVVA 1S1AA 2ZGTA 1F35A 4PCRA 3AKPA 4ISQA 1GNZA 2CYFA 2Y6GA 4QB1A 5FY4A 3VKOA 2Y0OA 4C0HA 1W0PA 3IIIA 4E2SA 5FPUA 4FFFA 5A7SA 1ZZ8A 3VBRC 4YLZA 1SBEA 1K5MA 1NG0A 3MF6A 2VH9A 3HQUA 3K4AA 2D5HA 2VECA 4M01A 4CDWC 1QQP1 5DZEA 3OBRA 3FBYA 4J1WA 3SH3A 1ZVFA 2R49A 5LA2A 1XBFA 1YEWA 2ERFA 5JOWA 5JOYA 4NRQA 4RHV3 3D4KA 4CCNA 3LPGA 4Q0SA 3UGHA 3CJIC 2E6VA 2D5FA 1LODA 1PIV1 2WA3A 2ZHNA 4LJHA 4HG6B 2HWF2 1RUOA 3FJSA 4XFFA 3GCWA 4YVWA 5LRRA 1BCXA 3LDRA 4OUMA 2VG9A 5LW9A 4OZXA 1HQLA 3UKTA 1CR7A 2IXLA 1JZ8A 1YJKA 3A23A 2BVVA 1OD3A 1EV11 1OF3A 4BOWA 4P9XA 1GZWA 1CAXB 3HN3A 5LBBA 3ILFA 1W3VA 4P9IA 1Y9MA 3NRUA 2CSGA 4FPGA 5FP4A 1DGWX 3VKNA 3Q8BA 1YUDA 2XBO2 5HBAA 3U1XA 2OPKA 1HRI3 3AFGA 3I59B 1NXMA 2JDAA 1QY4A 2XJRA 4QU1A 4XHBA 3RWKX 3T2QA 3TEZA 4GAZA 1PVC3 2WSUA 2ZHKA 1WW6A 1AR93 2RR13 1PVC1 2ZHLA 2B9UA 4Q4W2 1W99A 2XGXA 4QX0A 3RWNA 3WP6A 4Q0UA 5FLJA 1QWRA 1EUUA 4Y1VA 5DUXA 1MVEA 2R041 3ETPA 4TZDA 1WW4A 2RS31 2WLPA 1GMMA 1Q56A 1AVBA 2BTVC 2WUHA 4UF0B 1YJLA 3VZOA 4KWKA 1ZZ6A 3NVCA 3WNMA 2GZWA 1GZWB 4QB2A 1ENQA 2XDVA 5EIYB 4DNYA 2ZABA 4AAPA 3WX5A 3I54A 4LITA 1V6OA 3IIAA 4AFAA 4CCEA 4CU6A 4OUSA 4LO5B 5ABJC 3S30A 2HBUA 2H0BA 1UZWA 2OXBA 1O4ZA 2W08A 5FCCA 2JDHA 3ZIWA 2Y64A 3ZN6B 1XU1A 2VL4A 3AZYA 4OFGA 4XXAA 3K51A 4BMEA 4LKDA 1HJGA 3GZEA 1MS9A 2ZGMA 1S2BA 4PQQA 5LATA 1Z7S2 1F9KA 3EBRA 2Y6JA 4OHVA 5EFUA 4CPBA 3ACFA 1I3HA 2RM21 3WOGA 3WDUA 5KHJA 3U0ZA 1F31A 1JTZX 4XFGA 5JI7A 3E5XA 2MEV1 5FZDA 4LA3A 2AENA 5FOBB 2GAUA 3JBG1 1JMUB 2BGPA 2EALA 2RMU1 4NN0A 2LALA 2NQYA 4P02B 5C9AA 4NPMA 5JVVA 5D2AA 5K0UC 5HI0A 4DUVA 1UMHA 2HWD1 3ZVXA 3MO4A 1OPOA 2HLEA 4NIHA 4AG4A 3MPPG 4W6XA 4BQXA 5CZKA 5C3QA 4BQ3A 1Q8OA 4M3CF 1T2XA 1NZIA 1DG6A 3KMHA 4P9GA 4CCKA 2VZTA 4HSLA 4DXSA 5IVYA 3WW2A 1ZRIA 2FD8A 4GWIA 3WEZA 3IM0A 1FI2A 3CMGA 4WVWA 2VUJA 4JTNA 2TBVA 5BNPA 4ZONA 1DU3D 3I2OA 4OHYA 1UZ0A 2ZACA 1AHSA 1D0GA 4XFIA 2FQPA 1U5XA 1NCRC 2IXHA 3OEAA 2IXIA 4GKYA 4CCCA 4NIDA 1DYOA 3X29B 2C9KA 1OLMA 3U4XA 5ACA3 3RYKA 4JQTA 2PN5A 1LOBA 1YO8A 3MIFA 5CISA 4XZUG 4ET7A 2ZEYA 1LR5A 1A6CA 2GNBA 2WLQA 3WHUA 1UAIA 1R092 3OPTA 3THTA 5K7PA 5C9AB 5JOXA 3H1WA 4GH4A 4EWDA 4BLJA 4CCOA 2ATFA 3NNGA 3W9AA 2BFUS 3IAPA 2Y6LA 3HT2A 3IKWA 1PX4A 3L9JT 3B5LB 4QGNA 1PO21 5DUUA 1ASJ1 4N9HA 1HRI1 5EHDA 2JE9A 4LOSA 2VNRA 3PTRB 3TNPB 2YYOA 1IKPA 4NAOA 1W6OA 2D3SA 3CU7A 3D5OA 4CU7A 4E4DX 2VXJA 5JXHA 5AFBA 1VBE2 2XPJA 4OYUA 3N36A 1UYZA 5CU1A 2WN3A 1GQHA 4Z82A 4EN8B 3R0RA 5FZ0A 1GQPA 1RMU3 3C3VA 3TNQA 4N9IA 3UL2A 3E97A 3CZJA 4HVRA 3JBG3 1C8NA 3AX4A 3A0KA 3I2IA 2AR6A 1C1LA 3NW4A 4GWNA 2NMOA 4FTEA 3MW4A 4HN1A 5F2WA 2UWCA 4MHRA 1VBB1 4QPYA 1MACA 1VJ2A 3HR9A 1I5PA 1RC6A 2XJVA 3LEKA 1IHMA 4UF0A 2X05A 3VL8A 2IUWA 3AYEA 4QHOA 2WAOA 1V6MA 5LWBA 3KQRA 1ZNPA 1WMFA 3BPZA 2YPJA 3JQWA 4Q4X3 4XYXA 4YGDA 1UXZA 1TZOA 2O8QA 4FOYA 3PVNA 4D6QA 1FYUA 1O59A 2DYCA 1YQCA 1MZEA 4HVQA 2GC0A 4HOOA 4LIVA 2E9QA 2VZPA 1AJOA 2H0VA 4AW7A 5A32A 2ZXQA 3RZMA 3LOBA 2J1AA 4CEWB 4GMP3 4QDRA 3JD73 1VALA 1YCIA 4K21A 2D43A 1VBE1 2WWSA 3LD8A 3OBTA 5DDJ1 2UYAA 4CDXB 1FPN3 1VBB3 3URFA 3NKGA 4R9AA 5FREA 2CDOA 2X53S 5CKQA 4KGGA 2W91A 2YUEA 1RMU1 1O3RA 2WZPP 3MICA 2XR4A 3ZSLA 3CLPA 2YFZA 3H8XA 2YZ4A 4MV2A 4I01A 1IPKA 2PHRA 2P3IA 1IPJA 3SQOA 1RUG2 5I93A 4Q27A 1JUHA 4LNVA 4ZKTB 1LESA 3O1RA 4AQSA 1QJZA 5J48A 2DUPA 1POQA 5FZOB 3AB0A 1U0AA 2D6OX 3C7GA 4FPYA 1H8TB 1OFSA 2HH9A 3NV1A 3WV6A 1NCRA 1H1AA 3OBAA 4XIOA 1VMFA 5I0DA 3VDDC 5JUVA 1YLLA 2OZ6A 2HWF3 1ZBA2 3K2OA 3OB8A 4Y24A 1D4M2 1DQ5A 4IE5A 4MGTA 3POBA 2ADDA 1X7NA 4XQ4A 3OD0A 2JD4A 2C1FA 5DAQA 1RITA 1B35B 2ADEA 5FUIA 4ASMB 5IK5A 1BXHA 1VRBA 5JXGA 4QX1A 1W2AX 4A3XA 3DGTA 4NHKA 4WVMA 4PT6A 1ZA4A 4FSJA 1H6YA 1QXJA 1UMIA 5F5AA 4IV1B 4WBBA 4CXXA 1ENRA 1URXA 2ES3A 2WZ8A 3THCA 1AJKA 1XOYA 5TSWA 1E5RA 1XNBA 1QJU2 2BERA 1UOGA 3BTXA 1CONA 3MGUA 2A3WA 3HIFA 4PIYA 4RL7A 5FTTC 5HPOA 2FDKA 1J1LA 1CAUB 2CWMA 3RVHA 4CYDA 3ZSJA 3SISA 3FLRA 5CFDC 4YW3A 1A8MA 2MHFA 3NJVA 1NKGA 2D6MA 2W95A 4IEYA 1RUH3 4A6SA 1C4RA 5FXWA 2Z69A 4CU9A 1MR5A 1KRIA 4NPRA 2A6VA 2PHXA 3PUIA 4LHKA 3SMHA 4RS5C 5IAXA 1SDWA 3GNEA 2DTWA 3WF3A 4QWNA 3BALA 4AEMA 5A3PA 5FO8B 4BIOA 5IVCA 5IJRA 3VBRB 1H9PA 2R073 5IWFA 1AR61 3AL5A 3AVSA 3WR0A 2O1QA 3IPVA 4IW3A 3WHTA 2JJ6A 1D0HA 1DQ2A 4YSFA 5FDBA 4QXCA 4AK3A 4CDWB 4AI2A 1AX2A 2HBTA 3IMMA 4TWTA 4OZOA 2WAAA 1LULA 2VMCA 5C5TA 4K6BA 2VW2A 1E57A 4DXZA 2Y6HA 1W6PA 3ZFFA 5C8WA 4CE8A 2DDUA 4FPLA 4XJZA 3ZFEA 2QQUA 5LY2A 3WG2A 4YVSA 3TBDA 2WO2A 3QH7A 1JYTA 2QUOA 4TYSA 4Z2WA 5FWJA 4CDUA 3IN9A 4S2GA 4JDOA 4I02A 1ULCA 3C7OA 3WG3A 4A44A 5GZDA 4D0QA 3WCRA 4K3UA 1GU3A 1XU2A 2I45A 3GXUA 2XBO1 3O7OA 2B8MA 2VBBA 4F83A 2C4XA 5BPXA 3N9QA 5T54A 3VBRA 4UWDA 4IE7A 2JIJA 4YRDA 3WQ0A 4ZXEA 4COWA 3R4SA 4QU2A 5L9BA 2UY9A 4JGYA 5C3PA 4K40A 3W59A 5T55A 1C8M3 3BI3A 5FZ3A 3JCIA 4D6SA 1S55A 4KNCA 5E16A 1OD5A 2AREA 5JDBA 4KU7A 1V6NA 1REDA 2JDMA 3ACHA 4XUTA 3VBHB 1PHMA 2BNMA 4H55A 2AH2A 1SHWB 2PFWA 4IGQA 4M4PA 5C7GA 5CA6A 3DPRC 2FCUA 2VOKA 3QCWA 4CDQC 5FZ4A 4XDOA 1W2NA 1XNAA 2RMU3 2XUEA 4Q1PA 4UFIA 4LT5A 3WUDA 1AX0A 1VBC3 2BUKA 3PVOA 4BQ1A 1OF4A 5EJ3A 2FDHA 5FMBA 1O4YA 4FAHA 4QPIA 3H1MA 1JOPA 3KS7A 4PI0A 4GKXA 4R8HA 4W65A 4RR3B 4CCDA 3H1YA 3THPA 4JRAA 5DXDA 4Q4V1 5EV7A 4IE6A 4XXPA 4LKFA 4BXSV 3NAPC 3VZNA 2ARBA 2W1SA 5FPLA 4E27A 3ETQA 1R083 2G1MA 3AP6A 3K3NA 4KWLA 5ERLA 5JSOA 4HPKB 3ZYGA 2O0OA 5H9SA 3Q8EA 3RPQA 1D4M3 5GZGA 4H7MA 3J7MA 4LBQB 2BV4A 2BP6A 2JG9C 3ZFGC 4KG0A 4ASLA 3NJYA 4DFSA 1YFXA 2X09A 2XJQA 4OHWA 3WW3A 2PLV3 3V0AA 1F2NA 2EF6A 4ZU7A 3RZKA 1OLQA 4AI9A 3OBZA 1LEDA 1XE0A 2J1EA 3A4UA 5I8TA 4XETA 1TME2 2P34A 5K8SA 3CBNA 2DVGA 1WLWA 1OKOA 1UN1A 5FZAA 5LK5A 5C3OA 4UFJA 1GV9A 4QPIB 1OOPB 4B1LA 3B9CA 4QGLA 1U5IA 1X50A 2X5IA 3ZXFA 1NYWA 4JCKA 5ANQA 3ZXJA 1UZZA 5AC91 3J8F2 1EAH3 4MXWA 5C5UA 1QJY2 4QPGC 3D82A 5I91A 1V70A 4CCLA 3ZYPA 4MXVA 2DBNA 1JS9A 2VZ1A 3A0NA 3JD72 4BQ2A 2PHUA 3SH5A 1O3QA 4QXBA 1QJX3 1X8MA 2WFPA 4I3PA 1LOFA 1WW5A 3WP5A 4O61A 1U5ZA 1ULFA 2JB4A 2QQIA 4BHPA 1ZA7A 3UGFA 4XUNA 1QJFA 1X33A 1HQNA 2PQSA 5C9AC 1CAVB 1MZ6A 1CESA 2YC2A 1XYNA 3HOBA 3N7MA 4LBOA 3DKWA 1GOHA 2DU0A 3KV4A 3N9MA 4JVAA 5DAXA 5J96B 1DQ1A 2GU9A 4GD4A 2IWGB 5FY9A 1R1A3 1PMHX 4AI3A 4YM2A 3S7EA 3HQRA 1HDKA 4LBQD 2BQPA 3UGGA 1NQJA 1WLTA 4TXWA 5FY7A 2ZGRA 3RI8A 2PHWA 1WCSA 3RZGA 2XXZA 4L99A 4QQPA 1PZ8A 1Z0HA 3JU9A 4RA0A 3PUHA 4YM1A 2OVUA 1MEC3 2WQZC 5GALA 2GNDA 2QE3A 3NNMA 3PUAA 4WM7B 3UETA 4HBNA 1PIV2 2Y6KA 4YNIA 3AL6A 3KT7A 5D8AC 1YQ5A 2P37A 4H3WA 4B1MA 3MI8A 2RS32 1RUD2 1MS4A 5E88A 2QBXA 3GHNA 5KXBA 2FCVA 3BB6A 1QJY1 2QQWA 4M4RA 4CDXA 4OCTA 5J36A 1JYIA 4Y1XA 1HRV3 1BMV1 2ZEZA 3OPWA 1D2SA 4CP9A 3IPVB 5C4WC 1H4HA 4Y4RA 5A70A 3VZJA 3BIEA 4LTAA 4R52A 5FZ9A 3WUCA 2ARXA 2RVAA 1YQ2A 4OQ9A 4BLIA 3AK0A 1AL23 2RDNA 4AFBA 1BMV2 4FP2A 2XG3A 3VDAA 4XHXA 5IVBA 3OUJA 2R043 3AXEA 4AQTA 1SPPA 4IEZA 4DXTA 1RUJ3 1POV0 5EJ1B 3MIGA 5JR7B 1PK6C 2WS91 4NR1A 2VTXJ 4QKDA 1HJFA 1S0JA 1VPHA 4NRPA 4UBGA 1UXXX 1H8VA 4IV1A 2JG8C 3BVCA 4KQ7A 4XFBA 5BNOB 2RS11 4BE3A 1VBA3 3HBZA 1MQTC 1US3A 2V73A 4KL1A 5DUWA 2R16A 3I2FA 1RIRA 3C7FA 5LBFA 1NE4A 4C1WA 4EZ4A 1RB8G 4ES9A 2VUAA 4XMAA 5A6YA 4WM7A 2CTVA 5T5OA 3S0MA 3PLQA 4A3ZA 1TEIA 4FFIA 2BBVA 4KH9A 4XEZA 1SLTA 3ON7A 3H42B 1SFPA 4JKKA 4AQ6A 1W8HA 3TB0A 4IDZA 4YM0A 4CDUB 2QKDA 1ONAA 2VOVA 4SBVA 1H8TA 3I2DA 1DCSA 4M3CA 2VVDA 4NWVA 1J3QA 2VZSA 3POYA 1CAWB 3AP4A 3VDBA 1VAKA 2QQVA 2W39A 1F5JA 2QDRA 2PLV2 4JAAA 1SG3A 4XUQA 1GLHA 4BMBA 2EIEA 1GP6A 3O1UA 3WQ1A 2W1UA 1MS8A 4FOVA 1R082 3LE0A 2FBEA 3BOWA 1ZBE1 2JENA 3BYWA 3GBWA 4I30A 3NV2A 3VD9A 1NY71 3B93A 1HRV2 5C3RA 5CFDB 2OQ7A 1PO11 1Q8VA 5FUPA 3H9AA 1AR71 2WZR3 3LSDA 4BM8A 1UYPA 4IV3C 3RS6A 3N9LA 2XHKA 4GIQA 4DOUA 1OLME 3T1LA 4BDVB 1SQ4A 4K1ZA 1CPNA 1XYPA 3N9NA 1KFXL 3VHRA 5JZGA 2ZKLA 1C8M1 4CPBD 3BKZA 1AYM1 2K9ZA 2DURA 4XFHA 5FQ0B 4URAA 3O1OA 4H7LA 4F8AA 1QMJA 1OI6A 3I2KA 4YW2A 5JZGB 4CEYB 1GZCA 1WCQA 5DMYA 2FHRA 2XH6A 5FZLA 3VHOA 2Q8EA 3AMPA 1ND3A 2YHJA 4FCAA 2FDFA 3LWCA 1T6BX 1YC61 2NMNA 3VUOA 3PUQA 1O6UA 1LHVA 2CV6A 2WNOA 2VE1A 4XF3A 1FMD1 2RR12 5G04L 4JDNA 4HT1T 4IEUA 1H1IA 1UX6A 3R4DB 5KHKA 2JB8A 5EP9A 3RJRA 4D8MA 2IFWA 1DGWA 2DUQA 3K4DA 2JEMA 5EQUA 2IXJA 2VAUA 1LEMA 3EYPA 1GUIA 2XONA 3ASIA 2PMWB 4EN0A 2WZR1 5BNQA 2VCCA 5F3EA 2MNGA 3T09A 1DQ6A 4UFLA 3MV01 1DYKA 5DUVA 1IS5A 3LSEA 3WDTA 3P5BA 1RJ8A 2KR2A 4LK6A 4AXOA 5AVAA 4XMIA 2GDFA 3OJBA 5F1RA 1W6OB 2WIIB 1F4AA 1N3PA 1U5YA 4HKLA 1TME3 2NM1A 3WNXA 3C8XA 1CZTA 2W47A 1JZ4A 5CYYA 4YARA 1WBLA 4TN7A 4QB6A 4BU2A 2ZMLA 1O91A 1TMF3 2YROA 5DQ0A 3VBSB 3AJYA 3MDPA 4EZHA 1RUJ2 3H0OA 2P5BA 3L2HA 2DUOA 1ZZ7A 4N53B 4QDSA 5F5IA 4Y1UA 1VBD3 4AVBA 3U11A 5FJKA 1JXNA 2BBAA 1F8VA 1KGYA 5IVJA 3PVEA 1RUI1 3VHPA 2DFBA 1QJU1 2R1BA 2XJTA 5GKAC 5JMCA 3DPRB 4CDQB 1GOGA 4K9SA 2WA4A 4YW7A 2EXIA 1W8NA 2EA7A 1WLCA 4NO4A 4ZU4A 3UKNA 1FPN2 2HWE3 3WF4A 4QQ2A 5CFCB 1RJ7A 4AVTA 5FZ7A 3AC0A 5KXEA 1XC6A 2F6BA 2OYZA 2XHNA 5F2SA 3AP5A 4OI1A 2E63A 3HEIA 4NWWA 5FY1A 1FXZA 3UJQA 3WNNA 4FPOB 4NIIA 5CFDA 2LW8A 1GP5A 5BUVA 1LGBA 2GALA 3W5NA 1CAXA 3EQEA 3LPFA 3IWZA 1SEFA 3M8LA 1GSLA 1W9YA 4CCMA 3GALA 3IDAA 2NYYA 2ZA9A 5C3SA 1W6QB 3T4VA 4NHYA 3CJIB 3U14A 2Q1FA 4AEJA 1JYXA 3VZKA 2WYSA 3LQCA 1J3RA 3ZOIA 3CL1A 3KCYA 5HCHA 4LBNA 2FZ1A 5LBCA 1QQP3 1VRH3 4DEVA 1IKQA 2WNUC 3H7YA 4IEXA 2GH8A 3EJKA 4K8RB 2WT0A 2LROA 1AR62 1YFYA 1R1A2 5BNNC 1EPWA 1OXCA 2ARAA 2P6CA 2GMMA 3H8OA 4Q8LA 1WCUA 1S2EA
chains in the Genus database with same CATH topology
2CGNA 3TYJA 5JOZA 1QKQA 4BCUA 3HQXA 1COV3 4INDA 5GJ6A 4PLMA 2CAVA 4WVZA 3WCSA 4DPNA 1OA3A 4KWJA 3R05A 2XVLA 4P14A 1QJY3 4U36A 1RUJ1 2DCTA 2ZGSA 1RUE2 3OPZA 4FVVA 5A3LA 1G9BA 1J3PA 5FMOS 1OOPA 4LULA 2K2SA 4CEWA 5ACA2 4Q4Y1 1OA2A 1VBB2 4D7YA 5J09A 5F9TA 1KS4A 4YW1A 1POV1 3AKQA 4GA9A 3QBQA 4L92A 2VW1A 4Y1YA 2P2KA 4COVA 5KHIA 4LBJA 1CVNA 1ENXA 3OY8A 3C2UA 2JX9A 2EXJA 4U2AA 3L2YA 4Q4Y3 1X82A 3VBUC 4OI4A 3LB9A 2E7AA 3KLSA 5AFEA 2EAAA 4XJ8A 1J58A 1VRH1 2A73B 4YM3A 1VRH2 2ZGKA 4NVPA 2WINB 4XQDA 1RMU2 1RHI2 2XLGA 3VBFB 3ZN6A 2PHTA 1K5MB 4MGYE 2PAMA 4MSVA 4YGCA 4EWEA 1FOD3 5J7MA 1XXNA 3SXWA 1Z7S3 5C8CA 3LOIA 5I0UA 1CIWA 1COV1 1LOEA 3B94A 1LCLA 3HAGA 3KGLA 3BTAA 1G9DA 1BEV2 3ENRA 1PO23 3OD4A 5CFCA 3JUUA 5LRSA 2GH2A 5I0RA 1CAVA 2KXLA 4GH4C 3PJQA 5A33A 5GZFA 1SCRA 5SV5A 4ASMB 2YV8A 2ZAHA 5GLTA 5L19A 4ZXKA 3EO6A 1FV2A 3ZFEC 3WDXA 3AZXA 2QCSB 4PLNA 1RTVA 2XWJB 2Q4SA 3NO8A 1PK6B 4MGKE 4LO6B 4JGYB 1RUI3 3B69A 4LO8A 1RUE1 4O9EA 3ZPYA 2B45X 2A70A 3H3UA 1N1TA 4RGGA 3SH4A 2YGMA 2ZGPA 3MFAA 4YZ2A 2IC1A 1KXGA 4GB31 1D2QA 5JSPA 3AYCA 3RSJA 2VVEA 1XRUA 1EP0A 3RNSA 2RJKA 3FWEA 2DVFA 3FUQA 2XWBB 1RUG3 2FMYA 1ND3C 5KXCA 4V1PA 1Y9QA 1UKGA 3FZ3A 3MLKA 1BVP1 4IERA 3ZFFB 1BJQA 4BIFA 5JSRA 3BOPA 5DZGA 3M3CA 3JBG2 3O0VA 2RS12 4YVSB 2PHLA 1O4TA 1QHDA 4IV3A 4XPVA 1LHNA 5K0UB 1Q8QA 3SCGA 2WS93 4WVVA 1X36A 1G8WA 1ULDA 3RRDA 1DQ4A 4XJWA 4AGVA 2ZCWA 2TNFA 1AF9A 2GSYA 3T2TA 3AYDA 1LU2A 3TN92 5GZCA 4R9CA 3N35A 4RQPC 2ZX1A 1DDLA 2DV9A 2VW0A 2WQ4A 3ST7A 4CEYA 3GF6A 2F4PA 1V9U3 3PNAA 2V09A 3OTFA 1C5IA 4FXGB 1ND2B 1LECA 1NLRA 2OZJA 1OMIA 1AR81 4RGAA 5JZGC 2RHPA 1AR83 5JPMB 1NQDA 1QJU3 2X5IB 3VBOB 1CPMA 1FOD1 2RMU2 3FFQA 1MEC1 2D7FA 4IXLA 2NLRA 3CF6E 1OQ1A 2VNOA 2MEV2 1XNKA 1OPMA 1WCDJ 5LEKA 2BWCA 3O0XA 1MQTA 3VLBB 1FV3A 1VAVA 4PBOA 1BZWA 1HIXA 3BODA 1H8TC 4JQRA 1C28A 5FRAA 1ND2A 3QD6A 1R1ZA 4WV8A 2C5DA 2QQPA 2VMGA 3TOJA 2D6NA 4AI1A 4BA6A 4GMP1 1QH6A 1OLRA 3GBGA 1B35C 2PAEA 1HLCA 1OKQA 4HZFA 5F6LB 4LO7A 1PZ7A 2A71A 3MIBA 4Q0QA 4YG3A 4X6RB 5IK7A 1YI9A 4JGZA 4XDQA 1H2MA 4O9GA 1UIKA 1WBFA 3B3QE 3OY8B 3NL1A 2NPIA 2DCJA 1HV1A 4C0BA 4EN7B 1FT9A 3AKRA 1M4WA 4X8PA 5D8AA 3WZ1A 1RVF1 2ZTNA 4I0WB 2R32A 4AEDC 4JRLA 4F3JA 1N47A 2BEOA 3MFCA 1QOOA 4GWMA 2UWBA 2HWC3 1AL21 4CDXC 1KJLA 3HN1A 1HW5A 3GZAA 2LM3A 4YW5A 1HV0A 4D69A 4QM8A 4XTMA 4GQ7A 4HANA 2ZPXA 5T3NA 2E51A 1HRV1 2A5ZA 1PO13 4R9DA 1CAUA 3O14A 3AXDA 3SITA 3WT3A 1FAYA 2RS53 4DQAA 3SNMA 1NA1B 2KM2A 1FX5A 4J6GA 4B7EA 4COUA 1I1EA 2RE9A 3J9SA 3WD5A 1XYOA 1YHFA 2A3XA 1H0BA 5J37A 4CZSA 4HL0A 2UY8A 4CP0A 4EV0A 1RUF2 5BNPC 5GM0A 1UPSA 1Y3TA 2R062 2G9FA 2VXRA 2YXSA 3E6BA 4QPGA 3TAYA 5BNNB 3H7JA 1TNFA 2Q0AA 3E5QA 4M0NA 1SLLA 1N3OA 3O5SA 4X6QB 4ORFA 1W0OA 2OUJA 5E89A 1FNZA 2ZZQA 2HWC1 3ZSKA 1SFNA 1Z78A 3MIDA 3W58A 1YWKA 1EV13 3M1HA 2N7GA 5KXDA 1QDOA 1WLDA 3FLPA 4AHYA 4FQ4A 2D93A 3KB5A 3OF1A 2VVFA 2GN7A 4FQZA 4L2NA 1JHNA 2RS13 1GKBA 1OSGA 2YDEA 2HEWF 5BYNA 3M3OA 5BNNA 4I09A 1MS0A 2I74A 1PGSA 5J98B 2Q1ZB 4A2UA 1AL22 1HX6A 4AYUA 2Y26A 3ZMOA 5F5QA 4YZ1A 3DN7A 3WG1A 2ET7A 2GMPA 1AL0G 1IS6A 3DL3A 3G7DA 1OQEA 4BH9A 4H14A 1VBD1 4MH0E 2P17A 4XILA 3SLIA 1ZX5A 3OGJA 4B8EA 2ZGNA 2ZZJA 1RUD1 3VKFC 1DF0A 2BNNA 1VBC2 4YVWB 1UU6A 3CJXA 4DS0A 3O12A 1PVC2 2NN8A 3KGZA 5FLHA 1UIJA 1VP6A 4K20A 1VAMA 2D3RA 1WW7A 2GN3A 4KBBA 1UW8A 4OVEA 1CD3G 2VMHA 3HD8B 2ZMKA 4L9BA 4N53A 1O5UA 5HCBA 5ABJA 4QT6A 3FBMA 4A7YA 4BZ4A 4FPJA 1TME1 4AEDA 5DDJ3 1OHFA 2BFUL 3NSTA 4QPIC 4Y22B 4ZU5A 1PNGA 1PZ9A 1V9U1 1G9CA 5GLVA 3J4UH 3QH6A 4L8QA 4W6WA 5E8AA 4XBLA 3WY6A 3ZO0B 3HWJA 4HKWA 4N7UA 3RI9A 2R30A 4MGZE 1TQ5A 1WD4A 3VBHC 2ZOEB 3BIWE 1DGLA 3D0SA 5GZEA 4OI0A 3IMNA 2ZGQA 4JGYC 2Z2SB 3I59A 5H9RA 4QD2A 3SCFA 1RUNA 4LEJA 5FMOL 2XVGA 3RJ2X 2UURA 4CDWA 4OLLA 2I07B 4AHZA 5B2GB 3GYDA 4HMZA 4AEKA 1G9FA 3AZVA 4DINB 3M3IA 2JE7A 2Y0IA 3BCWA 1C3HA 1UL9A 1YRZA 3J26N 3D8CA 3I8TA 2WKKA 3NAPB 4UBHA 4PBPA 1ZZBA 2Z79A 1W2UA 4BPZA 1OQDA 4L11A 4F7ZA 5AC93 1RHI1 2MEV3 1LGNA 3RMXA 2XL7A 2D40A 2VQ0A 4YVSC 4XJAA 3WDVA 2DCYA 1SBDA 2WNVB 1AR63 5D8AB 3U07A 2FMDA 4X8NA 4HN0A 1QXRA 3ZYIB 4M3CE 1G86A 3MLJA 2NP0A 3ROUA 1NCQC 4N7IA 1KITA 1IGOA 2Y38A 3USUB 2VPVA 4C90A 5KBFA 3FMGA 4E2QA 3M4FA 5FOJB 2HWD3 4RQPA 1NCQA 3USUA 4AFCA 4ES8A 4C1XA 4QM9A 1MS1A 1CQ9A 1QU0A 2WT1A 2UYBA 4G9SB 4YFWA 1O3TA 1YIFA 3MEPA 1ZRFA 4QPGB 3OCPA 1JUIA 3I7DA 5EWSA 3NKTA 1V6IA 4DB5A 5A32B 1GQGA 1GR3A 5HCAA 1TMF2 2JKBA 3MLLA 1ASJ3 5GLWA 1DGRA 1NA1A 1LOAA 3ACLA 1HXS2 2VOWA 3TRSB 5BNOA 4FXKB 3OYWB 4XTPA 1I5ZA 1KFUL 1ZBE3 4MX3A 4YG6A 4XJ9A 1WA4A 1REFA 1ZRCA 3RQ0A 2JG8A 4D94A 5L7OC 1G9AA 1ULGA 4CP1A 4CTEA 3N4MA 2XJSA 1X8EA 4LUMA 1WCKA 2K0GA 4Y26A 1C57A 3N7KA 3VDDA 4AHWA 4QMAA 4M0HA 1LHWA 1XE7A 3WP4A 4ONUA 4WM7C 2IXKA 4AFMA 2XJPA 3KD4A 1UMZA 3ZDSA 4XF9A 4UW4A 2I2SA 4Y22A 2D98A 2X29A 1WUVA 1SBFA 5JIUA 4DMIA 1GICA 1UCXA 1AR73 3VL9A 3D6EA 4E4ZA 3D0JA 1LU1A 1ALYA 4IV3B 4JGZB 1PMIA 3VKMA 2R071 1W6NA 4K7JA 1LRHA 1GYKA 3TWIA 4E9KA 4YFZA 3VV1A 1FPN1 1XNCA 5C8CC 4IEPA 4MYEA 2Q1MA 5IUQA 4Q2FA 1IOAA 1QDCA 4N90A 5C4WA 4XW3A 3I4IA 3GHMA 4LHNA 3WQ7A 1LJ7A 2HWE2 3WXPA 3LA3A 4A7ZA 3LA7A 1D4VB 2JG9B 3ZFGB 1MQTB 2R0FA 4K8FA 5D1IA 3UK9A 3B01A 4G3YC 4FPFA 3PVBB 4YGEA 1H2KA 4FPEA 4YZ5A 3VBOA 4AFDA 5L73A 3JZVA 1GBGA 1OOPC 3V64A 3B9IA 1ZRDA 3ZSMA 3E6CC 3DUIA 1I6XA 4UXAA 1MS5A 4YZ4A 3M70A 3UV9A 4RFT0 1H9WA 3MZHA 2HWE1 5I0SA 4P5HA 4N43B 3VZLA 1Q8PA 2B46X 1B09A 1N1SA 2ZX0A 4UW3A 3ZIXA 2JXAA 5CADA 1FMD2 3VBSC 2ENRA 4HK8A 4AWDA 3MW3A 1VBD2 3H8UA 4Q4W1 4MGIE 4BWOA 4GB33 1BEV3 1I9RA 5K0UA 2WT2A 2D6LX 4LBQA 2ETEA 1N1VA 5I0TA 1COV2 4I3GA 2WNUA 4JC1A 1LTEA 1CN1A 2HWB3 4LUKA 1TNRA 1YNAA 1RINA 4MLOA 2PELA 2Q8OA 2DU1A 2ZX2A 1RUI2 2WFF2 1EPZA 1PO22 4ATEA 1PM7A 1FATA 1NE6A 1PNFA 3H3ZA 4S2HA 4CRQA 5IT6A 2JICA 1ZBE2 3VZMA 4BYYA 3Q9OA 1POV3 2DVAA 1ZZCA 2ZGUA 3OGGA 3UKVA 5DZFA 3G6JB 4IESA 4XBNA 4HVOA 1KDMA 2D3PA 4WVMB 1AXZA 1QQP2 1SLCA 1PGW1 5C4WB 3UJOA 2YMZA 2IXCA 3KCCA 1EYBA 1AR72 3CO2A 3AYAA 1W6NB 3AMQA 2HKXA 1UKRA 1V6JA 2PYTA 1BKZA 3E5UA 3FLTA 4KGQA 4CP2A 1JYCA 2ZX3A 2ZBJA 3JB8A 1RVF3 4ISRA 3SCHA 2V5YA 3JB4C 4IL7A 2P3JA 2RM22 4PDWB 5DG2A 2H6BA 2WS92 2FZ2A 2EAKA 4S2FA 3ZXLA 2XKPA 4HK9A 4CDUC 4AE2A 4RS5B 3AP7A 2AZ5A 2XKOA 3ZXAC 5IK8A 1C8M2 5JIAA 4EWAA 1APNA 1ZYBA 2ZJCA 3AMHA 2GNMA 1ASJ2 4LE4A 3LZZA 4JDMA 4KU8A 1RUE3 2GMEA 1RUC1 3OYWA 1NY72 3ZYJB 1EAH2 1UZYA 3ILRA 2YGLA 5EYYA 1JN2P 4OULA 3V0BB 4EN6B 2QDNA 2VU9A 2GC3A 4QHBA 3AP9A 1QJX2 5FO9B 3IT8A 5KHHA 1UF2C 1Q8SA 4Q29A 3KT4A 4RS5A 3WP3A 1SLIA 2BVBA 3KSCA 1DGRN 4XIKA 4AVCA 1KD7A 1JBCA 1K5MC 4YG0A 4KG8A 1Z7S1 1W6PB 1AYN2 4PDWA 1UD1A 4HETA 1NCRB 3WINE 2OW4A 3ZN4A 4UW6A 5H9QA 3PJYA 3FHIB 3MW2A 4CEYC 1H1MA 1RUD3 4R4XA 1XNDA 4IEQA 4COZA 2B5HA 4B4QA 2DWRA 2HWD2 3RYRA 2BPA2 3V0AB 3TN93 1DFQA 1J1TA 5JAXA 1L3JA 3LKJA 4PF5A 2OA2A 3AZZA 3WDWA 1MEC2 2Q5TA 2A6ZA 4FPHA 1FOD2 2IZWA 4WZCA 4XQWA 3AKSA 3H50A 4I0AA 1S0BA 1QOTA 3S6PA 1RGSA 1AR82 3GZTB 4HKOA 3LGRA 2ZS6B 4LR4A 2PTMA 4M3CB 3AKTA 1GANA 1VBE3 1HQWA 4P9LA 3T1MA 4QX5A 5J3UA 2WFF3 2CY6A 1AUYA 4P9YA 4GULA 2R061 4P9JA 5CVRA 2WNEA 4DRRA 3ME2A 3VKLA 5KHGA 4RR3C 4B29A 1MZ5A 1BYHA 2CWSA 4WM8B 1UU5A 4IV1C 4EROA 2BGCA 4RHV1 5KWRA 2Z5WA 5L7OB 2E7TA 4NHLA 2GC1A 4TSVA 3JD71 1ULEA 2R042 4LLOA 5FQ0A 1QNWA 2HEVF 3RYPA 3VBUB 4Y1ZA 3IDCB 2BW8A 3ZXGA 1JOJA 2B39A 3R4UA 2R063 3VBFC 5GLZA 1CJPA 4PJYA 3VBSA 3AM2A 4OHXA 1FMD3 1YYNA 1Q5OA 5CFCC 3MIHA 1H4GA 4RQPB 3N7LA 1WMDA 1BK1A 4MZUA 1BBT3 4UW5A 4HFSA 4QQHA 5JCTA 3NWKA 4Q26A 1RUF1 4N43A 1VIWB 4GB32 1NZCA 3ELNA 1S0GA 1CAWA 2VQAA 4Q0VA 2RS33 1KDKA 3N7JA 2YC0A 1Y7BA 3ZXEA 3LA2A 4L97A 4NHMA 4FP3A 2HWC2 3M7AA 1QGLA 5DG1A 3VBOC 1M06G 4Q0PA 5CAZA 2Q30A 1LENA 1H2NA 3ZXKA 4AHXA 4FBFA 2SBAA 3R6SA 3WW1A 3N3HA 4AI8A 5KC5A 3USSA 2PAKA 1F5FA 3LAGA 4Q4X1 5T50A 4ATFA 3MPBA 1ND3B 1LHUA 5SV8A 3PMSA 4GMP0 4Z8BA 4Z07A 2XJUA 1AYN3 2G9GA 1QH7A 1LOFC 4XF4A 1YFUA 2XLAA 4J1XA 1YXWA 2CGOA 1N3QA 1N1YA 4HSJA 4EJRA 2TEPA 1SMVA 5KC6A 1DZRA 3M3QA 4QXKA 3FUOA 5GLUA 3EXUA 2DCZA 3BU7A 4META 3RZZA 1ZM1A 2WFF1 3ES1A 3HT1A 2WJSA 5A33B 4FTSA 4I0BA 4N43C 5T5LA 4FOQA 1CX4A 4JV4A 3ZX7A 1IS3A 1LB2A 2AGSA 1A78A 1AXYA 1MVQA 3MIEA 2W68A 1S0EA 1XE8A 2BYVE 2D6PA 2H6CA 4XE9A 1W6MB 2EXKA 4XF1A 2E53A 1B35A 3ZXDA 1AZDA 2A75A 4HLTA 1IQAA 1RVF2 4LBMA 2AUYA 1H2LA 1AR91 2BNOA 1TE1B 4B4PA 3TN91 1SFYA 2WSVA 2XB6C 2CL2A 1ND2C 4OHZA 2G4IA 5ACA1 1VB2A 1PVXA 5JWPA 5K9YA 5AVPA 3B00A 5FO7B 4AF9A 2X5IC 4YGBA 5JLVA 1DIWA 3IDEA 2JG8B 4MXWB 5BNOC 4WM8A 1T6GC 1CGPA 2ZAAA 4PQ9A 2KA3A 3V0BA 1NA1C 1LGCA 4RR3A 2HJIA 4Z92B 2A6XA 4ITCA 2JECA 3VGIA 1AYN1 4Z1VA 3ATGA 2JG9A 3ZFGA 5CB7A 4CDQA 2QVSB 3POWA 2DTYA 4D7TA 1DBNA 2B42B 2A6WA 3EHKA 4I2OA 5JPNB 4MUVA 4B3NA 3M3EA 4B4RA 2XVKA 2RS52 4M00A 4AI0A 1GZ9A 2EIGA 2GC2A 3FE5A 3PMEA 1IS4A 3QOPA 5LK7B 1QF3A 3LCPA 5I8SA 1PGL2 1ZBA3 1S0IA 1RUG1 4AVSA 2VY0A 1O7FA 1YIPA 1VBA1 5T5JA 1RUC2 3INAA 3M2MA 2ZX4A 5BY5A 5AC92 1S2KA 2RS51 2PQQA 1DZQA 2VULA 3KM5A 4XFBA 2ZGLA 2RJLA 1BEV1 3P3PA 4PDWC 1LKNA 1D4M1 1BBT1 4LBKA 4AEDB 3QACA 4S2DA 2HWB1 3ZSEA 1VLNA 3IDBB 1NLSA 4RD7A 3ZFFC 1KQRA 1G7YA 1WGPA 3ZYRA 1U12A 2CAUA 2A3YA 3CJIA 4OI2A 1Q3EA 4AQ2A 5CG9A 2DVBA 4FPCA 1YI7A 2YY1A 3J8F3 1SLAA 5L7OA 3CNAA 2D6KA 3QLQA 1O3SA 1DYPA 4YVWC 3WVJA 5C6CA 2W52A 1AX1A 2D44A 4Q4V2 3GBFA 3JQXA 4PIXA 1HXS1 2R072 5BNPB 3VBHA 5HCFA 2P3KA 4GALA 2DFCA 1OFNA 1QXPA 1PGW2 4YW4A 3P3NA 5EXOA 1EY2A 1RL3A 2VOXA 4DRVA 1WMEA 2XL9A 4IEVA 5BV6A 3ECQA 1G6NA 2GNTA 3VHNA 4Q4Y2 1V00A 3E6DA 5T5PA 5EZWA 4XF0A 3B02A 4Y4YA 5CG8A 1S0CA 4N53C 4W6YA 5CIRA 2QNKA 5ABJB 4IETA 4XFCA 2VMIA 1O5LA 2PA7A 2EVXA 2LUWA 1RHI3 2HWB2 3ES4A 4XBQA 5DDJ2 3GZUC 2Z42A 4QQLA 1AYM2 4XJUA 1BBT2 1BVVA 3B7MA 2JDZA 1HRI2 4D7SA 2DVDA 2BWAA 3DF0A 3KT1A 1HKDA 2D97A 4WM8C 4FTBA 4LLFA 3NJZA 2ET1A 5FLIA 1SACA 1H30A 1MS3A 3RDIA 4FPKA 1Q43A 3ZMNA 2R0HA 2ZMNA 3WG4A 3IBMA 1KS5A 1PK6A 1HXS3 3CEWA 1WD3A 2WNUB 4Q4W3 2HEYF 1R093 4Y20A 1DHKB 2PHDA 3FC0A 2WNVC 4TLFA 1ZREA 1C5HA 2C0ZA 1XQNA 1V6KA 4DZGA 5IK4A 5BXXA 5T52A 3KCXA 4COYA 1VR3A 4P9WA 4FT8A 5A3MA 4A7KA 4LHLA 1W6MA 1Y43B 2UU8A 3AFKA 1R1A1 4YYOA 1S0FA 2A6YA 1NXD1 4QGMA 4E2GA 1RUC3 2R1DA 1VBA2 2VNGA 1A8DA 2QJVA 2PHFA 1IZ3A 1R091 4LO4B 2LTNA 2ZHMA 4AGRA 1V9U2 3V65A 4HPKA 1PIV3 5CNAA 1PGL1 1C1FA 4E4SA 2QZ2A 4RHV2 4LE3A 3MYXA 1LOGA 3NV3A 5FAXA 1MZFA 1AYM3 3RG0A 4FO9A 1W6QA 1JH5A 3SHRA 2CNAA 2UWAA 3FFZA 5JI9A 4DY3A 1REEA 4R4ZA 3VBUA 4C91A 4LBLA 3AMMA 1ZBA1 3RMYA 2ZGOA 3APBA 2X8KA 2A7AA 4FAGA 4B7KA 5F6KA 1SCSA 5FFOC 4IEOA 1VBC1 2HYKA 4QQOA 4RSUA 3O0WA 3VN4A 3ILNA 2XUMA 2W0XA 4NOTA 4PIZA 5LEJA 4AVAA 5E1RA 5C33A 2DCKA 4Q4V3 5L36A 1GNHA 1OA4A 3WDYA 2HWF1 1ZRRA 1NOVA 4R9BA 3DV8A 1DZTA 2OUHA 4FOWA 4CEWC 5CBLA 5I8YA 2XBO3 4XFAA 4MVTA 4PLOA 2AYHA 2XLFA 2QFEA 3WLUA 1W39A 4URTA 1NCQB 2R6QA 2IFRA 3K48A 3MF9A 3V56A 4D3WA 4Y5Z0 4JTOA 5FBZA 2E7QA 1AR92 4Q1RA 1EV12 1SLBA 1A3KA 1UU4A 5FPXA 1AXKA 4DY5A 4JGZC 5HXVA 1FNYA 3VBFA 1VB4A 4AGGA 4IQPA 1ENSA 1TMF1 5H9PA 2CGPA 4GH4B 3AMNA 2C9AA 2O8OA 5C8CB 2QZ3A 5EYXA 1V6LA 5FPZA 2WNVA 1QJX1 2RM23 4G4FA 3ZFEB 1BQPA 2MPFA 1GFF2 1RUH1 2WC2A 2DF7A 2EXHA 2RR11 1QNYA 1LHOA 1EAH1 4Y20B 3VDDB 3POSA 4K1YA 1J59A 3NV4A 2WL1A 3J8F1 2PLV1 3FX3A 3S7IA 3KZ4C 2WZR2 3NAPA 3PHMA 4LA2A 2ZKNA 3ALQA 4XOGA 1DQ0A 3AJZA 4WZFA 2ILMA 4XZPA 1YFWA 2OIIA 4Q4X2 3WW4A 4Q8KA 3HMYA 3U10A 1KJRA 1JW6A 2VGDA 1LOCA 2TUNA 1S0DA 2B7YA 1PO12 3ZN5A 1RUF3 4IEWA 3DPRA 1CJDA 3AZWA 1QOSA 1DLLA 2SLIA 4EN9B 1UPIA 1ZZ9A 4SLIA 3PTYA 4GXLA 2NZ9A 4YZ3A 1RUH2 1R081 4AVVA 1S1AA 2ZGTA 4PCRA 3AKPA 4ISQA 1GNZA 2CYFA 3VKOA 2Y0OA 4C0HA 1W0PA 4E2SA 1ZZ8A 3VBRC 4YLZA 1SBEA 1K5MA 1NG0A 3MF6A 2VH9A 2D5HA 2VECA 4M01A 4CDWC 1QQP1 5DZEA 3OBRA 3FBYA 4J1WA 1ZVFA 2R49A 2ERFA 5JOWA 5JOYA 4RHV3 3D4KA 4Q0SA 3CJIC 2E6VA 2ZHNA 2D5FA 1LODA 1PIV1 2WA3A 2HWF2 1RUOA 3FJSA 4XFFA 4YVWA 5LRRA 1BCXA 4OUMA 2VG9A 4OZXA 1HQLA 3UKTA 1CR7A 2IXLA 1YJKA 2BVVA 4BOWA 1EV11 4P9XA 1GZWA 1CAXB 3ILFA 4P9IA 4FPGA 1DGWX 3VKNA 5HBAA 1YUDA 2XBO2 2OPKA 1HRI3 3AFGA 3I59B 1NXMA 1QY4A 2XJRA 4XHBA 1PVC3 2WSUA 2ZHKA 1WW6A 1AR93 2RR13 1PVC1 2ZHLA 2B9UA 4Q4W2 2XGXA 3RWNA 3WP6A 4Q0UA 5FLJA 1QWRA 4Y1VA 5DUXA 1MVEA 2R041 4TZDA 1WW4A 2RS31 2WLPA 1Q56A 1AVBA 2BTVC 1YJLA 3VZOA 4KWKA 1ZZ6A 3NVCA 2GZWA 1GZWB 1ENQA 4DNYA 2ZABA 3WX5A 3I54A 1V6OA 3IIAA 4AFAA 4OUSA 4LO5B 5ABJC 3S30A 2H0BA 2W08A 3ZIWA 1O4ZA 5FCCA 3ZN6B 1XU1A 4XXAA 3AZYA 4OFGA 3K51A 4BMEA 1MS9A 2ZGMA 1S2BA 1Z7S2 1F9KA 3EBRA 4OHVA 5EFUA 1I3HA 2RM21 3WOGA 3WDUA 5KHJA 3U0ZA 1F31A 1JTZX 4XFGA 5JI7A 3E5XA 2MEV1 4LA3A 2AENA 5FOBB 2GAUA 3JBG1 4NN0A 2EALA 2RMU1 5C9AA 2LALA 2NQYA 5K0UC 5JVVA 5HI0A 2HWD1 3ZVXA 1OPOA 4AG4A 3MPPG 4W6XA 1Q8OA 4M3CF 3KMHA 1DG6A 4P9GA 4HSLA 3WW2A 3IM0A 1FI2A 4WVWA 2VUJA 4JTNA 2TBVA 5BNPA 1DU3D 4OHYA 2ZACA 1AHSA 1D0GA 4XFIA 2FQPA 1U5XA 1NCRC 2IXHA 2IXIA 4GKYA 3X29B 3U4XA 5ACA3 3RYKA 2PN5A 1LOBA 1YO8A 3MIFA 1LR5A 1A6CA 2GNBA 2WLQA 3WHUA 1UAIA 1R092 3THTA 5K7PA 5C9AB 5JOXA 3H1WA 4GH4A 4EWDA 4BLJA 2ATFA 3W9AA 2BFUS 3L9JT 3HT2A 3IKWA 4QGNA 3B5LB 5DUUA 1PO21 1ASJ1 4N9HA 1HRI1 2JE9A 2VNRA 3TNPB 2YYOA 1IKPA 1W6OA 2D3SA 3CU7A 3D5OA 4E4DX 5AFBA 1VBE2 2XPJA 3N36A 5CU1A 1GQHA 4Z82A 4EN8B 3R0RA 1RMU3 3C3VA 3TNQA 4N9IA 3UL2A 3E97A 4HVRA 3JBG3 1C8NA 3AX4A 3A0KA 2AR6A 1C1LA 3NW4A 4GWNA 2NMOA 4FTEA 3MW4A 4HN1A 2UWCA 4QPYA 1VBB1 3SH3A 1MACA 1VJ2A 3HR9A 1RC6A 2XJVA 1IHMA 3VL8A 3AYEA 1V6MA 3KQRA 1ZNPA 1WMFA 3BPZA 2YPJA 3JQWA 4Q4X3 4XYXA 4YGDA 2O8QA 4FOYA 3PVNA 1FYUA 2DYCA 1MZEA 4HVQA 2GC0A 2E9QA 1AJOA 2H0VA 4AW7A 5A32A 3LOBA 4CEWB 4GMP3 3JD73 1VALA 1YCIA 4K21A 2D43A 1VBE1 2WWSA 3OBTA 5DDJ1 2UYAA 4CDXB 1FPN3 1VBB3 3URFA 3NKGA 4R9AA 5FREA 2X53S 4KGGA 2YUEA 1RMU1 1O3RA 2WZPP 3MICA 3ZSLA 3CLPA 2YZ4A 4MV2A 4I01A 1IPKA 2PHRA 2P3IA 1IPJA 1RUG2 5I93A 4Q27A 1JUHA 4LNVA 4ZKTB 1LESA 4AQSA 1QJZA 5J48A 2DUPA 3AB0A 1U0AA 2D6OX 4FPYA 1H8TB 1OFSA 3NV1A 3WV6A 1NCRA 1H1AA 4XIOA 3VDDC 1YLLA 2OZ6A 2HWF3 1ZBA2 4Y24A 1D4M2 1DQ5A 1X7NA 4XQ4A 3OD0A 2JD4A